(data stored in ACNUC7421 zone)

EMBL: CP000611

ID   CP000611; SV 1; circular; genomic DNA; STD; PRO; 4419977 BP.
XX
AC   CP000611;
XX
PR   Project:PRJNA18883;
XX
DT   01-JUN-2007 (Rel. 92, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Mycobacterium tuberculosis H37Ra, complete genome.
XX
KW   .
XX
OS   Mycobacterium tuberculosis H37Ra
OC   Bacteria; Actinobacteria; Corynebacteriales; Mycobacteriaceae;
OC   Mycobacterium; Mycobacterium tuberculosis complex.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-4419977
RX   PUBMED; 18584054.
RA   Zheng H., Lu L., Wang B., Pu S., Zhang X., Zhu G., Shi W., Zhang L.,
RA   Wang H., Wang S., Zhao G., Zhang Y.;
RT   "Genetic basis of virulence attenuation revealed by comparative genomic
RT   analysis of Mycobacterium tuberculosis strain H37Ra versus H37Rv";
RL   PLoS One 3(6):E2375-E2375(2008).
XX
RN   [2]
RP   1-4419977
RA   Lu L.D., Wang H.H.;
RT   ;
RL   Submitted (12-MAR-2007) to the INSDC.
RL   Fudan University, Shanghai 200433, P.R. China
XX
RN   [3]
RP   1-4419977
RA   Wang S.Y., Zheng H.J., Wang B.F., Zhang X.L., Pu S.Y., Zhu G.F., Zhao G.P.;
RT   ;
RL   Submitted (12-MAR-2007) to the INSDC.
RL   Genomic Sequencing Department, Chinese National Human Genome Center at
RL   Shanghai, 250 Bibo Road, Zhangjiang High Technology Park, Pudong District,
RL   Shanghai 201203, P.R. China
XX
RN   [4]
RP   1-4419977
RA   Zhang Y.;
RT   ;
RL   Submitted (12-MAR-2007) to the INSDC.
RL   Department of Molecular Microbiology & Immunology, Bloomberg School of
RL   Public Health, Johns Hopkins University, Baltimore, MD 21205, USA
XX
DR   MD5; 45ceebd25394c34b908f3165c1e4f4df.
DR   BioSample; SAMN02603128.
DR   EnsemblGenomes-Gn; EBG00001434188.
DR   EnsemblGenomes-Gn; EBG00001434189.
DR   EnsemblGenomes-Gn; EBG00001434190.
DR   EnsemblGenomes-Gn; EBG00001434191.
DR   EnsemblGenomes-Gn; EBG00001434192.
DR   EnsemblGenomes-Gn; EBG00001434193.
DR   EnsemblGenomes-Gn; EBG00001434194.
DR   EnsemblGenomes-Gn; EBG00001434195.
DR   EnsemblGenomes-Gn; EBG00001434196.
DR   EnsemblGenomes-Gn; EBG00001434197.
DR   EnsemblGenomes-Gn; EBG00001434198.
DR   EnsemblGenomes-Gn; EBG00001434199.
DR   EnsemblGenomes-Gn; EBG00001434200.
DR   EnsemblGenomes-Gn; EBG00001434201.
DR   EnsemblGenomes-Gn; EBG00001434202.
DR   EnsemblGenomes-Gn; EBG00001434203.
DR   EnsemblGenomes-Gn; EBG00001434204.
DR   EnsemblGenomes-Gn; EBG00001434205.
DR   EnsemblGenomes-Gn; EBG00001434206.
DR   EnsemblGenomes-Gn; EBG00001434207.
DR   EnsemblGenomes-Gn; EBG00001434208.
DR   EnsemblGenomes-Gn; EBG00001434209.
DR   EnsemblGenomes-Gn; EBG00001434210.
DR   EnsemblGenomes-Gn; EBG00001434211.
DR   EnsemblGenomes-Gn; EBG00001434212.
DR   EnsemblGenomes-Gn; EBG00001434213.
DR   EnsemblGenomes-Gn; EBG00001434214.
DR   EnsemblGenomes-Gn; EBG00001434215.
DR   EnsemblGenomes-Gn; EBG00001434216.
DR   EnsemblGenomes-Gn; EBG00001434217.
DR   EnsemblGenomes-Gn; EBG00001434218.
DR   EnsemblGenomes-Gn; EBG00001434219.
DR   EnsemblGenomes-Gn; EBG00001434220.
DR   EnsemblGenomes-Gn; EBG00001434221.
DR   EnsemblGenomes-Gn; EBG00001434222.
DR   EnsemblGenomes-Gn; EBG00001434223.
DR   EnsemblGenomes-Gn; EBG00001434224.
DR   EnsemblGenomes-Gn; EBG00001434225.
DR   EnsemblGenomes-Gn; EBG00001434226.
DR   EnsemblGenomes-Gn; EBG00001434227.
DR   EnsemblGenomes-Gn; EBG00001434228.
DR   EnsemblGenomes-Gn; EBG00001434229.
DR   EnsemblGenomes-Gn; EBG00001434230.
DR   EnsemblGenomes-Gn; EBG00001434231.
DR   EnsemblGenomes-Gn; EBG00001434232.
DR   EnsemblGenomes-Gn; EBG00001434233.
DR   EnsemblGenomes-Gn; EBG00001434234.
DR   EnsemblGenomes-Gn; EBG00001434235.
DR   EnsemblGenomes-Gn; EBG00001434236.
DR   EnsemblGenomes-Gn; EBG00001434237.
DR   EnsemblGenomes-Gn; EBG00001434238.
DR   EnsemblGenomes-Gn; EBG00001434239.
DR   EnsemblGenomes-Gn; EBG00001434240.
DR   EnsemblGenomes-Gn; EBG00001434241.
DR   EnsemblGenomes-Gn; EBG00001434242.
DR   EnsemblGenomes-Gn; EBG00001434243.
DR   EnsemblGenomes-Gn; EBG00001434244.
DR   EnsemblGenomes-Gn; EBG00001434245.
DR   EnsemblGenomes-Gn; EBG00001434246.
DR   EnsemblGenomes-Gn; EBG00001434247.
DR   EnsemblGenomes-Gn; EBG00001434248.
DR   EnsemblGenomes-Gn; EBG00001434249.
DR   EnsemblGenomes-Gn; EBG00001434250.
DR   EnsemblGenomes-Gn; EBG00001434251.
DR   EnsemblGenomes-Gn; EBG00001434252.
DR   EnsemblGenomes-Gn; EBG00001434253.
DR   EnsemblGenomes-Gn; EBG00001434254.
DR   EnsemblGenomes-Gn; EBG00001434255.
DR   EnsemblGenomes-Gn; MRA_r01.
DR   EnsemblGenomes-Gn; MRA_r02.
DR   EnsemblGenomes-Gn; MRA_r03.
DR   EnsemblGenomes-Gn; MRA_t01.
DR   EnsemblGenomes-Gn; MRA_t02.
DR   EnsemblGenomes-Gn; MRA_t03.
DR   EnsemblGenomes-Gn; MRA_t04.
DR   EnsemblGenomes-Gn; MRA_t05.
DR   EnsemblGenomes-Gn; MRA_t06.
DR   EnsemblGenomes-Gn; MRA_t07.
DR   EnsemblGenomes-Gn; MRA_t08.
DR   EnsemblGenomes-Gn; MRA_t09.
DR   EnsemblGenomes-Gn; MRA_t10.
DR   EnsemblGenomes-Gn; MRA_t11.
DR   EnsemblGenomes-Gn; MRA_t12.
DR   EnsemblGenomes-Gn; MRA_t13.
DR   EnsemblGenomes-Gn; MRA_t14.
DR   EnsemblGenomes-Gn; MRA_t15.
DR   EnsemblGenomes-Gn; MRA_t16.
DR   EnsemblGenomes-Gn; MRA_t17.
DR   EnsemblGenomes-Gn; MRA_t18.
DR   EnsemblGenomes-Gn; MRA_t19.
DR   EnsemblGenomes-Gn; MRA_t20.
DR   EnsemblGenomes-Gn; MRA_t21.
DR   EnsemblGenomes-Gn; MRA_t22.
DR   EnsemblGenomes-Gn; MRA_t23.
DR   EnsemblGenomes-Gn; MRA_t24.
DR   EnsemblGenomes-Gn; MRA_t25.
DR   EnsemblGenomes-Gn; MRA_t26.
DR   EnsemblGenomes-Gn; MRA_t27.
DR   EnsemblGenomes-Gn; MRA_t28.
DR   EnsemblGenomes-Gn; MRA_t29.
DR   EnsemblGenomes-Gn; MRA_t30.
DR   EnsemblGenomes-Gn; MRA_t31.
DR   EnsemblGenomes-Gn; MRA_t32.
DR   EnsemblGenomes-Gn; MRA_t33.
DR   EnsemblGenomes-Gn; MRA_t34.
DR   EnsemblGenomes-Gn; MRA_t35.
DR   EnsemblGenomes-Gn; MRA_t36.
DR   EnsemblGenomes-Gn; MRA_t37.
DR   EnsemblGenomes-Gn; MRA_t38.
DR   EnsemblGenomes-Gn; MRA_t39.
DR   EnsemblGenomes-Gn; MRA_t40.
DR   EnsemblGenomes-Gn; MRA_t41.
DR   EnsemblGenomes-Gn; MRA_t42.
DR   EnsemblGenomes-Gn; MRA_t43.
DR   EnsemblGenomes-Gn; MRA_t44.
DR   EnsemblGenomes-Gn; MRA_t45.
DR   EnsemblGenomes-Tr; EBT00001812112.
DR   EnsemblGenomes-Tr; EBT00001812113.
DR   EnsemblGenomes-Tr; EBT00001812114.
DR   EnsemblGenomes-Tr; EBT00001812115.
DR   EnsemblGenomes-Tr; EBT00001812116.
DR   EnsemblGenomes-Tr; EBT00001812117.
DR   EnsemblGenomes-Tr; EBT00001812118.
DR   EnsemblGenomes-Tr; EBT00001812119.
DR   EnsemblGenomes-Tr; EBT00001812120.
DR   EnsemblGenomes-Tr; EBT00001812121.
DR   EnsemblGenomes-Tr; EBT00001812122.
DR   EnsemblGenomes-Tr; EBT00001812123.
DR   EnsemblGenomes-Tr; EBT00001812124.
DR   EnsemblGenomes-Tr; EBT00001812125.
DR   EnsemblGenomes-Tr; EBT00001812126.
DR   EnsemblGenomes-Tr; EBT00001812127.
DR   EnsemblGenomes-Tr; EBT00001812128.
DR   EnsemblGenomes-Tr; EBT00001812129.
DR   EnsemblGenomes-Tr; EBT00001812130.
DR   EnsemblGenomes-Tr; EBT00001812131.
DR   EnsemblGenomes-Tr; EBT00001812132.
DR   EnsemblGenomes-Tr; EBT00001812133.
DR   EnsemblGenomes-Tr; EBT00001812134.
DR   EnsemblGenomes-Tr; EBT00001812135.
DR   EnsemblGenomes-Tr; EBT00001812136.
DR   EnsemblGenomes-Tr; EBT00001812137.
DR   EnsemblGenomes-Tr; EBT00001812138.
DR   EnsemblGenomes-Tr; EBT00001812139.
DR   EnsemblGenomes-Tr; EBT00001812140.
DR   EnsemblGenomes-Tr; EBT00001812141.
DR   EnsemblGenomes-Tr; EBT00001812142.
DR   EnsemblGenomes-Tr; EBT00001812143.
DR   EnsemblGenomes-Tr; EBT00001812144.
DR   EnsemblGenomes-Tr; EBT00001812145.
DR   EnsemblGenomes-Tr; EBT00001812146.
DR   EnsemblGenomes-Tr; EBT00001812147.
DR   EnsemblGenomes-Tr; EBT00001812148.
DR   EnsemblGenomes-Tr; EBT00001812149.
DR   EnsemblGenomes-Tr; EBT00001812150.
DR   EnsemblGenomes-Tr; EBT00001812151.
DR   EnsemblGenomes-Tr; EBT00001812152.
DR   EnsemblGenomes-Tr; EBT00001812153.
DR   EnsemblGenomes-Tr; EBT00001812154.
DR   EnsemblGenomes-Tr; EBT00001812155.
DR   EnsemblGenomes-Tr; EBT00001812156.
DR   EnsemblGenomes-Tr; EBT00001812157.
DR   EnsemblGenomes-Tr; EBT00001812158.
DR   EnsemblGenomes-Tr; EBT00001812159.
DR   EnsemblGenomes-Tr; EBT00001812160.
DR   EnsemblGenomes-Tr; EBT00001812161.
DR   EnsemblGenomes-Tr; EBT00001812162.
DR   EnsemblGenomes-Tr; EBT00001812163.
DR   EnsemblGenomes-Tr; EBT00001812164.
DR   EnsemblGenomes-Tr; EBT00001812165.
DR   EnsemblGenomes-Tr; EBT00001812166.
DR   EnsemblGenomes-Tr; EBT00001812167.
DR   EnsemblGenomes-Tr; EBT00001812168.
DR   EnsemblGenomes-Tr; EBT00001812169.
DR   EnsemblGenomes-Tr; EBT00001812170.
DR   EnsemblGenomes-Tr; EBT00001812171.
DR   EnsemblGenomes-Tr; EBT00001812172.
DR   EnsemblGenomes-Tr; EBT00001812173.
DR   EnsemblGenomes-Tr; EBT00001812174.
DR   EnsemblGenomes-Tr; EBT00001812175.
DR   EnsemblGenomes-Tr; EBT00001812176.
DR   EnsemblGenomes-Tr; EBT00001812177.
DR   EnsemblGenomes-Tr; EBT00001812178.
DR   EnsemblGenomes-Tr; EBT00001812179.
DR   EnsemblGenomes-Tr; MRA_r01-1.
DR   EnsemblGenomes-Tr; MRA_r02-1.
DR   EnsemblGenomes-Tr; MRA_r03-1.
DR   EnsemblGenomes-Tr; MRA_t01-1.
DR   EnsemblGenomes-Tr; MRA_t02-1.
DR   EnsemblGenomes-Tr; MRA_t03-1.
DR   EnsemblGenomes-Tr; MRA_t04-1.
DR   EnsemblGenomes-Tr; MRA_t05-1.
DR   EnsemblGenomes-Tr; MRA_t06-1.
DR   EnsemblGenomes-Tr; MRA_t07-1.
DR   EnsemblGenomes-Tr; MRA_t08-1.
DR   EnsemblGenomes-Tr; MRA_t09-1.
DR   EnsemblGenomes-Tr; MRA_t10-1.
DR   EnsemblGenomes-Tr; MRA_t11-1.
DR   EnsemblGenomes-Tr; MRA_t12-1.
DR   EnsemblGenomes-Tr; MRA_t13-1.
DR   EnsemblGenomes-Tr; MRA_t14-1.
DR   EnsemblGenomes-Tr; MRA_t15-1.
DR   EnsemblGenomes-Tr; MRA_t16-1.
DR   EnsemblGenomes-Tr; MRA_t17-1.
DR   EnsemblGenomes-Tr; MRA_t18-1.
DR   EnsemblGenomes-Tr; MRA_t19-1.
DR   EnsemblGenomes-Tr; MRA_t20-1.
DR   EnsemblGenomes-Tr; MRA_t21-1.
DR   EnsemblGenomes-Tr; MRA_t22-1.
DR   EnsemblGenomes-Tr; MRA_t23-1.
DR   EnsemblGenomes-Tr; MRA_t24-1.
DR   EnsemblGenomes-Tr; MRA_t25-1.
DR   EnsemblGenomes-Tr; MRA_t26-1.
DR   EnsemblGenomes-Tr; MRA_t27-1.
DR   EnsemblGenomes-Tr; MRA_t28-1.
DR   EnsemblGenomes-Tr; MRA_t29-1.
DR   EnsemblGenomes-Tr; MRA_t30-1.
DR   EnsemblGenomes-Tr; MRA_t31-1.
DR   EnsemblGenomes-Tr; MRA_t32-1.
DR   EnsemblGenomes-Tr; MRA_t33-1.
DR   EnsemblGenomes-Tr; MRA_t34-1.
DR   EnsemblGenomes-Tr; MRA_t35-1.
DR   EnsemblGenomes-Tr; MRA_t36-1.
DR   EnsemblGenomes-Tr; MRA_t37-1.
DR   EnsemblGenomes-Tr; MRA_t38-1.
DR   EnsemblGenomes-Tr; MRA_t39-1.
DR   EnsemblGenomes-Tr; MRA_t40-1.
DR   EnsemblGenomes-Tr; MRA_t41-1.
DR   EnsemblGenomes-Tr; MRA_t42-1.
DR   EnsemblGenomes-Tr; MRA_t43-1.
DR   EnsemblGenomes-Tr; MRA_t44-1.
DR   EnsemblGenomes-Tr; MRA_t45-1.
DR   EuropePMC; PMC2440308; 18584054.
DR   EuropePMC; PMC2693488; 19217827.
DR   EuropePMC; PMC2756628; 19823582.
DR   EuropePMC; PMC3061429; 21439222.
DR   EuropePMC; PMC3069002; 21483493.
DR   EuropePMC; PMC3089889; 21584191.
DR   EuropePMC; PMC3424577; 22618876.
DR   EuropePMC; PMC4219376; 24299240.
DR   EuropePMC; PMC4425900; 25879806.
DR   EuropePMC; PMC4602229.
DR   EuropePMC; PMC5293778; 28223967.
DR   EuropePMC; PMC5393005; 28415976.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01066; 6C.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01779; AS1726.
DR   RFAM; RF01780; AS1890.
DR   RFAM; RF01781; ASdes.
DR   RFAM; RF01782; ASpks.
DR   RFAM; RF01783; b55.
DR   RFAM; RF01791; F6.
DR   RFAM; RF01798; g2.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02003; group-II-D1D4-4.
DR   SILVA-LSU; CP000611.
DR   SILVA-SSU; CP000611.
DR   StrainInfo; 103703; 0.
XX
CC   Source DNA and bacteria is available from Ying Zhang
CC   (yzhang@jhsph.edu).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4419977
FT                   /organism="Mycobacterium tuberculosis H37Ra"
FT                   /strain="H37Ra; ATCC 25177"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:419947"
FT   gene            1..1524
FT                   /gene="dnaA"
FT                   /locus_tag="MRA_0001"
FT   CDS_pept        1..1524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="MRA_0001"
FT                   /product="chromosomal replication initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71719"
FT                   /db_xref="GOA:A5TY69"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PDB:3PVP"
FT                   /db_xref="PDB:3PVV"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TY69"
FT                   /protein_id="ABQ71719.1"
FT                   /translation="MTDDPGSGFTTVWNAVVSELNGDPKVDDGPSSDANLSAPLTPQQR
FT                   AWLNLVQPLTIVEGFALLSVPSSFVQNEIERHLRAPITDALSRRLGHQIQLGVRIAPPA
FT                   TDEADDTTVPPSENPATTSPDTTTDNDEIDDSAAARGDNQHSWPSYFTERPHNTDSATA
FT                   GVTSLNRRYTFDTFVIGASNRFAHAAALAIAEAPARAYNPLFIWGESGLGKTHLLHAAG
FT                   NYAQRLFPGMRVKYVSTEEFTNDFINSLRDDRKVAFKRSYRDVDVLLVDDIQFIEGKEG
FT                   IQEEFFHTFNTLHNANKQIVISSDRPPKQLATLEDRLRTRFEWGLITDVQPPELETRIA
FT                   ILRKKAQMERLAVPDDVLELIASSIERNIRELEGALIRVTAFASLNKTPIDKALAEIVL
FT                   RDLIADANTMQISAATIMAATAEYFDTTVEELRGPGKTRALAQSRQIAMYLCRELTDLS
FT                   LPKIGQAFGRDHTTVMYAQRKILSEMAERREVFDHVKELTTRIRQRSKR"
FT   gene            2052..3260
FT                   /gene="dnaN"
FT                   /locus_tag="MRA_0002"
FT   CDS_pept        2052..3260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="MRA_0002"
FT                   /product="DNA polymerase III subunit beta DnaN"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71720"
FT                   /db_xref="GOA:A5TY70"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A5TY70"
FT                   /protein_id="ABQ71720.1"
FT                   /translation="MDAATTRVGLTDLTFRLLRESFADAVSWVAKNLPARPAVPVLSGV
FT                   LLTGSDNGLTISGFDYEVSAEAQVGAEIVSPGSVLVSGRLLSDITRALPNKPVDVHVEG
FT                   NRVALTCGNARFSLPTMPVEDYPTLPTLPEETGLLPAELFAEAISQVAIAAGRDDTLPM
FT                   LTGIRVEILGETVVLAATDRFRLAVRELKWSASSPDIEAAVLVPAKTLAEAAKAGIGGS
FT                   DVRLSLGTGPGVGKDGLLGISGNGKRSTTRLLDAEFPKFRQLLPTEHTAVATMDVAELI
FT                   EAIKLVALVADRGAQVRMEFADGSVRLSAGADDVGRAEEDLVVDYAGEPLTIAFNPTYL
FT                   TDGLSSLRSERVSFGFTTAGKPALLRPVSGDDRPVAGLNGNGPFPAVSTDYVYLLMPVR
FT                   LPG"
FT   gene            3280..4437
FT                   /gene="recF"
FT                   /locus_tag="MRA_0003"
FT   CDS_pept        3280..4437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="MRA_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71721"
FT                   /db_xref="GOA:A5TY71"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TY71"
FT                   /protein_id="ABQ71721.1"
FT                   /translation="MYVRHLGLRDFRSWACVDLELHPGRTVFVGPNGYGKTNLIEALWY
FT                   STTLGSHRVSADLPLIRVGTDRAVISTIVVNDGRECAVDLEIATGRVNKARLNRSSVRS
FT                   TRDVVGVLRAVLFAPEDLGLVRGDPADRRRYLDDLAIVRRPAIAAVRAEYERVLRQRTA
FT                   LLKSVPGARYRGDRGVFDTLEVWDSRLAEHGAELVAARIDLVNQLAPEVKKAYQLLAPE
FT                   SRSASIGYRASMDVTGPSEQSDIDRQLLAARLLAALAARRDAELERGVCLVGPHRDDLI
FT                   LRLGDQPAKGFASHGEAWSLAVALRLAAYQLLRVDGGEPVLLLDDVFAELDVMRRRALA
FT                   TAAESAEQVLVTAAVLEDIPAGWDARRVHIDVRADDTGSMSVVLP"
FT   gene            4434..4997
FT                   /locus_tag="MRA_0004"
FT   CDS_pept        4434..4997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0004"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71722"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="InterPro:IPR023007"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TY72"
FT                   /protein_id="ABQ71722.1"
FT                   /translation="MTGSVDRPDQNRGERSMKSPGLDLVRRTLDEARAAARARGQDAGR
FT                   GRVASVASGRVAGRRRSWSGPGPDIRDPQPLGKAARELAKKRGWSVRVAEGMVLGQWSA
FT                   VVGHQIAEHARPTALNDGVLSVIAESTAWATQLRIMQAQLLAKIAAAVGNDVVRSLKIT
FT                   GPAAPSWRKGPRHIAGRGPRDTYG"
FT   gene            5123..7267
FT                   /gene="gyrB"
FT                   /locus_tag="MRA_0005"
FT   CDS_pept        5123..7267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="MRA_0005"
FT                   /product="DNA gyrase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71723"
FT                   /db_xref="GOA:A5TY73"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TY73"
FT                   /protein_id="ABQ71723.1"
FT                   /translation="MGKNEARRSALAPDHGTVVCDPLRRLNRMHATPEESIRIVAAQKK
FT                   KAQDEYGAASITILEGLEAVRKRPGMYIGSTGERGLHHLIWEVVDNAVDEAMAGYATTV
FT                   NVVLLEDGGVEVADDGRGIPVATHASGIPTVDVVMTQLHAGGKFDSDAYAISGGLHGVG
FT                   VSVVNALSTRLEVEIKRDGYEWSQVYEKSEPLGLKQGAPTKKTGSTVRFWADPAVFETT
FT                   EYDFETVARRLQEMAFLNKGLTINLTDERVTQDEVVDEVVSDVAEAPKSASERAAESTA
FT                   PHKVKSRTFHYPGGLVDFVKHINRTKNAIHSSIVDFSGKGTGHEVEIAMQWNAGYSESV
FT                   HTFANTINTHEGGTHEEGFRSALTSVVNKYAKDRKLLKDKDPNLTGDDIREGLAAVISV
FT                   KVSEPQFEGQTKTKLGNTEVKSFVQKVCNEQLTHWFEANPTDAKVVVNKAVSSAQARIA
FT                   ARKARELVRRKSATDIGGLPGKLADCRSTDPRKSELYVVEGDSAGGSAKSGRDSMFQAI
FT                   LPLRGKIINVEKARIDRVLKNTEVQAIITALGTGIHDEFDIGKLRYHKIVLMADADVDG
FT                   QHISTLLLTLLFRFMRPLIENGHVFLAQPPLYKLKWQRSDPEFAYSDRERDGLLEAGLK
FT                   AGKKINKEDGIQRYKGLGEMDAKELWETTMDPSVRVLRQVTLDDAAAADELFSILMGED
FT                   VDARRSFITRNAKDVRFLDV"
FT   gene            7302..9818
FT                   /gene="gyrA"
FT                   /locus_tag="MRA_0006"
FT   CDS_pept        7302..9818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="MRA_0006"
FT                   /product="DNA gyrase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71724"
FT                   /db_xref="GOA:A5TY74"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A5TY74"
FT                   /protein_id="ABQ71724.1"
FT                   /translation="MTDTTLPPDDSLDRIEPVDIEQEMQRSYIDYAMSVIVGRALPEVR
FT                   DGLKPVHRRVLYAMFDSGFRPDRSHAKSARSVAETMGNYHPHGDASIYDSLVRMAQPWS
FT                   LRYPLVDGQGNFGSPGNDPPAAMRYTEARLTPLAMEMLREIDEETVDFIPNYDGRVQEP
FT                   TVLPSRFPNLLANGSGGIAVGMATNIPPHNLRELADAVFWALENHDADEEETLAAVMGR
FT                   VKGPDFPTAGLIVGSQGTADAYKTGRGSIRMRGVVEVEEDSRGRTSLVITELPYQVNHD
FT                   NFITSIAEQVRDGKLAGISNIEDQSSDRVGLRIVIEIKRDAVAKVVINNLYKHTQLQTS
FT                   FGANMLAIVDGVPRTLRLDQLIRYYVDHQLDVIVRRTTYRLRKANERAHILRGLVKALD
FT                   ALDEVIALIRASETVDIARAGLIELLDIDEIQAQAILDMQLRRLAALERQRIIDDLAKI
FT                   EAEIADLEDILAKPERQRGIVRDELAEIVDRHGDDRRTRIIAADGDVSDEDLIAREDVV
FT                   VTITETGYAKRTKTDLYRSQKRGGKGVQGAGLKQDDIVAHFFVCSTHDLILFFTTQGRV
FT                   YRAKAYDLPEASRTARGQHVANLLAFQPEERIAQVIQIRGYTDAPYLVLATRNGLVKKS
FT                   KLTDFDSNRSGGIVAVNLRDNDELVGAVLCSAGDDLLLVSANGQSIRFSATDEALRPMG
FT                   RATSGVQGMRFNIDDRLLSLNVVREGTYLLVATSGGYAKRTAIEEYPVQGRGGKGVLTV
FT                   MYDRRRGRLVGALIVDDDSELYAVTSGGGVIRTAARQVRKAGRQTKGVRLMNLGEGDTL
FT                   LAIARNAEESGDDNAVDANGADQTGN"
FT   gene            9914..10828
FT                   /locus_tag="MRA_0007"
FT   CDS_pept        9914..10828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0007"
FT                   /product="putative conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71725"
FT                   /db_xref="GOA:A5TY75"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:A5TY75"
FT                   /protein_id="ABQ71725.1"
FT                   /translation="MTAPNEPGALSKGDGPNADGLVDRGGAHRAATGPGRIPDAGDPPP
FT                   WQRAATRQSQAGHRQPPPVSHPEGRPTNPPAAADARLNRFISGASAPVTGPAAAVRTPQ
FT                   PDPDASLGCGDGSPAEAYASELPDLSGPTPRAPQRNPAPARPAEGGAGSRGDSAAGSSG
FT                   GRSITAESRDARVQLSARRSRGPVRASMQIRRIDPWSTLKVSLLLSVALFFVWMITVAF
FT                   LYLVLGGMGVWAKLNSNVGDLLNNASGSSAELVSSGTIFGGAFLIGLVNIVLMTALATI
FT                   GAFVYNLITDLIGGIEVTLADRD"
FT   gene            10887..10960
FT                   /locus_tag="MRA_t01"
FT   tRNA            10887..10960
FT                   /locus_tag="MRA_t01"
FT                   /product="tRNA-Ile"
FT   gene            11112..11184
FT                   /locus_tag="MRA_t02"
FT   tRNA            11112..11184
FT                   /locus_tag="MRA_t02"
FT                   /product="tRNA-Ala"
FT   gene            complement(11874..12311)
FT                   /locus_tag="MRA_0008"
FT   CDS_pept        complement(11874..12311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0008"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71726"
FT                   /db_xref="GOA:A5TY76"
FT                   /db_xref="InterPro:IPR024245"
FT                   /db_xref="UniProtKB/TrEMBL:A5TY76"
FT                   /protein_id="ABQ71726.1"
FT                   /translation="MSEQVETRLTPRERLTRGLAYSAVGPVDVTRGLLELGVGLGLQSA
FT                   RSTAAGLRRRYREGRLAREVAAAQETLAQELTAAQDVVANLPQALQDARTQRRSKHHLW
FT                   IFAGIAAAILAGGAVAFSIVRRSSRPEPSPRPPSVEVQPRS"
FT   gene            12468..13016
FT                   /gene="ppiA"
FT                   /locus_tag="MRA_0009"
FT   CDS_pept        12468..13016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiA"
FT                   /locus_tag="MRA_0009"
FT                   /product="iron-regulated peptidyl-prolyl cis-trans
FT                   isomerase A"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71727"
FT                   /db_xref="GOA:A5TY77"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A5TY77"
FT                   /protein_id="ABQ71727.1"
FT                   /translation="MADCDSVTNSPLATATATLHTNRGDIKIALFGNHAPKTVANFVGL
FT                   AQGTKDYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADEFHPE
FT                   LQFDKPYLLAMANAGPGTNGSQFFITVGKTPHLNRRHTIFGEVIDAESQRVVEAISKTA
FT                   TDGNDRPTDPVVIESITIS"
FT   gene            complement(13133..13558)
FT                   /locus_tag="MRA_0010"
FT   CDS_pept        complement(13133..13558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0010"
FT                   /product="putative conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71728"
FT                   /db_xref="GOA:A5TY78"
FT                   /db_xref="InterPro:IPR019692"
FT                   /db_xref="UniProtKB/TrEMBL:A5TY78"
FT                   /protein_id="ABQ71728.1"
FT                   /translation="MQQTAWAPRTSGIAGCGAGGVVMAIASVTLVTDTPGRVLTGVAAL
FT                   GLILFASATWRARPRLAITPDGLAIRGWFRTQLLRHSNIKIIRIDEFRRYGRLVRLLEI
FT                   ETVSGGLLILSRWDLGTDPVEVLDALTAAGYAGRGQR"
FT   gene            complement(13665..14549)
FT                   /locus_tag="MRA_0011"
FT   CDS_pept        complement(13665..14549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0011"
FT                   /product="IS6110 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71729"
FT                   /db_xref="GOA:A5TY79"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TY79"
FT                   /protein_id="ABQ71729.1"
FT                   /translation="MRWGVESICTQLTELGVPIAPSTYYDHINREPSRRELRDGELKEH
FT                   ISRVHAANYGVYGARKVWLTLNREGIEVARCTVERLMTKLGLSGTTRGKARRTTIADPA
FT                   TARPADLVQRRFGPPAPNRLWVADLTYVSTWAGFAYVAFVTDAYARRILGWRVASTMAT
FT                   SMVLDAIEQAIWTRQQEGVLDLKDVIHHTDRGSQYTSIRFSERLAEAGIQPSVGAVGSS
FT                   YDNALAETINGLYKTELIKPGKPWRSIEDVELATARWVDWFNHRRLYQYCGDVPPVELE
FT                   AAYYAQRQRPAAG"
FT   gene            complement(14600..14926)
FT                   /locus_tag="MRA_0012"
FT   CDS_pept        complement(14600..14926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0012"
FT                   /product="IS6110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71730"
FT                   /db_xref="GOA:A5TY80"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TY80"
FT                   /protein_id="ABQ71730.1"
FT                   /translation="MSGGSSRRYPPELRERAVRMVAEIRGQHDSEWAAISEVARLLGVG
FT                   CAETVRKWVRQAQVDAGARPGTTTEESAELKRLRRDNAELRRANAILKTASAFFAAELD
FT                   RPAR"
FT   gene            complement(15072..15353)
FT                   /locus_tag="MRA_0013"
FT   CDS_pept        complement(15072..15353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71731"
FT                   /db_xref="GOA:A5TY81"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TY81"
FT                   /protein_id="ABQ71731.1"
FT                   /translation="MPKSKVRKKNDFTVSAVSRTPMKVKVGPSSVWFVSLFIGLMLIGL
FT                   IWLMVFQLAAIGSQAPTALNWMAQLGPWNYAIAFAFMITGLLLTMRWH"
FT   gene            15447..16235
FT                   /locus_tag="MRA_0014"
FT   CDS_pept        15447..16235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0014"
FT                   /product="putative conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71732"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:A5TY82"
FT                   /protein_id="ABQ71732.1"
FT                   /translation="MRLTHPTPCPENGETMIDRRRSAWRFSVPLVCLLAGLLLAATHGV
FT                   SGGTEIRRSDAPRLVDLVRRAQASVNRLATEREALTTRIDSVHGRSVDTALAAMQRRSA
FT                   KLAGVAAMNPVHGPGLVVTLQDAQRDANGRFPRDASPDDLVVHQQDIEAVLNALWNAGA
FT                   EAIQMQDQRIIAMSIARCVGNTLLLNGRTYSPPYTIAAIGDAAAMQAALAAAPLVTLYK
FT                   QYVVRFGLGYREEVHPDLQIVGYADPVRMHFAQPAGPLDY"
FT   gene            16272..16970
FT                   /gene="trpG"
FT                   /locus_tag="MRA_0015"
FT   CDS_pept        16272..16970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpG"
FT                   /locus_tag="MRA_0015"
FT                   /product="para-aminobenzoate synthase component II"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71733"
FT                   /db_xref="GOA:A5TY83"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A5TY83"
FT                   /protein_id="ABQ71733.1"
FT                   /translation="MRILVVDNYDSFVFNLVQYLGQLGIEAEVWRNDDHRLSDEAAVAG
FT                   QFDGVLLSPGPGTPERAGASVSIVHACAAAHTPLLGVCLGHQAIGVAFGATVDRAPELL
FT                   HGKTSSVFHTNVGVLQGLPDPFTATRYHSLTILPKSLPAVLRVTARTSSGVIMAVQHTG
FT                   LPIHGVQFHPESILTEGGHRILANWLTCCGWTQDDTLVRRLENEVLTAISPHFPTSTAS
FT                   AGEATGRTSA"
FT   gene            complement(16948..18828)
FT                   /gene="pknB"
FT                   /locus_tag="MRA_0016"
FT   CDS_pept        complement(16948..18828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pknB"
FT                   /locus_tag="MRA_0016"
FT                   /product="serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71734"
FT                   /db_xref="GOA:A5TY84"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="PDB:3ORK"
FT                   /db_xref="PDB:3ORL"
FT                   /db_xref="PDB:3ORM"
FT                   /db_xref="PDB:3ORP"
FT                   /db_xref="PDB:3ORT"
FT                   /db_xref="PDB:3OUV"
FT                   /db_xref="UniProtKB/TrEMBL:A5TY84"
FT                   /protein_id="ABQ71734.1"
FT                   /translation="MTTPSHLSDRYELGEILGFGGMSEVHLARDLRLHRDVAVKVLRAD
FT                   LARDPSFYLRFRREAQNAAALNHPAIVAVYDTGEAETPAGPLPYIVMEYVDGVTLRDIV
FT                   HTEGPMTPKRAIEVIADACQALNFSHQNGIIHRDVKPANIMISATNAVKVMDFGIARAI
FT                   ADSGNSVTQTAAVIGTAQYLSPEQARGDSVDARSDVYSLGCVLYEVLTGEPPFTGDSPV
FT                   SVAYQHVREDPIPPSARHEGLSADLDAVVLKALAKNPENRYQTAAEMRADLVRVHNGEP
FT                   PEAPKVLTDAERTSLLSSAAGNLSGPRTDPLPRQDLDDTDRDRSIGSVGRWVAVVAVLA
FT                   VLTVVVTIAINTFGGITRDVQVPDVRGQSSADAIATLQNRGFKIRTLQKPDSTIPPDHV
FT                   IGTDPAANTSVSAGDEITVNVSTGPEQREIPDVSTLTYAEAVKKLTAAGFGRFKQANSP
FT                   STPELVGKVIGTNPPANQTSAITNVVIIIVGSGPATKDIPDVAGQTVDVAQKNLNVYGF
FT                   TKFSQASVDSPRPAGEVTGTNPPAGTTVPVDSVIELQVSKGNQFVMPDLSGMFWVDAEP
FT                   RLRALGWTGMLDKGADVDAGGSQHNRVVYQNPPAGTGVNRDGIITLRFGQ"
FT   gene            complement(18825..20120)
FT                   /gene="pknA"
FT                   /locus_tag="MRA_0017"
FT   CDS_pept        complement(18825..20120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pknA"
FT                   /locus_tag="MRA_0017"
FT                   /product="serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71735"
FT                   /db_xref="GOA:A5TY85"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TY85"
FT                   /protein_id="ABQ71735.1"
FT                   /translation="MSPRVGVTLSGRYRLQRLIATGGMGQVWEAVDNRLGRRVAVKVLK
FT                   SEFSSDPEFIERFRAEARTTAMLNHPGIASVHDYGESQMNGEGRTAYLVMELVNGEPLN
FT                   SVLKRTGRLSLRHALDMLEQTGRALQIAHAAGLVHRDVKPGNILITPTGQVKITDFGIA
FT                   KAVDAAPVTQTGMVMGTAQYIAPEQALGHDASPASDVYSLGVVGYEAVSGKRPFAGDGA
FT                   LTVAMKHIKEPPPPLPPDLPPNVRELIEITLVKNPAMRYRSGGPFADAVAAVRAGRRPP
FT                   RPSQTPPPGRAAPAAIPSGTTARVAANSAGRTAASRRSRPATGGHRPPRRTFSSGQRAL
FT                   LWAAGVLGALAIIIAVLLVIKAPGDNSPQQAPTPTVTTTGNPPASNTGGTDASPRLNWT
FT                   ERGETRHSGLQSWVVPPTPHSRASLARYEIAQ"
FT   gene            complement(20117..21592)
FT                   /gene="pbpA"
FT                   /locus_tag="MRA_0018"
FT   CDS_pept        complement(20117..21592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbpA"
FT                   /locus_tag="MRA_0018"
FT                   /product="putative penicillin-binding protein PbpA"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71736"
FT                   /db_xref="GOA:A5TY86"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A5TY86"
FT                   /protein_id="ABQ71736.1"
FT                   /translation="MNASLRRISVTVMALIVLLLLNATMTQVFTADGLRADPRNQRVLL
FT                   DEYSRQRGQITAGGQLLAYSVATDGRFRFLRVYPNPEVYAPVTGFYSLRYSSTALERAE
FT                   DPILNGSDRRLFGRRLADFFTGRDPRGGNVDTTINPRIQQAGWDAMQQGCYGPCKGAVV
FT                   ALEPSTGKILALVSSPSYDPNLLASHNPEVQAQAWQRLGDNPASPLTNRAISETYPPGS
FT                   TFKVITTAAALAAGATETEQLTAAPTIPLPGSTAQLENYGGAPCGDEPTVSLREAFVKS
FT                   CNTAFVQLGIRTGADALRSMARAFGLDSPPRPTPLQVAESTVGPIPDSAALGMTSIGQK
FT                   DVALTPLANAEIAATIANGGITMRPYLVGSLKGPDLANISTTVGYQQRRAVSPQVAAKL
FT                   TELMVGAEKVAQQKGAIPGVQIASKTGTAEHGTDPRHTPPHAWYIAFAPAQAPKVAVAV
FT                   LVENGADRLSATGGALAAPIGRAVIEAALQGEP"
FT   gene            complement(21589..22998)
FT                   /gene="rodA"
FT                   /locus_tag="MRA_0019"
FT   CDS_pept        complement(21589..22998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rodA"
FT                   /locus_tag="MRA_0019"
FT                   /product="cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71737"
FT                   /db_xref="GOA:A5TY87"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:A5TY87"
FT                   /protein_id="ABQ71737.1"
FT                   /translation="MTTRLQAPVAVTPPLPTRRNAELLLLCFAAVITFAALLVVQANQD
FT                   QGVPWDLTSYGLAFLTLFGSAHLAIRRFAPYTDPLLLPVVALLNGLGLVMIHRLDLVDN
FT                   EIGEHRHPSANQQMLWTLVGVAAFALVVTFLKDHRQLARYGYICGLAGLVFLAVPALLP
FT                   AALSEQNGAKIWIRLPGFSIQPAEFSKILLLIFFSAVLVAKRGLFTSAGKHLLGMTLPR
FT                   PRDLAPLLAAWVISVGVMVFEKDLGASLLLYTSFLVVVYLATQRFSWVVIGLTLFAAGT
FT                   LVAYFIFEHVRLRVQTWLDPFADPDGTGYQIVQSLFSFATGGIFGTGLGNGQPDTVPAA
FT                   STDFIIAAFGEELGLVGLTAILMLYTIVIIRGLRTAIATRDSFGKLLAAGLSSTLAIQL
FT                   FIVVGGVTRLIPLTGLTTPWMSYGGSSLLANYILLAILARISHGARRPLRTRPRNKSPI
FT                   TAAGTEVIERV"
FT   gene            complement(22995..24539)
FT                   /gene="ppp"
FT                   /locus_tag="MRA_0020"
FT   CDS_pept        complement(22995..24539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppp"
FT                   /locus_tag="MRA_0020"
FT                   /product="putative serine/threonine phosphatase Ppp"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71738"
FT                   /db_xref="GOA:A5TY88"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A5TY88"
FT                   /protein_id="ABQ71738.1"
FT                   /translation="MARVTLVLRYAARSDRGLVRANNEDSVYAGARLLALADGMGGHAA
FT                   GEVASQLVIAALAHLDDDEPGGDLLAKLDAAVRAGNSAIAAQVEMEPDLEGMGTTLTAI
FT                   LFAGNRLGLVHIGDSRGYLLRDGELTQITKDDTFVQTLVDEGRITPEEAHSHPQRSLIM
FT                   RALTGHEVEPTLTMREARAGDRYLLCSDGLSDPVSDETILEALQIPEVAESAHRLIELA
FT                   LRGGGPDNVTVVVADVVDYDYGQTQPILAGAVSGDDDQLTLPNTAAGRASAISQRKEIV
FT                   KRVPPQADTFSRPRWSGRRLAFVVALVTVLMTAGLLIGRAIIRSNYYVADYAGSVSIMR
FT                   GIQGSLLGMSLHQPYLMGCLSPRNELSQISYGQSGGPLDCHLMKLEDLRPPERAQVRAG
FT                   LPAGTLDDAIGQLRELAANSLLPPCPAPRATSPPGRPAPPTTSETTEPNVTSSPASPSP
FT                   TTSAPAPTGTTPAIPTSASPAAPASPPTPWPVTSSPTMAALPPPPPQPGIDCRAAA"
FT   gene            complement(24628..25095)
FT                   /locus_tag="MRA_0021"
FT   CDS_pept        complement(24628..25095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71739"
FT                   /db_xref="GOA:A5TY89"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:A5TY89"
FT                   /protein_id="ABQ71739.1"
FT                   /translation="MQGLVLQLTRAGFLMLLWVFIWSVLRILKTDIYAPTGAVMMRRGL
FT                   ALRGTLLGARQRRHAARYLVVTEGALTGARITLSEQPVLIGRADDSTLVLTDDYASTRH
FT                   ARLSMRGSEWYVEDLGSTNGTYLDRAKVTTAVRVPIGTPVRIGKTAIELRP"
FT   gene            complement(25219..26802)
FT                   /locus_tag="MRA_0022"
FT   CDS_pept        complement(25219..26802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71740"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:A5TY90"
FT                   /protein_id="ABQ71740.1"
FT                   /translation="MGSQKRLVQRVERKLEQTVGDAFARIFGGSIVPQEVEALLRREAA
FT                   DGIQSLQGNRLLAPNEYIITLGVHDFEKLGADPELKSTGFARDLADYIQEQGWQTYGDV
FT                   VVRFEQSSNLHTGQFRARGTVNPDVETHPPVIDCARPQSNHAFGAEPGVAPMSDNSSYR
FT                   GGQGQGRPDEYYDDRYARPQEDPRGGPDPQGGSDPRGGYPPETGGYPPQPGYPRPRHPD
FT                   QGDYPEQIGYPDQGGYPEQRGYPEQRGYPDQRGYQDQGRGYPDQGQGGYPPPYEQRPPV
FT                   SPGPAAGYGAPGYDQGYRQSGGYGPSPGGGQPGYGGYGEYGRGPARHEEGSYVPSGPPG
FT                   PPEQRPAYPDQGGYDQGYQQGATTYGRQDYGGGADYTRYTESPRVPGYAPQGGGYAEPA
FT                   GRDYDYGQSGAPDYGQPAPGGYSGYGQGGYGSAGTSVTLQLDDGSGRTYQLREGSNIIG
FT                   RGQDAQFRLPDTGVSRRHLEIRWDGQVALLADLNSTNGTTVNNAPVQEWQLADGDVIRL
FT                   GHSEIIVRMH"
FT   gene            27002..27084
FT                   /locus_tag="MRA_t03"
FT   tRNA            27002..27084
FT                   /locus_tag="MRA_t03"
FT                   /product="tRNA-Leu"
FT   gene            complement(27271..28239)
FT                   /locus_tag="MRA_0023"
FT   CDS_pept        complement(27271..28239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0023"
FT                   /product="2-nitropropane dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71741"
FT                   /db_xref="GOA:A5TY91"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A5TY91"
FT                   /protein_id="ABQ71741.1"
FT                   /translation="MVLSTAFSQMFGIDYPIVSAPMDLIAGGELAAAVSGAGGLGLIGG
FT                   GYGDRDWLARQFDLAAGAPVGCGFITWSLARQPQLLDLALQYEPVAVMLSFGDPAVFAD
FT                   AIKSAGTRLVCQIQNRTQAERALQVGADVLVAQGTEAGGHGHGPRSTLTLVPEIVDLVT
FT                   ARGTDIPVIAAGGIADGRGLAAALMLGAAGVLVGTRFYATVEALSTPQARDPLLAATGD
FT                   DMCRTTIYDQLRRYPWPQGHTMSVLSNALTDQFEDTELDILHREEAMARYWRAVAARDY
FT                   SIANVTAGQAAGLVNAVLPAADVITGMAQQAARTLTAMRAV"
FT   gene            28351..28659
FT                   /locus_tag="MRA_0024"
FT   CDS_pept        28351..28659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71742"
FT                   /db_xref="UniProtKB/TrEMBL:A5TY92"
FT                   /protein_id="ABQ71742.1"
FT                   /translation="MATAGLADRASSGRLWANLCDRQVHHDPGHRGDLESFVAGQQSRI
FT                   VRELPGIDLAAGNPTQHVVGCRELFALSVLAAGKLDAGPYAVLHPMLDRVLSTPALL"
FT   gene            complement(28381..28800)
FT                   /gene="whiB5"
FT                   /locus_tag="MRA_0025"
FT   CDS_pept        complement(28381..28800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="whiB5"
FT                   /locus_tag="MRA_0025"
FT                   /product="putative transcriptional regulatory protein
FT                   whib-like WhiB5"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71743"
FT                   /db_xref="GOA:A5TY93"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:A5TY93"
FT                   /protein_id="ABQ71743.1"
FT                   /translation="MAHPCATDPELWFGYPDDDGSDGAAKARAYERSATQARIQCLRRC
FT                   PLLQQRRCAQHAVEHRVEYGVWAGIKLPGGQYRKREQLAAAHDVLRRIAGGEINSRQLP
FT                   DNAALLARNEGLEVTPVPGVVVHLPIAQVGPQPAA"
FT   gene            28953..29723
FT                   /locus_tag="MRA_0026"
FT   CDS_pept        28953..29723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0026"
FT                   /product="putative transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71744"
FT                   /db_xref="GOA:A5TY94"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A5TY94"
FT                   /protein_id="ABQ71744.1"
FT                   /translation="MSRESAGAAIRALRESRDWSLADLAAATGVSTMGLSYLERGARKP
FT                   HKSTVQKVENGLGLPPGTYSRLLVAADPDAELARLIAAQPSNPTAVRRAGAVVVDRHSD
FT                   TDVLEGYAEAQLDAIKSVIDRLPATTSNEYETYILSVIAQCVKAEMLAASSWRVAVNAG
FT                   ADSTGRLMEHLRALEATRGALLERMPTSLSARFDRACAQSSLPEAVVAALIGVGADEMW
FT                   DIRNRGVIPAGALPRVRAFVDAIEASHDADEGQQ"
FT   gene            29720..30565
FT                   /locus_tag="MRA_0027"
FT   CDS_pept        29720..30565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0027"
FT                   /product="NLP/P60 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71745"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A5TY95"
FT                   /protein_id="ABQ71745.1"
FT                   /translation="MNYSEVELLSRAHQLFAGDSRRPGLDAGTTPYGDLLSRAADLNVG
FT                   AGQRRYQLAVDHSRAALLSAARTDAAAGAVITGAQRDRAWARRSTGTVLDEARSDTTVT
FT                   AVMPIAQREAIRRRVARLRAQRAHVLTARRRARRHLAALRALRYRVAHGPGVALAKLRL
FT                   PSPSGRAGIAVHAALSRLGRPYVWGATGPNQFDCSGLVQWAYAQAGVHLDRTTYQQINE
FT                   GIPVPRSQVRPGDLVFPHPGHVQLAIGNNLVVEAPHAGASVRVSSLGNNVQIRRPLSGR
FT                   "
FT   gene            30603..30965
FT                   /locus_tag="MRA_0028"
FT   CDS_pept        30603..30965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71746"
FT                   /db_xref="InterPro:IPR019710"
FT                   /db_xref="UniProtKB/TrEMBL:A5TY96"
FT                   /protein_id="ABQ71746.1"
FT                   /translation="MSEQAGSSVAVIQERQALLARQHDAVAEADRELADVLASAHAAMR
FT                   ESVRRLDAIAAELDRAVPDQDQLAVDTPMGAREFQTFLVAKQREIVAVVAAAHELDRAK
FT                   SAVLKRLRAQYTEPAR"
FT   gene            31080..32426
FT                   /locus_tag="MRA_0029"
FT   CDS_pept        31080..32426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71747"
FT                   /db_xref="InterPro:IPR019710"
FT                   /db_xref="UniProtKB/TrEMBL:A5TY97"
FT                   /protein_id="ABQ71747.1"
FT                   /translation="MAFDAAMSTHEDLLATIRYVRDRTGDPNAWQTGLTPTEVTAVVTS
FT                   TTRSEQLDAILRKIRQRHSNLYYPAPPDREQGDAARAIADAEAALAHQNSATAQLDLQV
FT                   VSAILNAHLKTVEGGESLHELQQEIEAAVRIRSDLDTPAGARDFQRFLIGKLKDIREVV
FT                   ATASLDAASKSALMAAWTSLYDASKGDRGDADDRGPASVGSGGAPARGAGQQPELPTRA
FT                   EPDCLLDSLLLEDPGLLADDLQVPGGTSAAIPSASSTPSLPNLGGATMPGGGATPALVP
FT                   GVSAPGGLPLSGLLRGVGDEPELTDFDERGQEVRDPADYEHSNEPDERRADDREGADED
FT                   AGLGKSESPPQAPTTVTLPNGETVTAASPQLAAAIKAAASGTPIADAFQQQGIAIPLPG
FT                   TAVANPVDPARISAGDVGVFTATPLPLALAKLFWTARFNTSQPCEGQTF"
FT   gene            32547..32864
FT                   /locus_tag="MRA_0030"
FT   CDS_pept        32547..32864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71748"
FT                   /db_xref="GOA:A5TY98"
FT                   /db_xref="InterPro:IPR022536"
FT                   /db_xref="UniProtKB/TrEMBL:A5TY98"
FT                   /protein_id="ABQ71748.1"
FT                   /translation="MTDRIHVQPAHLRQAAAHHQQTADYLRTVPSSHDAIRESLDSLGP
FT                   IFSELRDTGRELLELRKQCYQQQADNHADIAQNLRTSAAMWEQHERAASRSLGNIIDGS
FT                   R"
FT   gene            32872..33177
FT                   /locus_tag="MRA_0031"
FT   CDS_pept        32872..33177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71749"
FT                   /db_xref="InterPro:IPR024426"
FT                   /db_xref="UniProtKB/TrEMBL:A5TY99"
FT                   /protein_id="ABQ71749.1"
FT                   /translation="MTDANPAFDTVHPSGHILVRSCRGGYMHSVSLSEAAMETDAETLA
FT                   EAILLTADVSCLKALLEVRNEIVAAGHTPSAQVPTTDDLNVAIEKLLAHQLRRRNR"
FT   gene            33415..34512
FT                   /locus_tag="MRA_0032"
FT   CDS_pept        33415..34512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71750"
FT                   /db_xref="InterPro:IPR040604"
FT                   /db_xref="InterPro:IPR040833"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYA0"
FT                   /protein_id="ABQ71750.1"
FT                   /translation="MAIFGRWSARQRLRRATRESLTIPTFSSSLDCTTRVIGGLWPAEL
FT                   SSNTAETATLAEHLKADLHRIVGSANDELMVIWRAGMADSTRRAEEDRVIDRARASAMR
FT                   RVESAMRELRQITGRVPVEIPRMRGAGGSDLDTTRLMPAVTVVQPADQACTDWPVAAAE
FT                   DDEARLQRLLAFVARQEPRLNWAVGVHADGTTVLVTDVAHGWIPPGIALPEGVRLLAPA
FT                   RRAGRAPELVGITTCCKTYTPGDSLRRAVDSTAPTSSVQPRALPAIAGLSVELGIATQR
FT                   HDGLPKIVHAMATAAGNGAAAEEVDLLRVHVDTALHHVLAQYPRVDPALLLNCMLLAAT
FT                   ERSVTGDPIAANYHFAWFRELDSRR"
FT   gene            34582..34911
FT                   /locus_tag="MRA_0033"
FT   CDS_pept        34582..34911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71751"
FT                   /db_xref="InterPro:IPR024296"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYA1"
FT                   /protein_id="ABQ71751.1"
FT                   /translation="MVSGSDSRSEPSQLSDRDLVESVLRDLSEAADKWEALVTQAETVT
FT                   YSVDLGDVRAVANSDGRLLELTLHPGVMTGYAHGELADRVNLAITALRDEVEAENRARY
FT                   GGRLQ"
FT   gene            34940..35152
FT                   /locus_tag="MRA_0034"
FT   CDS_pept        34940..35152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0034"
FT                   /product="putative remnant of a transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71752"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYA2"
FT                   /protein_id="ABQ71752.1"
FT                   /translation="MLARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKPRCESDVFA
FT                   RIGHTSHPSTRKSRVGPGASEAPLA"
FT   gene            35653..37968
FT                   /gene="bioF2"
FT                   /locus_tag="MRA_0035"
FT   CDS_pept        35653..37968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioF2"
FT                   /locus_tag="MRA_0035"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71753"
FT                   /db_xref="GOA:A5TYA3"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR038740"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYA3"
FT                   /protein_id="ABQ71753.1"
FT                   /translation="MPTGLGYDFLRPVEDSGINDLKHYYFMADLADGQPLGRANLYSVC
FT                   FDLATTDRKLTPAWRTTIKRWFPGFMTFRFLECGLLTMVSNPLALRSDTDLERVLPVLA
FT                   GQMDQLAHDDGSDFLMIRDVDPEHYQRYLDILRPLGFRPALGFSRVDTTISWSSVEEAL
FT                   GCLSHKRRLPLKTSLEFRERFGIEVEELDEYAEHAPVLARLWRNVKTEAKDYQREDLNP
FT                   EFFAACSRHLHGRSRLWLFRYQGTPIAFFLNVWGADENYILLEWGIDRDFEHYRKANLY
FT                   RAALMLSLKDAISRDKRRMEMGITNYFTKLRIPGARVIPTIYFLRHSTDPVHTATLARM
FT                   MMHNIQRPTLPDDMSEEFCRWEERIRLDQDGLPEHDIFRKIDRQHKYTGLKLGGVYGFY
FT                   PRFTGPQRSTVKAAELGEIVLLGTNSYLGLATHPEVVEASAEATRRYGTGCSGSPLLNG
FT                   TLDLHVSLEQELACFLGKPAAVLCSTGYQSNLAAISALCESGDMIIQDALNHRSLFDAA
FT                   RLSGADFTLYRHNDMDHLARVLRRTEGRRRIIVVDAVFSMEGTVADLATIAELADRHGC
FT                   RVYVDESHALGVLGPDGRGASAALGVLARMDVVMGTFSKSFASVGGFIAGDRPVVDYIR
FT                   HNGSGHVFSASLPPAAAAATHAALRVSRREPDRRARVLAAAEYMATGLARQGYQAEYHG
FT                   TAIVPVILGNPTVAHAGYLRLMRSGVYVNPVAPPAVPEERSGFRTSYLADHRQSDLDRA
FT                   LHVFAGLAEDLTPQGAAL"
FT   gene            37965..38228
FT                   /gene="acpA"
FT                   /locus_tag="MRA_0036"
FT   CDS_pept        37965..38228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpA"
FT                   /locus_tag="MRA_0036"
FT                   /product="acyl carrier protein AcpA"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71754"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYA4"
FT                   /protein_id="ABQ71754.1"
FT                   /translation="MKEAINATIQRILRTDRGITANQVLVDDLGFDSLKLFQLITELED
FT                   EFDIAISFRDAQNIKTVGDVYTSVAVWFPETAKPAPLGKGTA"
FT   gene            38225..38620
FT                   /locus_tag="MRA_0037"
FT   CDS_pept        38225..38620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71755"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYA5"
FT                   /protein_id="ABQ71755.1"
FT                   /translation="MTDDADLDLVRRTFAAFARGDLAELTQCFAPDVEQFVPGKHALAG
FT                   VFRGVDNVVACLGDTAAAADGTMTVTLEDVLSNTDGQVIAVYRLRASRAGKVLDQREAI
FT                   LVTVAGGRITRLSEFYADPAATESFWA"
FT   gene            38617..40305
FT                   /gene="fadD34"
FT                   /locus_tag="MRA_0038"
FT   CDS_pept        38617..40305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD34"
FT                   /locus_tag="MRA_0038"
FT                   /product="fatty-acid-CoA ligase FadD34"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71756"
FT                   /db_xref="GOA:A5TYA6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYA6"
FT                   /protein_id="ABQ71756.1"
FT                   /translation="MTAALLSPAIAWQQISACTDRTLTITCEDSEVISYQDLIARAAAC
FT                   IPPLRRLDLKRGEPVLITAHTNLEFLSCFLGLMLHGAVPVPIPPREALKTTERFMTRLG
FT                   PLLRHHRVLICTPAEHDEIRAAASTDCQISRFTALAEAGDEQFGRATAQQLADTATADW
FT                   PLCTLDDDAYVQYTSGSTAAPRGVVITYRNLLSNMRAMAVGSQFQHGDVMGSWLPLHHD
FT                   MGLVGSLFAALFNSVSAVFTTPHRFLYDPLGFLRLLTSSGATHTFMPNFALEWLINAYH
FT                   RRGADIEGIDLHKMRRLIIASEPVHAEGMRRFAATFAGVGLAPTALGSGYGLAEATVAV
FT                   SMSAPNTGFRTETHAAAEVVTGGRVLPGYEVRIDAAPGARAGTIKLRGDSVAAKAYVGG
FT                   KKLDALDEEGFCDTHDLGFLVDDEIVILGRQDEVFIVHGENRFPYDIEFIIRGESEQHR
FT                   TKVACFGVNERVVVVLESPLDSIIDKAEADRLRCQVVAATGLQLDELITVRRGAIPTTT
FT                   SGKLKRRAVAQAYRDGTLPRLATHAWTADPDSAPKTTRSSLEGAH"
FT   gene            complement(40414..41187)
FT                   /locus_tag="MRA_0039"
FT   CDS_pept        complement(40414..41187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71757"
FT                   /db_xref="GOA:A5TYA7"
FT                   /db_xref="InterPro:IPR013917"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR017518"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYA7"
FT                   /protein_id="ABQ71757.1"
FT                   /translation="MADPGPFVADLRAESDDLDALVAHLPADRWADPTPAPGWTIAHQI
FT                   GHLLWTDRVALTAVTDEAGFAELMTAAAANPAGFVDDAATELAAVSPAELLTDWRVTRG
FT                   RLHEELLAVPDGRKLAWFGPPMSAASMATARLMETWAHGLDVADALGVIRPATQRLRSI
FT                   AHLGVRTRDYAFIVNNLTPPAEPFLVELRGPSGDTWSWGPSDAAQRVTGSAEDFCFLVT
FT                   QRRALSTLDVNAVGEDAQRWLTIAQAFAGPPGRGR"
FT   gene            complement(41235..42560)
FT                   /locus_tag="MRA_0040"
FT   CDS_pept        complement(41235..42560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0040"
FT                   /product="putative conserved integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71758"
FT                   /db_xref="GOA:A5TYA8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYA8"
FT                   /protein_id="ABQ71758.1"
FT                   /translation="MPRVEVGLVIHSRMHARAPVDVWRSVRSLPDFWRLLQVRVASQFG
FT                   DGLFQAGLAGALLFNPDRAADPMAIAGAFAVLFLPYSLLGPFAGALMDRWDRRWVLVGA
FT                   NTGRLALIAGVGTILAVGAGDVPLLVGALVANGLARFVASGLSAALPHVVPREQVVTMN
FT                   SVAIASGAVSAFLDANFMLLPRWLLGSGDEGASAIVFLVAIPVSIALLWSLRFGPRVLG
FT                   PDDTERAIHGSAVYAVVTGWLHGARTVVQLPTVAAGLSGLAAHRMVVGINSLLILLLVR
FT                   HVTARAVGGLGTALLFFAATGLGAFLANVLTPTAIRRWGRYATANGALAAAATIQVAAA
FT                   GLLVPVMVVCGFLLGVAGQVVKLCADSAMQMDVDDALRGHVFAVQDALFWVSYILSITV
FT                   AAALIPEHGHAPVFVLFGSAIYLAGLVVHTIVGRRGQPVIGR"
FT   gene            42662..43270
FT                   /locus_tag="MRA_0041"
FT   CDS_pept        42662..43270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0041"
FT                   /product="putative transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71759"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TYA9"
FT                   /protein_id="ABQ71759.1"
FT                   /translation="MVAPHEDPEDHVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVE
FT                   HNDGGTLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRVGADP
FT                   EGVPGLRHVAGRLVMVDLDADPEVLAAAVEGVRIYAGYSGWTIGQLEGEIERDDWIVLS
FT                   ALPSDVLVGPRADLWGQVLRRQPLPLSLLATHPIDLSRN"
FT   gene            complement(43362..43709)
FT                   /locus_tag="MRA_0042"
FT   CDS_pept        complement(43362..43709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0042"
FT                   /product="putative conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71760"
FT                   /db_xref="GOA:A5TYB0"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYB0"
FT                   /protein_id="ABQ71760.1"
FT                   /translation="MFLAGVLCMCAAAASALFGSWSLCHTPTADPTALALRAMAPTQLA
FT                   AAVMLAAGGVVAVAAPGHTALMVVIVCIAGAVGTLAAGSWQSAQYALRRETASPTANCV
FT                   GSCAVCTQACH"
FT   gene            complement(43791..44723)
FT                   /gene="mtc28"
FT                   /locus_tag="MRA_0043"
FT   CDS_pept        complement(43791..44723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtc28"
FT                   /locus_tag="MRA_0043"
FT                   /product="proline rich secreted protein Mtc28"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71761"
FT                   /db_xref="InterPro:IPR019674"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYB1"
FT                   /protein_id="ABQ71761.1"
FT                   /translation="MIQIARTWRVFAGGMATGFIGVVLVTAGKASADPLLPPPPIPAPV
FT                   SAPATVPPVQNLTALPGGSSNRFSPAPAPAPIASPIPVGAPGSTAVPPLPPPVTPAISG
FT                   TLRDHLREKGVKLEAQRPHGFKALDITLPMPPRWTQVPDPNVPDAFVVIADRLGNSVYT
FT                   SNAQLVVYRLIGDFDPAEAITHGYIDSQKLLAWQTTNASMANFDGFPSSIIEGTYREND
FT                   MTLNTSRRHVIATSGADKYLVSLSVTTALSQAVTDGPATDAIVNGFQVVAHAAPAQAPA
FT                   PAPGSAPVGLPGQAPGYPPAGTLTPVPPR"
FT   gene            44920..47829
FT                   /gene="leuS"
FT                   /locus_tag="MRA_0044"
FT   CDS_pept        44920..47829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="MRA_0044"
FT                   /product="leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71762"
FT                   /db_xref="GOA:A5TYB2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TYB2"
FT                   /protein_id="ABQ71762.1"
FT                   /translation="MTESPTAGPGGVPRADDADSDVPRYRYTAELAARLERTWQENWAR
FT                   LGTFNVPNPVGSLAPPDGAAVPDDKLFVQDMFPYPSGEGLHVGHPLGYIATDVYARYFR
FT                   MVGRNVLHALGFDAFGLPAEQYAVQTGTHPRTRTEANVVNFRRQLGRLGFGHDSRRSFS
FT                   TTDVDFYRWTQWIFLQIYNAWFDTTANKARPISELVAEFESGARCLDGGRDWAKLTAGE
FT                   RADVIDEYRLVYRADSLVNWCPGLGTVLANEEVTADGRSDRGNFPVFRKRLRQWMMRIT
FT                   AYADRLLDDLDVLDWPEQVKTMQRNWIGRSTGAVALFSARAASDDGFEVDIEVFTTRPD
FT                   TLFGATYLVLAPEHDLVDELVAASWPAGVNPLWTYGGGTPGEAIAAYRRAIAAKSDLER
FT                   QESREKTGVFLGSYAINPANGEPVPIFIADYVLAGYGTGAIMAVPGHDQRDWDFARAFG
FT                   LPIVEVIAGGNISESAYTGDGILVNSDYLNGMSVPAAKRAIVDRLESAGRGRARIEFKL
FT                   RDWLFARQRYWGEPFPIVYDSDGRPHALDEAALPVELPDVPDYSPVLFDPDDADSEPSP
FT                   PLAKATEWVHVDLDLGDGLKPYSRDTNVMPQWAGSSWYELRYTDPHNSERFCAKENEAY
FT                   WMGPRPAEHGPDDPGGVDLYVGGAEHAVLHLLYSRFWHKVLYDLGHVSSREPYRRLVNQ
FT                   GYIQAYAYTDARGSYVPAEQVIERGDRFVYPGPDGEVEVFQEFGKIGKSLKNSVSPDEI
FT                   CDAYGADTLRVYEMSMGPLEASRPWATKDVVGAYRFLQRVWRLVVDEHTGETRVADGVE
FT                   LDIDTLRALHRTIVGVSEDFAALRNNTATAKLIEYTNHLTKKHRDAVPRAAVEPLVQML
FT                   APLAPHIAEELWLRLGNTTSLAHGPFPKADAAYLVDETVEYPVQVNGKVRGRVVVAADT
FT                   DEETLKAAVLTDEKVQAFLAGATPRKVIVVAGRLVNLVI"
FT   gene            complement(47939..48565)
FT                   /locus_tag="MRA_0045"
FT   CDS_pept        complement(47939..48565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0045"
FT                   /product="MarR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71763"
FT                   /db_xref="GOA:A5TYB3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYB3"
FT                   /protein_id="ABQ71763.1"
FT                   /translation="MSVVRSIGKKMQRISGPNALAVKGRPTQVYGHTHVRLDCRFMADS
FT                   EFTAPEVTQLAEGLHRALSKLISMLRRGDPNGAAAGDLTLAQLSILVTLLDQGPIRMTD
FT                   LAAHERVRTPTTTVAIRRLEKIGLVKRSRDPSDLRAVLVDITPQGRAVHGESLANRRAA
FT                   LAALLSQLPRSDLETLRKALAPLERLASGEPASGPASNSPARKRA"
FT   gene            complement(48724..49458)
FT                   /locus_tag="MRA_0046"
FT   CDS_pept        complement(48724..49458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0046"
FT                   /product="GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71764"
FT                   /db_xref="GOA:A5TYB4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYB4"
FT                   /protein_id="ABQ71764.1"
FT                   /translation="MPKKYGVKEKDQVVAHILNLLLTGKLRSGDRVDRNEIAHGLGVSR
FT                   VPIQEALVQLEHDGIVSTRYHRGAFIERFDVATILEHHELDGLLNGIASARAAANPTPR
FT                   ILGQLDAVMRSLRNSKESRAFAECVWEYRRTVNDEYAGPRLHATIRASQNLIPRVFWMT
FT                   YQNSRDDVLPFYEEENAAIHRREPEAARAACIGRSELMAQTMLAELFRRRVLVPPEGAC
FT                   PGPFGAPIPGFARSYQPSSPVP"
FT   gene            complement(49591..50385)
FT                   /locus_tag="MRA_0047"
FT   CDS_pept        complement(49591..50385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0047"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71765"
FT                   /db_xref="GOA:A5TYB5"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR022480"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYB5"
FT                   /protein_id="ABQ71765.1"
FT                   /translation="MTSLVRPDLPVRIGVQLQPQHAPHYRAVRDAVRRCEDIGVDIAFT
FT                   WDHFFPLYGDPDGPHFECWTVLGAWAEQTSHIEIGALVTCNSYRNPELLADMARTVDHI
FT                   SGGRLILGIGSGWKQKDYDEYGYRFGTAGSRLDDLAAALPRIKARLGKLNPPPTRDIPV
FT                   LIGGGGERKTLRLVAEYADIWHSFTAGDSYLAKSAVLSTHCSTVGRNPATIERSAAVDG
FT                   GGLIASAEALAGLGVTLLTVGCDGPDYDLSAAAALCRWRDGR"
FT   gene            complement(50401..51297)
FT                   /locus_tag="MRA_0048"
FT   CDS_pept        complement(50401..51297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0048"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71766"
FT                   /db_xref="GOA:A5TYB6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYB6"
FT                   /protein_id="ABQ71766.1"
FT                   /translation="MLSDDELTGLDEFALLAENAEQAGVNGPLPEVERVQAGAISALRW
FT                   GGSAPRVIFLHGGGQNAHTWDTVIVGLGEPALAVDLPGHGHSAWREDGNYSPQLNSETL
FT                   APVLRELAPGAEFVVGMSLGGLTAIRLAAMAPDLVGELVLVDVTPSALQRHAELTAEQR
FT                   GTVALMHGEREFPSFQAMLDLTIAAAPHRDVKSLRRGVFHNSRRLDNGNWVWRYDAIRT
FT                   FGDFAGLWDDVDALSAPITLVRGGSSGFVTDQDTAELHRRATHFRGVHIVEKSGHSVQS
FT                   DQPRALIEIVRGVLDTR"
FT   gene            complement(51379..52482)
FT                   /gene="ino1"
FT                   /locus_tag="MRA_0049"
FT   CDS_pept        complement(51379..52482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ino1"
FT                   /locus_tag="MRA_0049"
FT                   /product="1L-myo-inositol-1-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71767"
FT                   /db_xref="GOA:A5TYB7"
FT                   /db_xref="InterPro:IPR002587"
FT                   /db_xref="InterPro:IPR013021"
FT                   /db_xref="InterPro:IPR017815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYB7"
FT                   /protein_id="ABQ71767.1"
FT                   /translation="MSEHQSLPAPEASTEVRVAIVGVGNCASSLVQGVEYYYNADDTST
FT                   VPGLMHVRFGPYHVRDVKFVAAFDVDAKKVGFDLSDAIFASENNTIKIADVAPTNVIVQ
FT                   RGPTLDGIGKYYADTIELSDAEPVDVVQALKEAKVDVLVSYLPVGSEEADKFYAQCAID
FT                   AGVAFVNALPVFIASDPVWAKKFTDARVPIVGDDIKSQVGATITHRVLAKLFEDRGVQL
FT                   DRTMQLNVGGNMDFLNMLERERLESKKISKTQAVTSNLKREFKTKDVHIGPSDHVGWLD
FT                   DRKWAYVRLEGRAFGDVPLNLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVIPA
FT                   SAYLMKSPPEQLPDDIARAQLEEFIIG"
FT   gene            complement(52543..53085)
FT                   /locus_tag="MRA_0050"
FT   CDS_pept        complement(52543..53085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71768"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYB8"
FT                   /protein_id="ABQ71768.1"
FT                   /translation="MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRR
FT                   MQADGLIAENAAPAGTPVRRARRVYQLTDKGRRRFGELVADTGPHNYTDDGFGVHLAFF
FT                   NRTPAEARMRILEGRRRQVEERREGLREAVARASSSFDRYTRQLHQLGLESSEREVKWL
FT                   NELIAAERAAPNPAEQT"
FT   gene            complement(53186..54055)
FT                   /locus_tag="MRA_0051"
FT   CDS_pept        complement(53186..54055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71769"
FT                   /db_xref="GOA:A5TYB9"
FT                   /db_xref="InterPro:IPR012551"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYB9"
FT                   /protein_id="ABQ71769.1"
FT                   /translation="MAKWLGAPLARGVSTATRAKDSDRQDACRILDDALRDGELSMEEH
FT                   RERVSAATKAVTLGDLQRLVADLQVESAPAQMPALKSRAKRTELGLLAAAFVASVLLGV
FT                   GIGWGVYGNTRSPLDFTSDPGAKPDGIAPVVLTPPRQLHSLGGLTGLLEQTRKRFGDTM
FT                   GYRLVIYPEYASLDRVDPADDRRVLAYTYRGGWGDATSSAKSIADVSVVDLSKFDAKTA
FT                   VGIMRGAPETLGLKQSDVKSMYLIVEPVKDPTTPAALSLSLYVSSDYGGGYLVFAGDGT
FT                   IKHVSYPS"
FT   gene            54189..54602
FT                   /locus_tag="MRA_0052"
FT   CDS_pept        54189..54602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71770"
FT                   /db_xref="InterPro:IPR035169"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYC0"
FT                   /protein_id="ABQ71770.1"
FT                   /translation="MDYTLRRRSLLAEVYSGRTGVSEVCDANPYLLRAAKFHGKPSRVI
FT                   CPICRKEQLTLVSWVFGEHLGAVSGSARTAEELILLATRFSEFAVHVVEVCRTCSWNHL
FT                   VKSYVLGAARPARPPRGSGGTRTARNGARTASE"
FT   gene            55021..57057
FT                   /gene="ponA1"
FT                   /locus_tag="MRA_0053"
FT   CDS_pept        55021..57057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ponA1"
FT                   /locus_tag="MRA_0053"
FT                   /product="bifunctional penicillin-binding protein 1A/1B
FT                   PonA1"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71771"
FT                   /db_xref="GOA:A5TYC1"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYC1"
FT                   /protein_id="ABQ71771.1"
FT                   /translation="MVILLPMVTFTMAYLIVDVPKPGDIRTNQVSTILASDGSEIAKIV
FT                   PPEGNRVDVNLSQVPMHVRQAVIAAEDRNFYSNPGFSFTGFARAVKNNLFGGDLQGGST
FT                   ITQQYVKNALVGSAQHGWSGLMRKAKELVIATKMSGEWSKDDVLQAYLNIIYFGRGAYG
FT                   ISAASKAYFDKPVEQLTVAEGALLAALIRRPSTLDPAVDPEGAHARWNWVLDGMVETKA
FT                   LSPNDRAAQVFPETVPPDLARAENQTKGPNGLIERQVTRELLELFNIDEQTLNTQGLVV
FT                   TTTIDPQAQRAAEKAVAKYLDGQDPDMRAAVVSIDPHNGAVRAYYGGDNANGFDFAQAG
FT                   LQTGSSFKVFALVAALEQGIGLGYQVDSSPLTVDGIKITNVEGEGCGTCNIAEALKMSL
FT                   NTSYYRLMLKLNGGPQAVADAAHQAGIASSFPGVAHTLSEDGKGGPPNNGIVLGQYQTR
FT                   VIDMASAYATLAASGIYHPPHFVQKVVSANGQVLFDASTADNTGDQRIPKAVADNVTAA
FT                   MEPIAGYSRGHNLAGGRDSAAKTGTTQFGDTTANKDAWMVGYTPSLSTAVWVGTVKGDE
FT                   PLVTASGAAIYGSGLPSDIWKATMDGALKGTSNETFPKPTEVGGYAGVPPPPPPSEVPP
FT                   SETVIQPTVEIAPGITIPIGPPTTITLAPPPPAPPAATPTPPP"
FT   gene            57054..58736
FT                   /locus_tag="MRA_0054"
FT   CDS_pept        57054..58736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0054"
FT                   /product="putative conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71772"
FT                   /db_xref="GOA:A5TYC2"
FT                   /db_xref="InterPro:IPR016570"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYC2"
FT                   /protein_id="ABQ71772.1"
FT                   /translation="MTGALSQSSNISPLPLAADLRSADNRDCPSRTDVLGAALANVVGG
FT                   PVGRHALIGRTRLMTPLRVMFAIALVFLALGWSTKAACLQSTGTGPGDQRVANWDNQRA
FT                   YYQLCYSDTVPLYGAELLSQGKFPYKSSWIETDSNGTPQLRYDGQIAVRYMEYPVLTGI
FT                   YQYLSMAIAKTYTALSKVAPLPVVAEVVMFFNVAAFGLALAWLTTVWATSGLAGRRIWD
FT                   AALVAASPLVIFQIFTNFDALATGLATSGLLAWARRRPVLAGVLIGLGSAAKLYPLLFL
FT                   YPLLLLGIRAGRLNALARTMAAAAATWLLVNLPVMLLFPRGWSEFFRLNTRRGDDMDSL
FT                   YNVVKSFTGWRGFDPTLGFWEPPLVLNTVVTLLFVLCCAAIAYIALTAPHRPRVAQLTF
FT                   LTVASFLLVNKVWSPQFSLWLVPLAVLALPHRRILLAWMTIDALVWVPRMYYLYGNPSR
FT                   SLPEQWFTTTVLLRDIAVMVLCGLVVWQIYRPGRDLVRTGGPGALPACGGVDDPVGGVF
FT                   ANAADAPPGRLPSWLRPRLGDEHARERTPDAGRDRTFSGQHRA"
FT   gene            58768..59331
FT                   /locus_tag="MRA_0055"
FT   CDS_pept        58768..59331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0055"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71773"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYC3"
FT                   /protein_id="ABQ71773.1"
FT                   /translation="MPSFDVVFVGHRRGEVRSDNAMLGLLCDAAFDELTRPDVVIFPGG
FT                   IGTRTLIHDQTVLDWVREAHRHTLLTTSVCTGGLVLAAAGLLNGLTATTHWRVQDLFNS
FT                   LGARYVPQRVVEHLPERVITAAGVSSGIDMGLRLVELLVSREAAEASQLMIEYDPQPPV
FT                   DAGSLAKASPATHRLALEFYQHRL"
FT   gene            59550..59840
FT                   /gene="rpsF"
FT                   /locus_tag="MRA_0056"
FT   CDS_pept        59550..59840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="MRA_0056"
FT                   /product="30S ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71774"
FT                   /db_xref="GOA:A5TYC4"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TYC4"
FT                   /protein_id="ABQ71774.1"
FT                   /translation="MRPYEIMVILDPTLDERTVAPSLETFLNVVRKDGGKVEKVDIWGK
FT                   RRLAYEIAKHAEGIYVVIDVKAAPATVSELDRQLSLNESVLRTKVMRTDKH"
FT   gene            59944..60438
FT                   /gene="ssb"
FT                   /locus_tag="MRA_0057"
FT   CDS_pept        59944..60438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="MRA_0057"
FT                   /product="single-strand DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71775"
FT                   /db_xref="GOA:A5TYC5"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYC5"
FT                   /protein_id="ABQ71775.1"
FT                   /translation="MAGDTTITIVGNLTADPELRFTPSGAAVANFTVASTPRIYDRQTG
FT                   EWKDGEALFLRCNIWREAAENVAESLTRGARVIVSGRLKQRSFETREGEKRTVIEVEVD
FT                   EIGPSLRYATAKVNKASRSGGFGSGSRPAPAQTSSASGDDPWGSAPASGSFGGGDDEPP
FT                   F"
FT   gene            60480..60734
FT                   /gene="rpsR1"
FT                   /locus_tag="MRA_0058"
FT   CDS_pept        60480..60734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR1"
FT                   /locus_tag="MRA_0058"
FT                   /product="30S ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71776"
FT                   /db_xref="GOA:A5TYC6"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TYC6"
FT                   /protein_id="ABQ71776.1"
FT                   /translation="MAKSSKRRPAPEKPVKTRKCVFCAKKDQAIDYKDTALLRTYISER
FT                   GKIRARRVTGNCVQHQRDIALAVKNAREVALLPFTSSVR"
FT   gene            60767..61225
FT                   /gene="rplI"
FT                   /locus_tag="MRA_0059"
FT   CDS_pept        60767..61225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="MRA_0059"
FT                   /product="50S ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71777"
FT                   /db_xref="GOA:A5TYC7"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TYC7"
FT                   /protein_id="ABQ71777.1"
FT                   /translation="MKLILTADVDHLGSIGDTVEVKDGYGRNFLLPRGLAIVASRGAQK
FT                   QADEIRRARETKSVRDLEHANEIKAAIEALGPIALPVKTSADSGKLFGSVTAADVVAAI
FT                   KKAGGPNLDKRIVRLPKTHIKAVGTHFVSVHLHPEIDVEVSLDVVAQS"
FT   gene            61254..61775
FT                   /locus_tag="MRA_0059A"
FT   CDS_pept        61254..61775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0059A"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0059A"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71778"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYC8"
FT                   /protein_id="ABQ71778.1"
FT                   /translation="MPVVTAVGRRRGFAMPWVSTARSGAVMLANYSAGVCGRVSSPGLN
FT                   VRKMCLKANTPGAVTWLDTPKRFLSTQTASRCMAVNSSDVVTGRIDPQVLHTPLNTDVD
FT                   GYAHAMHSSINSGPLEYLPATFSVFPALGDVGDLGGGVGAATYALDRLSNMRSGACVGG
FT                   GESPWRSLMT"
FT   gene            61754..64378
FT                   /gene="dnaB"
FT                   /locus_tag="MRA_0060"
FT   CDS_pept        61754..64378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="MRA_0060"
FT                   /product="replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71779"
FT                   /db_xref="GOA:A5TYC9"
FT                   /db_xref="InterPro:IPR003586"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR004860"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR006142"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYC9"
FT                   /protein_id="ABQ71779.1"
FT                   /translation="MAVVDDLAPGMDSSPPSEDYGRQPPQDLAAEQSVLGGMLLSKDAI
FT                   ADVLERLRPGDFYRPAHQNVYDAILDLYGRGEPADAVTVAAELDRRGLLRRIGGAPYLH
FT                   TLISTVPTAANAGYYASIVAEKALLRRLVEAGTRVVQYGYAGAEGADVAEVVDRAQAEI
FT                   YDVADRRLSEDFVALEDLLQPTMDEIDAIASSGGLARGVATGFTELDEVTNGLHPGQMV
FT                   IVAARPGVGKSTLGLDFMRSCSIRHRMASVIFSLEMSKSEIVMRLLSAEAKIKLSDMRS
FT                   GRMSDDDWTRLARRMSEISEAPLFIDDSPNLTMMEIRAKARRLRQKANLKLIVVDYLQL
FT                   MTSGKKYESRQVEVSEFSRHLKLLAKELEVPVVAISQLNRGPEQRTDKKPMLADLRESG
FT                   CLTASTRILRADTGAEVAFGELMRSGERPMVWSLDERLRMVARPMINVFPSGRKEVFRL
FT                   RLASGREVEATGSHPFMKFEGWTPLAQLKVGDRIAAPRRVPEPIDTQRMPESELISLAR
FT                   MIGDGSCLKNQPIRYEPVDEANLAAVTVSAAHSDRAAIRDDYLAARVPSLRPARQRLPR
FT                   GRCTPIAAWLAGLGLFTKRSHEKCVPEAVFRAPNDQVALFLRHLWSAGGSVRWDPTNGQ
FT                   GRVYYGSTSRRLIDDVAQLLLRVGIFSWITHAPKLGGHDSWRLHIHGAKDQVRFLRHVG
FT                   VHGAEAVAAQEMLRQLKGPVRNPNLDSAPKKVWAQVRNRLSAKQMMDIQLHEPTMWKHS
FT                   PSRSRPHRAEARIEDRAIHELARGDAYWDTVVEITSIGDQHVFDGTVSGTHNFVANGIS
FT                   LHNSLEQDADVVILLHRPDAFDRDDPRGGEADFILAKHRNGPTKTVTVAHQLHLSRFAN
FT                   MAR"
FT   gene            64558..65250
FT                   /locus_tag="MRA_0061"
FT   CDS_pept        64558..65250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71780"
FT                   /db_xref="InterPro:IPR029494"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYD0"
FT                   /protein_id="ABQ71780.1"
FT                   /translation="MITRYKPESGFVARSGGPDRKRPHDWIVWHFTHADNLPGIITAGR
FT                   LLADSAVTPTTEVAYNPVKELRRHKVVAPDSRYPASMASDHVPFYIAARSPMLYVVCKG
FT                   HSGYSGGAGPLVHLGVALGDIIDADLTWCASDGNAAASYTKFSRQVDTLGTFVDFDLLC
FT                   QRQWHNTDDDPNRQSRRAAEILVYGHVPFELVSYVCCYNTETMTRVRTLLDPVGGVRKY
FT                   VIKPGMYY"
FT   gene            65267..66325
FT                   /locus_tag="MRA_0062"
FT   CDS_pept        65267..66325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71781"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYD1"
FT                   /protein_id="ABQ71781.1"
FT                   /translation="MITYGSGDLLRADTEALVNTVNCVGVMGKGIALQFKRRYPEMFTA
FT                   YEKACKRGEVTIGKMFVVDTGQLDGPKHIINFPTKKHWRAPSKLAYIDAGLIDLIRVIR
FT                   ELNIASVAVPPLGVGNGGLDWEDVEQRLVSAFQQLPDVDAVIYPPSGGSRAIEGVEGLR
FT                   MTWGRAVILEAMRRYLQQRRAMEPWEDPAGISHLEIQKLMYFANEADPDLALDFTPGRY
FT                   GPYSERVRHLLQGMEGAFTVGLGDGTARVLANQPISLTTKGTDAITDYLATDAAADRVS
FT                   AAVDTVLRVIEGFEGPYGVELLASTHWVATREGAKEPATAAAAVRKWTKRKGRIYSDDR
FT                   IGVALDRILMTA"
FT   gene            66349..66774
FT                   /locus_tag="MRA_0063"
FT   CDS_pept        66349..66774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71782"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYD2"
FT                   /protein_id="ABQ71782.1"
FT                   /translation="MCADAQPSGSVGLLGRNCPTATTRWRRAGEGLTAADTIEVKLWAG
FT                   KPRLHPLVPKRAVGVLLAVAHGQVAKTPSATRAIAFRHVRLMRVRWICAGNRGRKHKRR
FT                   CTTQYRSTQASKLQLHFKLRQTLNRLGGLQAMVSACG"
FT   gene            66910..68052
FT                   /gene="celA1"
FT                   /locus_tag="MRA_0064"
FT   CDS_pept        66910..68052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="celA1"
FT                   /locus_tag="MRA_0064"
FT                   /product="cellulase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71783"
FT                   /db_xref="GOA:A5TYD3"
FT                   /db_xref="InterPro:IPR016288"
FT                   /db_xref="InterPro:IPR036434"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYD3"
FT                   /protein_id="ABQ71783.1"
FT                   /translation="MTRRTGQRWRGTLPGRRPWTRPAPATCRRHLAFVELRHYFARVMS
FT                   SAIGSVARWIVPLLGVAAVASIGVIADPVRVVRAPALILVDAANPLAGKPFYVDPASAA
FT                   MVAARNANPPNAELTSVANTPQSYWLDQAFPPATVGGTVARYTGAAQAAGAMPVLTLYG
FT                   IPHRDCGSYASGGFATGTDYRGWIDAVASGLGSSPATIIVEPDALAMADCLSPDQRQER
FT                   FDLVRYAVDTLTRDPAAAVYVDAGHSRWLSAEAMAARLNDVGVGRARGFSLNVSNFYTT
FT                   DEEIGYGEAISGLTNGSHYVIDTSRNGAGPAPDAPLNWCNPSGRALGAPPTTATAGAHA
FT                   DAYLWIKRPGESDGTCGRGEPQAGRFVSQYAIDLAHNAGQ"
FT   gene            68281..69720
FT                   /locus_tag="MRA_0065"
FT   CDS_pept        68281..69720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0065"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71784"
FT                   /db_xref="GOA:A5TYD4"
FT                   /db_xref="InterPro:IPR006093"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYD4"
FT                   /protein_id="ABQ71784.1"
FT                   /translation="MAREISRQTFLRGAAGALAAGAVFGSVRATADPAASGWEALSSAL
FT                   GGKVLQPDDGPQFATAKQVFNTNYNGYTPAVIVTPTSQLDVQKAMAFAAANNLKVAPRG
FT                   GGHSYVGASTANGAMVLDLRQLPGDINYDATTGRVTVTPATGLYAMHQVLAAAGRGIPT
FT                   GTCPTVGVAGHALGGGLGANSRHAGLLCDQLTSASVVLPSGQAVTASATDHPDLFWALR
FT                   GGGGGNFGVTTSLTFATFPSGDLDVVNLNFPPQSFAQVLVGWQNWLRTADRGSWALADA
FT                   TVDPLGTHCRILATCPAGSGGSVAAAIVSAVGTQPTGTENHTFNYLDLVRYLAVGNLNP
FT                   SPLGYVGGSDVFTTITPATAQGIASAVDAFPRGAGRMLAIMHALDGALATVSPGATAFP
FT                   WRRQSALVQWYVETSGSPSEATSWLNTAHQAVRAYSVGGYVNYLEVNQPPARYFGPNLS
FT                   RLSAVRQKYDPSRVMFSGLNF"
FT   gene            69978..72917
FT                   /locus_tag="MRA_0066"
FT   CDS_pept        69978..72917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71785"
FT                   /db_xref="GOA:A5TYD5"
FT                   /db_xref="InterPro:IPR005372"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TYD5"
FT                   /protein_id="ABQ71785.1"
FT                   /translation="METGSPGKRPVLPKRARLLVTAGMGMLALLLFGPRLVDIYVDWLW
FT                   FGEVGFRSVWITVLLTRLAIVAAVALVVAGIVLAALLLAYRSRPFFVPDEPQRDPVAPL
FT                   RSAVMRRPRLFGWGIAVTLGVVCGLIASFDWVKVQLFVHGGTFGIVDPEFGYDIGFFVF
FT                   DLPFYRSVLNWLFVAVVLAFLASLLTHYLFGGLRLTTGRGMLTQAARVQLAVFAGAVVL
FT                   LKAVAYWLDRYELLSSGRKEPTFTGAGYTDIHAELPAKLVLVAIAVLCAVSFFTAIFLR
FT                   DLRIPAMAAALLVLSAILVGGLWPLLMEQFSVRPNAADVERPYIQRNIEATREAYRIGG
FT                   DWVQYRSYPGIGTKQPRDVPVDVTTIAKVRLLDPHILSRTFTQQQQLKNFFSFAEILDI
FT                   DRYRIDGELQDYIVGVRELSPKSLTGNQTDWINKHTVYTHGNGFVAAPANRVNAAARDA
FT                   ENISDSNSGYPIYAVSDIASLGSGRQVIPVEQPRVYYGEVIAQADPDYAIVGGAPGSAP
FT                   REYDTDTSKYTYTGAGGVSIGNWFNRTVFATKVAQHKFLFSREIGSESKVLIHRDPKER
FT                   VQRVAPWLTTDDNPYPVVVNGRIVWIVDAYTTLDTYPYAQRSSLEGPVTSPTGIVRQGK
FT                   QVSYVRNSVKATVDAYDGTVTLFQFDRDDPVLRTWMRAFPGTVKSEDQIPDELRAHFRY
FT                   PEDLFEVQRSLLAKYHVDEPREFFTTNAFWSVPSDPTNNANATQPPFYVLVGDQQSAQP
FT                   SFRLASAMVGYNREFLSAYISAHSDPANYGKLTVLELPTDTLTQGPQQIQNSMISDTRV
FT                   ASERTLLERSNRIHYGNLLSLPIADGGVLYVEPLYTERISTSPSSSTFPQLSRVLVSVR
FT                   EPRTEGGVRVGYAPTLAESLDQVFGPGTGRVATARGGDAASAPPPGAGGPAPPQAVPPP
FT                   RTTQPPAAPPRGPDVPPATVAELRETLADLRAVLDRLEKAIDAAETPGG"
FT   gene            73179..73580
FT                   /locus_tag="MRA_0067"
FT   CDS_pept        73179..73580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71786"
FT                   /db_xref="GOA:A5TYD6"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYD6"
FT                   /protein_id="ABQ71786.1"
FT                   /translation="MDECVVDAAAVVDALAGKGASAIVLRGLLKESISNAPHLLDAEVG
FT                   HALRRAVLSDEISEEQARAALDALPYLIDNRYPHSPRLIEYTWQLRHNVTFYDALYVAL
FT                   ATALDVPLLTGDSRLAAAPGLPCEIKLVR"
FT   gene            complement(73632..75869)
FT                   /gene="icd2"
FT                   /locus_tag="MRA_0068"
FT   CDS_pept        complement(73632..75869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icd2"
FT                   /locus_tag="MRA_0068"
FT                   /product="isocitrate dehydrogenase (NADP) Icd2"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71787"
FT                   /db_xref="GOA:A5TYD7"
FT                   /db_xref="InterPro:IPR004436"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYD7"
FT                   /protein_id="ABQ71787.1"
FT                   /translation="MSAEQPTIIYTLTDEAPLLATYAFLPIVRAFAEPAGIKIEASDIS
FT                   VAARILAEFPDYLTEEQRVPDNLAELGRLTQLPDTNIIKLPNISASVPQLVAAIKELQD
FT                   KGYAVPDYPADPKTDQEKAIKERYARCLGSAVNPVLRQGNSDRRAPKAVKEYARKHPHS
FT                   MGEWSMASRTHVAHMRHGDFYAGEKSMTLDRARNVRMELLAKSGKTIVLKPEVPLDDGD
FT                   VIDSMFMSKKALCDFYEEQMQDAFETGVMFSLHVKATMMKVSHPIVFGHAVRIFYKDAF
FT                   AKHQELFDDLGVNVNNGLSDLYSKIESLPASQRDEIIEDLHRCHEHRPELAMVDSARGI
FT                   SNFHSPSDVIVDASMPAMIRAGGKMYGADGKLKDTKAVNPESTFSRIYQEIINFCKTNG
FT                   QFDPTTMGTVPNVGLMAQQAEEYGSHDKTFEIPEDGVANIVDVATGEVLLTENVEAGDI
FT                   WRMCIVKDAPIRDWVKLAVTRARISGMPVLFWLDPYRPHENELIKKVKTYLKDHDTEGL
FT                   DIQIMSQVRSMRYTCERLVRGLDTIAATGNILRDYLTDLFPILELGTSAKMLSVVPLMA
FT                   GGGMYETGAGGSAPKHVKQLVEENHLRWDSLGEFLALGAGFEDIGIKTGNERAKLLGKT
FT                   LDAAIGKLLDNDKSPSRKTGELDNRGSQFYLAMYWAQELAAQTDDQQLAEHFASLADVL
FT                   TKNEDVIVRELTEVQGEPVDIGGYYAPDSDMTTAVMRPSKTFNAALEAVQG"
FT   gene            complement(75987..76556)
FT                   /locus_tag="MRA_0069"
FT   CDS_pept        complement(75987..76556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0069"
FT                   /product="TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71788"
FT                   /db_xref="GOA:A5TYD8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYD8"
FT                   /protein_id="ABQ71788.1"
FT                   /translation="MAPTDRRVRADAARNRARVLEVAYQTFAADGLSVPVDEIARRAGV
FT                   GAGTVYRHFPTKEALFQAVIADRMHRIIDKGHALLKSKHPGDALFAFLRSMVLQWGATD
FT                   RGLVEALAGVGIEISSAAPEAEADFLDLLTDLLRAAQRAGTVRPDVDVLEVKTLLVGCQ
FT                   AMQSYNAELAAKVTDVALDGLRANRK"
FT   gene            76659..77570
FT                   /locus_tag="MRA_0070"
FT   CDS_pept        76659..77570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0070"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71789"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYD9"
FT                   /protein_id="ABQ71789.1"
FT                   /translation="MTKWTAADIPDQTGRTAVITGANTGLGFETAAALAAHGAHVVLAV
FT                   RNLDKGKQAAARITEATPGAEVELQELDLTSLASVRAAAAQLKSDHQRIDLLINNAGVM
FT                   YTPRQTTADGFEMQFGTNHLGHFALTGLLIDRLLPVAGSRVVTISSVGHRIRAAIHFDD
FT                   LQWERRYRRVAAYGQAKLANLLFTYELQRRLAPGGTTIAVASHPGVSNTEVVRNMPRPL
FT                   VAVAAILAPLMQDAELGALPTLRAATDPAVRGGQYFGPDGFGEIRGYPKVVASSAQSHD
FT                   EQLQRRLWAVSEELTGVVYPVG"
FT   gene            complement(77595..78980)
FT                   /gene="sdaA"
FT                   /locus_tag="MRA_0071"
FT   CDS_pept        complement(77595..78980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdaA"
FT                   /locus_tag="MRA_0071"
FT                   /product="L-serine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71790"
FT                   /db_xref="GOA:A5TYE0"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYE0"
FT                   /protein_id="ABQ71790.1"
FT                   /translation="MTISVFDLFTIGIGPSSSHTVGPMRAANQFVVALRRRGHLDDLEA
FT                   MRVDLFGSLAATGAGHGTMSAILLGLEGCQPETITTEHKERRLAEIAASGVTRIGGVIP
FT                   VPLTERDIDLHPDIVLPTHPNGMTFTAAGPHGRVLATETYFSVGGGFIVTEQTSGNSGQ
FT                   HPCSVALPYVSAQELLDICDRLDVSISEAALRNETCCRTENEVRAALLHLRDVMVECEQ
FT                   RSIAREGLLPGGLRVRRRAKVWYDRLNAEDPTRKPEFAEDWVNLVALAVNEENASGGRV
FT                   VTAPTNGAAGIVPAVLHYAIHYTSAGAGDPDDVTVRFLLTAGAIGSLFKERASISGAEV
FT                   GCQGEVGSAAAMAAAGLAEILGGTPRQVENAAEIAMEHSLGLTCDPIAGLVQIPCIERN
FT                   AISAGKAINAARMALRGDGIHRVTLDQVIDTMRATGADMHTKYKETSAGGLAINVAVNI
FT                   VEC"
FT   gene            complement(78977..80254)
FT                   /gene="glyA2"
FT                   /locus_tag="MRA_0072"
FT   CDS_pept        complement(78977..80254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA2"
FT                   /locus_tag="MRA_0072"
FT                   /product="serine hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71791"
FT                   /db_xref="GOA:A5TYE1"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYE1"
FT                   /protein_id="ABQ71791.1"
FT                   /translation="MNTLNDSLTAFDPDIAALIDGELRRQESGLEMIASENYAPLAVMQ
FT                   AQGSVLTNKYAEGYPGRRYYGGCEFVDGVEQLAIDRVKALFGAEYANVQPHSGATANAA
FT                   TMHALLNPGDTILGLSLAHGGHLTHGMRINFSGKLYHATAYEVSKEDYLVDMDAVAEAA
FT                   RTHRPKMIIAGWSAYPRQLDFARFRAIADEVDAVLMVDMAHFAGLVAAGVHPSPVPHAH
FT                   VVTSTTHKTLGGPRGGIILCNDPAIAKKINSAVFPGQQGGPLEHVIAAKATAFKMAAQP
FT                   EFAQRQQRCLDGARILAGRLTQPDVAERGIAVLTGGTDVHLVLVDLRDAELDGQQAEDR
FT                   LAAVDITVNRNAVPFDPRPPMITSGLRIGTPALAARGFSHNDFRAVADLIAAALTATND
FT                   DQLGPLRAQVQRLAARYPLYPELHRT"
FT   gene            80844..81551
FT                   /locus_tag="MRA_0073"
FT   CDS_pept        80844..81551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0073"
FT                   /product="putative maturase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71792"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYE2"
FT                   /protein_id="ABQ71792.1"
FT                   /translation="MSSITVSVDPVDPVDPVDPVDPVDAVVAAGSDGLTVARIESEIGA
FT                   LEFLNELRTELKSGQFRPQPVRERKIPKPGGLGKVRRLGIPTVADRVVQAALKLVLEPI
FT                   FETDFEPVSYGFRPARRAHDTIAEIHLFGTQEYRWVLDADIKACFDRIDHADLMDRVRH
FT                   RIKDKRVLRLVNWQRIRHRWNWTDVRRWLTDPTGRWHPISADGITLFNPAAVPIRRYRY
FT                   RGNTIPTPWTQAV"
FT   gene            81982..83031
FT                   /locus_tag="MRA_0074"
FT   CDS_pept        81982..83031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0074"
FT                   /product="putative glutamine-transport transmembrane
FT                   protein ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71793"
FT                   /db_xref="GOA:A5TYE3"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYE3"
FT                   /protein_id="ABQ71793.1"
FT                   /translation="MLFAALRDMQWRKRRLVITIISTGLIFGMTLVLTGLANGFRVEAR
FT                   HTVDSMGVDVFVVRSGAAGPFLGSIPFPDVDLARVAAEPGVMAAAPLGSVGTIMKEGTS
FT                   TRNVTVFGAPEHGPGMPRVSEGRSPSKPDEVAASSTMGRHLGDTVEVGARRLRVVGIVP
FT                   NSTALAKIPNVFLTTEGLQKLAYNGQPNITSIGIIGMPRQLPEGYQTFDRVGAVNDLVR
FT                   PLKVAVNSISIVAVLLWIVAVLIVGSVVYLSALERLRDFAVFKAIGTPTRSIMAGLALQ
FT                   ALVIALLAAVVGVVLAQVLAPLFPMIVAVPVGAYLALPVAAIVIGLFASVAGLKRVVTV
FT                   DPAQAFGGP"
FT   gene            83034..84026
FT                   /gene="glnQ1"
FT                   /locus_tag="MRA_0075"
FT   CDS_pept        83034..84026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnQ1"
FT                   /locus_tag="MRA_0075"
FT                   /product="glutamine-transport ATP-binding protein ABC
FT                   transporter GlnQ"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71794"
FT                   /db_xref="GOA:A5TYE4"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYE4"
FT                   /protein_id="ABQ71794.1"
FT                   /translation="MGDLSIQNLVVEYYSGGYALRPINGLNLDVAAGSLVMLLGPSGCG
FT                   KTTLLSCLGGILRPKSGAIKFDEVDITTLQGAELANYRRNKVGIVFQAFNLVPSLTAVE
FT                   NVMVPLRSAGMSRRASRRRAEELLARVNLAERMNHRPGDLSGGQQQRVAVARAIALDPP
FT                   LILADEPTAHLDFIQVEEVLRLIRELADGERVVVVATHDSRMLPMADRVVELTPDFAET
FT                   NRPPETVHLQAGEVLFEQSTMGDLIYVVSEGEFEIVHELADGGEELVKVAGPGDYFGEI
FT                   GVLFHLPRSATVRARSDATAVGYTVQAFRERLGVGGLRDLIEHRALAND"
FT   gene            84106..85341
FT                   /locus_tag="MRA_0076"
FT   CDS_pept        84106..85341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71795"
FT                   /db_xref="GOA:A5TYE5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYE5"
FT                   /protein_id="ABQ71795.1"
FT                   /translation="MGDLSISQVSARPGRIGIRARQMFDGYRFQRGPVLVVVEDGRISA
FT                   VDFAGSACPDMNLVDLGESTLLPGLVDAHAHLCWDPDGRPEDLAGDPHAVLVGRARRHA
FT                   AAALRSGITTIRDLGDRDYAALALREEYRQKTTVGPELVVSGPPLTRSGGHCWFLGGVA
FT                   DSVEELVDAVQERAARGADWIKVMATGGFVTTASDPWQPQYGSGQLAAVVAAAEQVGLP
FT                   VTAHAHATAGIAAAVAAGVDGIEHCTFLSEGSAAASPDVVEAIVAQGVWCGMTIPRVYP
FT                   EMPENLVAVVQDGWRNIRRLIDAGARVALSTDAGVAPGRRHDVLPDDLVYLSRHGFTST
FT                   EVLTGATAAAAASCGLGHRKGRIAPGYDADLLAVAAGVDHDPAGLCDVKAVWRSGTQVP
FT                   LQASAVGYNTPS"
FT   gene            85354..86526
FT                   /locus_tag="MRA_0077"
FT   CDS_pept        85354..86526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0077"
FT                   /product="putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71796"
FT                   /db_xref="GOA:A5TYE6"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYE6"
FT                   /protein_id="ABQ71796.1"
FT                   /translation="MQDSIFNLLTEEQLRGRNTLKWNYFGPDVVPLWLAEMDFPTAPAV
FT                   LDGVRACVDNEEFGYPPLGEDSLPRATADWCRQRYGWCPRPDWVRVVPDVLKGMEVVVE
FT                   FLTRPESPVALPVPAYMPFFDVLHVTGRQRVEVPMVQQDSGRYLLDLDALQAAFVRGAG
FT                   SVIICNPNNPLGTAFTEAELRAIVDIAARHGARVIADEIWAPVVYGSRHVAAASVSEAA
FT                   AEVVVTLVSASKGWNLPGLMCAQVILSNRRDAHDWDRINMLHRMGASTVGIRANIAAYH
FT                   HGESWLDELLPYLRANRDHLARALPELAPGVEVNAPDGTYLSWVDFRALALPSEPAEYL
FT                   LSKAKVALSPGIPFGAAVGSGFARLNFATTRAILDRAIEAIAAALRDIID"
FT   gene            complement(86541..86930)
FT                   /locus_tag="MRA_0078"
FT   CDS_pept        complement(86541..86930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0078"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71797"
FT                   /db_xref="GOA:A5TYE7"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYE7"
FT                   /protein_id="ABQ71797.1"
FT                   /translation="MPAVTTPSNHWGDERRKLSHQPPVRGQILGRRQARRLSQHFARVG
FT                   VEAPPKRLQEMLLGAPAADEEWTDVKFALIVTQLNHEKRVAKFHRLQRRATHSLICLGL
FT                   VLVALNFLICLAYIFFSLTQHAAAL"
FT   gene            complement(86994..87824)
FT                   /locus_tag="MRA_0079"
FT   CDS_pept        complement(86994..87824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0079"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71798"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYE8"
FT                   /protein_id="ABQ71798.1"
FT                   /translation="MSTIDISAGTIHYEATGPETGRPVVFVHGYMMGGQLWRRVSERLA
FT                   GRGLRCIAPTWPLGAHPKPLRPGADQTIGGVAGIVADVLAALELKDVVLVGNDTGGVVT
FT                   QLVAVHYPERLGALVLTSCDAFEHFPPPILKPVILAAKSATLFRAAIQVMRAPAARNRA
FT                   YAGLSHHNIDHLTRAWVRPALSNPAIAEDLRQLSLSLRTEVTTAVAARLPEFDKPALIA
FT                   WSADDVFFALENGQRLAATIPRARFEVIEGARTFSMVDSPDRLADQLSTVAVRT"
FT   gene            87886..88491
FT                   /locus_tag="MRA_0080"
FT   CDS_pept        87886..88491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0080"
FT                   /product="putative transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71799"
FT                   /db_xref="GOA:A5TYE9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYE9"
FT                   /protein_id="ABQ71799.1"
FT                   /translation="MEIKRRTQEERSAATREALITGARKLWGLRGYAEVGTPEIATEAG
FT                   VTRGAMYHQFADKAALFRDVVEVVEQDVMARMATLVAASGAATPADAIRAAVDAWLEVS
FT                   GDPEVRQLILLDAPVVLGWAGFRDVAQRYSLGMTEQLITEAIRAGQLARQPVRPLAQVL
FT                   IGALDEAAMFIATADDPKRARRETRQVLRRLIDGMLNG"
FT   gene            complement(88566..89159)
FT                   /locus_tag="MRA_0081"
FT   CDS_pept        complement(88566..89159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71800"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYF0"
FT                   /protein_id="ABQ71800.1"
FT                   /translation="MNAVESTLRRVAKDLTGLRQRWALVGGFAVSARSEPRFTRDVDIV
FT                   VAVANDDAAESLVRQLLTQQYHLLASVEQDAARRLAAVRLGATADTAANVVVDLLFASC
FT                   GIEPEIAEAAEEIEILPDLVAPVATTAHLIAMKLLARDDDRRPQDRSDLRALVDAASPQ
FT                   DIQDARKAIELITLRGFHRDRDLAAEWTRLAAKW"
FT   gene            complement(89156..89362)
FT                   /locus_tag="MRA_0082"
FT   CDS_pept        complement(89156..89362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71801"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYF1"
FT                   /protein_id="ABQ71801.1"
FT                   /translation="MAVSVAAQKLRLALDMYEVGEQMQRMRLGRERPNADVVEIEAAID
FT                   AWRMTRPGAEEGDSAGPTSTRFT"
FT   gene            89562..90383
FT                   /locus_tag="MRA_0083"
FT   CDS_pept        89562..90383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71802"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYF2"
FT                   /protein_id="ABQ71802.1"
FT                   /translation="MEPKRSRLVVCAPEPSHAREFPDVAVFSGGRANASQAERLARAVG
FT                   RVLADRGVTGGARVRLTMANCADGPTLVQINLQVGDTPLRAQAATAGIDDLRPALIRLD
FT                   RQIVRASAQWCPRPWPDRPRRRLTTPAEALVTRRKPVVLRRATPLQAIAAMDAMDYDVH
FT                   LFTDAETGEDAVVYRAGPSGLRLARQHHVFPPGWSRCRAPAGPPVPLIVNSRPTPVLTE
FT                   AAAVDRAREHGLPFLFFTDQATGRGQLLYSRYDGNLGLITPTGDGVADGLA"
FT   gene            90380..90838
FT                   /locus_tag="MRA_0084"
FT   CDS_pept        90380..90838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71803"
FT                   /db_xref="GOA:A5TYF3"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYF3"
FT                   /protein_id="ABQ71803.1"
FT                   /translation="MSPGSRRASPQSAREVVELDRDEAMRLLASVDHGRVVFTRAALPA
FT                   IRPVNHLVVDGRVIGRTRLTAKVSVAVRSSADAGVVVAYEADDLDPRRRTGWSVVVTGL
FT                   ATEVSDPEQVARYQRLLHPWVNMAMDTVVAIEPEIVTGIRIVADSRTP"
FT   gene            90933..91277
FT                   /locus_tag="MRA_0085"
FT   CDS_pept        90933..91277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0085"
FT                   /product="putative transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71804"
FT                   /db_xref="GOA:A5TYF4"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYF4"
FT                   /protein_id="ABQ71804.1"
FT                   /translation="MESEPLYKLKAEFFKTLAHPARIRILELLVERDRSVGELLSSDVG
FT                   LESSNLSQQLGVLRRAGVVAARRDGNAMIYSIAAPDIAELLAVARKVLARVLSDRVAVL
FT                   EDLRAGGSAT"
FT   gene            91282..91761
FT                   /locus_tag="MRA_0086"
FT   CDS_pept        91282..91761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0086"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71805"
FT                   /db_xref="GOA:A5TYF5"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYF5"
FT                   /protein_id="ABQ71805.1"
FT                   /translation="MGWVAKIFRVGRVVEPAAPLPAAIAEPPAGVRGSLQIRHVDAGSC
FT                   NGCEVEISGAFGPVYDAERFGARLVASPRHADALLVTGVVTHNMAGPLRKTLEATPRPR
FT                   VVIACGDCALNRGVFADAYGVVGAVGEVVPVDVEIAGCPPTPAAIMAALRSVTGK"
FT   gene            91758..93680
FT                   /locus_tag="MRA_0087"
FT   CDS_pept        91758..93680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0087"
FT                   /product="putative NADH-ubiquinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71806"
FT                   /db_xref="GOA:A5TYF6"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYF6"
FT                   /protein_id="ABQ71806.1"
FT                   /translation="MTAAPTAGGVVTSGVGVAGVGVGLLGMFGPVRVVHVGWLLPLSGV
FT                   HIELDRLGGFFMALTGAVAAPVGCYLIGYVRREHLGRVPMAVVPLFVAAMLLVPAAGSV
FT                   TTFLLAWELMAIASLILVLSEHARPQVRSAGLWYAVMTQLGFIAILVGLVVLAAAGGSD
FT                   RFAGLGAVCDGVRAAVFMLTLVGFGSKAGLVPLHAWLPRAHPEAPSPVSALMSAAMVNL
FT                   GIYGIVRFDLQLLGPGPRWWGLALLAVGGTSALYGVLQASVAADLKRLLAYSTTENMGL
FT                   ITLALGAATLFADTGAYGPASIAAAAAMLHMIAHAAFKSLAFMAAGSVLAATGLRDLDL
FT                   LGGLARRMPATTVFFGVAALGACGLPLGAGFVSEWLLVQSLIHAAPGHDPIVALTTPLA
FT                   VGVVALATGLSVAAMTKAFGIGFLARPRSTQAEAAREAPASMRAGMAIAAGACLVLAVA
FT                   PLLVAPMVRRAAATLPAAQAVKFTGLGAVVRLPAMSGSIAPGVIAAAVLAAALAVAVLA
FT                   RWRFRRRPAPARLPLWACGAADLTVRMQYTATSFAEPLQRVFGDVLRPDTDIEVTHTAE
FT                   SRYMAERITYRTAVADAIEQRLYTPVVGAVAAMAELLRRAHTGSVHRYLAYGALGVLIV
FT                   LVVAR"
FT   gene            93686..94636
FT                   /gene="hycD"
FT                   /locus_tag="MRA_0088"
FT   CDS_pept        93686..94636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hycD"
FT                   /locus_tag="MRA_0088"
FT                   /product="formate hydrogenlyase HycD"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71807"
FT                   /db_xref="GOA:A5TYF7"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYF7"
FT                   /protein_id="ABQ71807.1"
FT                   /translation="MSYLAGAAQIGGVMVGAPLVIGMTRQVRARWEGRAGAGLLQPWRD
FT                   LLKQLGKQQITPAGTTIVFAAAPVIVAGTTLLIAAIAPLVATGSPLDPSADLFAVVGLL
FT                   FLGTVALTLAGIDTGTSFGGMGASREITIAALVEPTILLAVFALSIPAGSANLGALVAS
FT                   TIDHPGHVVSLAGVLAFVALVIVIVAETGRLPVDNPATHLELTMVHEAMVLEYAGPRLA
FT                   LVEWAAGMRLTVLLALLANLFLPWGIAGAAPTALDVLTGVVAVAAKVAILAVLLATFEV
FT                   FLAKLRLFRVPELLAGSFLLALLAVTAANFFTVGA"
FT   gene            94647..95309
FT                   /gene="hycP"
FT                   /locus_tag="MRA_0089"
FT   CDS_pept        94647..95309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hycP"
FT                   /locus_tag="MRA_0089"
FT                   /product="putative hydrogenase HycP"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71808"
FT                   /db_xref="GOA:A5TYF8"
FT                   /db_xref="InterPro:IPR038730"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYF8"
FT                   /protein_id="ABQ71808.1"
FT                   /translation="MSNANFSILVDFAAGGLVLASVLIVWRRDLRAIVRLLAWQGAALA
FT                   AIPLLRGIRDNDRALIAVGIAVLALRALVLPWLLARAVGAEAAAQREATPLVNTASSLL
FT                   ITAGLTLTAFAITQPVVNLEPGVTINAVPAAFAVVLIALFVMTTRLHAVSQAAGFLMLD
FT                   NGIAATAFLLTAGVPLIVELGASLDVLFAVIVIGVLTGRLRRIFGDADLDKLRELRD"
FT   gene            95309..96775
FT                   /gene="hycQ"
FT                   /locus_tag="MRA_0090"
FT   CDS_pept        95309..96775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hycQ"
FT                   /locus_tag="MRA_0090"
FT                   /product="putative hydrogenase HycQ"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71809"
FT                   /db_xref="GOA:A5TYF9"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYF9"
FT                   /protein_id="ABQ71809.1"
FT                   /translation="MTGLLLAAILAPLAASIASLITGWRRTTATLTALSATTVLACAVA
FT                   MGFWMGSGAQFGLGGLLRADALTVVMLVVIGIVGTLATAASIGYIDTELAHGHIDGRSA
FT                   RLYGVLTPAFLCAMVLAVCANNIGVIWVAIEATTVITAFLVGHRRTRTALEATWKYVVI
FT                   CSVGIAVAFLGTVLLYFAARDSGAAAAGALNLDILAEHAAGLDPGVARLAGGLLLIGYG
FT                   AKAGLFPFHTWLADAHSQAPAPVSALMSGVLLAVAFSVLIRLRPILDAVSGPAYLRNGL
FT                   LVVGLATLLVAVLMLTVTGDVKRMLAYSSMEHMGLIAIAAAAGTTLAIAALLLHVLAHG
FT                   IGKTVLFLAGGQLQAAHDSTAIADITGVMRRSRLIGVSFAVGLIVLLGLPPFAMFASEL
FT                   AIARSLANERLAWVLGAALLLIAIGFTALARNSGRMLLGTPAAGAPAITVPATAAAALM
FT                   VGIVVSAALGITAGPLADLLGIAASNVGLP"
FT   gene            96772..98250
FT                   /gene="hycE"
FT                   /locus_tag="MRA_0091"
FT   CDS_pept        96772..98250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hycE"
FT                   /locus_tag="MRA_0091"
FT                   /product="putative formate hydrogenase HycE"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71810"
FT                   /db_xref="GOA:A5TYG0"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR020396"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYG0"
FT                   /protein_id="ABQ71810.1"
FT                   /translation="MMSASWLRHRVSERGLIATAEQLWADSFRLALVAAHDDGDSLRVV
FT                   YLFLAGYPDRRVELEYVVPADNPEIRSLAYLSFPAGRFEREMADLYGIRPVGHPKPRRL
FT                   VRHAHWPDWHPMRTDAGPAPEFTDTGAFPFLAVEGPGVYEIPVGPVHAGLIEPGHFRFS
FT                   VAGETIVRLKARLWFVHRGIEKLFHGRPATAAVDLAERISGDTSAAHALAHSLAIEDAL
FT                   GIELPHEVHRLRALIVELERLYNHAADLGALANDVGYSLANAHAQRIRENLLRRNAAVT
FT                   GHRLLRGAIRAGGVALRALPDTDELAALAVDLAEVATLTLANSVVYDRFAGTAVLHPDD
FT                   ASALGCLGYVARASGLRSDARVEHPTIVLPITEIGAPDGDVLARYTVRRDEFAASAALA
FT                   QHIVESHTGPIEYAATLHPVGAPSSGIGIVEGWRGTIVHRVEIDVDGRITRAKVVDPSW
FT                   FNWPALPVAMADTIVPDFPLANKSFNQSYAGNDL"
FT   gene            98285..98959
FT                   /locus_tag="MRA_0092"
FT   CDS_pept        98285..98959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71811"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYG1"
FT                   /protein_id="ABQ71811.1"
FT                   /translation="MSVYKHAPSRVRLRQTRSTVVKGRSGSLSWRRVRTGDLGLAVWGG
FT                   REEYRAVKPGTPGIQPKGDMMTVTVVDAGPGRVSRSVEVAAPAAELFAIVADPRRHREL
FT                   DGSGTVRGNIKVPAKLVVGSKFSTKMKLFGLPYRITSRVTALKPNELVEWSHPLGHRWR
FT                   WEFESLSPTLTRVTETFDYHAAGAIKNGLKFYEMTGFAKSNAAGIEATLAKLSDQYARG
FT                   RA"
FT   gene            99116..99709
FT                   /locus_tag="MRA_0093"
FT   CDS_pept        99116..99709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0093"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71812"
FT                   /db_xref="GOA:A5TYG2"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYG2"
FT                   /protein_id="ABQ71812.1"
FT                   /translation="MDQPWNANIHYDALLDAMVPLGTQCVLDVGCGDGLLAARLARRIP
FT                   YVTAVDIDAPVLRRAQTRFANAPIRWLHADIMTAELPNAGFDAVVSNAALHHIEDTRTA
FT                   LSRLGGLVTPGGTLAVVTFVTPSLRNGLWHLTSWVACGMANRVKGKWEHSAPIKWPPPQ
FT                   TLHELRSHVRALLPGACIRRLLYGRVLVTWRAPV"
FT   gene            99838..100608
FT                   /locus_tag="MRA_0094"
FT   CDS_pept        99838..100608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0094"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71813"
FT                   /db_xref="GOA:A5TYG3"
FT                   /db_xref="InterPro:IPR014511"
FT                   /db_xref="InterPro:IPR021125"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYG3"
FT                   /protein_id="ABQ71813.1"
FT                   /translation="MAKNQNRIRNRWELITCGLGGHVTYAPDDAALAARLRASTGLGEV
FT                   WRCLRCGDFALGGPQGRGAPEDAPLIMRGKALRQAIIIRALGVERLVRALVLALAAWAV
FT                   WEFRGARGAIQATLDRDLPVLRAAGFKVDQMTVIHALEKALAAKPSTLALITGMLAAYA
FT                   VLQAVEGVGLWLLKRWGEYFAVVATSIFLPLEVHDLAKGITTTRVVTFSINVAAVVYLL
FT                   ISKRLFGVRGGRKAYDVERRGEQLLDLERAAMLT"
FT   gene            101042..101809
FT                   /gene="mtn"
FT                   /locus_tag="MRA_0095"
FT   CDS_pept        101042..101809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtn"
FT                   /locus_tag="MRA_0095"
FT                   /product="putative 5-methylthioadenosine
FT                   nucleosidase/S-adenosylhomocysteine nucleosidase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71814"
FT                   /db_xref="GOA:A5TYG4"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYG4"
FT                   /protein_id="ABQ71814.1"
FT                   /translation="MAVTVGVICAIPQELAYLRGVLVDAKRQQVAQILFDSGQLDAHRV
FT                   VLAAAGMGKVNTGLTATLLADRFGCRTIVFTGVAGGLDPELCIGDIVIADRVVQHDFGL
FT                   LTDERLRPYQPGHIPFIEPTERLGYPVDPAVIDRVKHRLDGFTLAPLSTAAGGGGRQPR
FT                   IYYGTILTGDQYLHCERTRNRLHHELGGMAVEMEGGAVAQICASFDIPWLVIRALSDLA
FT                   GADSGVDFNRFVGEVAASSARVLLRLLPVLTAC"
FT   gene            101941..104226
FT                   /gene="ctpA"
FT                   /locus_tag="MRA_0096"
FT   CDS_pept        101941..104226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctpA"
FT                   /locus_tag="MRA_0096"
FT                   /product="cation transporter p-type ATPase A"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71815"
FT                   /db_xref="GOA:A5TYG5"
FT                   /db_xref="InterPro:IPR000579"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYG5"
FT                   /protein_id="ABQ71815.1"
FT                   /translation="MTTAVTGEHHASVQRIQLRISGMSCSACAHRVESTLNKLPGVRAA
FT                   VNFGTRVATIDTSEAVDAAALCQAVRRAGYQADLCTDDGRSASDPDADHARQLLIRLAI
FT                   AAVLFVPVADLSVMFGVVPATRFTGWQWVLSALALPVVTWAAWPFHRVAMRNARHHAAS
FT                   METLISVGITAATIWSLYTVFGNHSPIERSGIWQALLGSDAIYFEVAAGVTVFVLVGRY
FT                   FEARAKSQAGSALRALAALSAKEVAVLLPDGSEMVIPADELKEQQRFVVRPGQIVAADG
FT                   LAVDGSAAVDMSAMTGEAKPTRVRPGGQVIGGTTVLDGRLIVEAAAVGADTQFAGMVRL
FT                   VEQAQAQKADAQRLADRISSVFVPAVLVIAALTAAGWLIAGGQPDRAVSAALAVLVIAC
FT                   PCALGLATPTAMMVASGRGAQLGIFLKGYKSLEATRAVDTVVFDKTGTLTTGRLQVSAV
FT                   TAAPGWEADQVLALAATVEAASEHSVALAIAAATTRRDAVTDFRAIPGRGVSGTVSGRA
FT                   VRVGKPSWIGSSSCHPNMRAARRHAESLGETAVFVEVDGEPCGVIAVADAVKDSARDAV
FT                   AALADRGLRTMLLTGDNPESAAAVATRVGIDEVIADILPEGKVDVIEQLRDRGHVVAMV
FT                   GDGINDGPALARADLGMAIGRGTDVAIGAADIILVRDHLDVVPLALDLARATMRTVKLN
FT                   MVWAFGYNIAAIPVAAAGLLNPLVAGAAMAFSSFFVVSNSLRLRKFGRYPLGCGTVGGP
FT                   QMTAPSSA"
FT   gene            complement(104173..105021)
FT                   /locus_tag="MRA_0097"
FT   CDS_pept        complement(104173..105021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0097"
FT                   /product="putative conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71816"
FT                   /db_xref="GOA:A5TYG6"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYG6"
FT                   /protein_id="ABQ71816.1"
FT                   /translation="MLAQATTAGSFNHHASTVLQGCRGVPAAMWSEPAGAIRRHCATID
FT                   GMDCEVAREALSARLDGERAPVPSARVDEHLGECSACRAWFTQVASQAGDLRRLAESRP
FT                   VVPPVGRLGIRRAPRRQHSPMTWRRWALLCVGIAQIALGTVQGFGLDVGLTHQHPTGAG
FT                   THLLNESTSWSIALGVIMVGAALWPSAAAGLAGVLTAFVAILTGYVIVDALSGAVSTTR
FT                   ILTHLPVVIGAVLAIMVWRSASGPRPRPDAVAAEPDIVLPDNASRGRRRGHLWPTDGSA
FT                   A"
FT   gene            complement(105068..106021)
FT                   /locus_tag="MRA_0098"
FT   CDS_pept        complement(105068..106021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71817"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYG7"
FT                   /protein_id="ABQ71817.1"
FT                   /translation="MSTRQAAEADLAGKAAQYRPDELARYAQRVMDWLHPDGDLTDTER
FT                   ARKRGITLSNQQYDGMSRLSGYLTPQARATFEAVLAKLAAPGATNPDDHTPVIDTTPDA
FT                   AAIDRDTRSQAQRNHDGLLAGLRALIASGKLGQHNGLPVSIVVTTTLTDLQTGAGKGFT
FT                   GGGTLLPMADVIRMTSHAHHYSPASGRYPQAIFDHGTPLALYHTKRLASPAQRIMLFAN
FT                   DRGCTKPGCDAPAYHSQAHHVTAWTSTGRTDITELTLACGPDNRLAEKGWTTHNNTHGH
FT                   TEWLPPPHLDHGQPRTNTFHHPERFLHNQDDDDKPD"
FT   gene            complement(106163..106573)
FT                   /locus_tag="MRA_0099"
FT   CDS_pept        complement(106163..106573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71818"
FT                   /db_xref="GOA:A5TYG8"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYG8"
FT                   /protein_id="ABQ71818.1"
FT                   /translation="MRYLPVSTRRIWVNPLCHFSFTVISGALFVSARRYDSNMLANSRE
FT                   ELVEVFDALDADLDRLDEVSFEVLSTPERLRSLERLECLARRLPAAQHTLINQLDTQAS
FT                   EEELGGTLCCALANRLRITKPEAGRRSAEAKP"
FT   gene            106682..108073
FT                   /locus_tag="MRA_0100"
FT   CDS_pept        106682..108073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0100"
FT                   /product="PPE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71819"
FT                   /db_xref="GOA:A5TYG9"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYG9"
FT                   /protein_id="ABQ71819.1"
FT                   /translation="MAIPPEVHSGLLSAGCGPGSLLVAAQQWQELSDQYALACAELGQL
FT                   LGEVQASSWQGTAATQYVAAHGPYLAWLEQTAINSAVTAAQHVAAAAAYCSALAAMPTP
FT                   AELAANHAIHGVLIATNFFGINTVPIALNEADYVRMWLQAADTMAAYQAVADAATVAVP
FT                   STQPAPPIRAPGGDAADTRLDVLSSIGQLIRDILDFIANPYKYFLEFFEQFGFSPAVTV
FT                   VLALVALQLYDFLWYPYYASYGLLLLPFFTPTLSALTALSALIHLLNLPPAGLLPIAAA
FT                   LGPGDQWGANLAVAVTPATAAVPGGSPPTSNPAPAAPSSNSVGSASAAPGISYAVPGLA
FT                   PPGVSSGPKAGTKSPDTAADTLATAGAARPGLARAHRRKRSESGVGIRGYRDEFLDATA
FT                   TVDAATDVPAPANAAGSQGAGTLGFAGTAPTTSGAAAGMVQLSSHSTSTTVPLLPTTWT
FT                   TDAEQ"
FT   gene            108092..108961
FT                   /locus_tag="MRA_0101"
FT   CDS_pept        108092..108961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0101"
FT                   /product="putative dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71820"
FT                   /db_xref="GOA:A5TYH0"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYH0"
FT                   /protein_id="ABQ71820.1"
FT                   /translation="MTLKVKGEGLGAQVTGVDPKNLDDITTDEIRDIVYTNKLVVLKDV
FT                   HPSPREFIKLGRIIGQIVPYYEPMYHHEDHPEIFVSSTEEGQGVPKTGAFWHIDYMFMP
FT                   EPFAFSMVLPLAVPGHDRGTYFIDLARVWQSLPAAKRDPARGTVSTHDPRRHIKIRPSD
FT                   VYRPIGEVWDEINRTTPPIKWPTVIRHPKTGQEILYICATGTTKIEDKDGNPVDPEVLQ
FT                   ELMAATGQLDPEYQSPFIHTQHYQVGDIILWDNRVLMHRAKHGSAAGTLTTYRLTMLDG
FT                   LKTPGYAA"
FT   gene            108958..109509
FT                   /locus_tag="MRA_0102"
FT   CDS_pept        108958..109509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71821"
FT                   /db_xref="InterPro:IPR022598"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYH1"
FT                   /protein_id="ABQ71821.1"
FT                   /translation="MSHTDLTPCTRVLASSGTVPIAEELLARVLEPYSCKGCRYLIDAQ
FT                   YSATEDSVLAYGNFTIGESAYIRSTGHFNAVELILCFNQLAYSAFAPAVLNEEIRVLRG
FT                   WSIDDYCQHQLSSMLIRKASSRFRKPLNPQKFSARLLCRDLQVIERTWRYLKVPCVIEF
FT                   WDENGGAASGEIELAALNIP"
FT   gene            109514..111136
FT                   /gene="fadD10"
FT                   /locus_tag="MRA_0103"
FT   CDS_pept        109514..111136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD10"
FT                   /locus_tag="MRA_0103"
FT                   /product="fatty-acid-CoA ligase FadD10"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71822"
FT                   /db_xref="GOA:A5TYH2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYH2"
FT                   /protein_id="ABQ71822.1"
FT                   /translation="MGGKKFQAMPQLPSTVLDRVFEQARQQPEAIALRRCDGTSALRYR
FT                   ELVAEVGGLAADLRAQSVSRGSRVLVISDNGPETYLSVLACAKLGAIAVMADGNLPIAA
FT                   IERFCQITDPAAALVAPGSKMASSAVPEALHSIPVIAVDIAAVTRESEHSLDAASLAGN
FT                   ADQGSEDPLAMIFTSGTTGEPKAVLLANRTFFAVPDILQKEGLNWVTWVVGETTYSPLP
FT                   ATHIGGLWWILTCLMHGGLCVTGGENTTSLLEILTTNAVATTCLVPTLLSKLVSELKSA
FT                   NATVPSLRLVGYGGSRAIAADVRFIEATGVRTAQVYGLSETGCTALCLPTDDGSIVKIE
FT                   AGAVGRPYPGVDVYLAATDGIGPTAPGAGPSASFGTLWIKSPANMLGYWNNPERTAEVL
FT                   IDGWVNTGDLLERREDGFFYIKGRSSEMIICGGVNIAPDEVDRIAEGVSGVREAACYEI
FT                   PDEEFGALVGLAVVASAELDESAARALKHTIAARFRRESEPMARPSTIVIVTDIPRTQS
FT                   GKVMRASLAAAATADKARVVVRG"
FT   gene            111141..111377
FT                   /locus_tag="MRA_0104"
FT   CDS_pept        111141..111377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0104"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71823"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYH3"
FT                   /protein_id="ABQ71823.1"
FT                   /translation="MRDRILAAVCDVLYIDEADLIDGDETDLRDLGLDSVRFVLLMKQL
FT                   GVNRQSELPSRLAANPSIAGWLRELEAVCTEFG"
FT   gene            111359..111637
FT                   /gene="nrp1"
FT                   /locus_tag="MRA_0105"
FT   CDS_pept        111359..111637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrp1"
FT                   /locus_tag="MRA_0105"
FT                   /product="putative peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71824"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYH4"
FT                   /protein_id="ABQ71824.1"
FT                   /translation="MHRVRLSRSQRNLYNGVRQDNNPALYLIGKSYRFRRLELARFLAA
FT                   LHATVLDNPVQLCVLENSGADYPDLVPRLRFGDIVRVGSADEHLQST"
FT   gene            111665..118897
FT                   /gene="nrp2"
FT                   /locus_tag="MRA_0106"
FT   CDS_pept        111665..118897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrp2"
FT                   /locus_tag="MRA_0106"
FT                   /product="putative peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71825"
FT                   /db_xref="GOA:A5TYH5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYH5"
FT                   /protein_id="ABQ71825.1"
FT                   /translation="MRHTVHTDPNGYVTGLDVHTHHILLDGGATGTIEADLARYLTTDP
FT                   AGETPSVGAGLAKLREAHRRETAKVEESRGRLSAVVQRELADEAYHGGHGHSVSDAPGT
FT                   AAKGVLHESATICGNAFDAILTLSEAQRVPLNVLVAAAAVAVDASLRQNTETLLVHTVD
FT                   NRFGDSDLNVATCLVNSVAQTVRFPPFASVSDVVRTLDRGYVKAVRRRWLREEHYRRMY
FT                   LAINRTSHVEALTLNFIREPCAPGLRPFLSEVPIATDIGPVEGMTVASVLDEEQRTLNL
FT                   AIWNRADLPACKTHPKVAERIAAALESMAAMWDRPIAMIVNDWFGIGPDGTRCQGDWPA
FT                   RQPSTPAWFLDSARGVHQFLGRRRFVYPWVAWLVQRGAAPGDVLVFTDDDTDKTIDLLI
FT                   ACHLAGCGYSVCDTADEISVRTNAITEHGDGILVTVVDVAATQLAVVGHDELRKVVDER
FT                   VTQVTHDALLATKTAYIMPTSGTTGQPKLVRISHGSLAVFCDAISRAYGWGAHDTVLQC
FT                   APLTSDISVEEIFGGAACGARLVRSAAMKTGDLAALVDDLVARETTIVDLPTAVWQLLC
FT                   ADGDAIDAIGRSRLRQIVIGGEAIRCSAVDKWLESAASQGISLLSSYGPTEATVVATFL
FT                   PIVCDQTTMDGALLRLGRPILPNTVFLAFGEVVIVGDLVADGYLGIDGDGFGTVTAADG
FT                   SRRRAFATGDRVTVDAEGFPVFSGRKDAVVKISGKRVDIAEVTRRIAEDPAVSDVAVEL
FT                   HSGSLGVWFKSQRTREGEQDAAAATRIRLVLVSLGVSSFFVVGVPNIPRKPNGKIDSDN
FT                   LPRLPQWSAAGLNTAETGQRAAGLSQIWSRQLGRAIGPDSSLLGEGIGSLDLIRILPET
FT                   RRYLGWRLSLLDLIGADTAANLADYAPTPDAPTGEDRFRPLVAAQRPAAIPLSFAQRRL
FT                   WFLDQLQRPAPVYNMAVALRLRGYLDTEALGAAVADVVGRHESLRTVFPAVDGVPRQLV
FT                   IEARRADLGCDIVDATAWPADRLQRAIEEAARHSFDLATEIPLRTWLFRIADDEHVLVA
FT                   VAHHIAADGWSVAPLTADLSAAYASRCAGRAPDWAPLPVQYVDYTLWQREILGDLDDSD
FT                   SPIAAQLAYWENALAGMPERLRLPTARPYPPVADQRGASLVVDWPASVQQQVRRIARQH
FT                   NATSFMVVAAGLAVLLSKLSGSPDVAVGFPIAGRSDPALDNLVGFFVNTLVLRVNLAGD
FT                   PSFAELLGQVRARSLAAYENQDVPFEVLVDRLKPTRALTHHPLIQVMLAWQDNPVGQLN
FT                   LGDLQATPMPIDTRTARMDLVFSLAERFSEGSEPAGIGGAVEYRTDVFEAQAIDVLIER
FT                   LRKVLVAVAAAPERTVSSIDALDGTERARLDEWGNRAVLTAPAPTPVSIPQMLAAQVAR
FT                   IPEAEAVCCGDASMTYRELDEASNRLAHRLAGCGAGPGECVALLFERCAPAVVAMVAVL
FT                   KTGAAYLPIDPANPPPRVAFMLGDAVPVAAVTTAGLRSRLAGHDLPIIDVVDALAAYPG
FT                   TPPPMPAAVNLAYILYTSGTTGEPKGVGITHRNVTRLFASLPARLSAAQVWSQCHSYGF
FT                   DASAWEIWGALLGGGRLVIVPESVAASPNDFHGLLVAEHVSVLTQTPAAVAMLPTQGLE
FT                   SVALVVAGEACPAALVDRWAPGRVMLNAYGPTETTICAAISAPLRPGSGMPPIGVPVSG
FT                   AALFVLDSWLRPVPAGVAGELYIAGAGVGVGYWRRAGLTASRFVACPFGGSGARMYRTG
FT                   DLVCWRADGQLEFLGRTDDQVKIRGYRIELGEVATALAELAGVGQAVVIAREDRPGDKR
FT                   LVGYATEIAPGAVDPAGLRAQLAQRLPGYLVPAAVVVIDALPLTVNGKLDHRALPAPEY
FT                   GDTNGYRAPAGPVEKTVAGIFARVLGLERVGVDDSFFELGGDSLAAMRVIAAINTTLNA
FT                   DLPVRALLHASSTRGLSQLLGRDARPTSDPRLVSVHGDNPTEVHASDLTLDRFIDADTL
FT                   ATAVNLPGPSPELRTVLLTGATGFLGRYLVLELLRRLDVDGRLICLVRAESDEDARRRL
FT                   EKTFDSGDPELLRHFKELAADRLEVVAGDKSEPDLGLDQPMWRRLAETVDLIVDSAAMV
FT                   NAFPYHELFGPNVAGTAELIRIALTTKLKPFTYVSTADVGAAIEPSAFTEDADIRVISP
FT                   TRTVDGGWAGGYGTSKWAGEVLLREANDLCALPVAVFRCGMILADTSYAGQLNMSDWVT
FT                   RMVLSLMATGIAPRSFYEPDSEGNRQRAHFDGLPVTFVAEAIAVLGARVAGSSLAGFAT
FT                   YHVMNPHDDGIGLDEYVDWLIEAGYPIRRIDDFAEWLQRFEASLGALPDRQRRHSVLPM
FT                   LLASNSQRLQPLKPTRGCSAPTDRFRAAVRAAKVGSDKDNPDIPHVSAPTIINYVTNLQ
FT                   LLGLL"
FT   gene            119072..121057
FT                   /locus_tag="MRA_0107"
FT   CDS_pept        119072..121057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0107"
FT                   /product="putative conserved integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71826"
FT                   /db_xref="GOA:A5TYH6"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR019108"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYH6"
FT                   /protein_id="ABQ71826.1"
FT                   /translation="MGTHGATKSATSAVPTPRSNSMAMVRLAIGLLGVCAVVAAFGLVS
FT                   GARRYAEAGNPYPGAFVSVAEPVGFFAASLAGALCLGALIHVVMTAKPEPDGLIDAAAF
FT                   RIHLLAERVSGLWLGLAATMVVIQAAHDTGVGPARLLASGALSDSVAASEMARGWIVAA
FT                   ICALVVATALRLYTRWLGHVVLLVPTVLAVVATAVTGNPGQGPDHDYATSAAIVFAVAF
FT                   ATLTGLKIAAALAGTTPSRAVLVTQVTCGALALAYGAMLLYLFIPGWAVDSDFARLGLL
FT                   AGVILTSVWLFDCWRLLVRPPHAGRRRGGGSGAALAMMAAMASIAAMAVMTAPRFLTHA
FT                   FTAWDVFLGYELPQPPTIARVLTVWRFDSLIGAAGVVLAIGYAAGFAALRRRGNSWPVG
FT                   RLIAWLTGCAALVFTSGSGVRAYGSAMFSVHMAEHMTLNMFIPVLLVLGGPVTLALRVL
FT                   PVTGDGRPPGAREWLTWLLHSRVTTFLSHPITAFVLFVASPYIVYFTPLFDTFVRYHWG
FT                   HEFMAIHFLVVGYLFYWAIIGIDPGPRRLPYPGRIGLLFAVMPFHAFFGIALMTMSSTV
FT                   GATFYRSVNLPWLSSIIADQHLGGGIAWSLTELPVIMVIVALVTQWARQDRRVASREDR
FT                   HADSDYADDELEAYNAMLRELSRMRR"
FT   gene            complement(121273..123531)
FT                   /gene="ctpB"
FT                   /locus_tag="MRA_0108"
FT   CDS_pept        complement(121273..123531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctpB"
FT                   /locus_tag="MRA_0108"
FT                   /product="Cation-transporting P-type ATPase B"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71827"
FT                   /db_xref="GOA:A5TYH7"
FT                   /db_xref="InterPro:IPR000579"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYH7"
FT                   /protein_id="ABQ71827.1"
FT                   /translation="MAAPVVGDADLQSVRRIRLDVLGMSCAACASRVETKLNKIPGVRA
FT                   SVNFATRVATIDAVGMAADELCGVVEKAGYHAAPHTETTVLDKRTKDPDGAHARRLLRR
FT                   LLVAAVLFVPLADLSTLFAIVPSARVPGWGYILTALAAPVVTWAAWPFHSVALRNARHR
FT                   TTSMETLISVGIVAATAWSLSSVFGDQPPREGSGIWRAILNSDSIYLEVAAGVTVFVLA
FT                   GRYFEARAKSKAGSALRALAELGAKNVAVLLPDGAELVIPASELKKRQRFVTRPGETIA
FT                   ADGVVVDGSAAIDMSAMTGEAKPVRAYPAASVVGGTVVMDGRLVIEATAVGADTQFAAM
FT                   VRLVEQAQTQKARAQRLADHIAGVFVPVVFVIAGLAGAAWLVSGAGADRAFSVTLGVLV
FT                   IACPCALGLATPTAMMVASGRGAQLGIFIKGYRALETIRSIDTVVFDKTGTLTVGQLAV
FT                   STVTMAGSGTSERDREEVLGLAAAVESASEHAMAAAIVAASPDPGPVNGFVAVAGCGVS
FT                   GEVGGHHVEVGKPSWITRTTPCHDAALVSARLDGESRGETVVFVSVDGVVRAALTIADT
FT                   LKDSAAAAVAALRSRGLRTILLTGDNRAAADAVAAQVGIDSAVADMLPEGKVDVIQRLR
FT                   EEGHTVAMVGDGINDGPALVGADLGLAIGRGTDVALGAADIILVRDDLNTVPQALDLAR
FT                   ATMRTIRMNMIWAFGYNVAAIPIAAAGLLNPLIAGAAMAFSSFFVVSNSLRLRNFGAQ"
FT   gene            123675..125189
FT                   /locus_tag="MRA_0109"
FT   CDS_pept        123675..125189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0109"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71828"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYH8"
FT                   /protein_id="ABQ71828.1"
FT                   /translation="MTPVTTFPLVDAILAGRDRNLDGVILIAAQHLLQTTHAMLRSLFR
FT                   VGLDPRNVAVIGKCYSTHPGVVDAMRADGIYVDDCSDAYAPHESFDTQYTRHVERFFAE
FT                   SWARLTAGRTARVVLLDDGGSLLAVAGAMLDASADVIGIEQTSAGYAKIVGCALGFPVI
FT                   NIARSSAKLLYESPIIAARVTQTAFERTAGIDSSAAILITGAGAIGTALADVLRPLHDR
FT                   VDVYDTRSGCMTPIDLPNAIGGYDVIIGATGATSVPASMHELLRPGVLLMSASSSDREF
FT                   DAVALRRRTTPNPDCHADLRVADGSVDATLLNSGFPVNFDGSPMCGDASMALTMALLAA
FT                   AVLYASVAVADEMSSDHPHLGLIDQGDIVASFLNIDVPLQALSRLPLLSIDGYRRLQVR
FT                   SGYTLFRQGERADHFFVIESGELEALVDGKVILRLGAGDHFGEACLLGGMRRIATVRAC
FT                   EPSVLWELDGKAFGDALHGDAAMREIAYGVARTRLMHAGASESLMV"
FT   gene            complement(125338..125622)
FT                   /gene="rpmB1"
FT                   /locus_tag="MRA_0110"
FT   CDS_pept        complement(125338..125622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB1"
FT                   /locus_tag="MRA_0110"
FT                   /product="ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71829"
FT                   /db_xref="GOA:A5TYH9"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYH9"
FT                   /protein_id="ABQ71829.1"
FT                   /translation="MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDR
FT                   RIKVRVSAQGIKVIDRDGHRGRRRAARAGSAPAHFARQAGSSLRTAAIL"
FT   gene            125732..126928
FT                   /locus_tag="MRA_0111"
FT   CDS_pept        125732..126928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71830"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYI0"
FT                   /protein_id="ABQ71830.1"
FT                   /translation="MRTPVILVAGQDHTDEVTGALLRRTGTVVVEHRFDGHVVRRMTAT
FT                   LSRGELITTEDALEFAHGCVSCTIRDDLLVLLRRLHRRDNVGRIVVHLAPWLEPQPICW
FT                   AIDHVRVCVGHGYPDGPAALDVRVAAVVTCVDCVRWLPQSLGEDELPDGRTVAQVTVGQ
FT                   AEFADLLVLTHPEPVAVAVLRRLAPRARITGGVDRVELALAHLDDNSRRGRTDTPHTPL
FT                   LAGLPPLAADGEVAIVEFSARRPFHPQRLHAAVDLLLDGVVRTRGRLWLANRPDQVMWL
FT                   ESAGGGLRVASAGKWLAAMAASEVAYVDLERRLFADLMWVYPFGDRHTAMTVLVCGADP
FT                   TDIVNALNAALLSDDEMASPQRWQSYVDPFGDWHDDPCHEMPDAAGEFSAHRNSGESR"
FT   gene            complement(127001..131899)
FT                   /gene="ctpI2"
FT                   /locus_tag="MRA_0112"
FT   CDS_pept        complement(127001..131899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctpI2"
FT                   /locus_tag="MRA_0112"
FT                   /product="cation-transporter ATPase I CtpI"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71831"
FT                   /db_xref="GOA:A5TYI1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYI1"
FT                   /protein_id="ABQ71831.1"
FT                   /translation="MKIPGVATVLGGVTNGVAQTVRAGARLPGSAAAAVQTLASPVLEL
FT                   TGPVVQSVVQTTGRAIGVRGSHNESPDGMTPPVRWRSGRRVHFDLDPLLPFPRWHEHAA
FT                   MVEEPVRRIPGVAEAHVEGSLGRLVVELEPDADSDIAVDEVRDVVSAVAADIFLAGSVS
FT                   SPNSAPFADPGNPLAILVPLTAAAMDLVAMGATVTGWVARLPAAPQTTRALAALINHQP
FT                   RMVSLMESRLGRVGTDIALAATTAAANGLTQSLGTPLLDLVQRSLQISEAAAHRRVWRD
FT                   REPALASPRRPQAPVVPIISSAGAKSQEPRHSWAAAAAGEASHVVVGGSIDAAIDTAKG
FT                   SRAGPVEQYVNQAANGSLIAAASALVAGGGTEDAAGAILAGVPRAAHMGRQAFAAVLGR
FT                   GLANTGQLVLDPGALRRLDRVRVVVIDGAALRGDNRAVLHAQGDEPGWDDDRVYEVADA
FT                   LLHGEQAPEPDPDELPATGARLRWAPAQGPSATPAQGLEHADLVVDGQCVGSVDVGWEV
FT                   DPYAIPLLQTAHRTGARVVLRHVAGTEDLSASVGSTHPPGTPLLKLVRELRADRGPVLL
FT                   ITAVHRDFASTDTLAALAIADVGVALDDPRGATPWTADLITGTDLAAAVRILSALPVAR
FT                   AASESAVHLAQGGTTLAGLLLVTGEQDKTTNPASFRRWLNPVNAAAATALVSGMWSAAK
FT                   VLRMPDPTPQPLTAWHALDPEIVYSRLAGGSRPLAVEPGIPAWRRILDDLSYEPVMAPL
FT                   RGPARTLAQLAVATRHELADPLTPILAVGAAASAIVGSNIDALLVAGVMTVNAITGGVQ
FT                   RLRAEAAAAELFAEQDQLVRRVVVPAVATTRRRLEAARHATRTATVSAKSLRVGDVIDL
FT                   AAPEVVPADARLLVAEDLEVDESFLTGESLPVDKQVDPVAVNDPDRASMLFEGSTIVAG
FT                   HARAIVVATGVGTAAHRAISAVADVETAAGVQARLRELTSKVLPMTLAGGAAVTALALL
FT                   RRASLRQAVADGVAIAVAAVPEGLPLVATLSQLAAAQRLTARGALVRSPRTIEALGRVD
FT                   TICFDKTGTLTENRLRVVCALPSSTAAERDPLPQTTDAPSAEVLRAAARASTQPHNGEG
FT                   HAHATDEAILAAASALAGSLSSQGDSEWVVLAEVPFESSRGYAAAIGRVGTDGIPMLML
FT                   KGAPETILPRCRLADPGVDHEHAESVVRHLAEQGLRVLAVAQRTWDNGTTHDDETDADA
FT                   VDAVAHDLELIGYVGLADTARSSSRPLIEALLDAERNVVLITGDHPITARAIARQLGLP
FT                   ADARVVTGAELAVLDEEAHAKLAADMQVFARVSPEQKVQIVAALQRCGRVTAMVGDGAN
FT                   DAAAIRMADVGIGVSGRGSSAARGAADIVLTDDDLGVLLDALVEGRSMWAGVRDAVTIL
FT                   VGGNVGEVLFTVIGTAFGAGRAPVGTRQLLLVNLLTDMFPALAVAVTSQFAEPDDAEYP
FT                   TDDAAERAQREHRRAVLIGPTPSLDAPLLRQIVNRGVVTAAGATAAWAIGRWTPGTERR
FT                   TATMGLTALVMTQLAQTLLTRRHSPLVIATALGSAGVLVGIIQTPVISHFSGVPRWDRS
FT                   PGRASSAPRQEPPQSQRWHRSGWQAQSVSCNLMNALTTRKTLTRVDRTYRRPR"
FT   gene            complement(132253..132462)
FT                   /locus_tag="MRA_0114"
FT   CDS_pept        complement(132253..132462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71832"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYI2"
FT                   /protein_id="ABQ71832.1"
FT                   /translation="MVPVETLHSGDPITDVNGGGQRYIVLESKTVGDSCVVLELESRVN
FT                   HQLQVIEKSFPAGYHVGRAHHRIL"
FT   gene            132741..134231
FT                   /locus_tag="MRA_0115"
FT   CDS_pept        132741..134231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0115"
FT                   /product="PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71833"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYI3"
FT                   /protein_id="ABQ71833.1"
FT                   /translation="MSLLITSPATVAAAATHLAGIGSALSTANAAAAAPTTALSVAGAD
FT                   EVSVLIAALFEAYAQEYQALSAQALAFHDQFVQALNMGAVCYAAAETANATPLQALQTV
FT                   QQNVLTVVNAPTQALLGRPIIGNGANGLPNTGQDGGPGGLLFGNGGNGGSGGVDQAGGN
FT                   GGAAGLIGNGGSGGVGGPGIAGSAGGAGGAGGLLFGNGGPGGAGGIGTTGDGGPGGAGG
FT                   NAIGLFGSGGTGGMGGVGGMGGVGNGGNAGNGGTAGLFGHGGAGGAGGIGSADGGLGGG
FT                   GGNGRFMGNGGVGGAGGYGASGDGGNAGNGGLGGVFGDGGAGGTGGLGDVNGGLAGIGG
FT                   NAGFVGNGGAGGNGQLGSGAVSSAGGMGGNGGLVFGNGGPGGLGGPGTSAGNGGMGGNA
FT                   VGLFGQGGAGGAGGSGFGAGIPGGRGGDGGSGGLIGDGGTGGGAGAGDAAASAGGNGGN
FT                   ARLIGNGGDGGPGMFGGPGGAGGSGGTIFGFAGTPGPS"
FT   gene            134379..135128
FT                   /locus_tag="MRA_0116"
FT   CDS_pept        134379..135128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0116"
FT                   /product="Rhomboid family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71834"
FT                   /db_xref="GOA:A5TYI4"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYI4"
FT                   /protein_id="ABQ71834.1"
FT                   /translation="MRVGPVGHQCAECVREGARAVRQPRTPFGGRQRSATPVVTYTLIS
FT                   LNALVFVMQVTVMGLERQLALWPPAVASGQTYRLVTSAFLHYGAMHLLLNMWALYVVGP
FT                   PLEMWLGRLRFGALYAVSALGGSVLVYLIAPLNTATAGASGAVFGLFGATFMVARRLHL
FT                   DVRWVVALIVINLAFTFLAPAISWQGHVGGLVTGALVAATYVYAPRERRNLIQATVTIT
FT                   VLVAFVVLIGWRTVDLLALFGGRLNLS"
FT   gene            135309..137366
FT                   /locus_tag="MRA_0117"
FT   CDS_pept        135309..137366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0117"
FT                   /product="putative transmembrane acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71835"
FT                   /db_xref="GOA:A5TYI5"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYI5"
FT                   /protein_id="ABQ71835.1"
FT                   /translation="MPARSVPRPRWVAPVRRVGRLAVWDRPERRSGIPALDGLRAIAVA
FT                   LVLASHGGIPGMGGGFIGVDAFFVLSGFLITSLLLDELGRTGRIDLSGFWIRRARRLLP
FT                   ALVLMVLTVSAARALFPDQALTGLRSDAIAAFLWTANWRFVAQNTDYFTQGAPPSPLQH
FT                   TWSLGVEEQYYVVWPLLLIGATLLLAARARRRCRRATVGGVRFAAFLIASLGTMASATA
FT                   AVAFTSAATRDRIYFGTDTRAQALLIGSAAAALLVRDWPSLNRGWCLIRTRWGRRIARL
FT                   LPFVGLAGLAVTTHVATGSVGEFRHGLLIVVAGAAVIVVASVAMEQRGAVARILAWRPL
FT                   VWLGTISYGVYLWHWPIFLALNGQRTGWSGPALFAARCAATVVLAGASWWLIEQPIRRW
FT                   RPARVPLLPLAAATVASAAAVTMLVVPVGAGPGLREIGLPPGVSAVAAVSPSPPEASQP
FT                   APGPRDPNRPFTVSVFGDSIGWTLMHYLPPTPGFRFIDHTVIGCSLVRGTPYRYIGQTL
FT                   EQRAECDGWPARWSAQVNRDQPDVALLIVGRWETVDRVNEGRWTHIGDPTFDAYLNAEL
FT                   QRALSIVGSTGVRVMVTTVPYSRGGEKPDGRLYPEDQPERVNKWNAMLHNAISQHSNVG
FT                   MIDLNKKLCPDGVYTAKVDGIKVRSDGVHLTQEGVKWLIPWLEDSVRVAS"
FT   gene            137648..138604
FT                   /gene="gca"
FT                   /locus_tag="MRA_0118"
FT   CDS_pept        137648..138604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gca"
FT                   /locus_tag="MRA_0118"
FT                   /product="putative GDP-D-mannose dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71836"
FT                   /db_xref="GOA:A5TYI6"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYI6"
FT                   /protein_id="ABQ71836.1"
FT                   /translation="MKVWITGAGGMMGSHLAEMLLAAGHDVYATYCRPTIDPSDLQFNG
FT                   AEVDITDWCSVYDSIATFRPDAVFHLAAQSYPAVSWARPVETLTTNMVGTAIVFEALRR
FT                   VRPHAKIIVAGSSAEYGFVDPSEVPINERRELRPLHPYGVSKAATDMLAYQYHKSYGMH
FT                   TVVARIFNCTGPRKVGDALSDFVRRCTWLEHHPEQSAIRVGNLKTKRTIVDVRDLNRAL
FT                   MLMLDKGEAGADYNVGGSIAYEMGDVLKQVIAACKRDDIVPEVDPALLRPTDEKIIYGD
FT                   CSKLAAITGWQQEICLTQTIADMFDYWRSKSESALMV"
FT   gene            138678..139268
FT                   /gene="gmhA"
FT                   /locus_tag="MRA_0119"
FT   CDS_pept        138678..139268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmhA"
FT                   /locus_tag="MRA_0119"
FT                   /product="putative phosphoheptose isomerase GmhA"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71837"
FT                   /db_xref="GOA:A5TYI7"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TYI7"
FT                   /protein_id="ABQ71837.1"
FT                   /translation="MCTARTAEEIFVETIAVKTRILNDRVLLEAARAIGDRLIAGYRAG
FT                   ARVFMCGNGGSAADAQHFAAELTGHLIFDRPPLGAEALHANSSHLTAVANDYDYDTVFA
FT                   RALEGSARPGDTLFAISTSGNSMSVLRAAKTARELGVTVVAMTGESGGQLAEFADFLIN
FT                   VPSRDTGRIQESHIVFIHAISEHVEHALFAPRQ"
FT   gene            139300..139872
FT                   /gene="gmhB"
FT                   /locus_tag="MRA_0120"
FT   CDS_pept        139300..139872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmhB"
FT                   /locus_tag="MRA_0120"
FT                   /product="D-alpha,beta-D-heptose-1,7-biphosphate
FT                   phosphatase GmhB"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71838"
FT                   /db_xref="GOA:A5TYI8"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYI8"
FT                   /protein_id="ABQ71838.1"
FT                   /translation="MVAERAGHQWCLFLDRDGVINRQVVGDYVRNWRQFEWLPGAARAL
FT                   KKLRAWAPYIVVVTNQQGVGAGLMSAVDVMVIHRHLQMQLASDGVLIDGFQVCPHHRSQ
FT                   RCGCRKPRPGLVLDWLGRHPDSEPLLSIVVGDSLSDLELAHNVAAAAGACASVQIGGAS
FT                   SGGVADASFDSLWEFAVAVGHARGERG"
FT   gene            139872..141032
FT                   /gene="hddA"
FT                   /locus_tag="MRA_0121"
FT   CDS_pept        139872..141032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hddA"
FT                   /locus_tag="MRA_0121"
FT                   /product="D-alpha-D-heptose-7-phosphate kinase HddA"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71839"
FT                   /db_xref="GOA:A5TYI9"
FT                   /db_xref="InterPro:IPR001174"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014606"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYI9"
FT                   /protein_id="ABQ71839.1"
FT                   /translation="MAILRGRAPLRLGLGGGGTDVEPYSSQFGGRILSVTIDKYAYAFA
FT                   ERGTGDEIAFRSPDRDRAGQASIDDLASLEEDFPLHVAVYRRVIAEFNGGTPFPLQLAT
FT                   QVDAPPGSGLGSSSALVVAMLLTTCALIGSSPGPYELARLAWEIERVDLGMAGGWQDHY
FT                   AAAFGGFNFMESRPNGEVVVNPLRIRREVIAELEASLLLYFGGVSRLSSEVIADQQRNV
FT                   VERDADALAATHSICAEALEMKDLLVVGDIPGFADSLLRGWQAKKRTSTRISNPAIEHA
FT                   YQVAQSSGMVAGKVSGAGGGGFLMMIVDPRRRIEVARSLERECGGSVAPCLFTKGGAVT
FT                   WHIPESTAPVRRGVADAVASALGNAGILLCAGCVLATSHSTWRVPV"
FT   gene            141324..141503
FT                   /locus_tag="MRA_0122"
FT   CDS_pept        141324..141503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71840"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYJ0"
FT                   /protein_id="ABQ71840.1"
FT                   /translation="MIMTFVVPQRVTRATKGRARSLLRVSRRLTDTFRAPLAWTPQERA
FT                   DRYVARMPIAVIAD"
FT   gene            complement(141626..142381)
FT                   /locus_tag="MRA_0123"
FT   CDS_pept        complement(141626..142381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0123"
FT                   /product="putative conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71841"
FT                   /db_xref="GOA:A5TYJ1"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="InterPro:IPR041280"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYJ1"
FT                   /protein_id="ABQ71841.1"
FT                   /translation="MRRVVRYLSVVVAITLMLTAESVSIATAAVPPLQPIPGVASVSPA
FT                   NGAVVGVAHPVVVTFTTPVTDRRAVERSIRISTPHNTTGHFEWVASNVVRWVPHRYWPP
FT                   HTRVSVGVQELTEGFETGDALIGVASISAHTFTVSRNGEVLRTMPASLGKPSRPTPIGS
FT                   FHAMSKERTVVMDSRTIGIPLNSSDGYLLTAHYAVRVTWSGVYVHSAPWSVNSQGYANV
FT                   SHGCINLSPDNAAWYFDAVTVGDPIEVVG"
FT   gene            142559..143503
FT                   /gene="oxyS"
FT                   /locus_tag="MRA_0124"
FT   CDS_pept        142559..143503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oxyS"
FT                   /locus_tag="MRA_0124"
FT                   /product="oxidative stress response regulatory protein
FT                   OxyS"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71842"
FT                   /db_xref="GOA:A5TYJ2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYJ2"
FT                   /protein_id="ABQ71842.1"
FT                   /translation="MLFRQLEYFVAVAQERHFARAAEKCYVSQPALSSAIAKLERELNV
FT                   TLINRGHSFEGLTREGERLVVWAKRILAEHAAFKAEVDAVRSGITGTLRLGTVPTASTT
FT                   ASLVLSAFCSAHPLAKVQVCSRLAATELYRRLREFELDAVIVHPETQDSDDVDLVPLYE
FT                   EQYVLLSPADMLPPGTSTLVWRDAAQLPLALLTADMRDRQVIDAAFADHAVSAIPQVET
FT                   DSVASLFAQVATGNWASIVPHTWLWAMPMSGPTGGEIRAVELVDPVLKAQIALATNALG
FT                   PGSPVARALITCAQALALNEFFDTQLRGITRRR"
FT   gene            complement(143487..145235)
FT                   /locus_tag="MRA_0125"
FT   CDS_pept        complement(143487..145235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71843"
FT                   /db_xref="GOA:A5TYJ3"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR017660"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYJ3"
FT                   /protein_id="ABQ71843.1"
FT                   /translation="MTTRSASPCTVLTDGCHLVVDALKANDVDTIYGVVGIPITDLARA
FT                   AQASGIRYIGFRHEASAGNAAAAAGFLTARPGVCLTTSGPGFLNGLPALANATTNCFPM
FT                   IQISGSSSRPMVDLQRGDYQDLDQLNAARPFVKAAYRIGQVQDIGRGVARAIRTATSGR
FT                   PGGVYLDIPGDVLGQAVEASAASGAIWRPVDPAPRLLPAPEAIDRALDVLAQAQRPLLV
FT                   LSKGAAYAQADNVIREFVEHTGIPFLPMSMAKGLLPDSHPQSAAAARSLAMARADVVLL
FT                   VGARLNWLLGNGESPQWSADAKFIQVDIEASEFDSNRPIVAPLTGDIGSVMSALLEAAA
FT                   DRSSVASAAWTGELADRKARNSAKMRRRLADDHHPMRFYNALGAIRSVLQRNPDVYVVN
FT                   EGANALDLARNIIDMHLPRHRLDSGTWGVMGIGMGYAIAAAVETGRPVVAIEGDSAFGF
FT                   SGMEFETICRYRLPVTVVILNNGGVYRGDEATIFRSAAPVWRHDPAPTVLNAHARHELI
FT                   AEAFGGKGYHVSTPTELESALTDALASNGPSLIDCELDPADGVESGHLAKLNTTSAATP
FT                   AISGDG"
FT   gene            145408..146985
FT                   /gene="fadD7"
FT                   /locus_tag="MRA_0126"
FT   CDS_pept        145408..146985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD7"
FT                   /locus_tag="MRA_0126"
FT                   /product="fatty-acid-CoA ligase FadD7"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71844"
FT                   /db_xref="GOA:A5TYJ4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYJ4"
FT                   /protein_id="ABQ71844.1"
FT                   /translation="MASDFGPRIADLVEVAATRLPEAPALVVTADRIAISHRDLARLVD
FT                   ELAGQLTRSGLLPGDRVALRMGSNAEFVVALLAASRADLVVVPLDPALPITEQRVRSQA
FT                   AGARVVLIDADGPHDRAEPTTRWWPLTVNVGGDSGPSGGTLSVHLDAATEPNPATSTPE
FT                   GLRPDDAMIMFTGGTTGLPKMVPWTHANIASSVRAIITGYRLSPRDATVAVMPLYHGHG
FT                   LIASLLATLASGGAVSLPARGRFSAHTFWDDIKAVGATWYTAVPTIHQILLERSATEPS
FT                   GRKPAALRFIRSCSAPLTAQAALALQTEFAAPVVCAFGMTEATHQVTTTQIEGIDQTET
FT                   PVVSTGLVGRSTGAQIRIVGSDGLPLPAGAVGEIWLRGTTVVRGYLGDPTITAANFTDG
FT                   WLRTGDLGSLSAAGDLSIRGRIKELINRGGEKISPERVEGVLASHPNVMEAAVFGVPHQ
FT                   LYGEAVAAVIVPRESAPPTREELVQFCRERLAAFEIPASFQEASGLPHTAKGSLDRRAV
FT                   AERFGHSV"
FT   gene            complement(146986..149130)
FT                   /gene="fusA2"
FT                   /locus_tag="MRA_0127"
FT   CDS_pept        complement(146986..149130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA2"
FT                   /locus_tag="MRA_0127"
FT                   /product="translation elongation factor EF-G"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71845"
FT                   /db_xref="GOA:A5TYJ5"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYJ5"
FT                   /protein_id="ABQ71845.1"
FT                   /translation="MADRVNASQGAAAAPTANGPGGVRNVVLVGPSGGGKTTLIEALLV
FT                   AAKVLSRPGSVTEGTTVCDFDEAEIRQQRSVGLAVASLAYDGIKVNLVDTPGYADFVGE
FT                   LRAGLRAADCALFVIAANEGVDEPTKSLWQECSQVGMPRAVVITKLDHARANYREALTA
FT                   AQDAFGDKVLPLYLPSGDGLIGLLSQALYEYADGKRTTRTPAESDTERIEEARGALIEG
FT                   IIEESEDESLMERYLGGETIDESVLIQDLEKAVARGSFFPVIPVCSSTGVGTLELLEVA
FT                   TRGFPSPMEHPLPEVFTPQGVPHAELACDNDAPLLAEVVKTTSDPYVGRVSLVRVFSGT
FT                   IRPDTTVHVSGHFSSFFGGGTSNTHPDHDEDERIGVLSFPLGKQQRPAAAVVAGDICAI
FT                   GKLSRAETGDTLSDKAEPLVLKPWTMPEPLLPIAIAAHAKTDEDKLSVGLGRLAAEDPT
FT                   LRIEQNQETHQVVLWCMGEAHAGVVLDTLANRYGVSVDTIELRVPLRETFAGNAKGHGR
FT                   HIKQSGGHGQYGVCDIEVEPLPEGSGFEFLDKVVGGAVPRQFIPNVEKGVRAQMDKGVH
FT                   AGYPVVDIRVTLLDGKAHSVDSSDFAFQMAGALALREAAAATKVILLEPIDEISVLVPD
FT                   DFVGAVLGDLSSRRGRVLGTETAGHDRTVIKAEVPQVELTRYAIDLRSLAHGAASFTRS
FT                   FARYEPMPESAAARVKAGAG"
FT   gene            complement(149267..149701)
FT                   /locus_tag="MRA_0128"
FT   CDS_pept        complement(149267..149701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0128"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71846"
FT                   /db_xref="GOA:A5TYJ6"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019967"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYJ6"
FT                   /protein_id="ABQ71846.1"
FT                   /translation="MGEFDPKLRFAQSPVARLATSTPDGTPHLVPVVFALGARRPAEAT
FT                   GADVIYTAVDAKRKTTQRLRRLANLEHNPRASVLVDSYADDWTQLWWVRADGVAAIHRD
FT                   GEVMRAAYRLLRAKYAQYQSVPLNGPVIAIAVQRWASWHA"
FT   gene            149850..150218
FT                   /locus_tag="MRA_0129"
FT   CDS_pept        149850..150218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71847"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYJ7"
FT                   /protein_id="ABQ71847.1"
FT                   /translation="MAGSVSAAAGIGWVGLNVTETNRDQCYRVERTTVDALTHPEYRVH
FT                   TRGVQRVRVTRNARKHRVSKHRIVAAMRHCGVPVIQEDGSLYYQGRDTSGRLTEVVAVE
FT                   ADDGDLIITHAMPKEWKR"
FT   gene            150215..150583
FT                   /locus_tag="MRA_0130"
FT   CDS_pept        150215..150583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0130"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71848"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYJ8"
FT                   /protein_id="ABQ71848.1"
FT                   /translation="MTKKPRNPADYVIGDDVEVSDVDLKQEEVYVDGERLTDERVEQMA
FT                   SESLRLAREREANLIPGGKSLSGGSAHSPAVQVVVSKATHAKLKELARSRKMSVSKLLR
FT                   PVLDEFVQRETGRILPRR"
FT   gene            150892..152355
FT                   /locus_tag="MRA_0131"
FT   CDS_pept        150892..152355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0131"
FT                   /product="PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71849"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYJ9"
FT                   /protein_id="ABQ71849.1"
FT                   /translation="MSFVSVAPEIVVAAATDLAGIGSAISAANAAAAAPTTAVLAAGAD
FT                   EVSAAIAALFSGHAQAYQALSAQAAAFHQQFVQTLAGGAGAYAAAEAQVEQQLLAAINA
FT                   PTQALLGRPLIGNGADGAPGTGQAGGAGGILYGNGGNGGSGAAGQAGGAGGPAGLIGHG
FT                   GSGGAGGSGAAGGAGGHGGWLWGNGGVGGSGGAGVGAGVAGGHGGAGGAAGLWGAGGGG
FT                   GNGGNGADANIVSGGDGGLGGAGGGGGWLYGDGGAGGHGGQGAIGLGGGAGGDGGQGGA
FT                   GRGLWGTGGAGGHGGQGGGTGGPPLPGQAGMGAAGGAGGLIGNGGAGGDGGVGASGGVA
FT                   GVGGAGGNAMLIGHGGAGGAGGDSSFVNGAAGGAGGAGGHLFGNGGSGGHGGAVTAGNT
FT                   GIGGAGGVGGDARLIGHGGAGGAGGDRAGALVGRDGGPGGNGGAGGQLYGNGGDGAPGT
FT                   GGTLQAAVSGLVTALFGAPGQPGDTGQPG"
FT   gene            152507..153574
FT                   /gene="pepA"
FT                   /locus_tag="MRA_0132"
FT   CDS_pept        152507..153574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepA"
FT                   /locus_tag="MRA_0132"
FT                   /product="putative serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71850"
FT                   /db_xref="GOA:A5TYK0"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYK0"
FT                   /protein_id="ABQ71850.1"
FT                   /translation="MSNSRRRSLRWSWLLSVLAAVGLGLATAPAQAAPPALSQDRFADF
FT                   PALPLDPSAMVAQVGPQVVNINTKLGYNNAVGAGTGIVIDPNGVVLTNNHVIAGATDIN
FT                   AFSVGSGQTYGVDVVGYDRTQDVAVLQLRGAGGLPSAAIGGGVAVGEPVVAMGNSGGQG
FT                   GTPRAVPGRVVALGQTVQASDSLTGAEETLNGLIQFDAAIQPGDSGGPVVNGLGQVVGM
FT                   NTAASDNFQLSQGGQGFAIPIGQAMAIAGQIRSGGGSPTVHIGPTAFLGLGVVDNNGNG
FT                   ARVQRVVGSAPAASLGISTGDVITAVDGAPINSATAMADALNGHHPGDVISVTWQTKSG
FT                   GTRTGNVTLAEGPPA"
FT   gene            153683..155488
FT                   /gene="treS"
FT                   /locus_tag="MRA_0133"
FT   CDS_pept        153683..155488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treS"
FT                   /locus_tag="MRA_0133"
FT                   /product="trehalose synthase TreS"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71851"
FT                   /db_xref="GOA:A5TYK1"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012810"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYK1"
FT                   /protein_id="ABQ71851.1"
FT                   /translation="MNEAEHSVEHPPVQGSHVEGGVVEHPDAKDFGSAAALPADPTWFK
FT                   HAVFYEVLVRAFFDASADGSGDLRGLIDRLDYLQWLGIDCIWLPPFYDSPLRDGGYDIR
FT                   DFYKVLPEFGTVDDFVALVDAAHRRGIRIITDLVMNHTSESHPWFQESRRDPDGPYGDY
FT                   YVWSDTSERYTDARIIFVDTEESNWSFDPVRRQFYWHRFFSHQPDLNYDNPAVQEAMID
FT                   VIRFWLGLGIDGFRLDAVPYLFEREGTNCENLPETHAFLKRVRKVVDDEFPGRVLLAEA
FT                   NQWPGDVVEYFGDPNTGGDECHMAFHFPLMPRIFMAVRRESRFPISEIIAQTPPIPDMA
FT                   QWGIFLRNHDELTLEMVTDEERDYMYAEYAKDPRMKANVGIRRRLAPLLDNDRNQIELF
FT                   TALLLSLPGSPVLYYGDEIGMGDVIWLGDRDGVRIPMQWTPDRNAGFSTANPGRLYLPP
FT                   SQDPVYGYQAVNVEAQRDTSTSLLNFTRTMLAVRRRHPAFAVGAFQELGGSNPSVLAYV
FT                   RQVAGDDGDTVLCVNNLSRFPQPIELDLQQWTNYTPVELTGHVEFPRIGQVPYLLTLPG
FT                   HGFYWFQLTTHEVGAPPTCGGERRL"
FT   gene            155591..156958
FT                   /locus_tag="MRA_0134"
FT   CDS_pept        155591..156958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0134"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71852"
FT                   /db_xref="GOA:A5TYK2"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR040999"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TYK2"
FT                   /protein_id="ABQ71852.1"
FT                   /translation="MTRSDTLATKLPWSDWLSRQRWYAGRNRELATVKPGVVVALRHNL
FT                   DLVLVDVTYTDGATERYQVLVGWDFEPASEYGTKAAIGVADDRTGFDALYDVAGPQFLL
FT                   SLIVSSAVCGTSTGEVTFTREPDVELPFAAQPRVCDAEQSNTSVIFDRRAILKVFRRVS
FT                   SGINPDIELNRVLTRAGNPHVARLLGAYQFGRPNRSPTDALAYALGMVTEYEANAAEGW
FT                   AMATASVRDLFAEGDLYAHEVGGDFAGESYRLGEAVASVHATLADSLGTAQATFPVDRM
FT                   LARLSSTVAVVPELREYAPTIEQQFQKLAAEAITVQRVHGDLHLGQVLRTPESWLLIDF
FT                   EGEPGQPLDERRAPDSPLRDVAGVLRSFEYAAYGPLVDQATDKQLAARAREWVERNRAA
FT                   FCDGYAVASGIDPRDSALLLGAYELDKAVYETGYETRHRPGWLPIPLRSIARLTAS"
FT   gene            157026..157805
FT                   /locus_tag="MRA_0135"
FT   CDS_pept        157026..157805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0135"
FT                   /product="putative conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71853"
FT                   /db_xref="GOA:A5TYK3"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYK3"
FT                   /protein_id="ABQ71853.1"
FT                   /translation="MQREIYDGEARLSWVLAALAGILGATAFTHSAGYFVTFMTGNSQR
FT                   AVLGLFGDDAWMSVTASLLILFFVAGVVIASVCRRHFWAAHPHGPTVLTTFSLIFAAGV
FT                   DIMLGGWHESMLDFVPILFVVFGIGALNTSFVKDGEVSVPLSYVTGTLVKMGQGIERHL
FT                   AGGKVEDWLGYFLLHASFVLGAAAGGAISMVVTGPQMLAVAAVVCAATTGYTYLHADRR
FT                   GLVNQKRPQPGKRLFRALRRGELDSGTSTPATNYGSS"
FT   gene            complement(157937..158959)
FT                   /gene="fbpC"
FT                   /locus_tag="MRA_0136"
FT   CDS_pept        complement(157937..158959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbpC"
FT                   /locus_tag="MRA_0136"
FT                   /product="secreted antigen 86-C FbpC"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71854"
FT                   /db_xref="GOA:A5TYK4"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYK4"
FT                   /protein_id="ABQ71854.1"
FT                   /translation="MTFFEQVRRLRSAATTLPRRLAIAAMGAVLVYGLVGTFGGPATAG
FT                   AFSRPGLPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEE
FT                   YYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTG
FT                   NAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANS
FT                   MWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYCGNGTPSDLGGDNIPAKFLEGLTLRTN
FT                   QTFRDTYAADGGRNGVFNFPPNGTHSWPYWNEQLVAMKADIQHVLNGATPPAAPAAPAA
FT                   "
FT   gene            159206..159661
FT                   /locus_tag="MRA_0137"
FT   CDS_pept        159206..159661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71855"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039375"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYK5"
FT                   /protein_id="ABQ71855.1"
FT                   /translation="MRTFESVADLAAAAGEKVGQSDWVTITQEEVNLFADATGDHQWIH
FT                   VDPERAAAGPFGTTIAHGFMTLALLPRLQHQMYTVKGVKLAINYGLNKVRFPAPVPVGS
FT                   RVRATSSLVGVEDLGNGTVQATVSTTVEVEGSAKPACVAESIVRYVA"
FT   gene            complement(159674..161017)
FT                   /gene="fadE1"
FT                   /locus_tag="MRA_0138"
FT   CDS_pept        complement(159674..161017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadE1"
FT                   /locus_tag="MRA_0138"
FT                   /product="acyl-CoA dehydrogenase FadE1"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71856"
FT                   /db_xref="GOA:A5TYK6"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYK6"
FT                   /protein_id="ABQ71856.1"
FT                   /translation="MPVRRRAGERLPTVWDFETDPQYQSKLDWVEKFMAEELEPLDLVA
FT                   LDPYDKKNADTMAILRPLQRQVKDQGLWAAHLRPELGGQGFGQVKLALLNEIIGRSRWA
FT                   PSAFGCQAPDSGNAEILALFGTDEQKARYLRPLLDGEITSCYSMTEPQGGSDPGLFVTA
FT                   ATRDAAGNGDWIINGEKWFSTNAKHASFFIVMAVTKPEARTYEKMSLFIVPADTPGIEI
FT                   VRNVGVGAESTRHASHGYIRYHDVRVPADHVLGGEGQAFMIAQTRLGGGRIHHAMRTIA
FT                   LARRAFDMMCERALSRQTRHGRLADLQMTQEKIADSWIQIEQFRLLVLRTAWLIDKHHD
FT                   YQKVRRDIAAVKVAMPQVLHDVVQRAMHLHGALGVSDEMPFVKMMLAAESLGIADGATE
FT                   LHKMTVARRTLREYQPVTTLFPSQHIPTRRAHAEAWLAQRLEHAIAEF"
FT   gene            complement(161059..162141)
FT                   /gene="fgd2"
FT                   /locus_tag="MRA_0139"
FT   CDS_pept        complement(161059..162141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fgd2"
FT                   /locus_tag="MRA_0139"
FT                   /product="putative f420-dependent glucose-6-phosphate
FT                   dehydrogenase Fgd2"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71857"
FT                   /db_xref="GOA:A5TYK7"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019945"
FT                   /db_xref="InterPro:IPR031017"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYK7"
FT                   /protein_id="ABQ71857.1"
FT                   /translation="MTGISRRTFGLAAGFGAIGAGGLGGGCSTRSGPTPTPEPASRGVG
FT                   VVLSHEQFRTDRLVAHAQAAEQAGFRYVWASDHLQPWQDNEGHSMFPWLTLALVGNSTS
FT                   SILFGTGVTCPIYRYHPATVAQAFASLAILNPGRVFLGLGTGERLNEQAATDTFGNYRE
FT                   RHDRLIEAIVLIRQLWSGERISFTGHYFRTDELKLYDTPAMPPPIFVAASGPQSATLAG
FT                   RYGDGWIAQARDINDAKLLAAFAAGAQAAGRDPTTLGKRAELFAVVGDDKAAARAADLW
FT                   RFTAGAVDQPNPVEIQRAAESNPIEKVLANWAVGTDPGVHIGAVQAVLDAGAVPFLHFP
FT                   QDDPITAIDFYRTNVLPELR"
FT   gene            162228..162833
FT                   /locus_tag="MRA_0140"
FT   CDS_pept        162228..162833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0140"
FT                   /product="putative puromycin N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71858"
FT                   /db_xref="GOA:A5TYK8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYK8"
FT                   /protein_id="ABQ71858.1"
FT                   /translation="MTPQARPARRADVRELSRTMARAFYDDPVMSWLLSNDNARTARLT
FT                   RLFATIVRHQHLAGGGVEVARGAAGIGGAALWDPPDRWRESRRQQLAMTPGFLRVFGFR
FT                   TAKARAALDVMMRVHPEEPHWYLAAIGSDPTVRGQGFGQVLMRSRLDRCDAEHCPAYLE
FT                   STKPENVPYYQRFGFRVTREIALPDAGPPLWAMWREPR"
FT   gene            163130..164032
FT                   /gene="ephF"
FT                   /locus_tag="MRA_0141"
FT   CDS_pept        163130..164032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ephF"
FT                   /locus_tag="MRA_0141"
FT                   /product="epoxide hydrolase EphF"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71859"
FT                   /db_xref="GOA:A5TYK9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYK9"
FT                   /protein_id="ABQ71859.1"
FT                   /translation="MIALPALEGVEHRHVDVAEGVRIHVADAGPADGPAVMLVHGFPQN
FT                   WWEWRDLIGPLAADGNRVLCPDLRGAGWSSAPRSRYTKTEMADDLAAVLDGLGVAKVKL
FT                   VAHDWGGPVAFIMMLRHPEKVTGFFGVNTVAPWVKRDLGMLRNMWRFWYQIPMSLPVIG
FT                   PRVISDPKGRYFRLLTGWVGGGFRVPDDDVRLYLDCMREPGHAEAGSRWYRTFQTREML
FT                   RWLRGEYNDARVDVPVRWLHGTGDPVITPDLLDGYAERASDFEVELVDGVGHWIVEQRP
FT                   ELVLDRVRAFLAAGTEQRD"
FT   gene            complement(164003..164608)
FT                   /locus_tag="MRA_0142"
FT   CDS_pept        complement(164003..164608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0142"
FT                   /product="putative transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71860"
FT                   /db_xref="GOA:A5TYL0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYL0"
FT                   /protein_id="ABQ71860.1"
FT                   /translation="MTAVAAGALVVETDSFRLRLLDGLVASIGERGYRATTVSDIVRHA
FT                   RTSKRTFYDRFTSKEQCFLELLLADNETLGNSIRAAVDPNADWHDQIRQAVEAYVTHIE
FT                   SRPAVTLSWIREFPSLGAAAYPVQRRGMEQLTSLLIELSASPGFRRANLPPLNVPLAVI
FT                   LLGGLRELTALTVEDGQPIRNIVEPAVDASIALLGPRS"
FT   gene            164725..166050
FT                   /gene="cyp138"
FT                   /locus_tag="MRA_0143"
FT   CDS_pept        164725..166050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyp138"
FT                   /locus_tag="MRA_0143"
FT                   /product="putative cytochrome p450 138 CYP138"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71861"
FT                   /db_xref="GOA:A5TYL1"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYL1"
FT                   /protein_id="ABQ71861.1"
FT                   /translation="MSEVVTAAPAPPVVRLPPAVRGPKLFQGLAFVVSRRRLLGRFVRR
FT                   YGKAFTANILMYGRVVVVADPQLARQVFTSSPEELGNIQPNLSRMFGSGSVFALDGDDH
FT                   RRRRRLLAPPFHGKSMKNYETIIEEETLRETANWPQGQAFATLPSMMHITLNAILRAIF
FT                   GAGGSELDELRRLIPPWVTLGSRLAALPKPKRDYGRLSPWGRLAEWRRQYDTVIDKLIE
FT                   AERADPNFADRTDVLALMLRSTYDDGSIMSRKDIGDELLTLLAAGHETTAATLGWAFER
FT                   LSRHPDVLAALVEEVDNGGHELRQAAILEVQRARTVIDFAARRVNPPVYQLGEWVIPRG
FT                   YSIIINIAQIHGDPDVFPQPDRFDPQRYIGSKPSPFAWIPFGGGTRRCVGAAFANMEMD
FT                   VVLRTVLRHFTLETTTAAGERSHGRGVAFTPKDGGRVVMRRR"
FT   gene            complement(166071..166619)
FT                   /gene="msrA"
FT                   /locus_tag="MRA_0144"
FT   CDS_pept        complement(166071..166619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA"
FT                   /locus_tag="MRA_0144"
FT                   /product="methionine sulfoxide reductase A"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71862"
FT                   /db_xref="GOA:A5TYL2"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TYL2"
FT                   /protein_id="ABQ71862.1"
FT                   /translation="MTSNQKAILAGGCFWGLQDLIRNQPGVVSTRVGYSGGNIPNATYR
FT                   NHGTHAEAVEIIFDPTVTDYRTLLEFFFQIHDPTTKDRQGNDRGTSYRSAIFYFDEQQK
FT                   RIALDTIADVEASGLWPGKVVTEVSPAGDFWEAEPEHQDYLQRYPNGYTCHFVRPGWRL
FT                   PRRTAESALRASLSPELGT"
FT   gene            166682..167185
FT                   /locus_tag="MRA_0145"
FT   CDS_pept        166682..167185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71863"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYL3"
FT                   /protein_id="ABQ71863.1"
FT                   /translation="MSASEFSRAELAAAFEKFEKTVARAAATRDWDCWVQHYTPDVEYI
FT                   EHAAGIMRGRQRVRAWIQETMTTFPGSHMVAFPSLWSVIDESTGRIICELDNPMLDPGD
FT                   GSVISATNISIITYAGNGQWCRQEDIYNPLRFLRAAMKWCRKAQELGTLDEDAARWMRR
FT                   HGGP"
FT   gene            167186..168208
FT                   /locus_tag="MRA_0146"
FT   CDS_pept        167186..168208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0146"
FT                   /product="dihydroflavonol 4-reductase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71864"
FT                   /db_xref="GOA:A5TYL4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYL4"
FT                   /protein_id="ABQ71864.1"
FT                   /translation="MNAPKLVIGANGFLGSHVTRQLVADCAPQKGEVRAMVRPAANTRS
FT                   IDDLPLTRFHGDVFDTATVAEAMAGCDDVYYCVVDTRAWLRDPSPLFRTNVAGLRNVLD
FT                   VATDASLRRFVFTSSYATVGRRRGHVATEEDRVDTRKVTPYVRSRVAAEDLVLQYAHDA
FT                   GLPAVAMCVSTTYGGGDWGRTPHGAFIAGAVFGRLPFTMRGIRLEAVGVDDAARALILA
FT                   AERGRNGERYLISERMMPLQEVVRIAADEAGVPPPRWSISVPVLYALGALGSLRARLTG
FT                   KDTELSLASVRMMRSEADVDHGKAVRELGWQPRPVEESIREAARFWAAMRTVGKDPAAS
FT                   "
FT   gene            168269..168649
FT                   /locus_tag="MRA_0147"
FT   CDS_pept        168269..168649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0147"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71865"
FT                   /db_xref="InterPro:IPR007361"
FT                   /db_xref="InterPro:IPR038694"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYL5"
FT                   /protein_id="ABQ71865.1"
FT                   /translation="MSNRIVLEPSADHPITIEPTNRRVQVRVNGEVVADTAAALCLQEA
FT                   SYPAVQYIPLADVVQDRLIRTETSTYCPFKGEASYYSVTTDAGDIVDDVMWTYENPYPA
FT                   VAAIAGHVACYPDKAEISIFPG"
FT   gene            complement(168630..169040)
FT                   /locus_tag="MRA_0148"
FT   CDS_pept        complement(168630..169040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71866"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYL6"
FT                   /protein_id="ABQ71866.1"
FT                   /translation="MTPFDDPQAELAWMFLQSLCEGGDLDEGFALLSNDFTYWSIVTRT
FT                   ELDKKTFRRAVERRKQVFEVNIELIRCVNEGETVVVEGHCDGVSADRTRYDSPFVCIFE
FT                   TRDGMIISLREYSDTQSLAEVYPVACATPGRC"
FT   gene            169070..169996
FT                   /locus_tag="MRA_0149"
FT   CDS_pept        169070..169996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71867"
FT                   /db_xref="GOA:A5TYL7"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYL7"
FT                   /protein_id="ABQ71867.1"
FT                   /translation="MRSIDVVVEAVVTFAGAAGFAHTLAPLRRGQQDPCFRVPGDGTIW
FT                   RTSLLPTGPVTARISRAGRDAARCVAWGSGAEEFVDMAPAMLGAADDASDFVPLHPAVA
FT                   AAHRRLPNLRLGRTGQVLEALIPAVIEQRVPGADAFRSWRLLVSKYGTQAPGPAPPGMR
FT                   VPPSAEVWRHIPSWEFHRANVDPGRARAVVGCAQRAASLERLVSLPAARAAEALTSLPG
FT                   VGVWTAAETTQRVFGDADAVSVGDYHIPKMIGWTLVGRPVDDAGMLELLEPMRPHRHRV
FT                   VRLLEASGLAREPRRGPRLPVQNIRAL"
FT   gene            complement(170063..171541)
FT                   /locus_tag="MRA_0150"
FT   CDS_pept        complement(170063..171541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0150"
FT                   /product="chloride channel"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71868"
FT                   /db_xref="GOA:A5TYL8"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYL8"
FT                   /protein_id="ABQ71868.1"
FT                   /translation="MAPGDWSVFAWHAANLPTMPEAEDIGNEAAGGRFGVSIRSAGYLR
FT                   KWFLLGITIGVIAGLGAVVFYLALKYTSEFLLGYLADYQIPTPVGEGGHRGSTGFARPW
FT                   AIPLVTTGGAVLSALIVAKLAPEATGHGTDEAIESVHGDPRAIRGRAVLVKMVASALTI
FT                   GSGGSGGREGPTAQISAGFCSLLTRRLNLSNEDGRTAVALGIGAGIGAIFAAPLGGAAL
FT                   GASIPYRDDFDYRNLLPGFIASGTAYAVLGAFLGFDPLFGYIDAEYRFEKAWPLLWFVV
FT                   IGLIAAAVGYLYARVFHASVAITRRLPGGPVLKPAIGGLLVGLLGLPIPQILSSGYGWA
FT                   QLAADRGTLLSIPLWIVIVLPIAKILATSLSIGTGGSGGLFGPGIVIGAFVGAAIWRLG
FT                   ELTELPGVPHEPGIFVVVAMMACFGSVSRAPLAVMIMVAEMTGSFSVVPGAIIAVGIAA
FT                   LLLSRTNVTIYETQRLNRQTAEAERGGSDRPTTA"
FT   gene            171643..172485
FT                   /locus_tag="MRA_0151"
FT   CDS_pept        171643..172485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0151"
FT                   /product="TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71869"
FT                   /db_xref="GOA:A5TYL9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYL9"
FT                   /protein_id="ABQ71869.1"
FT                   /translation="MPHSWTPTSVMTPPLVVAAFRPVGHYRLATDRAGGPCSPPATGAK
FT                   LTSSVASRPTVGTKPQWWHTLVMSMSLTAGRGPGRPPAAKADETRKRILHAARQVFSER
FT                   GYDGATFQEIAVRADLTRPAINHYFANKRVLYQEVVEQTHELVIVAGIERARREPTLMG
FT                   RLAVVVDFAMEADAQYPASTAFLATTVLESQRHPELSRTENDAVRATREFLVWAVNDAI
FT                   ERGELAADVDVSSLAETLLVVLCGVGFYIGFVGSYQRMATITDSFQQLLAGTLWRPPT"
FT   gene            172574..173527
FT                   /locus_tag="MRA_0152"
FT   CDS_pept        172574..173527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71870"
FT                   /db_xref="GOA:A5TYM0"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TYM0"
FT                   /protein_id="ABQ71870.1"
FT                   /translation="MTELDDVSSLPSSRRTAGDTWAITESVGATALGVAAARAVETAAT
FT                   NPLIRDEFAKVLVSSAGTAWARLADADLAWLDGDQLGRRVHRVACDYQAVRTHFFDEYF
FT                   GAAVDAGVRQVVILAAGLDARAYRLNWPAGTVVYEIDQPSVLEYKAGILQSHGAVPTAR
FT                   RHAVAVDLRDDWPAALIAAGFDGTQPTAWLAEGLLPYLPGDAADRLFDMVTALSAPGSQ
FT                   VAVEAFTMNTKGNTQRWNRMRERLGLDIDVQALTYHEPDRSDAAQWLATHGWQVHSVSN
FT                   REEMARLGRAIPQDLVDETVRTTLLRGRLVTPAQPA"
FT   gene            173570..174502
FT                   /locus_tag="MRA_0153"
FT   CDS_pept        173570..174502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71871"
FT                   /db_xref="GOA:A5TYM1"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TYM1"
FT                   /protein_id="ABQ71871.1"
FT                   /translation="MRTHDDTWDIKTSVGATAVMVAAARAVETDRPDPLIRDPYARLLV
FT                   TNAGAGAIWEAMLDPTLVAKAAAIDAETAAIVAYLRSYQAVRTNFFDTYFASAVAAGIR
FT                   QVVILASGLDSRAYRLDWPAGTIVYEIDQPKVLSYKSTTLAENGVTPSAGRREVPADLR
FT                   QDWPAALRDAGFDPTARTAWLAEGLLMYLPAEAQDRLFTQVGAVSVAGSRIAAETAPVH
FT                   GEERRAEMRARFKKVADVLGIEQTIDVQELVYHDQDRASVADWLTDHGWRARSQRAPDE
FT                   MRRVGRWVEGVPMADDPTAFAEFVTAERL"
FT   gene            174597..176117
FT                   /locus_tag="MRA_0154"
FT   CDS_pept        174597..176117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0154"
FT                   /product="putative aldehyde dehydrogenase (NAD+) dependent"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71872"
FT                   /db_xref="GOA:A5TYM2"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYM2"
FT                   /protein_id="ABQ71872.1"
FT                   /translation="MSDRVKAVAPPDGRTMMTTESVARKTQKSETEAPREPAPVSDEKQ
FT                   TDVAKTVARLRKTFASGRTRSVEWRKQQLRALQKLMDENEDAIAAALAEDLDRNPFEAY
FT                   LADIATTSAEAKYAAKRVRRWMRRRYLLLEVPQLPGRGWVEYEPYGTVLIIGAWNYPFY
FT                   LTLGPAVGAIAAGNAVVLKPSEIAAASAHLMTELVYRYLDTEAIAVVQGDGAVSQELIA
FT                   QGFDRVMFTGGTEIGRKVYEGAAPHLTPVTLELGGKSPVIVAADADVDVAAKRIAWIKL
FT                   LNAGQTCVAPDYVLADATVRDELVSKITAALTKFRSGAPQGMRIVNQRQFDRLSGYLAA
FT                   AKTDAAADGGGVVVGGDCDASNLRIQPTVVVDPDPDGPLMSNEIFGPILPVVTVKSLDD
FT                   AIRFVNSRPKPLSAYLFTKSRAVRERVIREVPAGGMMVNHLAFQVSTAKLPFGGVGASG
FT                   MGAYHGRWGFEEFSHRKSVLTKPTRPDLSSFIYPPYTERAIKVARRLF"
FT   gene            176192..177052
FT                   /locus_tag="MRA_0155"
FT   CDS_pept        176192..177052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0155"
FT                   /product="putative short-chain type
FT                   dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71873"
FT                   /db_xref="GOA:A5TYM3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYM3"
FT                   /protein_id="ABQ71873.1"
FT                   /translation="MPGVQDRVIVVTGAGGGLGREYALTLAGEGASVVVNDLGGARDGT
FT                   GAGSAMADEVVAEIRDKGGRAVANYDSVATEDGAANIIKTALDEFGAVHGVVSNAGILR
FT                   DGTFHKMSFENWDAVLKVHLYGGYHVLRAAWPHFREQSYGRVVVATSTSGLFGNFGQTN
FT                   YGAAKLGLVGLINTLALEGAKYNIHANALAPIAATRMTQDILPPEVLEKLTPEFVAPVV
FT                   AYLCTEECADNASVYVVGGGKVQRVALFGNDGANFDKPPSVQDVAARWAEITDLSGAKI
FT                   AGFKL"
FT   gene            177059..178027
FT                   /locus_tag="MRA_0156"
FT   CDS_pept        177059..178027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0156"
FT                   /product="putative quinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71874"
FT                   /db_xref="GOA:A5TYM4"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYM4"
FT                   /protein_id="ABQ71874.1"
FT                   /translation="MKACVVKELSGPSGMVYTDIDEVSGDGGKVVIDVRAAGVCFPDLL
FT                   LTKGEYQLKLTPPFVPGMETAGVVRSAPSDAGFHVGERVSAFGVLGGYAEQIAVPVANV
FT                   VRSPVELDDAGAVSLLVNYNTMYFALARRAALRPGDTVLVLGAAGGVGTAAVQIAKAMQ
FT                   AGKVIAMVHREGAIDYVASLGADVVLPLTEGWAQQVRDHTYGQGVDIVVDPIGGPTFDD
FT                   ALGVLAIDGKLLLIGFAAGAVPTLKVNRLLVRNISVVGVGWGEYLNAVPGSAALFAWGL
FT                   NQLVFLGLRPPPPQRYPLSEAQAALQSLDDGGVLGKVVLEP"
FT   gene            complement(178024..178311)
FT                   /locus_tag="MRA_0157"
FT   CDS_pept        complement(178024..178311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71875"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYM5"
FT                   /protein_id="ABQ71875.1"
FT                   /translation="MLTLPDDRAPTGLPDPGIEALAHTKIASTISTVVADGYAVVLSTA
FT                   DIANSLLANAIGYPIAASVALVTPAAGANSSCWPADPSQHHRIAESRACA"
FT   gene            complement(178903..180669)
FT                   /locus_tag="MRA_0158"
FT   CDS_pept        complement(178903..180669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0158"
FT                   /product="PE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71876"
FT                   /db_xref="GOA:A5TYM6"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="InterPro:IPR013228"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYM6"
FT                   /protein_id="ABQ71876.1"
FT                   /translation="MAPFGFTPKARHNRGVALRSTYRLDGWVMGPVDKEGWGLSYVFAQ
FT                   PSVLAAAATDLAGIGSAINQATAAVAAPTTGLAAAAADEVSTALATLFGAYGQQFQAIS
FT                   AQVAAFHNEFTQRLAAAANAFVNAEATNTSALVQEATAGLFKPTSPPVLPPMFNQNTAI
FT                   IMGGTGSPIPTPSYVNAITTLFIDPVVSNPVVKALVTPEELYPITGVKSLPFQTSVQLG
FT                   LQILDGAIWEQINAGNHVTVFGYSQSAVIASLEMQHLISLGPNAPSPSQLNFILIGNEM
FT                   NPNGGILARIPGLNVTTLGLPFYGATPDNPYPTTTYTLEYDGFADFPRYPLNVLSDINA
FT                   VFGILTVHTTYADLTPAQIASATQLPTQGTTSNTYYIIETEHLPLLAPLRAIPVIGPPL
FT                   AALVEPNLEVIVNLGYGDPRFGYSTSPANVPTPFGLFPDVPASVVADALVAGTQQGVND
FT                   FMVELPAALNTLPQTPMPAFPPYVPTLLPPPPPPQPATLINIADTFASVVSTGYSILLP
FT                   TADLGLAFVTILPAYDLTLFVNQLAAGNLRAAIELPLAATIGLAALGGMIEFIAIVVTL
FT                   ADITQQLQSFSI"
FT   gene            complement(180679..182256)
FT                   /locus_tag="MRA_0159"
FT   CDS_pept        complement(180679..182256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0159"
FT                   /product="PE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71877"
FT                   /db_xref="InterPro:IPR013228"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYM7"
FT                   /protein_id="ABQ71877.1"
FT                   /translation="MRCRPPSRNRSAHTARNTRPCSLKSRRFTVRFHQTLAAAANSYAD
FT                   AEAAIASTRQNQLAVPAAAPTPAAAAMIPPFPANLTTLFFGPTGIPLPPPSMLTPPIRC
FT                   RSVRRALQAVFTPEELYPLTGVRSLVLNTSVEEGLTILHDAIMVELATTGNAVTVFGWS
FT                   QSAIIASLEMQRFTAMGGAAPSASDLNFVLVGNEMNPNGGMLARFPDLTLPTLDLTFYG
FT                   ATPSDTIYPTAIYTLEYDGFADFSRYPLNFISDLNAVAGITFVHTKYLDLTPAQVEGAT
FT                   KLPTSPGYTGVTDYYIIRTENRPLLQPLRAVPVIGDPLADLIQPNLKVIVNLGYGDPNY
FT                   GYSTSYADVRTPFGLWPNVPPQVIADALAAGTQEGILDFTADLQALSAQPLTLPQIQLP
FT                   QPADLVAAVAAAPTPAEVVNTLARIISTNYAVLLPTVDIALALVTTLPLYTTQLFVRQL
FT                   AAGNLINAIGYPLAATVGLGTIDSGRRGIAHPPRGGLGHRSKHRGPRHLTDSRRHRRPP
FT                   TTVYRPRQ"
FT   gene            complement(182515..183345)
FT                   /gene="ptbB"
FT                   /locus_tag="MRA_0161"
FT   CDS_pept        complement(182515..183345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptbB"
FT                   /locus_tag="MRA_0161"
FT                   /product="phosphotyrosine protein phosphatase PtpB"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71878"
FT                   /db_xref="GOA:A5TYM8"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYM8"
FT                   /protein_id="ABQ71878.1"
FT                   /translation="MAVRELPGAWNFRDVADTATALRPGRLFRSSELSRLDDAGRATLR
FT                   RLGITDVADLRSSREVARRGPGRVPDGIDVHLLPFPDLADDDADDSAPHETAFKRLLTN
FT                   DGSNGESGESSQSINDAATRYMTDEYRQFPTRNGAQRALHRVVTLLAAGRPVLTHCFAG
FT                   KDRTGFVVALVLEAVGLDRDVIVADYLRSNDSVPQLRARISEMIQQRFDTELAPEVVTF
FT                   TKARLSDGVLGVRAEYLAAARQTIDETYGSLGGYLRDAGISQATVNRMRGVLLG"
FT   gene            complement(183347..184558)
FT                   /gene="fadE2"
FT                   /locus_tag="MRA_0162"
FT   CDS_pept        complement(183347..184558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadE2"
FT                   /locus_tag="MRA_0162"
FT                   /product="acyl-CoA dehydrogenase FadE2"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71879"
FT                   /db_xref="GOA:A5TYM9"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYM9"
FT                   /protein_id="ABQ71879.1"
FT                   /translation="MSAKAIDYRTRLSDFMTEHVFGAEADYDDYRRAAGPADHTAPPII
FT                   EELKTKAKDRGLWNLFLSAESGLTNLEYAPLAEMTGWSMEIAPEALNCAAPDTGNMEIL
FT                   HMFGTEQQRAQWLRPLLDGKIRSAFSMTEPAVASSDARNIETTISRDGADYVINGRKWW
FT                   TSGAADPRCKILIVMGRTNPDAAAHQQQSMVLVPIDTPGVTIVRSTPVFGWQDRHGHCE
FT                   IDYHNVRVPATNLLGEEGSGFAIAQARLGPGRIHHCMRALGAAERALALMVNRVRNRVA
FT                   FGRPLAEQGVVQQAIAQSRNEIDQARLLCEKAAWTIDQHGNKEARHLVAMIKAVAPRVA
FT                   CDVIDRAIQVHGAAGVSDDTPLARLYGWHRAMRIFDGPDEVHLRSIARAELSREKSTFA
FT                   AAVT"
FT   gene            184982..186082
FT                   /gene="pntAa"
FT                   /locus_tag="MRA_0163"
FT   CDS_pept        184982..186082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntAa"
FT                   /locus_tag="MRA_0163"
FT                   /product="putative NAD(P) transhydrogenase subunit alpha
FT                   PntAa"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71880"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYN0"
FT                   /protein_id="ABQ71880.1"
FT                   /translation="MTDPQTQSTRVGVVAESGPDERRVALVPKAVASLVNRGVAVVVEA
FT                   GAGERALLPDELYTAVGASIGDAWAADVVVKVAPPTAAEVGRLRGGQTLIGFLAPRNAD
FT                   NSIGALTQAGVQAFALEAIPRISRAQVMDALSSQANVSGYKAVLLAASESTRFFPMLTT
FT                   AAGTVKPATVLVLGVGVAGLQALATAKRLGARTTGYDVRPEVADQVRSVGAQWLDLGIS
FT                   ASGEGGYARELTDDERAQQQKALEEAISGFDVVITTALVPGRPAPTLVTAAAVEAMKPG
FT                   SVVVDLAGETGGNCELTEPGRTVVKHDVTIAAPLNLPATMPEHASELYSKNITALLDLL
FT                   IKDGRLAPDFDDEVIAQSCVTRGKDS"
FT   gene            186083..186415
FT                   /gene="pntAb"
FT                   /locus_tag="MRA_0164"
FT   CDS_pept        186083..186415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntAb"
FT                   /locus_tag="MRA_0164"
FT                   /product="putative NAD(P) transhydrogenase subunit alpha
FT                   PntAb"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71881"
FT                   /db_xref="GOA:A5TYN1"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYN1"
FT                   /protein_id="ABQ71881.1"
FT                   /translation="MYNELLENLAILVLSGFVGFAVISKVPNTLHTPLMSGTNAIHGIV
FT                   VLGALVVFGEIEHPSLVLQVILFVAVVFGTLNVIGGFIVTDRMLGMFKAKKPAVPAKPD
FT                   RDEALR"
FT   gene            186412..187839
FT                   /gene="pntB"
FT                   /locus_tag="MRA_0165"
FT   CDS_pept        186412..187839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntB"
FT                   /locus_tag="MRA_0165"
FT                   /product="NAD(P) transhydrogenase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71882"
FT                   /db_xref="GOA:A5TYN2"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYN2"
FT                   /protein_id="ABQ71882.1"
FT                   /translation="MNLHYLVEILYIISFSLFIYGLMGLTGPKTAVRGNLIAAAGMTIA
FT                   VAATLVMIRHTSQWPLIIAGLVVGVVLGVPPARLTKMTAMPQLVAFFNGVGGGTVALIA
FT                   LSEFIDTTGFSAFQHGESPTVHIVVASLFAAIIGSISFWGSIVAFGKLQEIISGRPIGL
FT                   GKAQQPINLLLLAVAVAAAVVIGLHAHPGSGGVALWWMIGLLVAAGVLGLMVVLPIGGA
FT                   DMPVVISMLNAMTGLSAAAAGLALNNTAMIVAGMIVGASGSILTNLMAKAMNRSIPAIV
FT                   AGGFGGGGVAPSGGGDDKHVKATSAADAAIQMAYANQVIVVPGYGLAVAQAQHAVKDLA
FT                   TLLEDRGVPVKYAIHPVAGRMPGHMNVLLAEAEVDYDAMKDMDDINDEFARTDVTIVIG
FT                   ANDVTNPAARNETSSPIYGMPILNVDKSRSVIVLKRSMNSGFAGIDNPLFYADGTTMLF
FT                   GDAKKSVTEVSEELKAL"
FT   gene            188145..188789
FT                   /locus_tag="MRA_0166"
FT   CDS_pept        188145..188789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0166"
FT                   /product="TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71883"
FT                   /db_xref="GOA:A5TYN3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYN3"
FT                   /protein_id="ABQ71883.1"
FT                   /translation="MPSDTSPNGLSRREELLAVATKLFAARGYHGTRMDDVADVIGLNK
FT                   ATVYHYYASKSLILFDIYRQAAEGTLAAVHDDPSWTAREALYQYTVRLLTAIASNPERA
FT                   AVYFQEQPYITEWFTSEQVAEVREKEQQVYEHVHGLIDRGIASGEFYECDSHVVALGYI
FT                   GMTLGSYRWLRPSGRRTAKEIAAEFSTALLRGLIRDESIRNQSPLGTRKET"
FT   gene            complement(188793..190199)
FT                   /locus_tag="MRA_0167"
FT   CDS_pept        complement(188793..190199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0167"
FT                   /product="PE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71884"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="InterPro:IPR013228"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYN4"
FT                   /protein_id="ABQ71884.1"
FT                   /translation="MSYVIAAPEMLATTAADVDGIGSAIRAASASAAGPTTGLLAAAAD
FT                   EVSSAAAALFSEYARECQEVLKQAAAFHGEFTRALAAAGAAYAQAEASNTAAMSGTAGS
FT                   SGALGSVGMLSGNPLTALMMGGTGEPILSDRVLAIIDSAYIRPIFGPNNPVAQYTPEQW
FT                   WPFIGNLSLDQSIAQGVTLLNNGINAELQNGHDVVVFGYSQSAAVATNEIRALMALPPG
FT                   QAPDPSRLAFTLIGNINNPNGGVLERYVGLYLPFLDMSFNGATPPDSPYQTYMYTGQYD
FT                   GYAHNPQYPLNILSDLNAFMGIRWVHNAYPFTAAEVANAVPLPTSPGYTGNTHYYMFLT
FT                   QDLPLLQPIRAIPFVGTPIAELIQPDLRVLVDLGYGYGYADVPTPASLFAPINPIAVAS
FT                   ALATGTVQGPQAALVSIGLLPQSALPNTYPYLPSANPGLMFNFGQSSVTELSVLSGALG
FT                   SVARLIPPIA"
FT   gene            complement(190291..191799)
FT                   /locus_tag="MRA_0168"
FT   CDS_pept        complement(190291..191799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0168"
FT                   /product="PE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71885"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="InterPro:IPR013228"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYN5"
FT                   /protein_id="ABQ71885.1"
FT                   /translation="MSHLVTAPDMLATAAAHVDEIASTLRAANAAAAGPTCNLLAAAGD
FT                   EVSAATAALFSAYGREYQAVVKQAAAFHSEFTRTLEAAGNAYAHAEAANAARVSHALDT
FT                   INAPIRTLLGRAPLSPNGSSGAGGLPAIAQLAAESPITALIMGGTNNPLPDPEYVTDIN
FT                   KAFIQTLFPGAVSQGLFTPEQFWPVTPDLGNLTFNQSVTEGVALLNTAVNNQLALDNKV
FT                   VAFGYSQSATIINNYINSLMAMGSPNPDDISFVMIGSGNNPVGGLLARFPGFYIPFLDV
FT                   PFNGATPANSPYPTHIYTAQYDGIAHAPQFPLRILSDINAFMGYFYVHNTYPELMATQV
FT                   DNAVPLPTSPGYTGNTQYYMFLTQDLPLLQPIRDIPYAGPPIADLFQPQLRVLVDLGYA
FT                   DYGPGGNYADIPTPAGLFSIPNPFAVTYYLIKGSLQAPYGAIVEIGVEAGLIGPEWFPD
FT                   SYPWVPSINPGLNFYFGQPQVTLLSLMSGGLGNILHLIPPPVFT"
FT   gene            191967..193316
FT                   /locus_tag="MRA_0169"
FT   CDS_pept        191967..193316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0169"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71886"
FT                   /db_xref="GOA:A5TYN6"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYN6"
FT                   /protein_id="ABQ71886.1"
FT                   /translation="MLTSLVSAVGSHHVTTDPDVLAGRSVDHTGRYRGRASALVRPGSA
FT                   EEVAEVLRVCRDAGAYVTVQGGRTSLVAGTVPEHDDVLLSTERLCVVSDVDTVERRIEI
FT                   GAGVTLAAVQHAASTAGLVFGVDLSARDTATVGGMASTNAGGLRTVRYGNMGEQVVGLD
FT                   VALPDGTVLRRHSRVRRDNTGYDLPALFVGAEGTLGVITALDLRLHPTPSHRVTAVCGF
FT                   AELAALVDAGRMFRDVEGIAALELIDGRAAALTREHLGVRPPVEADWLLLVELAADHDQ
FT                   TDRLADLLGGARMCGEPAVGVDAAAQQRLWRTRESLAEVLGVYGPPLKFDVSLPLSAIS
FT                   GFARDAVALVHRHVPDSPEALPLLFGHIGEGNLHLNVLRCPPDREPALYAKMMGLIAEC
FT                   GGNVSSEHGVGSRKRAYLGMSRQANDVAAMRRVKAALDPTGYLNAAVLFD"
FT   gene            complement(193344..194495)
FT                   /gene="adhE1"
FT                   /locus_tag="MRA_0170"
FT   CDS_pept        complement(193344..194495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adhE1"
FT                   /locus_tag="MRA_0170"
FT                   /product="zinc-type alcohol dehydrogenase subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71887"
FT                   /db_xref="GOA:A5TYN7"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYN7"
FT                   /protein_id="ABQ71887.1"
FT                   /translation="MPAVQPWLYSNMPAIRGAVLDQIGVPRPYWRSKPISVVELHLDPP
FT                   DRGEVLVRIEAAGVCHSDLSVVDGTRVRPVPILLGHEAAGIVEQVGDGVDGVAVGQRVV
FT                   LVFLPRCGQCAACATDGRTPCEPGSAANKAGTLLGGGIRLSRGGRPVYHHLGVSGFATH
FT                   VVVNRASVVPVPHEVPPTVAALLGCAVLTGGGAVLNVGDPQPGQSVAVVGLGGVGMAAV
FT                   LTALTYTDVRVVAVDQLPEKLSAAKALGAHEIYTPQQATAGGVKAAVVVEAVGHPAALH
FT                   TAIGLTAPGGRTITVGLPPPDVRISLSPLDFVTEGRSLIGSYLGSAVPSHDIPRFVSLW
FT                   QSGRLPVESLVTSTIRLDDINEAMDHLADGIAVRQLISFTGDL"
FT   gene            194477..194932
FT                   /locus_tag="MRA_0171"
FT   CDS_pept        194477..194932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71888"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYN8"
FT                   /protein_id="ABQ71888.1"
FT                   /translation="MAALPAPEKLLRSDFPVLWPVGTRWADNDMFGHLNNAVYYQLFDT
FT                   AINAWINTSTGVDPLAMPVLGIVAESGCRYFSELRFPESLMVGLAVTRLGRSSVTYRLG
FT                   VFKEPDDAGVITALGHWVHVYVDRTSRRPVPIPEAIRSLLSTACVSG"
FT   gene            194986..195471
FT                   /locus_tag="MRA_0172"
FT   CDS_pept        194986..195471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71889"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYN9"
FT                   /protein_id="ABQ71889.1"
FT                   /translation="MTAISCSPRPRYASRMPVLSKTVEVTADAASIMAIVADIERYPEW
FT                   NEGVKGAWVLARYDDGRPSQVRLDTAVQGIEGTYIHAVYYPGENQIQTVMQQGELFAKQ
FT                   EQLFSVVATGAASLLTVDMDVQVTMPVPEPMVKMLLNNVLEHLAENLKQRAEQLAAS"
FT   gene            complement(195504..196298)
FT                   /locus_tag="MRA_0173"
FT   CDS_pept        complement(195504..196298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0173"
FT                   /product="putative marr-family transcriptional regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71890"
FT                   /db_xref="GOA:A5TYP0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYP0"
FT                   /protein_id="ABQ71890.1"
FT                   /translation="MIKHDVVWVTLWPERPNNKPPPSPRQVPGNPGPTLKVLASHVNAP
FT                   LSAKPRSQLPLRRAQLSDEVAGHLRAAIMSGALRSGTFIRLDETAAELGVSVTPVREAL
FT                   LKLRGEGMVGLEPHRGHVVLPLTRQDIDDIFWLQATIAQELATSATAHITDVEIDELDR
FT                   INNALAGAIGSGDAKTIASIEFAFHRVFNKASRRIKLAWFLLNAARYMGAGVRGRPAMG
FT                   RGRGEQSSAADRRAAPPRHSRRNRAHRLAVHRWGTQADGGPG"
FT   gene            196353..198017
FT                   /gene="fadD5"
FT                   /locus_tag="MRA_0174"
FT   CDS_pept        196353..198017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD5"
FT                   /locus_tag="MRA_0174"
FT                   /product="fatty-acid-CoA ligase FadD5"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71891"
FT                   /db_xref="GOA:A5TYP1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYP1"
FT                   /protein_id="ABQ71891.1"
FT                   /translation="MTAQLASHLTRALTLAQQQPYLARRQNWVNQLERHAMMQPDAPAL
FT                   RFVGNTMTWADLRRRVAALAGALSGRGVGFGDRVMILMLNRTEFVESVLAANMIGAIAV
FT                   PLNFRLTPTEIAVLVEDCVAHVMLTEAALAPVAIGVRNIQPLLSVIVVAGGSSQDSVFG
FT                   YEDLLNEAGDVHEPVDIPNDSPALIMYTSGTTGRPKGAVLTHANLTGQAMTALYTSGAN
FT                   INSDVGFVGVPLFHIAGIGNMLTGLLLGLPTVIYPLGAFDPGQLLDVLEAEKVTGIFLV
FT                   PAQWQAVCTEQQARPRDLRLRVLSWGAAPAPDALLRQMSATFPETQILAAFGQTEMSPV
FT                   TCMLLGEDAIAKRGSVGRVIPTVAARVVDQNMNDVPVGEVGEIVYRAPTLMSCYWNNPE
FT                   ATAEAFAGGWFHSGDLVRMDSDGYVWVVDRKKDMIISGGENIYCAELENVLASHPDIAE
FT                   VAVIGRADEKWGEVPIAVAAVTNDDLRIEDLGEFLTDRLARYKHPKALEIVDALPRNPA
FT                   GKVLKTELRLRYGACVNVERRSASAGFTERRENRQKL"
FT   gene            198221..199018
FT                   /gene="yrbE1A"
FT                   /locus_tag="MRA_0175"
FT   CDS_pept        198221..199018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrbE1A"
FT                   /locus_tag="MRA_0175"
FT                   /product="conserved hypothetical integral membrane protein
FT                   YrbE1a"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71892"
FT                   /db_xref="GOA:A5TYP2"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYP2"
FT                   /protein_id="ABQ71892.1"
FT                   /translation="MTTSTTLGGYVRDQLQTPLTLVGGFFRMCVLTGKALFRWPFQWRE
FT                   FILQCWFIMRVGFLPTIMVSIPLTVLLIFTLNILLAQFGAADISGSGAAIGAVTQLGPL
FT                   TTVLVVAGAGSTAICADLGARTIREEIDAMEVLGIDPIHRLVVPRVLASMLVATLLNGL
FT                   VITVGLVGGFLFGVYLQNVSGGAYLATLTLITGLPEVVIATIKAATFGLIAGLVGCYRG
FT                   LTVRGGSKGLGTAVNETVVLCVIALFAVNVILTTIGVRFGTGR"
FT   gene            199020..199889
FT                   /gene="yrbE1B"
FT                   /locus_tag="MRA_0176"
FT   CDS_pept        199020..199889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrbE1B"
FT                   /locus_tag="MRA_0176"
FT                   /product="conserved hypothetical integral membrane protein
FT                   YrbE1b"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71893"
FT                   /db_xref="GOA:A5TYP3"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYP3"
FT                   /protein_id="ABQ71893.1"
FT                   /translation="MSTAAVLRARFPRAVANLRQYGGAAARGLDEAGQLTWFALTSIGQ
FT                   IAHALRYYRKETLRLIAQIGMGTGAMAVVGGTVAIVGFVTLSGSSLVAIQGFASLGNIG
FT                   VEAFTGFFAALINVRIAGPVVTGVALAATVGAGATAELGAMRISEEIDALEVMGIKSIS
FT                   FLASTRIMAGLVVIIPLYALAMIMSFLSPQITTTVLYGQSNGTYEHYFQTFLRPDDVFW
FT                   SFLEALIITAIVMVSHCYYGYAAGGGPVGVGEAVGRSMRFSLVSVQVVVLFAALALYGV
FT                   DPNFNLTV"
FT   gene            199894..201258
FT                   /gene="mce1A"
FT                   /locus_tag="MRA_0177"
FT   CDS_pept        199894..201258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce1A"
FT                   /locus_tag="MRA_0177"
FT                   /product="MCE-family protein Mce1A"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71894"
FT                   /db_xref="GOA:A5TYP4"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYP4"
FT                   /protein_id="ABQ71894.1"
FT                   /translation="MTTPGKLNKARVPPYKTAGLGLVLVFALVVALVYLQFRGEFTPKT
FT                   QLTMLSARAGLVMDPGSKVTYNGVEIGRVDTISEVTRDGESAAKFILDVDPRYIHLIPA
FT                   NVNADIKATTVFGGKYVSLTTPKNPTKRRITPKDVIDVRSVTTEINTLFQTLTSIAEKV
FT                   DPVKLNLTLSAAAEALTGLGDKFGESIVNANTVLDDLNSRMPQSRHDIQQLAALGDVYA
FT                   DAAPDLFDFLDSSVTTARTINAQQAELDSALLAAAGFGNTTADVFDRGGPYLQRGVADL
FT                   VPTATLLDTYSPELFCTIRNFYDADPLAKAASGGGNGYSLRTNSEILSGIGISLLSPLA
FT                   LATNGAAIGIGLVAGLIAPPLAVAANLAGALPGIVGGAPNPYTYPENLPRVNARGGPGG
FT                   APGCWQPITRDLWPAPYLVMDTGASLAPYNHMEVGSPYAVEYVWGRQVGDNTINP"
FT   gene            201255..202295
FT                   /gene="mce1B"
FT                   /locus_tag="MRA_0178"
FT   CDS_pept        201255..202295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce1B"
FT                   /locus_tag="MRA_0178"
FT                   /product="MCE-family protein Mce1B"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71895"
FT                   /db_xref="GOA:A5TYP5"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYP5"
FT                   /protein_id="ABQ71895.1"
FT                   /translation="MKITGTVVKLGIVSVVLLFFTVMIIVIFGQMRFDRTNGYTAEFSN
FT                   VSGLRQGQFVRASGVEIGKVKALHLVDGGRRVRVEFNIDRSVPLYQSTTAQIRYSDLIG
FT                   NRYVELKRGEGKGANDLLPPGGLIPLSRTSPALDLDALIGGFKPVFRALDPAKVNNIAN
FT                   ALITVFQGQGGTINDILDQTAQLTSQIAERDQAIGEVVKNLNIVLDTTVKHRKEFDETV
FT                   NNLENLITGLRNHSDQLAGGLAHISNGAGTVADLLAENRTLVRKAVSYLDAIQQPVIDQ
FT                   RVELDDLLHKTPTALTALGRANGTYGDFQNFYLCDLQIKWNGFQAGGPVRTVKLFSQPT
FT                   GRCTPQ"
FT   gene            202292..203839
FT                   /gene="mce1C"
FT                   /locus_tag="MRA_0179"
FT   CDS_pept        202292..203839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce1C"
FT                   /locus_tag="MRA_0179"
FT                   /product="MCE-family protein Mce1C"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71896"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYP6"
FT                   /protein_id="ABQ71896.1"
FT                   /translation="MRTLEPPNRMRIGLMGIVVALLVVAVGQSFTSVPMLFAKPSYYGQ
FT                   FTDSGGLHKGDRVRIAGLGVGTVEGLKIDGDHIVVKFSIGTNTIGTESRLAIRTDTILG
FT                   RKVLEIEPRGAQALPPGGVLPVGQSTTPYQIYDAFFDVTKAASGWDIETVKRSLNVLSE
FT                   TVDQTYPHLSAALDGVAKFSDTIGKRDEQITHLLAQANQVASILGDRSEQVDRLLVNAK
FT                   TLIAAFNERGRAVDALLGNISAFSAQVQNLINDNPNLNHVLEQLRILTDLLVDRKEDLA
FT                   ETLTILGRFSASFGETFASGPYFKVLLANLVPGQILQPFVDAAFKKRGISPEDFWRSAG
FT                   LPAYRWPDPNGTRFPNGAPPPPPPVLEGTPEHPGPAVPPGSPCSYTPPADGLPRPWDPL
FT                   PCANLTQGPFGGPDFPAPLDVATSPPNPDGPPPAPGLPIAGRPGEVPPNVPGTPVPIPQ
FT                   EAPPGARTLPLGPAPGPAPPPAAPGPPAPPGPGPQLPAPFINPGGTGGSGVTGGSEN"
FT   gene            203836..205428
FT                   /gene="mce1D"
FT                   /locus_tag="MRA_0180"
FT   CDS_pept        203836..205428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce1D"
FT                   /locus_tag="MRA_0180"
FT                   /product="MCE-family protein Mce1D"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71897"
FT                   /db_xref="GOA:A5TYP7"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYP7"
FT                   /protein_id="ABQ71897.1"
FT                   /translation="MSTIFDIRNLRLPQLSRASVVIGSLVVVLALAAGIVGVRLYQKLT
FT                   NNTVVAYFTQANALYVGDKVQIMGLPVGSIDKIEPAGDKMKVTFHYQNKYKVPANASAV
FT                   ILNPTLVASRNIQLEPPYRGGPVLADNAVIPVERTQVPTEWDELRDSVSHIIDELGPTP
FT                   EQPKGPFGEVIEAFADGLAGKGKQINTTLNSLSQALNALNEGRGDFFAVVRSLALFVNA
FT                   LHQDDQQFVALNKNLAEFTDRLTHSDADLSNAIQQFDSLLAVARPFFAKNREVLTHDVN
FT                   NLATVTTTLLQPDPLDGLETVLHIFPTLAANINQLYHPTHGGVVSLSAFTNFANPMEFI
FT                   CSSIQAGSRLGYQESAELCAQYLAPVLDAIKFNYFPFGLNVASTASTLPKEIAYSEPRL
FT                   QPPNGYKDTTVPGIWVPDTPLSHRNTQPGWVVAPGMQGVQVGPITQGLLTPESLAELMG
FT                   GPDIAPPSSGLQTPPGPPNAYDEYPVLPPIGLQAPQVPIPPPPPGPDVIPGPVPPTPAP
FT                   VGAPLPAEAGGGQ"
FT   gene            205425..206597
FT                   /gene="lprK"
FT                   /locus_tag="MRA_0181"
FT   CDS_pept        205425..206597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lprK"
FT                   /locus_tag="MRA_0181"
FT                   /product="MCE-family lipoprotein LprK"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71898"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYP8"
FT                   /protein_id="ABQ71898.1"
FT                   /translation="MMSVLARMRVMRHRAWQGLVLLVLALLLSSCGWRGISNVAIPGGP
FT                   GTGPGSYTIYVQMPDTLAINGNSRVMVADVWVGSIRAIKLKNWVATLTLSLKKDVTLPK
FT                   NATAKIGQTSLLGSQHVELAAPPDPSPVPLKDGDTIPLKRSSAYPTTEQTLASIATLLR
FT                   GGGLVNLEGIQQEINAIVTGRADQIRAFLGKLDTFTDELNQQRDDITRAIDSTNRLLAY
FT                   VGGRSEVLNRVLTDLPPLIKHFADKQELLINASDAVGRLSQSADQYLSAARGDLHQDLQ
FT                   ALQCPLKELRRAAPYLVGALKLILTQPFDVDTVPQLVRGDYMNLSLTLDLTYSAIDNAF
FT                   LTGTGFSGALRALEQSFGRDPETMIPDIRYTPNPNDAPGGPLVERGNRQC"
FT   gene            206591..208138
FT                   /gene="mce1F"
FT                   /locus_tag="MRA_0182"
FT   CDS_pept        206591..208138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce1F"
FT                   /locus_tag="MRA_0182"
FT                   /product="MCE-family protein Mce1F"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71899"
FT                   /db_xref="GOA:A5TYP9"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYP9"
FT                   /protein_id="ABQ71899.1"
FT                   /translation="MLTRFIRRQLILFAIVSVVAIVVLGWYYLRIPSLVGIGQYTLKAD
FT                   LPASGGLYPTANVTYRGITIGKVTAVEPTDQGARVTMSIASNYKIPVDASANVHSVSAV
FT                   GEQYIDLVSTGAPGKYFSSGQTITKGTVPSEIGPALDNSNRGLAALPTEKIGLLLDETA
FT                   QAVGGLGPALQRLVDSTQAIVGDFKTNIGDVNDIIENSGPILDSQVNTGDQIERWARKL
FT                   NNLAAQTATRDQNVRSILSQAAPTADEVNAVFSGVRDSLPQTLANLEVVFDMLKRYHAG
FT                   VEQLLVFLPQGAAIAQTVLTPTPGAAQLPLAPAINYPPPCLTGFLPASEWRSPADTSPR
FT                   PLPSGTYCKIPQDAQLQVRGARNIPCVDVLGKRAATPKECRSKDPYVPLGTNPWFGDPN
FT                   QILTCPAPGARCDQPVKPGLVIPAPSINTGLNPAPADQVQGTPPPVSDPLQRPGSGTVQ
FT                   CNGQQPNPCVYTPTSGPSAVYSPASGELVGPDGVKYAVANSSTTGDDGWKEMLAPAS"
FT   gene            208174..208815
FT                   /locus_tag="MRA_0183"
FT   CDS_pept        208174..208815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0183"
FT                   /product="putative conserved Mce associated membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71900"
FT                   /db_xref="GOA:A5TYQ0"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYQ0"
FT                   /protein_id="ABQ71900.1"
FT                   /translation="MKAADSAESDAGADQTGPQVKAADSAESDAGELGEDACPEQALVE
FT                   RRPSRLRRGWLVGIAATLLALAGGLGAAGYFALRSHQESQSIAREDLAAIEAAKDCVAA
FT                   TQAPDAGAMSASMQKIIECGTGDFGAQASLYTSMLVEAYQAASVHVQVTDMRAAVERNN
FT                   NDGSVDVLVALRVKVSNTDSDAHEVGYRLRVRMALDEGRYKIAKLDQVTK"
FT   gene            208818..209780
FT                   /locus_tag="MRA_0184"
FT   CDS_pept        208818..209780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0184"
FT                   /product="putative conserved Mce associated transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71901"
FT                   /db_xref="GOA:A5TYQ1"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYQ1"
FT                   /protein_id="ABQ71901.1"
FT                   /translation="MVVEKTPTTLPQATPNGAAPWHVRAGAFAIDVLPGLAVAATMALT
FT                   ALTVPPGSAWRWLCACLLGLTILLLAVNRLLLPTITGWSLGRALTGIRVVRRDGSAIGP
FT                   WRLLVRDLAHLVDTLSLFVGWLWPLWDSRRRTFADLLLRTEVRRVEPVQRPAVIRRLTA
FT                   AVALAAAGACASATAVGAAVVYVNEWQTDHTRAQLATRGPKLVVDVLSYDPETVQRDFE
FT                   RARSLATDRYRPQLSIQQDSVRESGPVRNQYWVTDSAVLSATPAQATMLLFMQGERGTP
FT                   PNQRYIQSTVRAIFQKSRGQWRLDDLAVVMKPRQPTGEK"
FT   gene            209777..210331
FT                   /locus_tag="MRA_0185"
FT   CDS_pept        209777..210331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0185"
FT                   /product="putative conserved Mce associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71902"
FT                   /db_xref="GOA:A5TYQ2"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYQ2"
FT                   /protein_id="ABQ71902.1"
FT                   /translation="MSPRRKFEPGEGALLAPQSIEPSRRWGLPLALTASAVVMAAAISA
FT                   CALMRISHESHQRAAHKDIVMLSDVRSFMTMFTSPDPFHANEYAERVLSHATGDFAKQY
FT                   HERANDILIRISGVEPTTGTVLDAGVQRWNEDGSANVLVVTQITSKSADGKRVVSNANR
FT                   WLVTAKQEGNEWKISSLLPVI"
FT   gene            210298..211032
FT                   /locus_tag="MRA_0186"
FT   CDS_pept        210298..211032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0186"
FT                   /product="putative conserved Mce associated membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71903"
FT                   /db_xref="GOA:A5TYQ3"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYQ3"
FT                   /protein_id="ABQ71903.1"
FT                   /translation="MEDQQSASGDLTQKSVANGESTDTASAATEGHRGEIDAAGEPDER
FT                   GAAVADSQADEDDSAATAARGGKTRARRSRGRRLAITVGVAAALFVGSAAFAGATVEPY
FT                   LSERAVVATKLMVARTAANAITTLWTYTPENMDTLADRAANYLSGDFAAQYRRFVDQIA
FT                   AANKQAKITNDTEVTGAAVESLSGRDAVAIVYTNTTTTSPVTKNIPALKYLSYRLFMKR
FT                   YDARWLVTRMTTITSLDLTPQV"
FT   gene            complement(211063..212172)
FT                   /gene="lprO"
FT                   /locus_tag="MRA_0187"
FT   CDS_pept        complement(211063..212172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lprO"
FT                   /locus_tag="MRA_0187"
FT                   /product="putative lipoprotein LprO"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71904"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYQ4"
FT                   /protein_id="ABQ71904.1"
FT                   /translation="MWIRAERVAVLTPTASLRRLTACYAALAVCAALACTTGQPAARAA
FT                   DGREMLAQAIATTRGSYLVYNFGGGHPMPLLNAGGHWYEMNNGGHLMIIKNASQRLSPH
FT                   LLVDTHTGDQARCEHNPGARTGEGLWQASEIYPPLKAWQRMGRPTIAVNANFFDVRGQK
FT                   GGSWRSTGCSSPLGAYVDNTRGQGRANQAVTGTVAYAGKQGLSGGNELWSSLTTMILPV
FT                   GGAPYVLRPKSRQDYDLATPVIEDLLNKNARFVAVAGIGLLSPGNTGQLHDGGPSAART
FT                   ALAYAKQKDEMYIFQGGNYTPDNIQDLFRGLGSDTAILLDGGGSSAIVLRRDTGGMWAG
FT                   AGSPKGSCDTRQVLCDSHERALPSWLAFN"
FT   gene            complement(212252..213610)
FT                   /locus_tag="MRA_0188"
FT   CDS_pept        complement(212252..213610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0188"
FT                   /product="putative conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71905"
FT                   /db_xref="GOA:A5TYQ5"
FT                   /db_xref="InterPro:IPR022703"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYQ5"
FT                   /protein_id="ABQ71905.1"
FT                   /translation="MSQAQPRPAAPNPKRNVKAIRTVRFWMAPIATTLALMSALAALYL
FT                   GGILNPMTNLRHFPIALVNEDAGPAGQQIVDGLVSGLDKNKFDIRVVSPDEARRLLDTA
FT                   AVYGSALIPPTFSSQLRDFGASAVTPTRTDRPAITISTNPRAGTLAASIAGQTLTRALT
FT                   VVNGKVGERLTAEVAAQTGGVALAGAAAAGLASPIDVKSTAYNPLPNGTGNGLSAFYYA
FT                   LLLLLAGFTGSIVVSTLVDSMLGYVPAEFGPVYRFAEQVNISRFRTLLVKWAVMVVLAL
FT                   LTSGVYLAIAHGLGMPIPLGWQVWLYGVFAIIAVGVTSSSLIAVLGSMGLLVSMLIFVI
FT                   LGLPSAGATVPLEAVPAFFRWLAQFEPMHQVFLGVRSLLYLNGNADAGLSQALTMTSIG
FT                   LIIGLLLGGFITHLYDRSSFHRIPGAVEMAIAVEHQAQYQARQSARESSSEQP"
FT   gene            complement(213637..214371)
FT                   /locus_tag="MRA_0189"
FT   CDS_pept        complement(213637..214371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71906"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR041602"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYQ6"
FT                   /protein_id="ABQ71906.1"
FT                   /translation="MTATVEIRRAADRAVTTTSWLKSRHSFSFGDHYDPDNTHHGLLLV
FT                   NNDDQMEPASGFDPHPHRDMEIVTWVLRGALRHQDSAGNSGVIYPGLAQRMSAGTGILH
FT                   SEMNDSATEPVHFVQMWVIPDATGITASYQQQEIDDELLRAGLVTIASGIPGQDAALTL
FT                   HNSSASLHGARLRPGATVSLPCAPFLHLFVAYGRLTLEGGGELADGDAVRFTDADARGL
FT                   TANEPSEVLIWEMHAKLGDSAT"
FT   gene            complement(214388..215500)
FT                   /gene="sigG"
FT                   /locus_tag="MRA_0190"
FT   CDS_pept        complement(214388..215500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigG"
FT                   /locus_tag="MRA_0190"
FT                   /product="RNA polymerase sigma-70 factor"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71907"
FT                   /db_xref="GOA:A5TYQ7"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014305"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYQ7"
FT                   /protein_id="ABQ71907.1"
FT                   /translation="MRTSPMPAKFRSVRVVVITGSVTAAPVRVSETLRRLIDVSVLAEN
FT                   SGREPADERRGDFSAHTEPYRRELLAHCYRMTGSLHDAEDLVQETLLRAWKAYEGFAGK
FT                   SSLRTWLHRIATNTCLTALEGRRRRPLPTGLGRPSADPSGELVERREVSWLEPLPDVTD
FT                   DPADPSTIVGNRESVRLAFVAALQHLSPRQRAVLLLRDVLQWKSAEVADAIGTSTVAVN
FT                   SLLQRARSQLQTVRPSAADRLSAPDSPEAQDLLARYIAAFEAYDIDRLVELFTAEAIWE
FT                   MPPYTGWYQGAQAIVTLIHQQCPAYSPGDMRLISLIANGQPAAAMYMRAGDVHLPFQLH
FT                   VLDMAADRVSHVVAFLDTTLFPKFGLPDSL"
FT   gene            215448..216287
FT                   /locus_tag="MRA_0191"
FT   CDS_pept        215448..216287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0191"
FT                   /product="putative lysophospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71908"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYQ8"
FT                   /protein_id="ABQ71908.1"
FT                   /translation="MTTTRTERNFAGIGDVRIVYDVWTPDTAPQAVVVLAHGLGEHARR
FT                   YDHVAQRLGAAGLVTYALDHRGHGRSGGKRVLVRDISEYTADFDTLVGIATREYPGCKR
FT                   IVLGHSMGGGIVFAYGVERPDNYDLMVLSAPAVAAQDLVSPVVAVAAKLLGVVVPGLPV
FT                   QELDFTAISRDPEVVQAYNTDPLVHHGRVPAGIGRALLQVGETMPRRAPALTAPLLVLH
FT                   GTDDRLIPIEGSRRLVECVGSADVQLKEYPGLYHEVFNEPERNQVLDDVVAWLTERL"
FT   gene            216329..217078
FT                   /locus_tag="MRA_0192"
FT   CDS_pept        216329..217078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71909"
FT                   /db_xref="InterPro:IPR024498"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYQ9"
FT                   /protein_id="ABQ71909.1"
FT                   /translation="MTNDKMLARIAALLRQAEGTDNPHEADAFMSTAQRLATAASIDLA
FT                   VARSHAGNRSPAQAPTQRTITIGAAGTRGLRTYVQLFVLIAAANDVRCDVASNSTFVYA
FT                   YGFAEDIDTSHALYASLVVQMVRASDAYLASGAHRPTPTITARLNFQLAFGARVGQRLA
FT                   DAREQTRQEATKDRDRPPGTAIALRDKDIELHEYYRRSSKARGAWRASRATAGYSSAAR
FT                   RAGDRAGRQARLGNNPELPGARAALGR"
FT   gene            217075..217584
FT                   /locus_tag="MRA_0193"
FT   CDS_pept        217075..217584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71910"
FT                   /db_xref="InterPro:IPR027595"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYR0"
FT                   /protein_id="ABQ71910.1"
FT                   /translation="MIGADVPRDSQRARVYAAEAFVRTLFDRVTAHGSPTVEFFGTQLT
FT                   LPPEGRFGSVASVQRYVDDVLALPAVGQNWPTVSPVRVRARRAATAAHYENHGGTGTIA
FT                   VPDRHTAGWAMRELVVLHEVAHHLCQVPPPHGPEFVATVCTLTELVMGPEVGHVFRVVY
FT                   AQEGVR"
FT   gene            217629..219704
FT                   /gene="bglS"
FT                   /locus_tag="MRA_0194"
FT   CDS_pept        217629..219704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglS"
FT                   /locus_tag="MRA_0194"
FT                   /product="putative beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71911"
FT                   /db_xref="GOA:A5TYR1"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYR1"
FT                   /protein_id="ABQ71911.1"
FT                   /translation="MTDDERFSLLVGLTGASDLWPVRDERIPQGVPMCAGYVPGIPRLG
FT                   VPALLMSDAGLGVTNPGYRPGDTATALPAGLALAASFNPVLARSSGKAIGREARSRGFN
FT                   VQLAGAINLARDPRNGRNFEYLSEDPLLSATMAAESIIGIQQQGVIATTKHFSLNCNET
FT                   NRHWLDAVIDPDAHRESDLLAFEIVIERSQPGAVMAAYNKVNGDYAAGNDHLLNDVLKG
FT                   AWGYRGWVMSDWGGTPSWECALAGLDQECGAQIDAVLWQSEAFTDRLRAAYADGNLPKG
FT                   RLSDMVRRILRSMFAVGIDRWKPAPAPDMNAHNEIAAQMARQGIVLLQNRGLLPLAPES
FT                   AGRIAVIGGYAHLGVPAGYGSSAVTPPGGYAGVIPIGGSGLAAGLRNLYLLPSSPLSEL
FT                   RKRLPNAQFEFDPGINPAEAVLAARRADIAIVFAIRAEGEGFDSADLSLPWGQDALIAA
FT                   VASANANTVVVLETGNPVTMPWRDSVNAIMQAWYPGQAGGQAVAEIVTGQVNPSGRLPI
FT                   TFPVDLGQTPRSQPPELGAPWGTSTTIHYTEGADVGYRWFASTNQTPMFAFGHGLSYTS
FT                   FEYRDLVVTGGHTVHASFSVTNTGDRSGADVPQLYMIAAPGESRLRLLGFERVELEPGQ
FT                   TRRVRIEADPRLLARYDGEARSWRIEPGGYTVAVGASAVALKLAAKVKLAGRGFGR"
FT   gene            220065..220727
FT                   /locus_tag="MRA_0195"
FT   CDS_pept        220065..220727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0195"
FT                   /product="O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71912"
FT                   /db_xref="GOA:A5TYR2"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYR2"
FT                   /protein_id="ABQ71912.1"
FT                   /translation="MGMDQQPNPPDVDAFLDSTLVGDDPALAAALAASDAAELPRIAVS
FT                   AQQGKFLCLLAGAIQARRVLEIGTLGGFSTIWLARGAGPQGRVVTLEYQPKHAEVARVN
FT                   LQRAGVADRVEVVVGPALDTLPTLAGGPFDLVFIDADKENNVAYIQWAIRLARRGAVIV
FT                   VDNVIRGGGILAESDDADAVAARRTLQMMGEHPGLDATAIQTVGRKGWDGFALALVR"
FT   gene            220846..221277
FT                   /locus_tag="MRA_0196"
FT   CDS_pept        220846..221277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0196"
FT                   /product="putative conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71913"
FT                   /db_xref="GOA:A5TYR3"
FT                   /db_xref="InterPro:IPR005530"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYR3"
FT                   /protein_id="ABQ71913.1"
FT                   /translation="MSTVHSSIDQHPDLLALRASFDRAAESTIAHFTFGLALLAGLYVA
FT                   ASPWIVGFSATRGLPTCDLIVGIAVAYLAYGFASALDRTHGMTWTLPVLGVWVIFSPWV
FT                   LPGVAVTAGMMWSHIIAGAVVAVLGFYFGMRTRAAANQG"
FT   gene            complement(221356..223083)
FT                   /gene="ilvD"
FT                   /locus_tag="MRA_0197"
FT   CDS_pept        complement(221356..223083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="MRA_0197"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71914"
FT                   /db_xref="GOA:A5TYR4"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYR4"
FT                   /protein_id="ABQ71914.1"
FT                   /translation="MPQTTDEAASVSTVADIKPRSRDVTDGLEKAAARGMLRAVGMDDE
FT                   DFAKPQIGVASSWNEITPCNLSLDRLANAVKEGVFSAGGYPLEFGTISVSDGISMGHEG
FT                   MHFSLVSREVIADSVEVVMQAERLDGSVLLAGCDKSLPGMLMAAARLDLAAVFLYAGSI
FT                   LPGRAKLSDGSERDVTIIDAFEAVGACSRGLMSRADVDAIERAICPGEGACGGMYTANT
FT                   MASAAEALGMSLPGSAAPPATDRRRDGFARRSGQAVVELLRRGITARDILTKEAFENAI
FT                   AVGMAFGGSTNAVLHLLAIAHEANVALSLQDFSRIGSGVPHLADVKPFGRHVMSDVDHI
FT                   GGVPVVMKALLDAGLLHGDCLTVTGHTMAENLAAITPPDPDGKVLRALANPIHPSGGIT
FT                   ILHGSLAPEGAVVKTAGFDSDVFEGTARVFDGERAALDALEDGTITVGDAVVIRYEGPK
FT                   GGPGMREMLAITGAIKGAGLGKDVLLLTDGRFSGGTTGLCVGHIAPEAVDGGPIALLRN
FT                   GDRIRLDVAGRVLDVLADPAEFASRQQDFSPPPPRYTTGVLSKYVKLVSSAAVGAVCG"
FT   gene            223231..223521
FT                   /locus_tag="MRA_0198"
FT   CDS_pept        223231..223521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71915"
FT                   /db_xref="GOA:A5TYR5"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYR5"
FT                   /protein_id="ABQ71915.1"
FT                   /translation="MTAAHGYTQQKDNYAKRLRRVEGQVRGIARMIEEDKYCIDVLTQI
FT                   SAVTSALRSVALNLLDEHLSHCVTRAVAEGGPGADGKLAEASAAIARLVRS"
FT   gene            223649..224890
FT                   /locus_tag="MRA_0199"
FT   CDS_pept        223649..224890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0199"
FT                   /product="putative conserved integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71916"
FT                   /db_xref="GOA:A5TYR6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYR6"
FT                   /protein_id="ABQ71916.1"
FT                   /translation="MTAPTGTSATTTRPWTPRIATQLSVLACAAFIYVTAEILPVGALS
FT                   AIARNLRVSVVLVGTLLSWYALVAAVTTVPLVRWTAHWPRRRALVVSLVCLTVSQLVSA
FT                   LAPNFAVLAAGRVLCAVTHGLLWAVIAPIATRLVPPSHAGRATTSIYIGTSLALVVGSP
FT                   LTAAMSLMWGWRLAAVCVTGAAAAVALAARLALPEMVLRADQLEHVGRRARHHRNPRLV
FT                   KVSVLTMIAVTGHFVSYTYIVVIIRDVVGVRGPNLAWLLAAYGVAGLVSVPLVARPLDR
FT                   WPKGAVIVGMTGLTAAFTLLTALAFGERHTAATALLGTGAIVLWGALATAVSPMLQSAA
FT                   MRSGGDDPDGASGLYVTAFQIGIMAGALLGGLLYERSLAMMLTASAGLMGVALFGMTVS
FT                   QHLFENPTLSPGDG"
FT   gene            224924..226024
FT                   /locus_tag="MRA_0200"
FT   CDS_pept        224924..226024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71917"
FT                   /db_xref="GOA:A5TYR7"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="InterPro:IPR041280"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYR7"
FT                   /protein_id="ABQ71917.1"
FT                   /translation="MPHWAEERHRRESNYVALEAGLDEGESIRRSEHSRSGCGADAGCW
FT                   RCRGGPGRGSRRSRRSRGPGGTAGPVDPPAVDLLAPPPDPLALPPALDPLAPPPPDPLA
FT                   PPPPDPLAVPVAAGPVAGQDPTSFVGPPPFRPPTFNPVDGAMVGVAKPIVINFAVPIAD
FT                   RAMAESAIHISSIPPVPGKFYWMSPTQVRWRPFEFWPANTAVNIDAAGTKSSFRTGDSL
FT                   VATADDATHQMTITRNGVVQKTFPMSMGMVSGGHQTPNGTYYVLEKFATVVMDSSTYGV
FT                   PVNSAQGYKLTVSDAVRIDNSGNFVHSAPWSVADQGKRNVTHGCINLSPANAKWFYDNF
FT                   GSGDPVVVKNSVGTYNKNDGAQDWQI"
FT   gene            complement(226084..227931)
FT                   /locus_tag="MRA_0201"
FT   CDS_pept        complement(226084..227931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71918"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYR8"
FT                   /protein_id="ABQ71918.1"
FT                   /translation="MIQISRDMSSLGQTATTQALPDNSDGIQLTKFAADDILPLEYAPP
FT                   IGPELVSQDQLPAAWAYKRFRDLDDKESYRRKLLQELTDALAAQGSEAAEIATAALRDL
FT                   IDQMAEQGAVVLADIVESDDFLELVKRYDELMAREGSRSFIHRFLDLRRSPGMLTDPAV
FT                   NGALVHPLMIALISYAVGGPIRMIDARGKDAEPLSVLAQDNMLHIDNTPFNDEYKILIT
FT                   WRRGTAQGPAGQNFTFLPGTHKLARTCFVNEDGVPWSSENASIFTTPDSIRKVFDAQRQ
FT                   LGGQDHPTVIEVTDSERPLSGVFAAGSLVHHRFRTASGSARSCIILVFHRVADNPGRMV
FT                   SDVEDSSDVSLSELLTRGVPDESYQQRFIATLCAAADEIAELLLKWKKTPQRPVSLPLQ
FT                   TKQIDGARFEEWISAATKAPEVREIRNRELTIPYGEVLSAEEFFDLIWRLMRFDKHGPL
FT                   DLILYHDNREEPRKWARNLIREMSADRLYERLLGWLADIQQPRPADCLRPLQIHALISE
FT                   VLKTLPLDEDQDPPADWHFDLLGMSHAEAARSVKHLLEDVAEALLRCEDMAAYLSTSLF
FT                   AFWAVDAAYSLDGRRNLVVKDCARRLLRHYTMLSLTCFQ"
FT   gene            228238..231822
FT                   /locus_tag="MRA_0202"
FT   CDS_pept        228238..231822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0202"
FT                   /product="drugs ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71919"
FT                   /db_xref="GOA:A5TYR9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYR9"
FT                   /protein_id="ABQ71919.1"
FT                   /translation="MRTNCWWRLSGYVMRHRRDLLLGFGAALAGTVIAVLVPLVTKRVI
FT                   DDAIAADHRPLAPWAVVLVAAAGATYLLMYVRRYYGGRIAHLVQHDLRMDAFQALLRWD
FT                   GRQQDRWSSGQLIVRTTNDLQLVQALLFDVPNVLRHVLTLLLGVAVMTWLSVPLALLAV
FT                   LLVPVIGLIAHRSRRLLAAATHCAQEHKAAVTGVVDAAVCGIRVVKAFGQEERETVKLV
FT                   TASRALYAAQLRVARLNAHFGPLLQTLPALGQMAVFALGGWMAAQGSITVGTFVAFWAC
FT                   LTLLARPACDLAGMLTIAQQARAGAVRVLELIDSRPTLVDGTKPLSPEARLSLEFQRVS
FT                   FGYVADRPVLREISLSVRAGETLAVVGAPGSGKSTLASLATRCYDVTQGAVRIGGQDVR
FT                   ELTLDSLRSAIGLVPEDAVLFSGTIGANIAYGRPDATPEQIATAARAAHIEEFVNTLPD
FT                   GYQTAVGARGLTLSGGQRQRIALARALLHQPRLLIMDDPTSAVDAVIECGIQEVLREAI
FT                   ADRTAVIFTRRRSMLTLADRVAVLDSGRLLDVGTPDEVWERCPRYRELLSPAPDLADDL
FT                   VVAERSPVCRPVAGLGTKAAQHTNVHNPGPHDHPPGPDPLRRLLREFRGPLALSLLLVA
FT                   VQTCAGLLPPLLIRHGIDVGIRRHVLSALWWAALAGTATVVIRWVVQWGSAMVAGYTGE
FT                   QVLFRLRSVVFAHAQRLGLDAFEDDGDAQIVTAVTADVEAIVAFLRTGLVVAVISVVTL
FT                   VGILVALLAIRARLVLLIFTTMPVLALATWQFRRASNWTYRRARHRLGTVTATLREYAA
FT                   GLRIAQAFRAEYRGLQSYFAHSDDYRRLGVRGQRLLALYYPFVALLCSLATTLVLLDGA
FT                   REVRAGVISVGALVTYLLYIELLYTPIGELAQMFDDYQRAAVAAGRIRSLLSTRTPSSP
FT                   AARPVGTLRGEVVFDAVHYSYRTREVPALAGINLRIPAGQTVVFVGSTGSGKSTLIKLV
FT                   ARFYDPTHGTVRVDGCDLREFDVDGYRNRLGIVTQEQYVFAGTVRDAIAYGRPDATDAQ
FT                   VERAAREVGAHPMITALDNGYLHQVTAGGRNLSAGQLQLLALARARLVDPDILLLDEAT
FT                   VALDPATEAVVQRATLTLAARRTTLIVAHGLAIAEHADRIVVLEHGTVVEDGAHTELLA
FT                   AGGHYSRLWAAHTRLCSPEITQLQCIDA"
FT   gene            232259..232894
FT                   /locus_tag="MRA_0203"
FT   CDS_pept        232259..232894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0203"
FT                   /product="LuxR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71920"
FT                   /db_xref="GOA:A5TYS0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYS0"
FT                   /protein_id="ABQ71920.1"
FT                   /translation="MAPVNVISVAVVASDPLTRDGALARLSSHRELDVRAWQAGCETSV
FT                   LLVLATTITAPLLCQIEDVQKDGPSHAPKLVVVADEFSAEQVFRMIKLGLTGLLYRSQS
FT                   TFDCIVETIRLSAEGRLRLPERVQRYLVGRIKSTPTAEPDTPCAAALAEREVAVLRLLA
FT                   DGLSTHQVAVQLNYCERTIKNIVHDIVTRLKLRNRTHAVAHALRAGLI"
FT   gene            233007..233591
FT                   /locus_tag="MRA_0204"
FT   CDS_pept        233007..233591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0204"
FT                   /product="putative transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71921"
FT                   /db_xref="GOA:A5TYS1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYS1"
FT                   /protein_id="ABQ71921.1"
FT                   /translation="MQGPRERMVVSAALLIRERGAHATAISDVLQHSGAPRGSAYHYFP
FT                   GGRTQLLCEAVDYAGEHVAAMINEAEGGLELLDALIDKYRQQLLSTDFRAGCPIAAVSV
FT                   EAGDEQDRERMAPVIARAAAVFDRWSDLTAQRFIADGIPPDRAHELAVLATSTLEGAIL
FT                   LARVRRDLTPLDLVHRQLRNLLLAELPERSR"
FT   gene            233591..235837
FT                   /locus_tag="MRA_0205"
FT   CDS_pept        233591..235837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0205"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71922"
FT                   /db_xref="GOA:A5TYS2"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYS2"
FT                   /protein_id="ABQ71922.1"
FT                   /translation="MTSSDWLPTACILCECNCGIVVQVDDRRLARIRGDKAHPGSAGYT
FT                   CNKALRLDHYQNNRARLSSPMRRRADGTYEEIDWDTAIVEIAEGFKQIRDTHGGDKIFY
FT                   YGGGGQGNHLGGAYSGAFLKALGSRYRSNALAQEKTGEAWVDFQLYGGHTRGEFENAEV
FT                   SVFVGKNPWMSQSFPRARVVLNEIAKDPGRSMIVIDPVVTDTAKMADFHLRVQPGCDAW
FT                   CLAALAAVLVQENLCNEAFLAAHVHGVDTVRAALQEVPVADYAQRCGVDEELLRAAARR
FT                   IGTAASVSVFEDLGIQQAPNSTVCSYLNKLLWILTGNFAKKGGQHLHSSFAPLFSQVSG
FT                   RTPVTGAPIIAGLIPGNVVPEEILTEHPDRFRAMIVERGNPAHSLADSAACRAAFQALE
FT                   LMVVVDVAMTETARLAHYVLPAASQFEKPEATFFNFEFPRNGFQLRRPLFPPLPGTLPE
FT                   PEIWARLVRALGVVDEADLRPLREAAAQGRQAYTEAFLAAAATNPTVAKLTAYVLYETL
FT                   GPTLPDGLAGAAALWGLAQKTAMAYPDAVRRAGHADGNALFDAILERPSGVTFTVHNYE
FT                   DDFALISHPDHKIALEIPEMLAEIRSLTQTPSRLTTPQLPIVLSVGERRAYTANDIFRD
FT                   PSWRKRDANGALRVSVEDAQALGLADGCLARITTAAGSAEATVEVTETMLAGHAALPNG
FT                   FGLDYTGDDGRTVVAGVAPNALTSTRWRDPYAGTPWHKHVPAAIRRADAESPIW"
FT   gene            complement(235878..237869)
FT                   /locus_tag="MRA_0206"
FT   CDS_pept        complement(235878..237869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0206"
FT                   /product="putative zinc metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71923"
FT                   /db_xref="GOA:A5TYS3"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042089"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYS3"
FT                   /protein_id="ABQ71923.1"
FT                   /translation="MTLAIPSGIDLSHIDADARPQDDLFGHVNGRWLAEHEIPADRATD
FT                   GAFRSLFDRAETQVRDLIIQASQAGAAVGTDAQRIGDLYASFLDEEAVERAGVQPLHDE
FT                   LATIDSAADATELAAALGTLQRAGVGGGIGVYVDTDSKDSTRYLVHFTQSGIGLPDESY
FT                   YRDEQHAAVLAAYPGHIARMFGLVYGGESRDHAKTADRIVALETKLADAHWDVVKRRDA
FT                   DLGYNLRTFAQLQTEGAGFDWVSWVTALGSAPDAMTELVVRQPDYLVTFASLWASVNVE
FT                   DWKCWARWRLIRARAPWLTRALVAEDFEFYGRTLTGAQQLRDRWKRGVSLVENLMGDAV
FT                   GKLYVQRHFPPDAKSRIDTLVDNLQEAYRISISELDWMTPQTRQRALAKLNKFTAKVGY
FT                   PIKWRDYSKLAIDRDDLYGNVQRGYAVNHDRELAKLFGPVDRDEWFMTPQTVNAYYNPG
FT                   MNEIVFPAAILQPPFFDPQADEAANYGGIGAVIGHEIGHGFDDQGAKYDGDGNLVDWWT
FT                   DDDRTEFAARTKALIEQYHAYTPRDLVDHPGPPHVQGAFTIGENIGDLGGLSIALLAYQ
FT                   LSLNGNPAPVIDGLTGMQRVFFGWAQIWRTKSRAAEAIRRLAVDPHSPPEFRCNGVVRN
FT                   VDAFYQAFDVTEDDALFLDPQRRVRIWN"
FT   gene            237912..238571
FT                   /locus_tag="MRA_0207"
FT   CDS_pept        237912..238571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0207"
FT                   /product="putative conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71924"
FT                   /db_xref="GOA:A5TYS4"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYS4"
FT                   /protein_id="ABQ71924.1"
FT                   /translation="MPDGEQSQPPAQEDAEDDSRPDAAEAAAAEPKSSAGPMFSTYGIA
FT                   STLLGVLSVAAVVLGAMIWSAHRDDSGERTYLTRVMLTAAEWTAVLINMNADNIDASLQ
FT                   RLHDGTVGQLNTDFDAVVQPYRQVVEKLRTHSSGRIEAVAIDTVHRELDTQSGAARPVV
FT                   TTKLPPFATRTDSVLLVATSVSENAGAKPQTVHWNLRLDVSDVDGKLMISRLESIR"
FT   gene            238568..239257
FT                   /locus_tag="MRA_0208"
FT   CDS_pept        238568..239257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0208"
FT                   /product="putative conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71925"
FT                   /db_xref="GOA:A5TYS5"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYS5"
FT                   /protein_id="ABQ71925.1"
FT                   /translation="MRNAWRLVVFDVLAPLATIAALAAIGVLLGWPLWWVSTCSVLVLL
FT                   VVEGVAINFWLLRRDSVTVGTDDDAPGLRLAVVFLCAAAISAAVVTGYLRWTTPDRDFN
FT                   RDSREVVHLATGMAETVASFSPSAPAAAVDRAAAMMVPEHAGGFKEQYAKSSADLARRG
FT                   VTAQAATLAAGVEAIGPSAASVAVILRVSQSIPGQPTSQAARALRVTLTKRGSGWLVLD
FT                   VTPINAR"
FT   gene            complement(239254..239757)
FT                   /locus_tag="MRA_0209"
FT   CDS_pept        complement(239254..239757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71926"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYS6"
FT                   /protein_id="ABQ71926.1"
FT                   /translation="MTLAAEPHPAPPQQPTVAWSEPDVDRRVEFWPTVAIRSALESGDI
FT                   ATWQRIAAALKRDPYGRTARQVEEVLEGIPATGIANAFWEVLDRARTHLDANERAEVAR
FT                   QVGLLLDRSGLQRQEFASRIGVTAQDLTAYLDGIVSPSASLMIRMRRLSDRFVRAKSVR
FT                   AADS"
FT   gene            complement(239754..242654)
FT                   /gene="mmpL11"
FT                   /locus_tag="MRA_0210"
FT   CDS_pept        complement(239754..242654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmpL11"
FT                   /locus_tag="MRA_0210"
FT                   /product="membrane protein MmpL11"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71927"
FT                   /db_xref="GOA:A5TYS7"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYS7"
FT                   /protein_id="ABQ71927.1"
FT                   /translation="MMRLSRNLRRCRWLVFTGWLLALVPAVYLAMTQSGNLTGGGFEVA
FT                   GSQSLLVHDQLDAHYPDRGAPALALVAAPRPDASYQDIDNAVALLRQIASELPGVTEAP
FT                   NPTQRPPQPDRPYVVSLRLDARNAGTSDVAKKLRDRIGVKGDQSGQTANGKVRLYVIGQ
FT                   GALSAAAAANTKHDIANAERWNLPIILMVLVAVFGSLAAAAIPLALAVCTVVITMGLVF
FT                   VLSMHTTMSVFVTSTVSMFGIALAVDYSLFILMRYREELRCGRRPPDAVDAAMATSGLA
FT                   VVLSGMTVIASLTGIYLINTPALRSMATGAILAVAVAMLTSATLTPAVLATFARAAAKR
FT                   SALVHWSRRPASTQSWFWSRWVGWVMRRPWITALAASTVLLVMAAPATLMVLGNSLLRQ
FT                   FDSSHEIRTGAAAAAQALGPGALGPVQVLVRFDAGGASAPEHSQTIAAIRHRIAQAPNV
FT                   VSVAPPRFADDNGSALLSAVLSVDPEDLGARDTITWMRTQLPRVAGAAQVDVGGPTALI
FT                   KDFDDRVSATQPLVLVFVAVIAFLMLLISIRSVFLAFKGVLMTLLSVAAAYGSLVMVFQ
FT                   WGWARGLGFPALHSIDSTVPPLVLAMTFGLSMDYEIFLLTRIRERFLQTGQTRDAVAYG
FT                   VRTSARTITSAALIMIAVFCGFAFAGMPLVAEIGVACAVAIAVDATVVRLVLVPALMAM
FT                   FDRWNWWLPRWLAHILPSVDFDRPLPKVDLGDVVVIPDDFAAAIPPSADVRMVLKSAAK
FT                   LKRLAPDAICVTDPLAFTGCGCDGKALDQVQLAYRNGIARAISWGQRPVHPVTVWRKRL
FT                   AVALDALQTTTWECGGVQTHRAGPGYRRRSPVETTNVALPTGDRLQIPTGAETLRFKGY
FT                   LIMSRNSSHDYADFADLVDTMAPETAAAVLAGMDRYYSCQAPGRQWMATQLVGRLADPQ
FT                   PSDLGDQSPGADAQAKWEEVRRRCLSVAVAMLEEAR"
FT   gene            242876..243286
FT                   /locus_tag="MRA_0211"
FT   CDS_pept        242876..243286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0211"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71928"
FT                   /db_xref="GOA:A5TYS8"
FT                   /db_xref="InterPro:IPR030937"
FT                   /db_xref="InterPro:IPR032407"
FT                   /db_xref="InterPro:IPR038378"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYS8"
FT                   /protein_id="ABQ71928.1"
FT                   /translation="MKTGTATTRRRLLAVLIALALPGAAVALLAEPSATGASDPCAASE
FT                   VARTVGSVAKSMGDYLDSHPETNQVMTAVLQQQVGPGSVASLKAHFEANPKVASDLHAL
FT                   SQPLTDLSTRCSLPISGLQAIGLMQAVQGARR"
FT   gene            complement(243338..244621)
FT                   /locus_tag="MRA_0212"
FT   CDS_pept        complement(243338..244621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0212"
FT                   /product="putative conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71929"
FT                   /db_xref="GOA:A5TYS9"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYS9"
FT                   /protein_id="ABQ71929.1"
FT                   /translation="MYRDYGATCTVTLKHVSHDAPARNLRQRVGALPRTRVGAPPAEGV
FT                   PPRGKYWWLRWAVLAIVAIVLAIEVALGWDQLAKAWVSLYRAKWWWLLAAVAAAGASMH
FT                   SFAQIQRTLLKSAGVHVKQWRSEAAFYAANSLSTTLPGGPVLSATFLLRQQRIWGASTV
FT                   VASWQLVMSGVLQAVGLALLGLGGAFFLGAKNNPFSLLFTLGGFVTLLLLAQAVASRPE
FT                   LIEGIGRRVLSWANSVRGRPADAGLPKWRETLMQLESVSLGRRDLGVAFGWSLFNWIAD
FT                   VACLGFAAYAAGDHASVGGLAVAYAAARAVGTIPLMPGGLLVVEAVLVPGLVSSGMPLP
FT                   SAISAMLIYRLISWLLIAAIGWVVFFFMFRTESTADSDNDRDPPTDPNLRLVIQPQGTP
FT                   CDDPVETTPQGPAPTPDLRPEGGETPPR"
FT   gene            244746..245849
FT                   /locus_tag="MRA_0213"
FT   CDS_pept        244746..245849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0213"
FT                   /product="putative conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71930"
FT                   /db_xref="GOA:A5TYT0"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYT0"
FT                   /protein_id="ABQ71930.1"
FT                   /translation="MSASLDDASVAPLVRKTAAWAWRFLVILAAMVALLWVLNKFEVIV
FT                   VPVLLALMLSALLVPPVDWLDSRGLPHAVAVTLVLLSGFAVLGGILTFVVSQFIAGLPH
FT                   LVTEVERSIDSARRWLIEGPAHLRGEQIDNAGNAAIEALRNNQAKLTSGALSTAATITE
FT                   LVTAAVLVLFTLIFFLYGGRSIWQYVTKAFPASVRDRVRAAGRAGYASLIGYARATFLV
FT                   ALTDAAGVGAGLAVMGVPLALPLASLVFFGAFIPLIGAVVAGFLAVVVALLAKGIGYAL
FT                   ITVGLLIAVNQLEAHLLQPLVMGRAVSIHPLAVVLAIAAGGVLAGVVGALLAVPTVAFF
FT                   NNAVQVLLGGNPFADVADVSSDHLTEV"
FT   gene            complement(245846..248680)
FT                   /gene="mmpL3"
FT                   /locus_tag="MRA_0214"
FT   CDS_pept        complement(245846..248680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmpL3"
FT                   /locus_tag="MRA_0214"
FT                   /product="putative conserved transmembrane transport
FT                   protein MmpL3"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71931"
FT                   /db_xref="GOA:A5TYT1"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYT1"
FT                   /protein_id="ABQ71931.1"
FT                   /translation="MFAWWGRTVYRYRFIVIGVMVALCLGGGVFGLSLGKHVTQSGFYD
FT                   DGSQSVQASVLGDQVYGRDRSGHIVAIFQAPAGKTVDDPAWSKKVVDELNRFQQDHPDQ
FT                   VLGWAGYLRASQATGMATADKKYTFVSIPLKGDDDDTILNNYKAIAPDLQRLDGGTVKL
FT                   AGLQPVAEALTGTIATDQRRMEVLALPLVAVVLFFVFGGVIAAGLPVMVGGLCIAGALG
FT                   IMRFLAIFGPVHYFAQPVVSLIGLGIAIDYGLFIVSRFREEIAEGYDTETAVRRTVITA
FT                   GRTVTFSAVLIVASAIGLLLFPQGFLKSLTYATIASVMLSAILSITVLPACLGILGKHV
FT                   DALGVRTLFRVPFLANWKISAAYLNWLADRLQRTKTREEVEAGFWGKLVNRVMKRPVLF
FT                   AAPIVIIMILLIIPVGKLSLGGISEKYLPPTNSVRQAQEEFDKLFPGYRTNPLTLVIQT
FT                   SNHQPVTDAQIADIRSKAMAIGGFIEPDNDPANMWQERAYAVGASKDPSVRVLQNGLIN
FT                   PADASKKLTELRAITPPKGITVLVGGTPALELDSIHGLFAKMPLMVVILLTTTIVLMFL
FT                   AFGSVVLPIKATLMSALTLGSTMGILTWIFVDGHFSKWLNFTPTPLTAPVIGLIIALVF
FT                   GLSTDYEVFLVSRMVEARERGMSTQEAIRIGTAATGRIITAAALIVAVVAGAFVFSDLV
FT                   MMKYLAFGLMAALLLDATVVRMFLVPSVMKLLGDDCWWAPRWARRLQTRIGLGEIHLPD
FT                   ERKRPVSNGRPARPPVTAGLVAARAAGDPRPPHDPTHPLAESPRPARSSPASSPELTPA
FT                   LEATAAPAAPSGASTTRMQIGSSTEPPTTRLAAAGRSVQSPASTPPPTPTPPSAPSAGQ
FT                   TRAMPLAANRSTDAAGDPAEPTAALPIIRSDGDDSEAATEQLNARGTSDKTRQRRRGGG
FT                   ALSAQDLLRREGRL"
FT   gene            complement(248746..249474)
FT                   /locus_tag="MRA_0215"
FT   CDS_pept        complement(248746..249474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71932"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYT2"
FT                   /protein_id="ABQ71932.1"
FT                   /translation="MSLTEDVTSQTSESLARHSVLAEDLSQDGLTSLGAPGARVLLVWD
FT                   APNLDMGLGSILGRRPTALERPRFDALGRWLLARTAEIVAGRPGISTEPEATVFTNIAP
FT                   GSAEVVRPWVDALRNVGFAVFAKPKVDEDSDVDRDMLAHIDERYREGLAALVVASADGQ
FT                   AFRQPLEAVARSGTPVQVLGFREHASWALASDTLEFVDLEDIAGVFREPLPRIGLDSLP
FT                   EQGAWLQPFRPLSSLLTSRV"
FT   gene            complement(249477..250268)
FT                   /gene="trmB"
FT                   /locus_tag="MRA_0216"
FT   CDS_pept        complement(249477..250268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmB"
FT                   /locus_tag="MRA_0216"
FT                   /product="tRNA (guanine-N7)-methyltransferase TrmB"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71933"
FT                   /db_xref="GOA:A5TYT3"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TYT3"
FT                   /protein_id="ABQ71933.1"
FT                   /translation="MVHHGQMHAQPGVGLRPDTPVASGQLPSTSIRSRRSGISKAQRET
FT                   WERLWPELGLLALPQSPRGTPVDTRAWFGRDAPVVLEIGSGSGTSTLAMAKAEPHVDVI
FT                   AVDVYRRGLAQLLCAIDKVGSDGINIRLILGNAVDVLQHLIAPDSLCGVRVFFPDPWPK
FT                   ARHHKRRLLQPATMALIADRLVPSGVLHAATDHPGYAEHIAAAGDAEPRLVRVDPDTEL
FT                   LPISVVRPATKYERKAQLGGGAVIELLWKKHGCSERDLKIR"
FT   gene            250400..251485
FT                   /locus_tag="MRA_0217"
FT   CDS_pept        250400..251485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71934"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYT4"
FT                   /protein_id="ABQ71934.1"
FT                   /translation="MRGQGHQIFVDELARFATSSADQRVVAIAQRAAEPLRVAVRGRPG
FT                   VGCRTVARALQGAGSSSGMTVTPQARAADSDVDLVVYVTVEVVKPEDREAIAATRRPVV
FT                   AVLNKADLAGPLSGAGPIVMAQARCAQFSTLLGVPMESMIGLLAVAALDDLDDTLRAVL
FT                   RALAAHPDGFDALDRAVAGFLAAALPVPTEVRLRLLDTLDLFGIALGMAAFRPGRPSRT
FT                   PAQLRTLLRRVSGVDAVIDKVTAAGSEVRYRRLLDAVAELEALAAQAKEIGGPIGEFLR
FT                   DDDTVLARMAAAVDVALAVGLDVGPLDDPAAHLPRAVRWHRYSLDNGDMHRTCGADIAR
FT                   GSLRLWSLAGGMPLHRYRKSS"
FT   gene            251482..252960
FT                   /locus_tag="MRA_0218"
FT   CDS_pept        251482..252960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71935"
FT                   /db_xref="GOA:A5TYT5"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYT5"
FT                   /protein_id="ABQ71935.1"
FT                   /translation="MIRAASDDPAGVDELVAAIAPGLAGLGLPVINRREVVLVTGPWLA
FT                   GVSGVRAALAERLPQRRFVETAELGPGDAPVAVVFVVSAATALTESDCVLLDTAAEHTD
FT                   AVVAVVSKIDVHRGWRDVLTSNRDRLAARASRYARVPWVGAAAAPELGEPYLDDLVAAI
FT                   QKQLADPAVARRNMLRAWESRLLMVARRFDGDAQSAGRRARVDALRQQRRTVLRQGRQS
FT                   KSEHTIALRAQIQHARVKLSYFARNRCSLLRVELQEHVAGLSRKDIARFAAYTRGRVQE
FT                   VVAEVGEGAVAHLADVAQLLGVPVQPPVLENLPAVLPTVVAPPLTSRRLEIRLTTLLGA
FT                   GFGLGIALTLSRLVAGLTPGLAASGMVAGVAIGLAVTAWVVNARALLHDRVVVDRWTGE
FT                   VTASLRSVVEQLVATRVVAVETLLSTAISERDDAENARVADQVSIIDGELREHAVAAAR
FT                   AAALRDREMPAVRAALEAVRAELGEPGAPTTGLF"
FT   gene            253144..254964
FT                   /gene="pckA"
FT                   /locus_tag="MRA_0219"
FT   CDS_pept        253144..254964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pckA"
FT                   /locus_tag="MRA_0219"
FT                   /product="phosphoenolpyruvate carboxykinase (GTP)"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71936"
FT                   /db_xref="GOA:A5TYT6"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="PDB:4WIE"
FT                   /db_xref="PDB:4WIU"
FT                   /db_xref="PDB:4WL8"
FT                   /db_xref="PDB:4WOU"
FT                   /db_xref="PDB:4WPT"
FT                   /db_xref="PDB:4WPU"
FT                   /db_xref="PDB:4WPV"
FT                   /db_xref="PDB:5I67"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TYT6"
FT                   /protein_id="ABQ71936.1"
FT                   /translation="MTSATIPGLDTAPTNHQGLLSWVEEVAELTQPDRVVFTDGSEEEF
FT                   QRLCDQLVEAGTFIRLNPEKHKNSYLALSDPSDVARVESRTYICSAKEIDAGPTNNWMD
FT                   PGEMRSIMKDLYRGCMRGRTMYVVPFCMGPLGAEDPKLGVEITDSEYVVVSMRTMTRMG
FT                   KAALEKMGDDGFFVKALHSVGAPLEPGQKDVAWPCSETKYITHFPETREIWSYGSGYGG
FT                   NALLGKKCYSLRIASAMAHDEGWLAEHMLILKLISPENKAYYFAAAFPSACGKTNLAML
FT                   QPTIPGWRAETLGDDIAWMRFGKDGRLYAVNPEFGFFGVAPGTNWKSNPNAMRTIAAGN
FT                   TVFTNVALTDDGDVWWEGLEGDPQHLIDWKGNDWYFRETETNAAHPNSRYCTPMSQCPI
FT                   LAPEWDDPQGVPISGILFGGRRKTTVPLVTEARDWQHGVFIGATLGSEQTAAAEGKVGN
FT                   VRRDPMAMLPFLGYNVGDYFQHWINLGKHADESKLPKVFFVNWFRRGDDGRFLWPGFGE
FT                   NSRVLKWIVDRIEHKAGGATTPIGTVPAVEDLDLDGLDVDAADVAAALAVDADEWRQEL
FT                   PLIEEWLQFVGEKLPTGVKDEFDALKERLG"
FT   gene            complement(255031..256002)
FT                   /gene="nadR"
FT                   /locus_tag="MRA_0220"
FT   CDS_pept        complement(255031..256002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadR"
FT                   /locus_tag="MRA_0220"
FT                   /product="putative transcriptional regulatory protein NadR"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71937"
FT                   /db_xref="GOA:A5TYT7"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR006417"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR016429"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038727"
FT                   /db_xref="InterPro:IPR041749"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYT7"
FT                   /protein_id="ABQ71937.1"
FT                   /translation="MTHGMVLGKFMPPHAGHVYLCEFARRWVDELTIVVGSTAAEPIPG
FT                   AQRVAWMRELFPFDRVVHLANENPQRPWEHPDFWDIWKASLQGVLATRPDFVFGAEPYN
FT                   ADFAQVLGARFVAVDHGRTVVPVTATDIRADPLGHWQHIPRCVRPAFVKRVSIIGPEST
FT                   GKTTLAQAVAEKLRTKWVPERAKMLRELNGGSLIGLEWAEIVRGQIASEEALARDADRV
FT                   LICDTDPLATTVWAEFLAGGCPQELRDLARRPYDLTLLTTPDVPWDADDGRCVPGARGT
FT                   FFARCEQALRAAGRSFVVITGGWEERLSVSLRAVEELVRARR"
FT   gene            complement(255999..257312)
FT                   /locus_tag="MRA_0221"
FT   CDS_pept        complement(255999..257312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0221"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71938"
FT                   /db_xref="GOA:A5TYT8"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYT8"
FT                   /protein_id="ABQ71938.1"
FT                   /translation="MSIKAYAKTQGIAVTSVNGLVAGHGSVQETWLAMQSAAALSGTPR
FT                   LVGFSCIDTFPEVLWLAQRARQAWDGVRIVIGNAMATLNYERILRQHDCFDYVVVGDGE
FT                   VAFTKLALALANDAAVDDVPGLARRSEQGQILRTPSSLVDLDELPRPARDELPTVLADG
FT                   FAASVFSTRGCPYRCTFCGTGAMSAMLGKDSYRAKSVDAVVDEIDYLVSDYDVNFLSIT
FT                   DDLFISKHPGSQQRAADFANAVLRRGISVNFMVDIRLDSVVDLDLFKHLHRAGLRRVFI
FT                   GVETGSYEQLRAYRKQILTRGQDAADTINALQQLGIDVIPGTIMFHPTVQPDELRETVR
FT                   LLRATKYTVGFKFMSRIVPYPGTPLYQAYSDAGYLTAKWPLGQWEFVDPEASRVYADVV
FT                   AKVAPDVGISFDEAEAYFLSRLDEWENVIAGRIAEATS"
FT   gene            257426..259039
FT                   /gene="fadD4"
FT                   /locus_tag="MRA_0222"
FT   CDS_pept        257426..259039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD4"
FT                   /locus_tag="MRA_0222"
FT                   /product="fatty-acid-CoA ligase FadD4"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71939"
FT                   /db_xref="GOA:A5TYT9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYT9"
FT                   /protein_id="ABQ71939.1"
FT                   /translation="MPRGELYKRFRLVMGGIAPCGSGRRAATYPRRMQIRPYIGADKPA
FT                   VILYPSGTVISFDELEARANRLAHWFRQAGLREDDVVAILMENNEHVHAVMWAARRSGL
FT                   YYVPINTHLTASEAAYIVDNSGAKAIVGSAALRETCHGLAEHLPGGLPDLLMLAGGGLV
FT                   GWMTYPECVADQPDTPIEDEREGDLLQYSSGTTGRPKGIKRELPHVSPDAAPGMMPALL
FT                   DFWMDADSVYLSPAPMYHTAPSVWTMSALAAGVTTVVMEKFDAEGALDAIQRYRVTHAQ
FT                   FVPAMFVRMLKLPEAVRNSYDMSSLRRVIHAAAPCPVQIKEQMIHWWGPIIDEYYASSE
FT                   ASGSTLITAEDWLTHPGSVGKPIQGGVHIVGADGSELPPNQPGEIYFEGGYPFEYLNDP
FT                   AKTAASRNKHGWVTVGDVGYLDDDGYLFLTGRRHHMIISGGVNIYPQEAENLLVAHPKV
FT                   LDAAVFGVPDDEMGQRVMAAVQTVDSADANDQFAGELLAWLRDRLSHFKCPRSIAFEPQ
FT                   LPRTDTGKLYKSGLVEKYSV"
FT   gene            complement(259145..260218)
FT                   /gene="fadE3"
FT                   /locus_tag="MRA_0223"
FT   CDS_pept        complement(259145..260218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadE3"
FT                   /locus_tag="MRA_0223"
FT                   /product="acyl-CoA dehydrogenase FadE3"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71940"
FT                   /db_xref="GOA:A5TYU0"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYU0"
FT                   /protein_id="ABQ71940.1"
FT                   /translation="MRNELNDDEAMLVATVRAFIDRDVKPTVREVEHANSYPEAWIEQM
FT                   KHIGIYGLAIDEQYGGSPVSMPCYVQVTQELARGWMSLAGAMGGHTVVAKLLTLFGTEE
FT                   QRRTYLPPMASGELRATMALTEPGGGSDLQNMSTTALADGPEGSAGLLINGCKTWISNA
FT                   RRSGLFAVLCKTDPNATPRHQGMSIVLVEPGPGLTVSRDLPKLGYKGVESCELSFDNLR
FT                   VPVSAILGGAMGQGFSQMMKGLETGRIQVAARALGVATAALEDSLAYAQQRESFGRPIW
FT                   QHQAVGNYLADMATKLTAARQLTRYAAERYDSGQRCDMEAGMAKLFASEVAMEIALNAV
FT                   RIHGGYGYSTEYDVERR"
FT   gene            260275..261288
FT                   /locus_tag="MRA_0224"
FT   CDS_pept        260275..261288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71941"
FT                   /db_xref="InterPro:IPR016790"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYU1"
FT                   /protein_id="ABQ71941.1"
FT                   /translation="MASGYGGIRVGGPYFDDLSKGQVFDWAPGVTLSLGLAAAHQSIVG
FT                   NRLRLALDSDLCAAVTGMPGPLAHPGLVCDVAIGQSTLATQRVKANLFYRGLRFHRFPA
FT                   VGDTLYTRTEVVGLRANSPKPGRAPTGLAGLRMTTIDRTDRLVLDFYRCAMLPASPDWK
FT                   PGAVPGDDLSRIGADAPAPAADPTAHWDGAVFRKRVPGPHFDAGIAGAVLHSTADLVSG
FT                   APELARLTLNIAATHHDWRVSGRRLVYGGHTIGLALAQATRLLPNLATVLDWESCDHTA
FT                   PVHEGDTLYSELHIESAQAHADGGVLGLRSLVYAVSDSASEPDRQVLDWRFSALQF"
FT   gene            complement(261285..262193)
FT                   /gene="lipW"
FT                   /locus_tag="MRA_0225"
FT   CDS_pept        complement(261285..262193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipW"
FT                   /locus_tag="MRA_0225"
FT                   /product="putative esterase LipW"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71942"
FT                   /db_xref="GOA:A5TYU2"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYU2"
FT                   /protein_id="ABQ71942.1"
FT                   /translation="MSGNEVHPDLRRIAVVTPRQLVGPRTLPVMRALIVVAGLRMSRTP
FT                   PDIEVLTLESGVGVRLYRPAGSNEPAPALLWIHAGGYVMGTAQQDDRLCLRFSSRLGIT
FT                   VASVDYRLAPENPYPAALGDCYSALTWLASLPAVDPARVAIGGASAGGGLAAALALLAR
FT                   DRGGITPAFQLLVYPMLDDRPSIAPANPHYRLWNGRANRFGWRAYLGDADARVAVPGRR
FT                   DDLGGLAPAWIGVGTHDLLHDEDLAYAERLTAAGVPCQVEVVEGAFHGFDRVAPNVGVS
FT                   QRFFTSQCNSLRAALALSNRT"
FT   gene            262286..263614
FT                   /locus_tag="MRA_0226"
FT   CDS_pept        262286..263614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0226"
FT                   /product="putative conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71943"
FT                   /db_xref="GOA:A5TYU3"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYU3"
FT                   /protein_id="ABQ71943.1"
FT                   /translation="MSDPARGAEAEDAYGFPAGLWRWLQRHPPPALHRLTRFRSPLRGP
FT                   WLTSVFGLVLLVALPFVIITGLLSYIAYAPQLGQAIPGDVGWLRLPAFTWPTRPSWLYR
FT                   LTQGLHVGLGLVIIPVVLAKLWSVIPRLFVWPPARSIAQVLERLSVLMLVGGILFQIVT
FT                   GVLNIQYDYIFGFSFYTGHYFGAWVFIAGFLLHIVVKIPHMVTGLRSIPMREVLGTNVA
FT                   DTRAQPCDPDGLVSVNPGEATLSRRGALGLVGAGVLLIGVLTVGQTLGGFTRKAALLLP
FT                   RGRVVSPGDFPVNKTAAAAGITAEAIGPDWRLVLCGGPAEVVLDRATLAGLPQRTARLP
FT                   LACVEGWSAVRTWSGVPLAELALLAGVPAARSARVTSLQRGGAFGEAKLAANQIADPDA
FT                   LLALRVDGADLSLDHGYPARIIVPALPGVHNTKWVAGIEFHKR"
FT   gene            263616..264164
FT                   /locus_tag="MRA_0227"
FT   CDS_pept        263616..264164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0227"
FT                   /product="putative conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71944"
FT                   /db_xref="GOA:A5TYU4"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYU4"
FT                   /protein_id="ABQ71944.1"
FT                   /translation="MFDIATRFKNSYGSGPLHLLAMVSGFALLGYIVATARPSALWNQA
FT                   TWWQSIAVWFVAAVVAHDLLLYPLYALADRILARLVGRRDVSAPRRRPELPVRNYIRIP
FT                   ALAAGLTLLVFLPGIIRQGAPTYLDATGQTQEPFLGRWLLLTAVAFGISAAAYAIRLVV
FT                   AHVRRRRAGCSRVDAIDEE"
FT   gene            264174..265385
FT                   /gene="lipC"
FT                   /locus_tag="MRA_0228"
FT   CDS_pept        264174..265385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipC"
FT                   /locus_tag="MRA_0228"
FT                   /product="esterase LipC"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71945"
FT                   /db_xref="GOA:A5TYU5"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYU5"
FT                   /protein_id="ABQ71945.1"
FT                   /translation="MNQRRAAGSTGVAYIRWLLRARPADYMLALSVAGGSLPVVGKHLK
FT                   PLGGVTAIGVWGARHASDFLSATAKDLLTPGINEVRRRDRASTQEVSVAALRGIVSPDD
FT                   LAVEWPAPERTPPVCGALRHRRYVHRRRVLYGDDPAQLLDVWRRKDMPTKPAPVLIFVP
FT                   GGAWVHGSRAIQGYAVLSRLAAQGWVCLSIDYRVAPHHRWPRHILDVKTAIAWARANVD
FT                   KFGGDRNFIAVAGCSAGGHLSALAGLTANDPQYQAELPEGSDTSVDAVVGIYGRYDWED
FT                   RSTPERARFVDFLERVVVQRTIDRHPEVFRDASPIQRVTRNAPPFLVIHGSRDCVIPVE
FT                   QARSFVERLRAVSRSQVGYLELPGAGHGFDLLDGARTGPTAHAIALFLNQVHRSRAQFA
FT                   KEVI"
FT   gene            265429..266838
FT                   /locus_tag="MRA_0229"
FT   CDS_pept        265429..266838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71946"
FT                   /db_xref="GOA:A5TYU6"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="InterPro:IPR014292"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYU6"
FT                   /protein_id="ABQ71946.1"
FT                   /translation="MKRLSGWDAVLLYSETPNVHMHTLKVAVIELDSDRQEFGVDAFRE
FT                   VIAGRLHKLEPLGYQLVDVPLKFHHPMWREHCQVDLNYHIRPWRLRAPGGRRELDEAVG
FT                   EIASTPLNRDHPLWEMYFVEGLANHRIAVVAKIHHALADGVASANMMARGMDLLPGPEV
FT                   GRYVPDPAPTKRQLLSAAFIDHLRHLGRIPATIRYTTQGLGRVRRSSRKLSPALTMPFT
FT                   PPPTFMNHRLTPERRFATATLALIDVKATAKLLGATINDMVLAMSTGALRTLLLRYDGK
FT                   AEPLLASVPVSYDFSPERISGNRFTGMLVALPADSDDPLQRVRVCHENAVSAKESHQLL
FT                   GPELISRWAAYWPPAGAEALFRWLSERDGQNKVLNLNISNVPGPRERGRVGAALVTEIY
FT                   SVGPLTAGSGLNITVWSYVDQLNISVLTDGSTVQDPHEVTAGMIADFIEIRRAAGLSVE
FT                   LTVVESAMAQA"
FT   gene            266869..267657
FT                   /gene="echA1"
FT                   /locus_tag="MRA_0230"
FT   CDS_pept        266869..267657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="echA1"
FT                   /locus_tag="MRA_0230"
FT                   /product="enoyl-CoA hydratase EchA1"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71947"
FT                   /db_xref="GOA:A5TYU7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYU7"
FT                   /protein_id="ABQ71947.1"
FT                   /translation="MSSESDAANTEPEVLVEQRDRILIITINRPKAKNAVNAAVSRGLA
FT                   DAMDQLDGDAGLSVAILTGGGGSFCAGMDLKAFARGENVVVEGRGLGFTERPPTKPLIA
FT                   AVEGYALAGGTELALAADLIVAARDSAFGIPEVKRGLVAGGGGLLRLPERIPYAIAMEL
FT                   ALTGDNLPAERAHELGLVNVLAEPGTALDAAIALAEKITANGPLAVVATKRIITESRGW
FT                   SPDTMFAEQMKILVPVFTSNDAKEGAIAFAERRRPRWTGT"
FT   gene            complement(267663..269126)
FT                   /locus_tag="MRA_0231"
FT   CDS_pept        complement(267663..269126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0231"
FT                   /product="aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71948"
FT                   /db_xref="GOA:A5TYU8"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYU8"
FT                   /protein_id="ABQ71948.1"
FT                   /translation="MSDSATEYDKLFIGGKWTKPSTSDVIEVRCPATGEYVGKVPMAAA
FT                   ADVDAAVAAARAAFDNGPWPSTPPHERAAVIAAAVKMLAERKDLFTKLLAAETGQPPTI
FT                   IETMHWMGSMGAMNYFAGAADKVTWTETRTGSYGQSIVSREPVGVVGAIVAWNVPLFLA
FT                   VNKIAPALLAGCTIVLKPAAETPLTANALAEVFAEVGLPEGVLSVVPGGIETGQALTSN
FT                   PDIDMFTFTGSSAVGREVGRRAAEMLKPCTLELGGKSAAIILEDVDLAAAIPMMVFSGV
FT                   MNAGQGCVNQTRILAPRSRYDEIVAAVTNFVTALPVGPPSDPAAQIGPLISEKQRTRVE
FT                   GYIAKGIEEGARLVCGGGRPEGLDNGFFIQPTVFADVDNKMTIAQEEIFGPVLAIIPYD
FT                   TEEDAIAIANDSVYGLAGSVWTTDVPKGIKISQQIRTGTYGINWYAFDPGSPFGGYKNS
FT                   GIGRENGPEGVEHFTQQKSVLLPMGYTVA"
FT   gene            complement(269225..269989)
FT                   /locus_tag="MRA_0232"
FT   CDS_pept        complement(269225..269989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0232"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71949"
FT                   /db_xref="GOA:A5TYU9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TYU9"
FT                   /protein_id="ABQ71949.1"
FT                   /translation="MAVTDVFARRATLRRSLRLLADFRYEQRDPARFYRTLAADTAAMI
FT                   GDLWLATHSEPPVGRTLLDVGGGPGYFATAFSDAGVGYIGVEPDPDEMHAAGPAFTGRP
FT                   GMFVRASGMALPFADDSVDICLSSNVAEHVPRPWQLGTEMLRVTKPGGLVVLSYTVWLG
FT                   PFGGHEMGLSHYLGGARAAARYVRKHGHPAKNNYGSSLFAVSAAEGLRWAAGTGAALAV
FT                   FPRYHPRWAWWLTSVPVLREFLVSNLVLVLTP"
FT   gene            270025..271179
FT                   /locus_tag="MRA_0233"
FT   CDS_pept        270025..271179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0233"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71950"
FT                   /db_xref="GOA:A5TYV0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYV0"
FT                   /protein_id="ABQ71950.1"
FT                   /translation="MSALRSVLLLCWRDIGHPQGGGSEAYLQRIGAQLAASGIAVTLRT
FT                   ARYPGAPRHELVDGVRISRAGGRYSVYLWALLAMAAARCGLGPLRRVRPDVVVDTQNGW
FT                   PFVARLLYGRRSLVLVHHCHREQWPVAGRMMGRLGWYVESMLSPRLHRRNQYVTVSLPS
FT                   ARDLIALGVDSERIAVVRNGLDEAPSPTLSGPRAPTPRVVVLSRLVPHKQIEDALAAVA
FT                   ELQPRIPGLHLDIVGGGWWRQRLVDHVHRLDIADAVTFHGHVDDVTKHHVLQSSWVHLL
FT                   PSRKEGWGLAVIEAAQHGVPTIGYRSSGGLADSIVDGVTGILVDDRAELVAWLEQLLSD
FT                   SVLRDQLGAKAQARSGEFSWRQSAEALRSVLEAVQASRFVSGVV"
FT   gene            complement(271196..272926)
FT                   /locus_tag="MRA_0234"
FT   CDS_pept        complement(271196..272926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0234"
FT                   /product="putative conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71951"
FT                   /db_xref="GOA:A5TYV1"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYV1"
FT                   /protein_id="ABQ71951.1"
FT                   /translation="MRWFRPGYALVLVLLLAAPLLRPGYLLLRDAVSTPRSYVSANALG
FT                   LTSAPRATPQDFAVALASHLVDGGVVVKALLLLGLWLAGWGAARLVATALPAAGAAGQF
FT                   VAITLAIWNPYVAERLLQGHWSLLVGYGCLPWVATAMLTMRTTVGAGWFGLFGLAFWVA
FT                   LAGLTPSGLLLAATVAVVCVAMPGAGRPRWQCGVAALGSALVGALPWLTASALGSSLTS
FT                   HTAANQLGVTAFAPRAEPGLGTLGSLASLGGIWNGEAVPSSRTTLFAVASAVVLLAMVA
FT                   IGLPTVARRPVAVPLLTLAAVSVMVPAVLATGPGLHALRVVVDAAPGLGVLRDGQKWVA
FT                   LAVPGYTLSGAGTVLTLRRWLRPATAAVVCCLALVLTLPDLAWGVWGKVAPVHYPSGWA
FT                   AVAAAINADPRTVAVLPAGTMRRFSWSGSAPVLDPLPRWVRADVLTTGDLVISGVTVPG
FT                   EDAHARAVQELLLTGPHPSTLAAAGVGWLVVESDSAGDMGAAARTLGRLAAAHRDDELA
FT                   LYRVGGQTSGASSARLKATMLAHWAWLSMLLVGGAGAAGYWVRRHLHHCEDTPASRAQD
FT                   "
FT   gene            complement(272936..274201)
FT                   /locus_tag="MRA_0235"
FT   CDS_pept        complement(272936..274201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0235"
FT                   /product="putative conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71952"
FT                   /db_xref="GOA:A5TYV2"
FT                   /db_xref="InterPro:IPR021424"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYV2"
FT                   /protein_id="ABQ71952.1"
FT                   /translation="MLRFAACGAIGLGAALLIAALLLSTYTTSRIAEIPLDIDATLISD
FT                   GTGTALDSASLATEHIVVNQDVPLVSQQQVTVESPANADVVTLQVGSSLRRTDKQKDSG
FT                   LLLAIVDTVTLNRKTAMAVSDDTHTGGAVQKPRGLNDENPPTAIPLRHDGLSYRFPFHT
FT                   EKKTYPYFDPIAQKAFDANYEGEEDVNGLTTYRFTQNVGYTPEGKLVAPLKYPSLYAGD
FT                   EDGKVTTSAAMWGLPGDPNEQITMTRYYAAQRTFWVDPVSGTIVKETERANHYFARDPL
FT                   KPEVTFADYQVTSTEETVESQVNAARDERDRLALWSRVLPITFTAAGLVALVGGGLFAS
FT                   FSLRTEGALMAASGDRDDHDYRRGGFEEPVPGAEAETEKLPTQRPDFPREPSGSDPPRL
FT                   GSAQPPPPPDAGHPDPGPPERR"
FT   gene            274417..275640
FT                   /locus_tag="MRA_0236"
FT   CDS_pept        274417..275640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0236"
FT                   /product="putative integral membrane acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71953"
FT                   /db_xref="GOA:A5TYV3"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYV3"
FT                   /protein_id="ABQ71953.1"
FT                   /translation="MGPADESGAPIRPQTPHRHTVLVTNGQVVGGTRGFLPAVEGMRAC
FT                   AAVGVVVTHVAFQTGHSSGVGGRLFGRFDLAVAVFFAVSGFLLWRGHAAAARDLRSHPR
FT                   TGPYLRSRVARIMPAYVVAVVVILSLLPDADHASLTVWLANLTLTQIYVPLTLTGGLTQ
FT                   MWSLSVEVAFYAALPVLALLGRRIPVGARVPAIAALAALSWAWGWLPLDAGSGINPLTW
FT                   PPAFFSWFAAGMLLAEWAYSPVGLPHRWARRRVAMAVTALLGYLVAASPLAGPEGLVPG
FT                   TAAQFAVKTAMGSLVAFALVAPLVLDRPDTSHRLLGSPAMVTLGRWSYGLFIWHLAALA
FT                   MVFPVIGAFPFTGRMPTVLVLTLIFGFAIAAVSYALVESPCREALRRWERRNEPISVGE
FT                   LQADAIAP"
FT   gene            complement(275668..276348)
FT                   /locus_tag="MRA_0237"
FT   CDS_pept        complement(275668..276348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0237"
FT                   /product="putative conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71954"
FT                   /db_xref="GOA:A5TYV4"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYV4"
FT                   /protein_id="ABQ71954.1"
FT                   /translation="MRQPRRANAMGLALCIYIGSLLIYTPIHGETSRRHRRAGFKHGSY
FT                   RIGHDDDQRHRQRGPAASHVSASSTRRRRSRHAGRRTARGPRRSMALKYLLDTSVIKRL
FT                   SRPAVRRAVEPLAEAGAVARTQITDLEVGYSARNETEWQRLMVALSAFDLIESTASHHR
FT                   RALGIQRLLAARSQRGRKIPDLLIAAAGEEHGLVVLHYDADFDLIAAVTGQPCQWIVPA
FT                   GTID"
FT   gene            complement(276345..277325)
FT                   /gene="php"
FT                   /locus_tag="MRA_0238"
FT   CDS_pept        complement(276345..277325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="php"
FT                   /locus_tag="MRA_0238"
FT                   /product="phosphotriesterase"
FT                   /note="parathion hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71955"
FT                   /db_xref="GOA:A5TYV5"
FT                   /db_xref="InterPro:IPR001559"
FT                   /db_xref="InterPro:IPR017947"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYV5"
FT                   /protein_id="ABQ71955.1"
FT                   /translation="MPELNTARGPIDTADLGVTLMHEHVFIMTTEIAQNYPEAWGDEDK
FT                   RVAGAIARLGELKARGVDTIVDLTVIGLGRYIPRIARVAAATELNIVVATGLYTYNDVP
FT                   FYFHYLGPGAQLDGPEIMTDMFVRDIEHGIADTGIKAGILKCATDEPGLTPGVERVLRA
FT                   VAQAHKRTGAPISTHTHAGLRRGLDQQRIFAEEGVDLSRVVIGHCGDSTDVGYLEELIA
FT                   AGSYLGMDRFGVDVISPFQDRVNIVARMCERGHADKMVLSHDACCYFDALPEELVPVAM
FT                   PNWHYLHIHNDVIPALKQHGVTDEQLHTMLVDNPRRIFERQGGYQ"
FT   gene            277420..279126
FT                   /gene="fadE4"
FT                   /locus_tag="MRA_0239"
FT   CDS_pept        277420..279126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadE4"
FT                   /locus_tag="MRA_0239"
FT                   /product="acyl-CoA dehydrogenase FadE4"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71956"
FT                   /db_xref="GOA:A5TYV6"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYV6"
FT                   /protein_id="ABQ71956.1"
FT                   /translation="MLLNPNHLTRKYPDRRSGEIMAATVDFFESRGKARLKHDDHERIW
FT                   YSDFLDFVGRERIFASLLTPASYGADDCRWDTYRISEFAEIMGFYGLSYWYPFQVTALG
FT                   LGPIWMSANEDAKRKAAAGLEAGEVFAFGLSEQTHGADVYQTDMILTPSDGGWTANGEK
FT                   YYIGNANVARMVSTFGKIAGTPESQEYVFFVADSQHERYDLIKNVVNSQNYVANYALRD
FT                   YPVTEADILHRGAEAFHAALNTVNVCKYNLGWGAIGMCTHALYESVTHAANRHLYGTVV
FT                   TDFSHVRRLLTDAYVRLIAMKLVASRASDYMRSASAADRRYLLYSPLTKAKVTSEGERV
FT                   ITALWDVIAAKGVEKDTFFETVAREIGLLPRLEGTVHINIGLLGKFMPNYLFAPDSTLP
FT                   VIPRRDDAADDAFLFAQGPTGGLGKVRFHDWRASFDTCAHLPNVALLREQVDVFAELLA
FT                   SATPDAAQQKDIDFAFGVGQLFANVPYAQLILEEARLSGVDEALIDEIFGVLVRDFNTH
FT                   AVELHGRSATTAEQARFAMRMVRRPVHDPARYDQIWKDHVLALNGAYQMAP"
FT   gene            279261..279950
FT                   /locus_tag="MRA_0240"
FT   CDS_pept        279261..279950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0240"
FT                   /product="TetR/AcrR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71957"
FT                   /db_xref="GOA:A5TYV7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYV7"
FT                   /protein_id="ABQ71957.1"
FT                   /translation="MPTVTWARVDPARRAAVVEAAEAEFGAHGFSRGSLNVIARRAGVA
FT                   KGSLFQYFADKRDLYAFIADIASQRVRSYMEDLIRELDPNRPFFEFLTDLLDGWVAYFA
FT                   EHPRERALHAAATLEVDTDARISVRSVLHRHYLDVLRPLVRDAHARGDLRADSDTGALM
FT                   SLLLLIFPHLALAPYMRGLDPILGLDEPTPEQPALAVRRLVAVLAAAFDAQHPATNSAQ
FT                   TRSEEIT"
FT   gene            279947..280891
FT                   /gene="nrdB"
FT                   /locus_tag="MRA_0241"
FT   CDS_pept        279947..280891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdB"
FT                   /locus_tag="MRA_0241"
FT                   /product="ribonucleoside-diphosphate reductase subunit beta
FT                   NrdB"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71958"
FT                   /db_xref="GOA:A5TYV8"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033908"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TYV8"
FT                   /protein_id="ABQ71958.1"
FT                   /translation="MTRTRSGSLAAGGLNWASLPLKLFAGGNAKFWHPADIDFTRDRAD
FT                   WEKLSDDERDYATRLCTQFIAGEEAVTEDIQPFMSAMRAEGRLADEMYLTQFAFEEAKH
FT                   TQVFRMWLDAVGISEDLHRYLDDLPAYRQIFYAELPECLNALSADPSPAAQVRASVTYN
FT                   HIVEGMLALTGYYAWHKICVERAILPGMQELVRRIGDDERRHMAWGTFTCRRHVAADDA
FT                   NWTVFETRMNELIPLALRLIEEGFALYGDQPPFDLSKDDFLQYSTDKGMRRFGTISNAR
FT                   GRPVAEIDVDYSPAQLEDTFADEDRRTLAAASA"
FT   gene            complement(280967..282502)
FT                   /gene="gabD1"
FT                   /locus_tag="MRA_0242"
FT   CDS_pept        complement(280967..282502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD1"
FT                   /locus_tag="MRA_0242"
FT                   /product="succinic semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71959"
FT                   /db_xref="GOA:A5TYV9"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TYV9"
FT                   /protein_id="ABQ71959.1"
FT                   /translation="MRSVTCSATLVLPVIEPTPADRRPRHLLLGSAGHVSGRLDTGRFV
FT                   QTHPAKDVSVPIATINPATGETVKTFTAATDDEVDAAIARAHRRFADYRQTSFAQRARW
FT                   ANATADLLEAEADQAAAMMTLEMGKTLAAAKAEALKCAKGFRYYAENAEALLADEPADA
FT                   AKVGASAAYGRYQPLGVILAVMPWNFPLWQAVRFAAPALMAGNVGLLKHASNVPQCALY
FT                   LADVIARGGFPDGCFQTLLVSSGAVEAILRDPRVAAATLTGSEPAGQSVGAIAGNEIKP
FT                   TVLELGGSDPFIVMPSADLDAAVSTAVTGRVQNNGQSCIAAKRFIVHADIYDDFVDKFV
FT                   ARMAALRVGDPTDPDTDVGPLATEQGRNEVAKQVEDAAAAGAVIRCGGKRLDRPGWFYP
FT                   PTVITDISKDMALYTEEVFGPVASVFRAANIDEAVEIANATTFGLGSNAWTRDETEQRR
FT                   FIDDIVAGQVFINGMTVSYPELPFGGVKRSGYGRELSAHGIREFCNIKTVWIA"
FT   gene            complement(282528..283976)
FT                   /locus_tag="MRA_0243"
FT   CDS_pept        complement(282528..283976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0243"
FT                   /product="putative conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71960"
FT                   /db_xref="GOA:A5TYW0"
FT                   /db_xref="InterPro:IPR009613"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYW0"
FT                   /protein_id="ABQ71960.1"
FT                   /translation="MGWFSAPEYWLGRLALERGTAIIYLIAFVAAAQQFRPLIGEHGML
FT                   PVPRYLAGQSFWRTPSIFHFRYSDRVFAGVCWLGAVLSAAVVAGAASFVPLWATMLIWL
FT                   TLWVLYLSIVNVGQAWYSFGWESLLLETGFLMIFLGNERTAPPILTLLLARWLLFRVEF
FT                   GAGLIKMRGDSCWRSLTCLYYHHETQPMPGPLSWFFHHLPKPLHRIEVAGNHFAQLVVP
FT                   FGLFTPQPAASIAAAIIVVTQLWLVASGNFSWLNWLTILLACSAIDTSSAAALLPMPAQ
FT                   PALSAPPQWFAGLVVVFTAAVLLLSYWPARNLLSSHQRMNMSFNPFHLVNTYGAFGSIC
FT                   RTRREVVIEGTDESPITEQTVWKAYEFKGKPGDPRRLPRQWAPYHLRLDWLMWFAAISP
FT                   GYALPWMTPFLNRLLRNDPATLKLLRHNPFPQSPPRYVRAQLYQYRFTTVAELRRDRAW
FT                   WHRTLIGRYVPPMSLRKVASPPAD"
FT   gene            complement(284011..288213)
FT                   /locus_tag="MRA_0244"
FT   CDS_pept        complement(284011..288213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0244"
FT                   /product="putative conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71961"
FT                   /db_xref="GOA:A5TYW1"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR021798"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYW1"
FT                   /protein_id="ABQ71961.1"
FT                   /translation="MAPLSRKWLPVVGAVALALTFAQSPGQVSPDTKLDLTANPLRFLA
FT                   RATNLWNSDLPFGQAQNQAYGYLFPHGTFFVIGHLLGVPGWVTQRLWWAVLLTVGFWGL
FT                   LRVAEALGVGGPSSRVVGAVAFALSPRVLTTLGSISSETLPMMLAPWVLLPTILALRGT
FT                   SGRSVRALAAQAGLAVALMGAVNAIATLAGCLPAVIWWACHRPNRLWWRYTAWWLLAMA
FT                   LATLWWVMALTQLHGVSPPFLDFIESSGVTTQWSSLVEVLRGTDSWTPFVAPNATAGAP
FT                   LVTGSAAILGTCLVAAAGLAGLTSPAMPARGRLVTMLLVGVVLLAVGHRGGLASPVAHP
FT                   VQAFLDAAGTPLRNVHKVGPVIRLPLVLGLAQLLSRVPLPGSAPRPAWLRAFAHPERDK
FT                   RVAVAVVALTALMVSTSLAWTGRVAPPGTFGALPQYWQEAADWLRTHHAATPTPGRVLV
FT                   VPGAPFATQVWGTSHDEPLQVLGDGPWGVRDSIPLTPPQTIRALDSVQRLFAAGRPSAG
FT                   LADTLARQGISYVLVRNDLDPETSRSARPILLHRSIAGSPGLAKLAEFGAPVGPDPLAG
FT                   FVNDSGLRPRYPAIEIYRVSAPANPGAPYFAATDQLARVDGGPEVLLRLDERRRLQGQP
FT                   PLGPVLMTADARAAGLPVPQVAVTDTPVARETDYGRVDHHSSAIRAPGDARHTYNRVPD
FT                   YPVPGAEPVVGGWTGGRITVSSSSADATAMPDVAPASAPAAAVDGDPATAWVSNALQAA
FT                   VGQWLQVDFDRPVTNAVVTLTPSATAVGAQVRRILIETVNGSTTLRFDEAGKPLTAALP
FT                   YGETPWVRFTAAATDDGSAGVQFGITDLAITQYDASGFAHPVQLRHTVLVPGPPPGSAI
FT                   AGWDLGSELLGRPGCAPGPDGVRCAASMALAPEEPANLSRTLTVPRPVSVTPMVWVRPR
FT                   QGPKLADLIAAPSTTRASGDSDLVDILGSAYAAADGDPATAWTAPQRVVQHKTPPTLTL
FT                   TLPRPTVVTGLRLAASRSMLPAHPTVVAINLGDGPQVRQLQVGELTTLWLHPRVTDTVS
FT                   VSLLDWDDVIDRNALGFDQLKPPGLAEVVVLSAGGAPIAPADAARNRARALTVDCDHGP
FT                   VVAVAGRFVHTSIRTTVGALLDGEPVAALPCEREPIALPAGQQELLISPGAAFVVDGAQ
FT                   LSTPGAGLSSATVTSAETGAWGPTHREVRVPESATSRVLVVPESINSGWVARTSTGARL
FT                   TPIAVNGWQQAWVVPAGNPGTITLTFAPNSLYRASLAIGLALLPLLALLAFWRTGRRQL
FT                   ADRPTPPWRPGAWAAAGVLAAGAVIASIAGVMVMGTALGVRYALRRRERLRDRVTVGLA
FT                   AGGLILAGAALSRHPWRSVDGYAGNWASVQLLALISVSVVAASVVATSESRGQDRMQ"
FT   gene            complement(288260..288433)
FT                   /locus_tag="MRA_0245"
FT   CDS_pept        complement(288260..288433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0245"
FT                   /product="small secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71962"
FT                   /db_xref="GOA:A5TYW2"
FT                   /db_xref="InterPro:IPR022566"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYW2"
FT                   /protein_id="ABQ71962.1"
FT                   /translation="MNRIVAPAAASVVVGLLLGAAAIFGVTLMVQQDKKPPLPGGDPSS
FT                   SVLNRVEYGNRS"
FT   gene            288548..289714
FT                   /gene="lpqI"
FT                   /locus_tag="MRA_0246"
FT   CDS_pept        288548..289714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpqI"
FT                   /locus_tag="MRA_0246"
FT                   /product="putative conserved lipoprotein LpqI"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71963"
FT                   /db_xref="GOA:A5TYW3"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYW3"
FT                   /protein_id="ABQ71963.1"
FT                   /translation="MAFPRTLAILAAAAALVVACSHGGTPTGSSTTSGASPATPVAVPV
FT                   PRSCAEPAGIPALLSPRDKLAQLLVVGVRDAADAQAVVTNYHVGGILIGSDTDLTIFDG
FT                   ALAEIVAGGGPLPLAVSVDEEGGRVSRLRSLIGGTGPSARELAQTRTVQQVRDLARDRG
FT                   RQMRKLGITIDFAPVVDVTDAPDDTVIGDRSFGSDPATVTAYAGAYAQGLRDAGVLPVL
FT                   KHFPGHGRGSGDSHNGGVTTPPLDDLVGDDLVPYRTLVTQAPVGVMVGHLQVPGLTGSE
FT                   PASLSKAAVNLLRTGTGYGAPPFDGPVFSDDLSGMAAISDRFGVSEAVLRTLQAGADIA
FT                   LWVTTKEVPAVLDRLEQALRAGELPMSAVDRSVVRVATMKGPNPGCGR"
FT   gene            289790..290404
FT                   /locus_tag="MRA_0247"
FT   CDS_pept        289790..290404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0247"
FT                   /product="TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71964"
FT                   /db_xref="GOA:A5TYW4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYW4"
FT                   /protein_id="ABQ71964.1"
FT                   /translation="MAGGTKRLPRAVREQQMLDAAVQMFSVNGYHETSMDAIAAEAQIS
FT                   KPMLYLYYGSKEDLFGACLNREMSRFIDALRSSINFDQSPKDLLRNTIVSFLRYIDANR
FT                   ASWIVMYTQATSSQAFAHTVREGREQIVQLVAELVRAGTRGPLTDAEIEMMAVALVGAG
FT                   EAVATRLGIGDTDVDEAAEMMINLFWLGLKGAPVDRLETGH"
FT   gene            290466..290699
FT                   /locus_tag="MRA_0248"
FT   CDS_pept        290466..290699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71965"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYW5"
FT                   /protein_id="ABQ71965.1"
FT                   /translation="MIRTQVQLPDELYRDAKRVAHEHEMTLAEVVRRGLEHMVRIYPRR
FT                   DAASDTWQPPTPRRLGPFRASEETWRELANEA"
FT   gene            290707..291144
FT                   /locus_tag="MRA_0249"
FT   CDS_pept        290707..291144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71966"
FT                   /db_xref="GOA:A5TYW6"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR006226"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYW6"
FT                   /protein_id="ABQ71966.1"
FT                   /translation="MLSIDTNILLYAQNRDCPEHDAAAAFLVECAGRADVAVCELVLME
FT                   LYQLLRNPTVVTRPLEGPEAAEVCQTFRRNRRWALLENAPVMNEVWVLAATPRIARRRL
FT                   FDARLALTLRHHGVDEFATRNINGFTDFGFSRVWDPITSDG"
FT   gene            complement(291174..292016)
FT                   /locus_tag="MRA_0250"
FT   CDS_pept        complement(291174..292016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71967"
FT                   /db_xref="GOA:A5TYW7"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR003965"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYW7"
FT                   /protein_id="ABQ71967.1"
FT                   /translation="MTQPSGLKNLLRAAAGALPVVPRTDQLPNRTVTVEELPIDPANVA
FT                   AYAAVTGLRYGNQVPLTYPFALTFPSVMSLVTGFDFPFAAMGAIHTENHITQYRPIAVT
FT                   DAVGVRVRAENLREHRRGLLVDLVTNVSVGNDVAWHQVTTFLHQQRTSLSGEPKPPPQK
FT                   KPKLPPPAAVLRITPAKIRRYAAVGGDHNPIHTNPIAAKLFGFPTVIAHGMFTAAAVLA
FT                   NIEARFPDAVRYSVRFAKPVLLPATAGLYVAEGDGGWDLTLRNMAKGYPHLTATVRGL"
FT   gene            complement(292027..293391)
FT                   /gene="fabG-1"
FT                   /locus_tag="MRA_0251"
FT   CDS_pept        complement(292027..293391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG-1"
FT                   /locus_tag="MRA_0251"
FT                   /product="3-ketoacyl-(acyl-carrier-protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71968"
FT                   /db_xref="GOA:A5TYW8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:3LLS"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYW8"
FT                   /protein_id="ABQ71968.1"
FT                   /translation="MAPKRSSDLFSQVVNSGPGSFLARQLGVPQPETLRRYRAGEPPLT
FT                   GSLLIGGAGRVVEPLRAALEKDYDLVGNNLGGRWADSFGGLVFDATGITEPAGLKGLHE
FT                   FFTPVLRNLGRCGRVVVVGGTPEAAASTNERIAQRALEGFTRSLGKELRRGATTALVYL
FT                   SPDAKPAATGLESTMRFLLSAKSAYVDGQVFSVGADDSTPPADWEKPLDGKVAIVTGAA
FT                   RGIGATIAEVFARDGAHVVAIDVESAAENLAETASKVGGTALWLDVTADDAVDKISEHL
FT                   RDHHGGKADILVNNAGITRDKLLANMDDARWDAVLAVNLLAPLRLTEGLVGNGSIGEGG
FT                   RVIGLSSIAGIAGNRGQTNYATTKAGMIGITQALAPGLAAKGITINAVAPGFIETQMTA
FT                   AIPLATREVGRRLNSLLQGGQPVDVAEAIAYFASPASNAVTGNVIRVCGQAMIGA"
FT   gene            293533..294855
FT                   /gene="fadA2"
FT                   /locus_tag="MRA_0252"
FT   CDS_pept        293533..294855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadA2"
FT                   /locus_tag="MRA_0252"
FT                   /product="acetyl-CoA acetyltransferase FadA2"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71969"
FT                   /db_xref="GOA:A5TYW9"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYW9"
FT                   /protein_id="ABQ71969.1"
FT                   /translation="MAPAAKNTSQTRRRVAVLGGNRIPFARSDGAYADASNQDMFTAAL
FT                   SGLVDRFGLAGERLDMVVGGAVLKHSRDFNLMRECVLGSELSPYTPAFDLQQACGTGLQ
FT                   AAIAAADGIAAGRYEVAAAGGVDTTSDPPIGLGDDLRRTLLKLRRSRSNVQRLKLVGTL
FT                   PASLGVEIPANSEPRTGLSMGEHAAVTAKQMGIKRVDQDELAAASHRNMADAYDRGFFD
FT                   DLVSPFLGLYRDDNLRPNSSVEKLATLRPVFGVKAGDATMTAGNSTPLTDGASVALLAS
FT                   EQWAEAHSLAPLAYLVDAETAAVDYVNGNDGLLMAPTYAVPRLLARNGLSLQDFDFYEI
FT                   HEAFASVVLAHLAAWESEEYCKRRLGLDAALGSIDRSKLNVNGSSLAAGHPFAATGGRI
FT                   LAQTAKQLAEKKAAKKGGGPLRGLISICAAGGQGVAAILEA"
FT   gene            complement(295160..296995)
FT                   /gene="fadE5"
FT                   /locus_tag="MRA_0253"
FT   CDS_pept        complement(295160..296995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadE5"
FT                   /locus_tag="MRA_0253"
FT                   /product="acyl-CoA dehydrogenase FadE5"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71970"
FT                   /db_xref="GOA:A5TYX0"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR034188"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYX0"
FT                   /protein_id="ABQ71970.1"
FT                   /translation="MSHYRSNVRDQVFNLFEVLGVDKALGHGEFSDVDVDTARDMLAEV
FT                   SRLAEGPVAESFVEGDRNPPVFDPKTHSVMLPESFKKSVNAMLEAGWDKVGIDEALGGM
FT                   PMPKAVVWALHEHILGANPAVWMYAGGAGFAQILYHLGTEEQKKWAVLAAERGWGSTMV
FT                   LTEPDAGSDVGAARTKAVQQADGSWHIDGVKRFITSGDSGDLFENIFHLVLARPEGAGP
FT                   GTKGLSLYFVPKFLFDVETGEPGERNGVFVTNVEHKMGLKVSATCELAFGQHGVPAKGW
FT                   LVGEVHNGIAQMFEVIEQARMMVGTKAIATLSTGYLNALQYAKSRVQGADLTQMTDKTA
FT                   PRVTITHHPDVRRSLMTQKAYAEGLRALYLYTATFQDAAVAEVVHGVDAKLAVKVNDLM
FT                   LPVVKGVGSEQAYAKLTESLQTLGGSGFLQDYPIEQYIRDAKIDSLYEGTTAIQAQDFF
FT                   FRKIVRDKGVALAHVSGQIQEFVDSGAGNGRLKTERALLAKALTDVQGMAAALTGYLMA
FT                   AQQDVTSLYKVGLGSVRFLMSVGDLIIGWLLQRQAAVAVAALDAGATGDERSFYEGKVA
FT                   VASFFAKNFLPLLTSTREVIETLDNDIMELDEAAF"
FT   gene            297367..297855
FT                   /locus_tag="MRA_0254"
FT   CDS_pept        297367..297855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0254"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71971"
FT                   /db_xref="GOA:A5TYX1"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYX1"
FT                   /protein_id="ABQ71971.1"
FT                   /translation="MNSTNNLTPSSLREAFGHFPTGVVAIAAEVDGVRQGLAASTFVPV
FT                   SLEPPLVSFCVQNTSTTWPKLTGVPMLGISVLGEAHDAAVRTLAAKTGDRFAGLETVSN
FT                   DAGAVFIKGTSVWLESAIEQLVPAGDHTIVVLRVNQVKVDPNVAPIVFHRSVLRRLGV"
FT   gene            298171..299481
FT                   /locus_tag="MRA_0255"
FT   CDS_pept        298171..299481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0255"
FT                   /product="putative conserved integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71972"
FT                   /db_xref="GOA:A5TYX2"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYX2"
FT                   /protein_id="ABQ71972.1"
FT                   /translation="MAKTSHRVSSADGMSKRILRLIIAQSGFYSAALQLGNVSIVLPFV
FT                   VAELDAELWIAALIFPAFTAGGAIGNVVAPPAVAAVPRRHRLFIIVSCLAVLAGVNALC
FT                   ATIGKGSVAGILLVVNVTLIGVVSAISFVAFADLVAAMPSGTARARILLTEVGVGAALT
FT                   AVVAATLSFVPDQHPLSRNIHLLWTAAVAMAISAAICRALPHRIVPRVHAAPGLHKLVY
FT                   VGWTAIRTNGWYRRYLLVQVLFGSVVLGSSFHSIRVAAVPGDQPDEVVAVVLFVCVGLL
FT                   GGIALWNRVRERFGLVGLFVGSALVSIAAAVLSIAFDLAGAWPNVVAIGLVIALVSIAN
FT                   QSVFTAGQLWIARDAEPGLRTSLISFGQLVINAGLVGMGLALGLIAQDHDAVWPVMIVL
FT                   LLNLTAAYSATRFAPAKSVDVRGLPQVSRTSRPKTGG"
FT   gene            complement(299478..300224)
FT                   /locus_tag="MRA_0256"
FT   CDS_pept        complement(299478..300224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0256"
FT                   /product="succinate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71973"
FT                   /db_xref="GOA:A5TYX3"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYX3"
FT                   /protein_id="ABQ71973.1"
FT                   /translation="MTYSASMRVWRGDESCGELREFTVEVNEGEVVLDVILRLQQTQTP
FT                   DLAVRWNCKAGKCGSCSAEINGKPRLMCMTRMSTFDEDEIVTVTPMRTFPVIRDLVTDV
FT                   SFNYQKAREIPSFAPPKELQPSEYRMAQVDVARSQEFRKCIECFLCQNVCHVVRDHEEN
FT                   KDAFAGPRFLMRIAELEMHPLDTRDRRSQAQEEHGLGYCNITKCCTEVCPENIKITDNA
FT                   LIPMKERVADRKYDPVVWLGSKLFRR"
FT   gene            complement(300225..302165)
FT                   /locus_tag="MRA_0257"
FT   CDS_pept        complement(300225..302165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0257"
FT                   /product="succinate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71974"
FT                   /db_xref="GOA:A5TYX4"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYX4"
FT                   /protein_id="ABQ71974.1"
FT                   /translation="MVEVERHSYDVVVIGAGGAGLRAVIEARERGLKVAVVCKSLFGKA
FT                   HTVMAEGGCAAAMGNANPKDNWKTHFGDTMRGGKFLNNWRMAELHAKEAPDRVWELETY
FT                   GALFDRTDDGRISQRNFGGHTYPRLAHVGDRTGLELIRTLQQKVVSLQQEDHAELGDYE
FT                   ARIKVFAECTITELLKDQGAIAGAFGYWRESGRFIVFEAPAVVLATGGIGKSFKVTSNS
FT                   WEYTGDGHALALRAGATLINMEFVQFHPTGMVWPPSVKGILVTEGVRGDGGVLKNSENS
FT                   RFMFDYIPPVFKGQYAETEEEADQWLKDNDSARRTPDLLPRDEVARAINSEVKAGRGTP
FT                   HGGVYLDIASRLTPAEIKRRLPSMYHQFKELAEVDITTQAMEVGPTCHYVMGGVEVDAD
FT                   TGAATVPGLFAAGECAGGMHGSNRLGGNSLSDLLVFGRRAGLGAADYVRALSSRPAVSA
FT                   EAIDAAAQQALSPFEGPKDGSAPENPYALHMDLQYVMNDLVGIIRNADEISRALTLLAE
FT                   LWSRYHNVLVEGHRQYNPGWNLSIDLRNMLLVSECVARAALQRTESRGGHTRDDHPGMD
FT                   PNWRRILLVCRATETMGTGGSGSGDSNCHINVTQQLQTPMRPDLLELFEISELEKYYTD
FT                   EELAEHPGRRG"
FT   gene            complement(302196..303017)
FT                   /locus_tag="MRA_0258"
FT   CDS_pept        complement(302196..303017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0258"
FT                   /product="putative succinate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71975"
FT                   /db_xref="GOA:A5TYX5"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYX5"
FT                   /protein_id="ABQ71975.1"
FT                   /translation="MSAPTANRPAIGVFTPTRAQIPERTLRTDLWWLPPLLTNLGLLAF
FT                   ICYATTRAFWGSQYWVEKYHYLTPFYSPCVSASCQPGASHLGVWFGHFPGWIPLGAMVL
FT                   PFLLGFRLTCYYYRKAYYRSVWQSPTSCAVPEPRAHYTGETRLPLIVQNTHRYFFYIAV
FT                   VVSLINTYDAIAAFHSPSGFGFGLGNVILTINVVLLWAYTISCHSCRHATGGRLKHFSK
FT                   HPVRYWIWTQVSKLNTRHMQFAWITLGTLALTDFYIMLVASGSITDLRFIG"
FT   gene            complement(303097..303390)
FT                   /locus_tag="MRA_0259"
FT   CDS_pept        complement(303097..303390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71976"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYX6"
FT                   /protein_id="ABQ71976.1"
FT                   /translation="MSTTAELAELHDLVGGLRRCVTALKARFGDNPATRRIVIDADRIL
FT                   TDIELLDTDVSELDLERAAVPQPSEKIAIPDTEYDREFWRDVDDEGVGGHRY"
FT   gene            complement(303535..304014)
FT                   /gene="hsp"
FT                   /locus_tag="MRA_0260"
FT   CDS_pept        complement(303535..304014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsp"
FT                   /locus_tag="MRA_0260"
FT                   /product="Heat shock protein Hsp"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71977"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYX7"
FT                   /protein_id="ABQ71977.1"
FT                   /translation="MNNLALWSRPVWDVEPWDRWLRDFFGPAATTDWYRPVAGDFTPAA
FT                   EIVKDGDDAVVRLELPGIDVDKDVNVELDPGQPVSRLVIRGEHRDEHTQDAGDKDGRTL
FT                   REIRYGSFRRSFRLPAHVTSEAIAASYDAGVLTVRVAGAYKAPAETQAQRIAITK"
FT   gene            304228..306789
FT                   /gene="nirB"
FT                   /locus_tag="MRA_0261"
FT   CDS_pept        304228..306789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirB"
FT                   /locus_tag="MRA_0261"
FT                   /product="NAD(P)H-dependent nitrite reductase large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71978"
FT                   /db_xref="GOA:A5TYX8"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYX8"
FT                   /protein_id="ABQ71978.1"
FT                   /translation="MPTAGSSRAPAAAREIVVVGHGMVGHRLVEAVRARDADGSLRITV
FT                   LAEEGDAAYDRVGLTSYTESWDRALLALPGNDYAGDQRVRLLLNTRVTQIDRATKSVVT
FT                   AAGQRHRYDTLVLATGSYAFVPPVPGHDLPACHVYRTFDDLDAIRAGAQRTLDGGHTDG
FT                   GVVIGGGLLGLEAANALRQFGLQTHVVEMMPRLMAQQIDEAGGALLARMIADLGIAVHV
FT                   GTGTESIESVKHSDGSVWARVRLSDGEVIDAGVVIFAAGIRPRDELARAAGLAIGDRGG
FT                   VLTDLSCRTSDPDIYAVGEVAAIDGRCYGLVGPGYTSAEVVADRLLDGSAEFPEADLST
FT                   KLKLLGVDVASFGDAMGATENCLEVVINDAVKRTYAKLVLSDDATTLLGGVLVGDASSY
FT                   GVLRPMVGAELPGDPLALIAPAGSGAGAGALGVGALPDSAQICSCNNVTKGELKCAIAD
FT                   GCGDVPALKSCTAAGTSCGSCVPLLKQLLEAEGVEQSKALCEHFSQSRAELFEIITATE
FT                   VRTFSGLLDRFGRGKGCDICKPVVASILASTGSDHILDGEQASLQDSNDHFLANIQKNG
FT                   SYSVVPRVPGGDIKPEHLILIGQIAQDFGLYTKITGGQRIDLFGARVDQLPLIWQRLVD
FT                   GGMESGHAYGKAVRTVKSCVGSDWCRYGQQDSVQLAIDLELRYRGLRAPHKIKLGVSGC
FT                   ARECAEARGKDVGVIATEKGWNLYVAGNGGMTPKHAQLLASDLDKETLIRYIDRFLIYY
FT                   IRTADRLQRTAPWVESLGLDHVREVVCEDSLGLAEEFEAAMQRHVANYKCEWKGVLEDP
FT                   DKLSRFVSFVNAPDAVDSTVTFTERAGRKVPVSIGIPRVRS"
FT   gene            306815..307171
FT                   /gene="nirD"
FT                   /locus_tag="MRA_0262"
FT   CDS_pept        306815..307171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirD"
FT                   /locus_tag="MRA_0262"
FT                   /product="putative nitrite reductase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71979"
FT                   /db_xref="GOA:A5TYX9"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017881"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYX9"
FT                   /protein_id="ABQ71979.1"
FT                   /translation="MTLLNDIQVWTTACAYDHLIPGRGVGVLLDDGSQVALFRLDDGSV
FT                   HAVGNVDPFSGAAVMSRGIVGDRGGRAMVQSPILKQAFALDDGSCLDDPRVSVPVYPAR
FT                   VTPEGRIQVARVAV"
FT   gene            complement(307187..307711)
FT                   /gene="cobU"
FT                   /locus_tag="MRA_0263"
FT   CDS_pept        complement(307187..307711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobU"
FT                   /locus_tag="MRA_0263"
FT                   /product="cobinamide kinase/cobinamide phosphate
FT                   guanylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71980"
FT                   /db_xref="GOA:A5TYY0"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYY0"
FT                   /protein_id="ABQ71980.1"
FT                   /translation="MRILVTGGVRSGKSTHAEALLGDAADVVYVAPGRPAAGSDPDWDA
FT                   RVALHRARRPPTWLTVETADVATALSEARSPVLVDCLGTWLTAIMDGEALWSAATADVY
FT                   AVLEARLDGLCAALTGLPTAIVVTNEVGLGVVPSHSSGVLFRDLLGTINRRVAAVCDEV
FT                   HLVIAGRVLKL"
FT   gene            complement(307736..309220)
FT                   /gene="cobQ1"
FT                   /locus_tag="MRA_0264"
FT   CDS_pept        complement(307736..309220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobQ1"
FT                   /locus_tag="MRA_0264"
FT                   /product="cobyric acid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71981"
FT                   /db_xref="GOA:A5TYY1"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TYY1"
FT                   /protein_id="ABQ71981.1"
FT                   /translation="MSGLLVAGTTSDAGKSAVTAGLCRALARRGVRVAPFKAQNMSNNS
FT                   MVCRGPDGTGVEIGRAQWVQALAARTTPEAAMNPVLLKPASDHRSHVVLMGKPWGEVAS
FT                   SSWCAGRRALAEAACRAFDALAARYDVVVAEGAGSPAEINLRAGDYVNMGLARHAGLPT
FT                   IVVGDIDRGGVFAAFLGTVALLAAEDQALVAGFVVNKFRGDSDLLAPGLRDLERVTGRR
FT                   VYGTLPWHPDLWLDSEDALDLQGRRAAGTGARRVAVVRLPRISNFTDVDALGLEPDLDV
FT                   VFASDPRALDDADLIVLPGTRATIADLAWLRARDLDRALLVHVAAGKPLLGICGGFQML
FT                   GRVIRDPYGIEGPGGQVTEVEGLGLLDVETAFSPHKVLRLPRGEGLGVPASGYEIHHGR
FT                   ITRGDTAEEFLGGARDGPVFGTMWHGSLEGDALREAFLRETLGLAPSGSCFLAARERRL
FT                   DLLGDLVERHLDVDALLNLARHGCPPTLPFLAPGAP"
FT   gene            complement(309239..310801)
FT                   /locus_tag="MRA_0265"
FT   CDS_pept        complement(309239..310801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0265"
FT                   /product="PPE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71982"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYY2"
FT                   /protein_id="ABQ71982.1"
FT                   /translation="MSIAYAETADELAALLAAVQAGTWDGPTAAVYVAAHTPYLAWLVQ
FT                   ASANSAAMATRQETAATAYGTALAAMPTLAELGANHALHGVLMATNFFGINTIPIALNE
FT                   SDYARMWIQAATTMASYQAVSTAAVAAAPQTTPAPQIVKANAPTAASDEPNQVQEWLQW
FT                   LQKIGYTDFYNNVIQPFINWLTNLPFLQAMFSGFDPWLPSLGNPLTFLSPANIAFALGY
FT                   PMDIGSYVAFLSQTFAFIGADLAAAFASGNPATIAFTLMFTTVEAIGTIITDTIALVKT
FT                   LLEQTLALLPAALPLLAAPLAPLTLAPASAAGGFAGLSGLAGLVGIPPSAPPVIPPVAA
FT                   IAPSIPTPTPTPAPAPAPTAVTAPTPPPGPPPPPVTAPPPVTGAGIQSFGYLVGDLNSA
FT                   AQARKAVGTGVRKKTPEPDSAEAPAAAAAPEEQVQPQRRRRPKIKQLGRGYEYLDLDPE
FT                   TGHDPTGSPQGAGTLGFAGTTHKASPGQVAGLITLPNDAFGGSPRTPMMPGTWDTDSAT
FT                   RVE"
FT   gene            311061..311435
FT                   /locus_tag="MRA_0265A"
FT   CDS_pept        311061..311435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0265A"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0265A"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71983"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYY3"
FT                   /protein_id="ABQ71983.1"
FT                   /translation="MTRVSWLPDRCLPRLPACGRGLRGSLPGDSGGTAPDSHRLPASSS
FT                   PDGKNIGMQSVDLHVERHLPSRGRSHRTVATVTCVTALGDIRSAQLSATGAWPAVLFPS
FT                   WSWLCGIGGGVDLQKPSCRA"
FT   gene            complement(311656..312111)
FT                   /locus_tag="MRA_0266"
FT   CDS_pept        complement(311656..312111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71984"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041678"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYY4"
FT                   /protein_id="ABQ71984.1"
FT                   /translation="MARSQEPSRGLLDPVAKMLRLPFGTPDFIEKIVTGSVNQVGRRTL
FT                   YVLITTWDAAGGGPFAASAIATTGLAKTAEIVQSMFIGPVFNPLLKMLGADKIAIRASL
FT                   CAAQLVGLGIMRYGVRSEPLHSMSVEMLVDAIGPTMQRYLVGDIGRG"
FT   gene            complement(312136..312879)
FT                   /locus_tag="MRA_0267"
FT   CDS_pept        complement(312136..312879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0267"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71985"
FT                   /db_xref="GOA:A5TYY5"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYY5"
FT                   /protein_id="ABQ71985.1"
FT                   /translation="MNLILTAHGTRRPSGVAMIADIAAQVSALVDRTVQVAFVDVLGPS
FT                   PSEVLSALSCRPAIVVPAFLSRGYHVRTDLPAHVAASAHPHVTVTPALGPCREIAQIVT
FT                   QQLVESGWRPGDSVILAAAGASDRRARADLHTTRTLVSELTGSWVDMGFAGTGGPDVRT
FT                   AVQRARDRAEANRGARRVAVASFLLAEGLFQERLRASGADVVTRPLGTHPGLAQLVANR
FT                   FRSAVARQQRLHRWHGTPTPVTLDL"
FT   gene            complement(312876..314021)
FT                   /locus_tag="MRA_0268"
FT   CDS_pept        complement(312876..314021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0268"
FT                   /product="uroporphyrinogen-III synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71986"
FT                   /db_xref="GOA:A5TYY6"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYY6"
FT                   /protein_id="ABQ71986.1"
FT                   /translation="MAQAHSAPLTGYRIAVTSARRAEELCALLRRQGAEVCSAPAIKMI
FT                   ALPDDDELQNNTEALIADPPDILVAHTGIGFRGWLAAAEGWGLANELLESLSSARIISR
FT                   GPKATGALRAAGLREEWSPDSESSHEVLEYLLESGVSRTRIAVQLHGAADSWDPFPEFL
FT                   GGLRFAGAQVVPIRVYRWKPAPLGGVFDHLVTGIARRQFDAVTFTSAPAAAAVLERSRE
FT                   LDIEDQLLAALRTDVHAMCVGPVTSRPLIRKGVPTSAPERMRLGALARHIAEELPLLGS
FT                   CTFKAAGHVIEIRGTSVLVDDSVKPLSPSGMAILRALVHRPGGVVSRGDLLRVLPGDGS
FT                   DTHAVDTAVLRLRTALGDKNIVATVVKRGYRLAVDSRHDDV"
FT   gene            complement(314121..315530)
FT                   /gene="narK3"
FT                   /locus_tag="MRA_0269"
FT   CDS_pept        complement(314121..315530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narK3"
FT                   /locus_tag="MRA_0269"
FT                   /product="integral membrane nitrite extrusion protein
FT                   NarK3"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71987"
FT                   /db_xref="GOA:A5TYY7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYY7"
FT                   /protein_id="ABQ71987.1"
FT                   /translation="MGRSHQISDWDPEDSVAWEAGNKFIARRNLIWSVAAEHVGFSVWS
FT                   LWSVMVLFMPTSVYGFSAGDKFLLGATATLVGACLRFPYTFATAKFGGRNWTIFSALVL
FT                   LIPTVGSILLLANPGLPLWPYLVCGALAGLGGGNFAASMTNINAFFPQRLKGAALALNA
FT                   GGGNLGVPMVQLVGLLVIATAGDREPYWVCAIYLVLLAVAGLGAALYMDNLTEYRIELN
FT                   TMRAVVSEPHTWVISLLYIGTFGSFIGFSFAFGQVLQINFIASGQSTAQASLHAAQIAF
FT                   LGPLLGSLSRIYGGKLADRIGGGRVTLAAFCAMLLATGILISASTFGDHLAGPMPTATM
FT                   VGYVIGFTALFILSGIGNGSVYKMIPSIFEARSHSLQISEAERRQWSRSMSGALIGLAG
FT                   AVGALGGVGVNLALRESYLTSGTATSAFWAFGVFYLVASVLTWAIYVRRGLKSAGELVP
FT                   ATTAPAGLAYV"
FT   gene            complement(315671..316216)
FT                   /gene="aac"
FT                   /locus_tag="MRA_0270"
FT   CDS_pept        complement(315671..316216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aac"
FT                   /locus_tag="MRA_0270"
FT                   /product="aminoglycoside 2-N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71988"
FT                   /db_xref="GOA:A5TYY8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYY8"
FT                   /protein_id="ABQ71988.1"
FT                   /translation="MHTQVHTARLVHTADLDSETRQDIRQMVTGAFAGDFTETDWEHTL
FT                   GGMHALIWHHGAIIAHAAVIQRRLIYRGNALRCGYVEGVAVRADWRGQRLVSALLDAVE
FT                   QVMRGAYQLGALSSSARARRLYASRGWLPWHGPTSVLAPTGPVRTPDDDGTVFVLPIDI
FT                   SLDTSAELMCDWRAGDVW"
FT   gene            complement(316226..317128)
FT                   /locus_tag="MRA_0271"
FT   CDS_pept        complement(316226..317128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0271"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71989"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYY9"
FT                   /protein_id="ABQ71989.1"
FT                   /translation="MTTLEILRSGPLALVEDLGRAGLAHLGVGRSGAADRRSHTLANRL
FT                   VANPDDWATVEVTFGGFSARVRGGDVDIAVTGADTDPTVNGIMVGTNSIHHVRDGQVIS
FT                   LGTPRAGLRTYLAVRGGVCVEPVLGSRSYDVMSAIGPSPLRAGDVLPVGEHTDDYPELD
FT                   QAPVAAIEEHLVELRVVPGPRDDWLVDPDALVHTIWMASNRSDRVGMRLQGRPLQHRWP
FT                   DRQLPGEGVTRGAIQVPPNGLPVILGPDHPITGSYPVVGVITDEDIDKVAQIRPGQYVR
FT                   LHWARPRSRLPGQGVTQAW"
FT   gene            complement(317145..317777)
FT                   /locus_tag="MRA_0272"
FT   CDS_pept        complement(317145..317777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0272"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71990"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYZ0"
FT                   /protein_id="ABQ71990.1"
FT                   /translation="MDAALACTVLDYGDHALMLQCDSTADAMAWTDALRAAALPGVVDI
FT                   VAASRTVLVKLDAPRYQGVTRQRLRRLRVTPEAVAAADHRCDLVIDVVYDGPDLAEVAR
FT                   CTGLTTAAVINAHTATGWRAGFSGSAPGFAYLIDGDPSLRVPRRPERRTSMPPGSVALA
FT                   DGFSAIYPSQAPSDWQIIGHTDAVLWDVDRPQPALLTPGMWVQFRAA"
FT   gene            complement(317873..318865)
FT                   /locus_tag="MRA_0273"
FT   CDS_pept        complement(317873..318865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0273"
FT                   /product="iron ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71991"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYZ1"
FT                   /protein_id="ABQ71991.1"
FT                   /translation="MRQGCSRRGFLQVAEAAAATGLFAGCSSPKPPPGTPGGAAVTITH
FT                   LFGQTVIKEPPKRVVSAGYTEQDDLLAVDVVPIAVTDWFGDQPFAVWPWAAPKLGGARP
FT                   AVLNLDNGIQIDRIAALKPDLIVAINAGVDADTYQQLSAIAPTVAQSGGDAFFEPWKDQ
FT                   ARSIGQAVFAADRMRSLIEAVDQKFAAVAQRHPRWRGKKALLLQGRLWQGNVVATLAGW
FT                   RTDFLNDMGLVIADSIKPFAVDQRGVIPRDHIKAVLDAADVLIWMTESPEDEKALLADP
FT                   EIAASQATAQRRHIFTSKEQAGAIAFSSVLSYPVVAEQLPPQISQILGA"
FT   gene            complement(318887..322516)
FT                   /gene="oplA"
FT                   /locus_tag="MRA_0274"
FT   CDS_pept        complement(318887..322516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oplA"
FT                   /locus_tag="MRA_0274"
FT                   /product="putative 5-oxoprolinase OplA"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71992"
FT                   /db_xref="GOA:A5TYZ2"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYZ2"
FT                   /protein_id="ABQ71992.1"
FT                   /translation="MVGAGWHFWVDRGGTFTDVVARRPDGRLLTHKLLSDNPARYRDAA
FT                   VAGIRALLANGEAGTRVDAVRMGTTVATNALLERTGERTLLVITRGFGDALRIAYQNRP
FT                   RIFDRRIVLPEMLYERVVEVDERVTADGRVLRAPDLEALGEKMRQAHADGIRAVAVVCL
FT                   HSYLYPGHEREIGTLAQRIGFAQISLSSEVSPLMKLVPRGDTTVVDAYLSPVLRRYINQ
FT                   VADQMRGVRLMFMQSNGGLAQAGHFRGKDAILSGPAGGIVGMVRMSALAGFDHVIGFDM
FT                   GGTSTDVSHYAGEYERVFTTQVAGVRLRAPMLDIHTVAAGGGSILHFDGSRYRVGPDSA
FT                   GADPGPACYRGGGPLCVTDANVMLGRIQPTHFPSVFGPSGDQPLDAGTVRRGFTDLAAD
FT                   IAARTGDDRSPEQVAEGYLRIAVANMANAVKKISVQKGHDVTRYALTTFGGAGGQHACA
FT                   VADALGIRTVLIPPMAGVLSALGIGLADTTAMREQSVEIPLGPAAPQRLASVAESLERA
FT                   ARAELLDEGVPGERIRVVRRVHLRYEGTDTAIPVQLAEIETMATAFESSHRALYTFLLD
FT                   RPLIAEAISVEATGLTDQPDLSQLGDQANDTTGSSETVRIYSNGLWRDAPLRRREAMRP
FT                   GDVLTGPAIIAEANATTVVDDGWQATMTETGHLLAQRVVTPPRPDAATRAGFEAGFEAD
FT                   PVLLEIFNNLFMSIAEQMGFRLEATAQSVNIRERLDFSCALFDPDGNLVANAPHIPVHL
FT                   GSMGTTVKEVIRRRLSGMKPGDVYAVNDPYHGGTHLPDITVITPVFNTGGEDVLFFVAS
FT                   RGHHAEIGGITPGSMPADSREIHEEGVLFDNWLLAENGRFREAETRRLLTEAPFGSRNP
FT                   DTNLADLRAQIAANQKGVDEVGKMIDHFGRDVVAAYMRHVQDNAEEAVRRVIDRLDNGA
FT                   YRYRMDSGATIAVRITVDRAARSATIDFTGTSAQLDTNFNAPTSVVNAAVLYVFRTLVA
FT                   DDIPLNDGCLRPLRIVVPEGSMLAPTHPAAVVAGNVETSQAITGALFAALGVQAEGSGT
FT                   MNNVTFGNERHQYYETVGSGSGAGDGYHGASVVQTHMTNSRLTDPEVLEWRYPVLLREF
FT                   AVRQGSGGAGRWRGGDGAVRRLEFTEPMTVSTLSGHRRVRPYGMAGGSPGELGRNRVER
FT                   ADGSTVELAGCGSTHVEPGDTLVIETPGGGGYGPASTSARRRR"
FT   gene            322693..324084
FT                   /gene="narU"
FT                   /locus_tag="MRA_0275"
FT   CDS_pept        322693..324084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narU"
FT                   /locus_tag="MRA_0275"
FT                   /product="integral membrane nitrite extrusion protein NarU"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71993"
FT                   /db_xref="GOA:A5TYZ3"
FT                   /db_xref="InterPro:IPR004737"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYZ3"
FT                   /protein_id="ABQ71993.1"
FT                   /translation="MALTTAPAIDYALPRQQDEGDHWIDDWRPEDPVFWETIGRPIARR
FT                   NLIFSIFAEHVGFSVWMLWSIVVVQMTAAAPGHPAASGWALSASQALCLVAVPSGVGAF
FT                   LRLPYTFAIPIFGGRNWTTVSAALLVIPCLLLAWAVSHPSLPFAVLVVIAATAGFGGGN
FT                   FASSMANISFFYPEKDKGWALGLNAAGGNIGVAVVQKIIPPIVVAGSGVALSRAGLFFV
FT                   PLAVAAAVCAFLFMNNLTEAKADVKPVWQSLRHADTWIMSLLYIGTFGSFIGYSAAFPT
FT                   LLKTVFGRGDIALGWAFLGAGIGSLVRPLGGKLADRIGGARITAASFVMLAAGAAAALW
FT                   SVQSVNLPVFFVSFMFLFVATGIGNGSSYRMISRIFQVKGEVAGGDPETMVNMRRQAAG
FT                   ALGIISSIGAFGGFVVPLAYAWSKVHFGNIEPALHFYVAFFLALLVVTWYCYLRRTTPM
FT                   GQVGV"
FT   gene            complement(324126..324635)
FT                   /locus_tag="MRA_0276"
FT   CDS_pept        complement(324126..324635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71994"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYZ4"
FT                   /protein_id="ABQ71994.1"
FT                   /translation="MGTRSKSRTRQLKQSNGCTATTSGASDRRRRARRRTAPAWLREDE
FT                   WLRHHLPHPPRQLSRCLHRRRRSACHHRYSRRTPKGGLPMTSSLVPISEARAHLSRLVR
FT                   ESADDDVVLMNHGRPAAILISAERYESLMEELEDLRDRLSVHEREHVTMPLDKLGAELG
FT                   VDIGRV"
FT   gene            complement(324700..325893)
FT                   /locus_tag="MRA_0277"
FT   CDS_pept        complement(324700..325893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0277"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71995"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYZ5"
FT                   /protein_id="ABQ71995.1"
FT                   /translation="MSRMAAPVSLDVHGRQVIVTHPGRVVFPAHNDRKGYTKFDLVRYY
FT                   LAVAEGAMRGVAGRPMILKRFVKGISAEAVFQKRAPANRPDWVDVAELHYASGRSAAEA
FT                   VIHDAAGLAWVINLGCVDLNPHPVLAGDLDHPDELRVDLDPMPGVAWQRVVEVALVVRE
FT                   VLEDYGLTAWPKTSGSRGFHVYARIAPCWSFPQVRLAAQTVAREVERRLPDAATSRWWK
FT                   EEREGVFVDFNQNAKDRTVASAYSVRATPDARVSTPLHWEEVPGCDPAVFTMATVPSRL
FT                   ADIGDPWAGMDDAVGRLDRLLMLAEELGPPQKAQSAKPLIEIARAKTRAEAMAALDIWR
FT                   DRYPGAAALLRPADVLVDGMRGPSSIWYRIRINLQHVPADQRPPQEELIADYSPWPR"
FT   gene            325929..327611
FT                   /gene="fadD2"
FT                   /locus_tag="MRA_0278"
FT   CDS_pept        325929..327611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD2"
FT                   /locus_tag="MRA_0278"
FT                   /product="fatty-acid-CoA ligase FadD2"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71996"
FT                   /db_xref="GOA:A5TYZ6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYZ6"
FT                   /protein_id="ABQ71996.1"
FT                   /translation="MPNLTDLPGQAVSKLQKSIGQYVARGTAELHYLRKIIESGAIGLE
FT                   PPLNYAALAADIRKWGEVGMLPSHNARRAPNRAAVIDEEGTLTFSELDEAAHAVANGLL
FT                   AKGVRAGDGVAILARNHRWFVIANYGAARVGARIILLNSEFSGPQIKEVSDREGAKVII
FT                   YDDEYTKAVSLAQPPLGKLRALGVNPDDDKPSGSSDETLAELIAHSSTAPAPKASRRAS
FT                   IIILTSGTTGTPKGANRNTPPTLAPIGGILSHVPFKAGEVTLLPSPMFHALGYMHAALA
FT                   MFLGSTLVLRRRFKPALVLEDIEKHKATSMVVVPVMLSRILDQLEKTEPKPDLSSLKIV
FT                   FVSGSQLGAELATRALGDLGPVIYNMYGSTEVAFATIAGPKDLQFNPSTVGPVVKGVTV
FT                   KILDENGNEVPQGAVGRIFVGNAFPFEGYTGGGGKQIIDGLLSSGDVGYFDERGLLYVS
FT                   GRDDEMIVSGGENVFPAEVEDLISGHPDVVEAAAIGVDDKEFGARLRAFVVKKPGADLD
FT                   EDTIKQYVRDHLARYKVPREVIFLDELPRNPTGKVLKRELRKL"
FT   gene            complement(327628..329823)
FT                   /gene="fadE6"
FT                   /locus_tag="MRA_0279"
FT   CDS_pept        complement(327628..329823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadE6"
FT                   /locus_tag="MRA_0279"
FT                   /product="acyl-CoA dehydrogenase FadE6"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71997"
FT                   /db_xref="GOA:A5TYZ7"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYZ7"
FT                   /protein_id="ABQ71997.1"
FT                   /translation="MSIAITPEHYELADSVRSLVARVAPSEVLHAALESPVENPPPYWQ
FT                   AAAEQGLQGVHLAESVGGQGFGILELAVVLAEFGYGAVPGPFVPSAIASALIAAHDPQA
FT                   KVLAELATGAAIAAYALDSGLTATRHGDVLVIRGEVRAVPAAAQASVLVLPVAIESRDE
FT                   WVVLRNDQLEIEAVKSLDPLRPIAHVRANAVDVSDDALLSNLTMTTAHALMSTLLSAEA
FT                   VGVARWATDTASAYAKIREQFGRPIGQFQAIKHKCAEMIADTERATAAVWDAARALDDA
FT                   GESSSDVEFAAAVAATLAPATAQRCTQDCIQVHGGIGFTWEHDTNVYYRRALMLAACFG
FT                   RGSEYPQRVVDTATTAGMRPVDIDLDPSTEKLRAQIRAEVAALKAMPREPRTVAIAEGG
FT                   WVLPYLPKPWGRAASPVEQIIIAQEFTAGRVKRPQIAIATWIVPSIVAFGTDNQKQRLL
FT                   PPTFRGDIFWCQLFSEPGAGSDLASLATKATRVDGGWRITGQKIWTTGAQYSQWGALLA
FT                   RTDPSAPKHNGITYFLLDMKSEGVQVKPLRELTGKEFFNTVYLDDVFVPDELVLGEVNR
FT                   GWEVSRNTLTAERVSIGGSDSTFLPTLGEFVDFVRDYRFEGQFDQVARHRAGQLIAEGH
FT                   ATKLLNLRSTLLTLAGGDPMAPAAISKLLSMRTGQGYAEFAVSSFGTDAVIGDTERLPG
FT                   KWGEYLLASRATTIYGGTSEVQLNIIAERLLGLPRDP"
FT   gene            complement(329937..331070)
FT                   /locus_tag="MRA_0280"
FT   CDS_pept        complement(329937..331070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71998"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYZ8"
FT                   /protein_id="ABQ71998.1"
FT                   /translation="MTGRAATPGVIREFVGLPSRTAGRAAAGGHPCQGLYHHSVGRKPK
FT                   VALIAAHYQIDFSEHYLAEYMAIRGIGFLGWNTRFRGFESSFLLDHALVDIGVGVRWLR
FT                   EVQGVETVVLLGNSGGGSLMAAYQSQAVDPNVTPLDGMRPAAGVTELPAADAYVAAAAH
FT                   PGRPDVLTAWMDAAVIDENDPVATDPELDLFDERNGPPYSPEFISRYRSAQVKRNHTIT
FT                   DWAESELKRVRAAGFSDRPFSVMRTWADPRMVDPSIEPTKRRPNQCYAGTPVKANRSAH
FT                   GIAAACTLRGWLGMWSLRVAQTRAAPHLARITCPALVLNAEADTGIFPSDAQQIYDGLA
FT                   SSDKTQVSIDTDHYFTTPGARSEQADTIAKWIAKRWR"
FT   gene            complement(331067..331687)
FT                   /locus_tag="MRA_0281"
FT   CDS_pept        complement(331067..331687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0281"
FT                   /product="putative transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ71999"
FT                   /db_xref="GOA:A5TYZ9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A5TYZ9"
FT                   /protein_id="ABQ71999.1"
FT                   /translation="MPDFPTQRGRRTQAAIDAAARTVVVRNGILATTVADITAEAGRSA
FT                   ASFYNYYDSKEAMVRQWALRFRDDANQRALSVIRHGLSDRERAYEAAAAHWYTYRNRLA
FT                   EAISVSQLAMVSDDFAQYWSEICQIPISFITETVKRAQAHGYCVGDDPQLMAEAIVAMF
FT                   NQFCYLQLSGKRSRRGQPDDQACIQTLANIYYRAIYSKEDSSN"
FT   gene            331784..332365
FT                   /locus_tag="MRA_0282"
FT   CDS_pept        331784..332365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72000"
FT                   /db_xref="GOA:A5TZ00"
FT                   /db_xref="InterPro:IPR000486"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ00"
FT                   /protein_id="ABQ72000.1"
FT                   /translation="MIKPHNTNTEFELGGINHVALVCSDMARTVDFYSNILGMPLIKAL
FT                   DLPGGQGQHFFFDAGNGDCVAFFWFADAPDRVPGLSSPVAIPGIGDITSAVSTMNHLAF
FT                   HVPAERFDAYRQRLKDKGVRVGPVLNHDDSETQVSAVVHPGVYVRSFYFQDPDGITLEF
FT                   ACWTKEFTTSDAQAVPKTAADRRPPVAADR"
FT   gene            complement(332295..333020)
FT                   /locus_tag="MRA_0283"
FT   CDS_pept        complement(332295..333020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0283"
FT                   /product="putative marr-family transcriptional regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72001"
FT                   /db_xref="GOA:A5TZ01"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ01"
FT                   /protein_id="ABQ72001.1"
FT                   /translation="MTRSDRPYRGVEAAERLATRRRQSLSAGLDLLGSDQHDIAELTIR
FT                   TICRRAGLSVRYFYESFTDKDEFVGRVFDWVVAELVATTQAAVTAVPAREQTRAGMANI
FT                   VRTITADARVGRLLFSTQLANAVITRKRAESSALFAMLSGQHAVDTLHAPANDHVKAVA
FT                   HFAVGGVGQTISAWLAGDVRLDPDQLVDQLAALLDELTDPNLSRPRVAATAAKSGANDP
FT                   QPPEVAGQPPSSARPARRS"
FT   gene            333110..334030
FT                   /locus_tag="MRA_0284"
FT   CDS_pept        333110..334030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72002"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ02"
FT                   /protein_id="ABQ72002.1"
FT                   /translation="MAISLVAHQPIPHVERPMADPPRLQLARRRRSAAGPGGNEDSLMG
FT                   VALLAGPANVIMELAMPGVGYGVLESRVESGRLDRHPIKRARTTFTYVAVAVAGSDDQK
FT                   AAFRRAVNKVHAQVYSTPESPVSYHAFDPELQLWVAACLYKGGVDVYRTFVGEMDDEEA
FT                   DHHYRAGMAMGTTLQVPPQMWPPDRAAFDRYWRQSLDRVHIDDVVRDYLYPIVALRIRG
FT                   IALPGPLRRLSEGIALLITTGFLPQRFRDEMRLPWDATKQRRFDALMAVLRTVNRLMPR
FT                   FVREFPFNLMLWDLDRRMRRGRPLV"
FT   gene            complement(334070..334498)
FT                   /locus_tag="MRA_0285"
FT   CDS_pept        complement(334070..334498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72003"
FT                   /db_xref="GOA:A5TZ03"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR006226"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ03"
FT                   /protein_id="ABQ72003.1"
FT                   /translation="MFLIDVNVLLAAHRGDHPNHRTVRPWFDRLLAADDPFTVPNLVWA
FT                   SFLRLTTNRRIFEIPSPRADAFAFVEAVNAQPHHLPTSPGPRHLVLLRKLCDEADASGD
FT                   LIPDAVLGAIAVEHHCAVVSLDRDFARFASVRHIRPPI"
FT   gene            complement(334522..334704)
FT                   /locus_tag="MRA_0286"
FT   CDS_pept        complement(334522..334704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72004"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ04"
FT                   /protein_id="ABQ72004.1"
FT                   /translation="MGAVIEDALRRELAAARTGGARPTVPVFDAGTGPRPGIDLTSNTV
FT                   LSEVLDEGLELNSRK"
FT   gene            complement(334799..337672)
FT                   /locus_tag="MRA_0287"
FT   CDS_pept        complement(334799..337672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0287"
FT                   /product="PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72005"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ05"
FT                   /protein_id="ABQ72005.1"
FT                   /translation="MSFVIAAPEVIAAAATDLASLGSSISAANAAAAANTTALMAAGAD
FT                   EVSTAIAALFGAHGQAYQALSAQAQAFHAQFVQALTSGGGAYAAAEAAAVSPLLDPINE
FT                   FFLANTGRPLIGNGANGAPGTGANGGDGGWLIGNGGAGGSGAAGVNGGAGGNGGAGGNG
FT                   GAGGLIGNGGAGGAGGVASSGIGGSGGAGGNAMLFGAGGAGGAGGGVVALTGGAGGAGG
FT                   AGGNAGLLFGAAGVGGAGGFTNGSALGGAGGAGGAGGLFATGGVGGSGGAGSSGGAGGA
FT                   GGAGGLFGAGGTGGHGGFADSSFGGVGGAGGAGGLFGAGGEGGSGGHSLVAGGDGGAGG
FT                   NAGMLALGAAGGAGGIGGDGGTLTAGGIGGAGGAGGNAGLLFGSGGSGGAGGFGFADGG
FT                   QGGPGGNAGTVFGSGGAGGNGGVGQGFAGGIGGAGGTPGLIGNGGNGGNGGASAVTGGN
FT                   GGIGGTGVLIGNGGNGGSGGIGAGKAGVGGVSGLLLGLDGFNAPASTSPLHTLQQNVLN
FT                   VVNEPFQTLTGRPLIGNGANGTPGTGADGGAGGWLFGNGANGTPGTGAAGGAGGWLFGN
FT                   GGNGGHGATNTAATATGGAGGAGGILFGTGGNGGTGGIATGAGGIGGAGGAGGVSLLIG
FT                   SGGTGGNGGNSIGVAGIGGAGGRGGDAGLLFGAAGTGGHGAAGGVPAGVGGAGGNGGLF
FT                   ANGGAGGAGGFNAAGGNGGNGGLFGTGGTGGAGTNFGAGGNGGNGGLFGAGGTGGAAGS
FT                   GGSGITTGGGGHGGNAGLLSLGASGGAGGSGGASSLAGGAGGTGGNGALLFGFGGAGGA
FT                   GGHGGAALTSIQQGGAGGAGGNGGLLFGSAGAGGAGGSGANALGAGTGGTGGDGGHAGV
FT                   FGNGGDGGCRRVWRRYRRQRWCRRQRRADRQRRQRRQRRQSRGHARCRRHRRAAARRER
FT                   TQRLAIAGRPATTRGVEGISCSPQMMP"
FT   gene            complement(337922..340435)
FT                   /locus_tag="MRA_0288"
FT   CDS_pept        complement(337922..340435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0288"
FT                   /product="PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72006"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ06"
FT                   /protein_id="ABQ72006.1"
FT                   /translation="MSFVIAAPEVIAAAATDLASLESSIAAANAAAAANTTALLAAGAD
FT                   EVSTAVAALFGAHGQAYQALSAQAQAFHAQFVQALTSGGGAYAAAEAAATSPLLAPINE
FT                   FFLANTGRPLIGNGTNGAPGTGANGGDGGWLIGNGGAGGSGAAGVNGGAGGNGGAGGLI
FT                   GNGGAGGAGGRASTGTGGAGGAGGAAGMLFGAAGVGGPGGFAAAFGATGGAGGAGGNGG
FT                   LFADGGVGGAGGATDAGTGGAGGSGGNGGLFGAGGTGGPGGFGIFGGGAGGDGGSGGLF
FT                   GAGGTGGSGGTSIINVGGNGGAGGDAGMLSLGAAGGAGGSGGSSPDGGGGAGGIGGDGG
FT                   TLFGSGGAGGVGGLGFDAGGAGGAGGKAGLLSGAGGAGGAGGGSFAGAGGTGGAGGAPG
FT                   LVGNAGNGGNGGASANGAGAAGGAGGSGVLIGNGGNGGSGGTGAPAGTAGAGGLGGQLL
FT                   GRDGFNAPASTPLHTLQQQILNAINEPTQALTGRPLIGNGANGTPGTGADGGAGGWLFG
FT                   NGGNGGHGATGADGGDGGSGGAGGILSGIGGTGGSGGIGTTGQGGTGGTGGAALLIGSG
FT                   GTGGSGGFGLDTGGAGGRGGDAGLFLGAAGTGGQAALSQNFIGAGGTAGAGGTGGLFAN
FT                   GGAGGAGGFGANGGTGGNGLLFGAGGTGGAGTLGADGGAGGHGGLFGAGGTGGAGGSSG
FT                   GTFGGNGGSGGNAGLLALGASGGAGGSGGSALNVGGTGGVGGNGGSGGSLFGFGGAGGT
FT                   GGSSGIGSSGGTGGDGGTAGVFGKKGDGGAGGFGAGTGGYGGVGGNAVLIGNGGNGGNG
FT                   GKAGGTPGAGGTSGLIIGENGLNGL"
FT   gene            340726..342336
FT                   /locus_tag="MRA_0289"
FT   CDS_pept        340726..342336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0289"
FT                   /product="PPE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72007"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ07"
FT                   /protein_id="ABQ72007.1"
FT                   /translation="MTLWMASPPEVHSALLSSGPGPGSVLSAAGVWSSLSAEYAAVADE
FT                   LIGLLGAVQTGAWQGPSAAAYVAAHAPYLAWLMRASETSAEAAARHETVAAAYTTAVAA
FT                   MPTLVELAANHTLHGVLVATNFFGINTIPIALNEADYARMWTQAASTMATYQAVAEAAV
FT                   ASAPQTTPAPPILAAEAADDDHDHDHDHGGEPTPLDYLVAEILRIISGGRLIWDPAEGT
FT                   MNGIPFEDYTDAAQPIWWVVRAIEFSKDFETFVQELFVNPVEAFQFYFELLLFDYPTHI
FT                   VQIVEALSQSPQLLAVALGSVISNLGAVTGFAGLSGLAGMQPAAIPALAPVAAAPSTLP
FT                   AVAMAPTMAAPGAAVASAAAPASAPAASTVASATPAPPPAPGAAGFGYPYAIAPPGIGF
FT                   GSGMSASASAQRKAPQPDSAAAAAAAAAVRDQARARRRRRVTRRGYGDEFMDMNIDVDP
FT                   DWGPPPGEDPVTSTVASDRGAGHLGFAGTARREAVADAAGMTTLAGDDFGDGPTTPMVP
FT                   GSWDPDRDAPGSAEPGDRG"
FT   gene            342360..343268
FT                   /locus_tag="MRA_0290"
FT   CDS_pept        342360..343268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72008"
FT                   /db_xref="GOA:A5TZ08"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TZ08"
FT                   /protein_id="ABQ72008.1"
FT                   /translation="MRTEGDSWDITTSVGSTALFVATARALEAQKSDPLVVDPYAEAFC
FT                   RAVGGSWADVLDGKLPDHKLKSTDFGEHFVNFQGARTKYFDEYFRRAAAAGARQVVILA
FT                   AGLDSRAYRLPWPDGTTVFELDRPQVLDFKREVLASHGAQPRALRREIAVDLRDDWPQA
FT                   LRDSGFDAAAPSAWIAEGLLIYLPATAQERLFTGIDALAGRRSHVAVEDGAPMGPDEYA
FT                   AKVEEERAAIAEGAEEHPFFQLVYNERCAPAAEWFGERGWTAVATLLNDYLEAVGRPVP
FT                   GPESEAGPMFARNTLVSAARV"
FT   gene            343492..345387
FT                   /locus_tag="MRA_0291"
FT   CDS_pept        343492..345387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72009"
FT                   /db_xref="GOA:A5TZ09"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR023835"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041627"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ09"
FT                   /protein_id="ABQ72009.1"
FT                   /translation="MAGVGEGDSGGVERDDIGMVAASPVASRVNGKVDADVVGRFATCC
FT                   RALGIAVYQRKRPPDLAAARSGFAALTRVAHDQCDAWTGLAAAGDQSIGVLEAASRTAT
FT                   TAGVLQRQVELADNALGFLYDTGLYLRFRATGPDDFHLAYAAALASTGGPEEFAKANHV
FT                   VSGITERRAGWRAARWLAVVINYRAERWSDVVKLLTPMVNDPDLDEAFSHAAKITLGTA
FT                   LARLGMFAPALSYLEEPDGPVAVAAVDGALAKALVLRAHVDEESASEVLQDLYAAHPEN
FT                   EQVEQALSDTSFGIVTTTAGRIEARTDPWDPATEPGAEDFVDPAAHERKAALLHEAELQ
FT                   LAEFIGLDEVKRQVSRLKSSVAMELVRKQRGLTVAQRTHHLVFAGPPGTGKTTIARVVA
FT                   KIYCGLGLLKRENIREVHRADLIGQHIGETEAKTNAIIDSALDGVLFLDEAYALVATGA
FT                   KNDFGLVAIDTLLARMENDRDRLVVIIAGYRADLDKFLDTNEGLRSRFTRNIDFPSYTS
FT                   HELVEIAHKMAEQRDSVFEQSALHDLEALFAKLAAESTPDTNGISRRSLDIAGNGRFVR
FT                   NIVERSEEEREFRLDHSEHAGSGEFSDEELMTITADDVGRSVEPLLRGLGLSVRA"
FT   gene            345384..347000
FT                   /locus_tag="MRA_0292"
FT   CDS_pept        345384..347000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0292"
FT                   /product="putative conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72010"
FT                   /db_xref="GOA:A5TZ10"
FT                   /db_xref="InterPro:IPR007795"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ10"
FT                   /protein_id="ABQ72010.1"
FT                   /translation="MTNQQHDHDFDHDRRSFASRTPVNNNPDKVVYRRGFVTRHQVTGW
FT                   RFVMRRIAAGIALHDTRMLVDPLRTQSRAVLMGVLIVITGLIGSFVFSLIRPNGQAGSN
FT                   AVLADRSTAALYVRVGEQLHPVLNLTSARLIVGRPVSPTTVKSTELDQFPRGNLIGIPG
FT                   APERMVQNTSTDANWTVCDGLNAPSRGGADGVGVTVIAGPLEDTGARAAALGPGQAVLV
FT                   DSGAGTWLLWDGKRSPIDLADHAVTSGLGLGADVPAPRIIASGLFNAIPEAPPLTAPII
FT                   PDAGNPASFGVPAPIGAVVSSYALKDSGKTISDTVQYYAVLPDGLQQISPVLAAILRNN
FT                   NSYGLQQPPRLGADEVAKLPVSRVLDTRRYPSEPVSLVDVTRDPVTCAYWSKPVGAATS
FT                   SLTLLAGSALPVPDAVHTVELVGAGNGGVATRVALAAGTGYFTQTVGGGPDAPGAGSLF
FT                   WVSDTGVRYGIDNEPQGVAGGGKAVEALGLNPPPVPIPWSVLSLFVPGPTLSRADALLA
FT                   HDTLVPDSRPARPVSAEGGYR"
FT   gene            346997..350989
FT                   /locus_tag="MRA_0293"
FT   CDS_pept        346997..350989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0293"
FT                   /product="putative conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72011"
FT                   /db_xref="GOA:A5TZ11"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR023836"
FT                   /db_xref="InterPro:IPR023837"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ11"
FT                   /protein_id="ABQ72011.1"
FT                   /translation="MSRLIFEARRRLAPPSSHQGTIIIEAPPELPRVIPPSLLRRALPY
FT                   LIGILIVGMIVALVATGMRVISPQTLFFPFVLLLAATALYRGNDKKMRTEEVDAERADY
FT                   LRYLSVVRDNIRAQAAEQRASALWSHPDPTALASVPGSRRQWERDPHDPDFLVLRAGRH
FT                   TVPLATTLRVNDTADEIDLEPVSHSALRSLLDTQRSIGDVPTGIDLTKVSPITVLGERA
FT                   QVRAVLRAWIAQAVTWHDPTVLGVALAARDLEGRDWNWLKWLPHVDIPGRLDALGPARN
FT                   LSTDPDELIALLGPVLADRPAFTGQPTDALRHLLIVVDDPDYDLGASPLAVGRAGVTVV
FT                   HCSASAPHREQYSDPEKPILRVAHGAIERWQTGGWQPYIDAADQFSADEAAHLARRLSR
FT                   WDSNPTHAGLRSAATRGASFTTLLGIEDASRLDVPALWAPRRRDEELRVPIGVTGTGEP
FT                   LMFDLKDEAEGGMGPHGLMIGMTGSGKSQTLMSILLSLLTTHSAERLIVIYADFKGEAG
FT                   ADSFRDFPQVVAVISNMAEKKSLADRFADTLRGEVARREMLLREAGRKVQGSAFNSVLE
FT                   YENAIAAGHSLPPIPTLFVVADEFTLMLADHPEYAELFDYVARKGRSFRIHILFASQTL
FT                   DVGKIKDIDKNTAYRIGLKVASPSVSRQIIGVEDAYHIESGKEHKGVGFLVPAPGATPI
FT                   RFRSTYVDGIYEPPQTAKAVVVQSVPEPKLFTAAAVEPDPGTVIADTDEQEPADPPRKL
FT                   IATIGEQLARYGPRAPQLWLPPLDETIPLSAALARAGVGPRQWRWPLGEIDRPFEMRRD
FT                   PLVFDARSSAGNMVIHGGPKSGKSTALQTFILSAASLHSPHEVSFYCLDYGGGQLRALQ
FT                   DLAHVGSVASALEPERIRRTFGELEQLLLSRQQREVFRDRGANGSTPDDGFGEVFLVID
FT                   NLYGFGRDNTDQFNTRNPLLARVTELVNVGLAYGIHVIITTPSWLEVPLAMRDGLGLRL
FT                   ELRLHDARDSNVRVVGALRRPADAVPHDQPGRGLTMAAEHFLFAAPELDAQTNPVAAIN
FT                   ARYPGMAAPPVRLLPTNLAPHAVGELYRGPDQLVIGQREEDLAPVILDLAANPLLMVFG
FT                   DARSGKTTLLRHIIRTVREHSTADRVAFTVLDRRLHLVDEPLFPDNEYTANIDRIIPAM
FT                   LGLANLIEARRPPAGMSAAELSRWTFAGHTHYLIIDDVDQVPDSPAMTGPYIGQRPWTP
FT                   LIGLLAQAGDLGLRVIVTGRATGSAHLLMTSPLLRRFNDLQATTLMLAGNPADSGKIRG
FT                   ERFARLPAGRAILLTDSDSPTYVQLINPLVDAAAVSGETQQKGSQS"
FT   gene            350986..351294
FT                   /locus_tag="MRA_0294"
FT   CDS_pept        350986..351294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0294"
FT                   /product="PE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72012"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ12"
FT                   /protein_id="ABQ72012.1"
FT                   /translation="MTLRVVPEGLAAASAAVEALTARLAAAHASAAPVITAVVPPAADP
FT                   VSLQTAAGFSAQGVEHAVVTAEGVEELGRAGVGVGESGASYLAGDAAAAATYGVVGG"
FT   gene            351345..352838
FT                   /locus_tag="MRA_0295"
FT   CDS_pept        351345..352838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0295"
FT                   /product="PPE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72013"
FT                   /db_xref="GOA:A5TZ13"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ13"
FT                   /protein_id="ABQ72013.1"
FT                   /translation="MLSNGPGPGSLVAAATAWSQLSAEYASTAAELSGLLGAVPGWAWQ
FT                   GPSAEWYVAAHLPYVAWLTQASADAAGAAAQHEAAAAAYTTALAAMPTLAELAANHVIH
FT                   TVLVATNFFGINTIPITLNEADYVRMWLQAAAVMGLYQAASGAALASAPRTVPAPTVMN
FT                   PGGGAASTVGAVNPWQWLLALLQQLWNAYTGFYGWMLQLIWQFLQDPIGNSIKIIIAFL
FT                   TNPIQALITYGPLLFALGYQIFFNLVGWPTWGMILSSPFLLPAGLGLGLAAIAFLPIVL
FT                   APAVIPPASTPLAAAAVAAGSVWPAVSMAVTGAGTAGAATPAAGAAPSAGAAPAPAAPA
FT                   TASFAYAVGGSGDWGPSLGPTVGGRGGIKAPAATVPAAAAAAATRGQSRARRRRRSELR
FT                   DYGDEFLDMDSDSGFGPSTGDHGAQASERGAGTLGFAGTATKERRVRAVGLTALAGDEF
FT                   GNGPRMPMVPGTWEQGSNEPEAPDGSGRGGGDGLPHDSK"
FT   gene            352887..353180
FT                   /locus_tag="MRA_0296"
FT   CDS_pept        352887..353180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0296"
FT                   /product="PE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72014"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ14"
FT                   /protein_id="ABQ72014.1"
FT                   /translation="MSLLDAHIPQLVASQSAFAAKAGLMRHTIGQAEQAAMSAQAFHQG
FT                   ESSAAFQAAHARFVAAAAKVNTLLDVAQANLGEAAGTYVAADAAAASTYTGF"
FT   gene            353210..353500
FT                   /gene="esxH"
FT                   /locus_tag="MRA_0297"
FT   CDS_pept        353210..353500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="esxH"
FT                   /locus_tag="MRA_0297"
FT                   /product="antigen Esxh"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72015"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ15"
FT                   /protein_id="ABQ72015.1"
FT                   /translation="MSQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQG
FT                   DTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGG"
FT   gene            353511..354398
FT                   /locus_tag="MRA_0298"
FT   CDS_pept        353511..354398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72016"
FT                   /db_xref="InterPro:IPR025734"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ16"
FT                   /protein_id="ABQ72016.1"
FT                   /translation="MDATPNAVELTVDNAWFIAETIGAGTFPWVLAITMPYSDAAQRGA
FT                   FVDRQRDELTRMGLLSPQGVINPAVADWIKVVCFPDRWLDLRYVGPASADGACELLRGI
FT                   VALRTGTGKTSNKTGNGVVALRNAQLVTFTAMDIDDPRALVPILGVGLAHRPPARFDEF
FT                   SLPTRVGARADERLRSGVPLGEVVDYLGIPASARPVVESVFSGPRSYVEIVAGCNRDGR
FT                   HTTTEVGLSIVDTSAGRVLVSPSRAFDGEWVSTFSPGTPFAIAVAIQTLTACLPDGQWF
FT                   PGQRVSRDFSTQSS"
FT   gene            354445..355863
FT                   /locus_tag="MRA_0299"
FT   CDS_pept        354445..355863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0299"
FT                   /product="putative conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72017"
FT                   /db_xref="GOA:A5TZ17"
FT                   /db_xref="InterPro:IPR006707"
FT                   /db_xref="InterPro:IPR024962"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ17"
FT                   /protein_id="ABQ72017.1"
FT                   /translation="MSGTVMQIVRVAILADSRLTEMALPAELPLREILPAVQRLVVPSA
FT                   QNGDGGQADSGAAVQLSLAPVGGQPFSLDASLDTVGVVDGDLLVLQPVPAGPAAPGIVE
FT                   DIADAAMIFSTSRLKPWGIAHIQRGALAAVIAVALLATGLTVTYRVATGVLAGLLAVAG
FT                   IAVASALAGLLITIRSPRSGIALSIAALVPIGAALALAVPGKFGPAQVLLGAAGVAAWS
FT                   LIALMIPSAERERVVAFFTAAAVVGASVALAAGAQLLWQLPLLSIGCGLIVAALLVTIQ
FT                   AAQLSALWARFPLPVIPAPGDPTPSAPPLRLLEDLPRRVRVSDAHQSGFIAAAVLLSVL
FT                   GSVAIAVRPEALSVVGWYLVAATAAAATLRARVWDSAACKAWLLAQPYLVAGVLLVFYT
FT                   ATGRYVAAFGAVLVLAVLMLAWVVVALNPGIASPESYSLPLRRLLGLVAAGLDVSLIPV
FT                   MAYLVGLFAWVLNR"
FT   gene            355860..357245
FT                   /gene="mycP3"
FT                   /locus_tag="MRA_0300"
FT   CDS_pept        355860..357245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mycP3"
FT                   /locus_tag="MRA_0300"
FT                   /product="putative membrane-anchored mycosin MycP3"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72018"
FT                   /db_xref="GOA:A5TZ18"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023834"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ18"
FT                   /protein_id="ABQ72018.1"
FT                   /translation="MIRAAFACLAATVVVAGWWTPPAWAIGPPVVDAAAQPPSGDPGPV
FT                   APMEQRGACSVSGVIPGTDPGVPTPSQTMLNLPAAWQFSRGEGQLVAIIDTGVQPGPRL
FT                   PNVDAGGDFVESTDGLTDCDGHGTLVAGIVAGQPGNDGFSGVAPAARLLSIRAMSTKFS
FT                   PRTSGGDPQLAQATLDVAVLAGAIVHAADLGAKVINVSTITCLPADRMVDQAALGAAIR
FT                   YAAVDKDAVIVAAAGNTGASGSVSASCDSNPLTDLSRPDDPRNWAGVTSVSIPSWWQPY
FT                   VLSVASLTSAGQPSKFSMPGPWVGIAAPGENIASVSNSGDGALANGLPDAHQKLVALSG
FT                   TSYAAGYVSGVAALVRSRYPGLNATEVVRRLTATAHRGARESSNIVGAGNLDAVAALTW
FT                   QLPAEPGGGAAPAKPVADPPVPAPKDTTPRNVAFAGAAALSVLVGLTAATVAIARRRRE
FT                   PTE"
FT   gene            357242..358237
FT                   /locus_tag="MRA_0301"
FT   CDS_pept        357242..358237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0301"
FT                   /product="putative conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72019"
FT                   /db_xref="GOA:A5TZ19"
FT                   /db_xref="InterPro:IPR021368"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ19"
FT                   /protein_id="ABQ72019.1"
FT                   /translation="MNPIPSWPGRGRVTLVLLAVVPVALAYPWQSTRDYVLLGVAAAVV
FT                   IGLFGFWRGLYFTTIARRGLAILRRRRRIAEPATCTRTTVLVWVGPPASDTNVLPLTLI
FT                   ARYLDRYGIRADTIRITSRVTASGDCRTWVGLTVVADDNLAALQARSARIPLQETAQVA
FT                   ARRLADHLREIGWEAGTAAPDEIPALVAADSRETWRGMRHTDSDYVAAYRVSANAELPD
FT                   TLPAIRSRPAQETWIALEIAYAAGSSTRYTVAAACALRTDWRPGGTAPVAGLLPQHGNH
FT                   VPALTALDPRSTRRLDGHTDAPADLLTRLHWPTPTAGAHRAPLTNAVSRT"
FT   gene            complement(358224..359426)
FT                   /locus_tag="MRA_0302"
FT   CDS_pept        complement(358224..359426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72020"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ20"
FT                   /protein_id="ABQ72020.1"
FT                   /translation="MSGTFTADAIGPPVPIPDVPGADAGAEGLPSRSVLSARQRILVES
FT                   SAIADVALRTAVASVLSATVTPAVVANALRHVNEGSERSNLNFYAELAAAHDPAKSFPA
FT                   PTELPKVTSRPASPLTEWVARGTVDNIAFASGFRAINPTMRQRWSALTANNIVHAQHWR
FT                   HRDGPRPTLCVIHGFMGSSYLLNGLFFSLPWYYRSGYDVLLYTLPFHGQRAEKFSPFSG
FT                   FGYFTSGLSGFAEAMAQAVYDFRSIVDYLRHIGVDRIALTGISLGGYTSALLASVESRL
FT                   EAVIPNCPVVMPAKLFDEWFPANKLVKLGLRLTNISRDELIAGLAYHGPLNYRPLLPKD
FT                   RRMIITGLGDRMAPPEHAVTLWKQWDRCALHWFPGSHLLHVSQLDYLRRMTVFLQGLMF
FT                   D"
FT   gene            359533..360318
FT                   /gene="tam"
FT                   /locus_tag="MRA_0303"
FT   CDS_pept        359533..360318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tam"
FT                   /locus_tag="MRA_0303"
FT                   /product="trans-aconitate methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72021"
FT                   /db_xref="GOA:A5TZ21"
FT                   /db_xref="InterPro:IPR023149"
FT                   /db_xref="InterPro:IPR023506"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TZ21"
FT                   /protein_id="ABQ72021.1"
FT                   /translation="MWDPDVYLAFSGHRNRPFYELVSRVGLERARRVVDLGCGPGHLTR
FT                   YLARRWPGAVIEALDSSPEMVAAAAERGIDATTGDLRDWKPKPDTDVVVSNAALHWVPE
FT                   HSDLLVRWVDELAPGSWIAVQIPGNFETPSHAAVRALARREPYAKLMRDIPFRVGAVVQ
FT                   SPAYYAELLMDTGCKVDVWETTYLHQLTGEHPVLDWITGSALVPVRERLSDESWQQFRQ
FT                   ELIPLLNDAYPPRADGSTIFPFRRLFMVAEVGGARRSGG"
FT   gene            complement(360307..361110)
FT                   /locus_tag="MRA_0304"
FT   CDS_pept        complement(360307..361110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72022"
FT                   /db_xref="GOA:A5TZ22"
FT                   /db_xref="InterPro:IPR015124"
FT                   /db_xref="InterPro:IPR024628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ22"
FT                   /protein_id="ABQ72022.1"
FT                   /translation="MSRAVRPYLVLATQRSGSTLLVESLRATGCAGEPQEFFQYLPSTG
FT                   MAPQPREWFAGVDDDTILQLLDPLDPGTPDTATPVAWREHVRTSGRTPNGVWGGKLMWN
FT                   QTALLQQRAAQLPDRSGDGLRAAIRDVIGNEPVFVHVHRPDVVSQAVSFWRAVQTQVWR
FT                   GHPDPKRDSQAVYHAGAIAHIIRNLRDQENGWRAWFAEEGIDPIDIAYPVLWRNLTAIV
FT                   ASVLDAIGQDPKLAPAPMLERQANQRSDEWVDRYRAEAPRLGLPT"
FT   gene            complement(361120..362517)
FT                   /locus_tag="MRA_0305"
FT   CDS_pept        complement(361120..362517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0305"
FT                   /product="putative sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72023"
FT                   /db_xref="GOA:A5TZ23"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ23"
FT                   /protein_id="ABQ72023.1"
FT                   /translation="MTSERATGQRENLLIVHWHDLGRYLGVYHHPDVYSPRLDRLAAEG
FT                   ILFTRAHATAPLCTPSRGSLFTGRYPQSNGLVGLAHHGWEYRTGVQTLPQLLSESGWYS
FT                   ALFGMQHETSYPKRLGFDEFDVSNSYCEYVVAKAQDWLHNRVPALDGQRFLLTAGFFET
FT                   HRPYPHERYRPADSAAVELPDYLPDTPEVRQDVAEFYGSIATADEAVGRLLDTLADTGL
FT                   DASTWVVFVTDHGPAFPRAKSTLYDAGTGIALIIRPPTRRAMAPRVYDELFSGVDLVPT
FT                   LLDLLRLEVPADVEGVSHAPALLAPDTENAAVRDHVYTAKTYHDSFDPIRAIRTKEYSY
FT                   IENYAPRPLLDLPWDIQESPAGMAVAPLVKAPRPQRELYDLRADPTETNNLLAGDDSTQ
FT                   GVAAIAADLAVRLHDWRQRTADVIPSDFAGSRIAERYTETYLRIHRKTPTGRSAIAADR
FT                   GIDEHCS"
FT   gene            362696..364471
FT                   /locus_tag="MRA_0306"
FT   CDS_pept        362696..364471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0306"
FT                   /product="PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72024"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ24"
FT                   /protein_id="ABQ72024.1"
FT                   /translation="MSFVIAQPEMIAAAAGELASIRSAINAANAAAAAQTTGVMSAAAD
FT                   EVSTAVAALFSSHAQAYQAASAQAAAFHAQVVRTLTVDAGAYASAEAANAGPNMLAAVN
FT                   APAQALLGRPLIGNGANGAPGTGQAGGDGGLLFGNGGNGGSGAPGQAGGAGGAAGFFGN
FT                   GGNGGDGGAGANGGAGGTAGWFFGFGGNGGAGGIGVAGINGGLGGAGGDGGNAGFFGNG
FT                   GNGGMGGAGAAGVNAVNPGLATPVTPAANGGNGLNLVGVPGTAGGGADGANGSAIGQAG
FT                   GAGGDGGNASTSGGIGIAQTGGAGGAGGAGGDGAPGGNGGNGGSVEHTGATGSSASGGN
FT                   GATGGNGGVGAPGGAGGNGGHVSGGSVNTAGAGGKGGNGGTGGAGGPGGHGGSVLSGPV
FT                   GDSGNGGAGGDGGAGVSATDIAGTGGRGGNGGHGGLWIGNGGDGGAGGVGGVGGAGAAG
FT                   AIGGHGGDGGSVNTPIGGSEAGDGGKGGLGGDGGGRGIFGQFGAGGAGGAGGVGGAGGA
FT                   GGTGGGGGNGGAIFNAGTPGAAGTGGDGGVGGTGAAGGKGGAGGSGGVNGATGADGAKG
FT                   LDGATGGKGNNGNPG"
FT   gene            364614..364841
FT                   /locus_tag="MRA_0307"
FT   CDS_pept        364614..364841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0307"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72025"
FT                   /db_xref="GOA:A5TZ25"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ25"
FT                   /protein_id="ABQ72025.1"
FT                   /translation="MTKEKISVTVDAAVLAAIDADARAAGLNRSEMIEQALRNEHLRVA
FT                   LRDYTAKTVPALDIDAYAQRVYQANRAAGS"
FT   gene            364838..365140
FT                   /locus_tag="MRA_0308"
FT   CDS_pept        364838..365140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0308"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72026"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ26"
FT                   /protein_id="ABQ72026.1"
FT                   /translation="MIAPGDIAPRRDSEHELYVAVLSNALHRAADTGRVITCPFIPGRV
FT                   PEDLLAMVVAVEQPNGTLLPELVQWLHVAALGAPLGNAGVAALREAASVVTALLC"
FT   gene            365188..365409
FT                   /locus_tag="MRA_0309"
FT   CDS_pept        365188..365409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72027"
FT                   /db_xref="GOA:A5TZ27"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ27"
FT                   /protein_id="ABQ72027.1"
FT                   /translation="MSDVLIRDIPDDVLASLDAIAARLGLSRTEYIRRRLAQDAQTARV
FT                   TVTAADLRRLRGAVAGLGDPELMRQAWR"
FT   gene            365406..365831
FT                   /locus_tag="MRA_0310"
FT   CDS_pept        365406..365831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72028"
FT                   /db_xref="GOA:A5TZ28"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ28"
FT                   /protein_id="ABQ72028.1"
FT                   /translation="MTDQRWLIDKSALVRLTDSPDMEIWSNRIERGLVHITGVTRLEVG
FT                   FSAECGEIARREFREPPLSAMPVEYLTPRIEDRALEVQTLLADRGHHRGPSIPDLLIAA
FT                   TAELSGLTVLHVDKDFDAIAALTGQKTERLTHRPPSA"
FT   gene            365967..366599
FT                   /locus_tag="MRA_0311"
FT   CDS_pept        365967..366599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0311"
FT                   /product="TetR/AcrR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72029"
FT                   /db_xref="GOA:A5TZ29"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ29"
FT                   /protein_id="ABQ72029.1"
FT                   /translation="MGVPAKKKQQQGERSRESILDATERLMATKGYAATSISDIRDACG
FT                   LAPSSIYWHFGSKEGVLAAMMERGAQRFFAAIPTWDEAHGPVEQRSERQLTELVSLQSQ
FT                   HPDFLRLFYLLSMERSQDPAVAAVVRRVRNTAIARFRDSITHLLPSDIPPGKADLVVAE
FT                   LTAFAVALSDGVYFAGHLEPDTTDVERMYRRLRQALEALIPVLLEET"
FT   gene            366596..367504
FT                   /locus_tag="MRA_0312"
FT   CDS_pept        366596..367504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0312"
FT                   /product="putative short-chain type
FT                   dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72030"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ30"
FT                   /protein_id="ABQ72030.1"
FT                   /translation="MNTGTAVITGASSGLGLQCARALLRRDASWHVVLAVRDPARGRAA
FT                   MEELGEPNRCSVLEVDLASVRSVRSFVETVRTTPLPPIRALVCNAGLQVVSGIAFTDDG
FT                   VEMTFGVNHLGHFALVTGILDWLARPARIVVVSSGTHDPSKHTGMPDPRYTCAADLAHP
FT                   PTDQNTPAEGRRRYTTSKLCNVLFTYELDRRLDHGEQGVMVNAFDPGLMPGSGLARDYP
FT                   PILRLAYRLLSPMLRVLPFVHSTRVSGEHLAALAVDPRFAGVTGQYFAGAKAIRSSAES
FT                   YDRAKALDLWETSERLLAQVT"
FT   gene            complement(367512..374633)
FT                   /locus_tag="MRA_0313"
FT   CDS_pept        complement(367512..374633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0313"
FT                   /product="PPE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72031"
FT                   /db_xref="InterPro:IPR002989"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ31"
FT                   /protein_id="ABQ72031.1"
FT                   /translation="MANTGNINTGAFISGNHSNGLLWRGDNQGLIDLAIGVDIPEIPIV
FT                   SVDVNIPIHIPITASFTDIVYSGLDLPPNTAVTVIFFGPVDIDPFTVPVIRITGPTPVV
FT                   MVGGPTTAINIGATVVVDAINIPIIHIPATPGFGNSTGGLSSGFFNSGAGSASGFGNFG
FT                   GAASGFMNLVSTTSGMSGFLNVGALGSGVANVGNTISGIYNVGTSDLSTPAVNSGLANI
FT                   GTNIAGLLRDGAGTAAINLGLANHGNLNVGFASLGGFNFGGATIGHNNVGIGNTGIFDV
FT                   GLANLGSYNIGFGNLGDDNLGFGNFGSYNIGFGNVGNDNLGFANAGGGNIGFANTGSNN
FT                   VGFGNTGSNNVGIGLTGNGQIGFGSFNSGSGNIGLFNSGSNNIGFFNSGSGNFGIANSG
FT                   SFNTGIGNTGNTNTGLFNSGDVNTGAFNPGSFNTGSFNTGSFNTGGFNPGNTNTGYLNI
FT                   GNYNTGIANTGDVDTGAFITGNYSNGLFLSGDYQGLVGLNLVIDMPLPISLGVNIPIDI
FT                   PITASAGNITLMGVTIPPTGDIVLSSIAGQRAHFGPITIPNITVVGPTTTVAIGGPNTA
FT                   ITITGGGAIRIPLISIPAAPGFGNSTTNPSSGFFNTGAGGASGFGNFGGANSGFWNLAS
FT                   ATSGASGLLNVGALGSGLANVGTTVSGFYNTSTSDLATPAFNSGLANISTSIAGLLRDS
FT                   TGTMVLNLGLANHGTLNVGIANLGDYNIGFANLGSANFGSANIGGNNIGGANTGIFDIG
FT                   LANLGSYNIGFGNFGDDNLGFGNLGSYNVGFGNLGNDNLGFANTGSNNIGFANTGSNNI
FT                   GIGLTGDGQIGFGSLNSGSGNIGLFNSGSGNIGFFNSGNGNVGIGNTGTANFGLGNTGS
FT                   TNTGFFNSGDVNTGIGNTGSFNTGSFNPGDSNTGDFNPGSYNTGLGNTGDVDTGAFISG
FT                   SYSNGFLWSGNYQGLIGLHAALAIPEIALTFGVDIPIHIPINIDAGVVTLQGFSIVAAE
FT                   NNIDFTPIIIPTINITLPTAAITVGGPTTSIGITASAGIGSITIPIIDIPATSGFGNST
FT                   TSPSSGFFNSGAGSASGFLNVVAGASGISGYLNVGALGSGVTNVGHTVSGFYNASALDL
FT                   VTPAFASGLMRDGMGTMTLNLGLANLGSNNAGFGNTGIFDVGVANLGNYNIGFGNFGDD
FT                   NLGFANLGSYNIGVANTGSNNIGFANTGSNNIGIGLTGTGQIGIGALNSGSGNIGLFNS
FT                   GDGNIGFFNSGTGNFGIGNTGTGNFGIGNSGSTSTGLFNSGDGNTGGFNPGNFNTGNFN
FT                   TGSFNTGGFNAGNTNTGHFNTGNYNTGIANTGDVSTGAFISGNYSNGILWRGDYQGLIG
FT                   YSYALTIPEIPAHLDVNIPIDIPITGSFTDLVVDNFTIPIIGFESFAFSFHIHTEPDIG
FT                   PIIVPSFVLSVPTFAIAVGGPTTAINISATAGLGPITIPIIDIPAAPGIGNSTTSPSSG
FT                   FFNTGAGTASGFGNVGGNTSGLWNLASAASGVSGLLNVGALGSGVANVGNTISGIYNTS
FT                   PLDLGTPAFGSGLANIAGLLQGGAGTTILDLAGLGNLNVGLANLGGSNFGIGNTGIFNV
FT                   GFANVGNHNIGLANLGNYSVGFANSGNYHIGIANTGSANIGFANTGSGNIGIGLTGTGQ
FT                   IGFGSFNSGSHNIGLFNSGDGNVGFFNSGTGNVGIGNTGTANFGIANSGSFNTGLGNTG
FT                   STNTGLFNPGNVNTGVGNTGSINTGSINTGSFNTGSTNTGSFNLGDHNTGSFNSGDYNT
FT                   GYFNAGDYNTGVANTGNVNTGAFISGNYSNGFFWRGDYQGLIGLSTTITIPEIPYRYDL
FT                   SVPIDIPITGTVVATTPNSFTIPGFQIRVLLGPAAVLVNEMIGPITIDVNQVIAIDSPI
FT                   QQTISMVGTGGFGPIPIGISIGGTPGFGNSTTGPSSGFFHTGAGHVSGFGNFGAGNMSG
FT                   SGNFGAGNSGFFNAGGLGNSGLLNFGALQSGLANLGNTISGVYNTSTLDLATPAFGSGI
FT                   ANIGANLAGLFLDNTGNLTLNFGVANQGGLNAGIGNLGSVNIGFVNTGDSNLGIGNLGD
FT                   LNFGGVNIGGNNIGIANTGIFDIGLANLGSYNIGLANLGDDNLGFGNAGSYNIGFANFG
FT                   SDNLGFANTGSYNIGFANTGNNNIGVGLTGNGQIGIGSLNSGSNNIGLFNSGSGNIGFF
FT                   NSGTGNVGIFNTGTGNFGLANSGGFNTGIGNAGSTNTGVFNPGDLNTGSFNPGSFNTGG
FT                   FNPGSGNTGYLNTGDYNTGVANTGDVDTGAFITGSYSNGFLVSGDYQGLIGLPLLGIPV
FT                   TPGYFNLTGGPSSGFFNSGAGSVSGFVNSGAGLSGYLNTGALGSGVANVGNTISGWLNA
FT                   SALDLATPGFLSGIGNFGTNLAGFFRG"
FT   gene            complement(374182..377073)
FT                   /locus_tag="MRA_0314"
FT   CDS_pept        complement(374182..377073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0314"
FT                   /product="PPE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72032"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR002989"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ32"
FT                   /protein_id="ABQ72032.1"
FT                   /translation="MDFVVSAPEVNSLRMYLGAGSGPMLAAAAAWDGLADELAVAASWF
FT                   GSVTSGLADAAWRGPAAVAMARAVAPYLGWLISATAQAEQAAAQARVAVATFEAARAAT
FT                   VHPAIVAANRAVLVSLVSSNLLGFNAPAIAATEAAYERMWAQDVAAMVGYHAGASAAVS
FT                   ALMPFTQQLKKLAGLSERLTSAAAAAAGPPSAAGFNLGLANVGANNVGNGNVGVFNVGF
FT                   GNLGSYNLGFANLGSDNLGLANLGGHNIGFANTGSNNVGFGNTGSNNVGIGLTGNGQIG
FT                   FGSFNSGSHNIGLFNSGSGNVGLFNSGTGNFGIGNSGTGNFGLGNTGSTNTGWFNTGDV
FT                   NTGGFNPGSYNTGNFNTGNYNTGSFNAGNYNTGYFNTGDYNTGVANTGNVNTGAFIAGN
FT                   YSNGVLWRGDYQGLIGADIALEIPAIPINAQLFSMPIHQVMVMPGSVMTIPGMRLPFTS
FT                   IVPFVVYYGPVELPQSTLTLPTVTITVGGPTTTIDGNLTGMVGGVSIPLIKIPAAPGFG
FT                   NSTTSPSSGFFNAGAGTASGFGNFGGGASGFWNLASATSGLSGFGNVGALGSGVANVGN
FT                   TISGLYNTSTSNLATPAFNSGLLHHSVGTMTLNFGLANVGGNNVGGANAGIFNVGLANL
FT                   GDYNIGFGNLGGDNLGFAHAGSYNIGFANTGSNNLGFANTGDNNIGFANIGSNNIGIGL
FT                   TGSGQIGFGSLNSGSHNIGLFNSGDGNIGLFNSGSGNFGIGNAGTGNWGIGNSGAGNFG
FT                   IGNAGSTNTGLFNSGDLNTGSLNPGSYNTGSVNTGSVNTGGFNAGNYNTGYFNTGDLQH
FT                   RHGEHRQYQHRRFHLRQPQQRPSVAGRQPGSDRPRHRRRHSRNPDCERRREYPDSHTDH
FT                   RQLHGHRIQRARSSTEHSRHCYFFRTRRYRPLHRPSDTDNRSHTCGHGGWTHYRDQYRR
FT                   HCGRRRHQHPDYPYSSDSRLRQLDRRTVVGLLQ"
FT   gene            377276..377947
FT                   /locus_tag="MRA_0315"
FT   CDS_pept        377276..377947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0315"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72033"
FT                   /db_xref="GOA:A5TZ33"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR012825"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ33"
FT                   /protein_id="ABQ72033.1"
FT                   /translation="MFSAPERRAVYRVIAERRDMRRFVPGGVVSEDVLARLLHAAHAAP
FT                   SVGLMQPWRFIRITDETLKRRIHALVDDERLLTAEALGAREEEFLALKVEGILDCAELL
FT                   VVALCDRRGSYIFGRRTLPQMDLASVSCAIQNLWLAARSEGLGMGWVSLFDPQRLAALL
FT                   AMPADAEPVAILCLGPVPEFPDRPALELDGWAYARPLAEFVSENRWSYPSALATDHHHG
FT                   E"
FT   gene            complement(377935..378417)
FT                   /locus_tag="MRA_0316"
FT   CDS_pept        complement(377935..378417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72034"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ34"
FT                   /protein_id="ABQ72034.1"
FT                   /translation="MAVIVRKWFGLGRLPADLRCQVEAEGLIYLAEYVAVTRRFTGVIP
FT                   GLRASHSIASYVGALAFTEQRVLGTLSMVPKLAGRVVDARWDGPQAGAATAEISPTGLQ
FT                   LDLDVADVDPKFSGQLALHFKATIGEDVLSRLPRRSLAFDVPAEYVNLAVGVTYSP"
FT   gene            378475..379191
FT                   /locus_tag="MRA_0317"
FT   CDS_pept        378475..379191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0317"
FT                   /product="putative conserved integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72035"
FT                   /db_xref="GOA:A5TZ35"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ35"
FT                   /protein_id="ABQ72035.1"
FT                   /translation="MTRPQALLAVSLAFVATAVYAVMWVGHSQDWGWLHSFDWSLLNAA
FT                   HDIGIKNPAWVRFWDGVSLILGPVVLRPLGLLAAMVALAKRKIRIALLLLACLPLNAIM
FT                   TIAAKSVAHRPRPATALVSAHSTSFPSGHALEATASVLALLTVLLPMLHSRFTRHIAIT
FT                   VGALCVLTVGVARVALNVHHPTDVVAGWALGYLYFLVCLCVFRPPSIFGAQRASHALSP
FT                   PVEVSRQPEPEVDTAR"
FT   gene            379293..379949
FT                   /locus_tag="MRA_0318"
FT   CDS_pept        379293..379949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0318"
FT                   /product="putative conserved exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72036"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ36"
FT                   /protein_id="ABQ72036.1"
FT                   /translation="MSRLLALLCAAVCTGCVAVVLAPVSLAVVNPWFANSVGNATQVVS
FT                   VVGTGGSTAKMDVYQRTAAGWQPLKTGITTHIGSAGMAPEAKSGYPATPMGVYSLDSAF
FT                   GTAPNPGGGLPYTQVGPNHWWSGDDNSPTFNSMQVCQKSQCPFSTADSENLQIPQYKHS
FT                   VVMGVNKAKVPGKGSAFFFHTTDGGPTAGCVAIDDATLVQIIRWLRPGAVIAIAK"
FT   gene            complement(380019..380510)
FT                   /locus_tag="MRA_0319"
FT   CDS_pept        complement(380019..380510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0319"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72037"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ37"
FT                   /protein_id="ABQ72037.1"
FT                   /translation="MCCNGVVTPGDPADIAAIKQLKYRYLRALDTKHWDDFTDTLAEDV
FT                   TGDYGSSVGTELHFTNRADLVDYLRQALGPGVITEHRVTHPEITVTGDTATGIWYLQDR
FT                   VIVAEFNFMLIGAAFYHDQYRRTTDGWRISATGYDRTYEATMSLAGLNFNIRPGRALAD
FT                   "
FT   gene            380534..381763
FT                   /locus_tag="MRA_0320"
FT   CDS_pept        380534..381763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72038"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ38"
FT                   /protein_id="ABQ72038.1"
FT                   /translation="MSQSRYAGLSRSELAVLLPELLLIGQLIDRSGMAWCIQAFGRQEM
FT                   LQIAIEEWAGASPIYTKRMQKALNFEGDDVPTIFKGLQLDIGAPPQFMDFRFTLHDRWH
FT                   GEFHLDHCGALLDVEPMGDDYVVGMCHTIEDPTFDATAIATNPRAQVRPIHRPPRKPAD
FT                   RHPHCAWTVIIDESYPEAEGIPALDAVRETKAATWELDNVDASDDGLVDYSGPLVSDLD
FT                   FGAFSHSALVRMADEVCLQMHLLNLSFAIAVRKRAKADAQLAISVNTRQLIGVAGLGAE
FT                   RIHRAMALPGGIEGALGVLELHPLLNPAGYVLAETSPDRLVVHNSPAHADGAWISLCTP
FT                   ASVQPLQAIATAVDPHLKVRISGTDTDWTAELIEADAPASELPEVLVAKVSRGSVFQFE
FT                   PRRSLPLTVK"
FT   gene            381918..383780
FT                   /locus_tag="MRA_0321"
FT   CDS_pept        381918..383780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0321"
FT                   /product="conserved hypothetical proline and threonine rich
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72039"
FT                   /db_xref="GOA:A5TZ39"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ39"
FT                   /protein_id="ABQ72039.1"
FT                   /translation="MYDPLGLSIGTTNLVAAGNGGPPVTRRAVLTLYPHCAPKIGVPSQ
FT                   NPNLIEPGALMSGFVERIGDAVALVSPDGSVHDPDLLLVEALDAMVLTAGADASSSEIA
FT                   IAVPAHWKPGAVHALRNGLRTHVGFVRSGMAPRLVSDAIAALTAVNSELGLPHGSVVGL
FT                   LDFGGSATYVTLVETKSDSRTSDFQPVSATARYQDFSGSQIDQALLLRVIDQFGYGDDV
FT                   DPASTAAVGQLGQLREQCRAAKERLSTDVATELFAELAGCSSSIEMTREQLEDLIQDPL
FT                   TGFIYAFDDMLARHNASWADLAAVVTVGGGANIPLVTQRLSFHTRRPVLTASQPGCAAA
FT                   MGALLLANRGGERDSRTRTSIGLATAAAAGTSVIELPAGDVMVIDHEALTDRELAWSQT
FT                   DFPSEAPARFEGDSYNEGGPCWSMRLNAVEPPKGPAWRRIRVSQLLIGVSAVVAMTAIG
FT                   GVALTLTAIERRPSPLPTPIVPGLAPMPPGSVVPSSRAPTPPPPPSTVAPLPSAAPAPT
FT                   TVAPAPPPPTQVVTTTTAPPVTTTPRPSPTTTTTTAPPSTTTTTEPPVTTTSTIPTIPT
FT                   TTTTVKMTTEWLHVPFLPVPIPVPIPQNPGAGEPQNPFGSLGSG"
FT   gene            383852..384238
FT                   /locus_tag="MRA_0322"
FT   CDS_pept        383852..384238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72040"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ40"
FT                   /protein_id="ABQ72040.1"
FT                   /translation="MGDYGPFGFDPDEFDRVIREGSEGLRDAFERIGRFLSSSGAGTGW
FT                   SAIFEDLSRRSRPAPETAGEAGDGVWAIYTVDADGGARVEQVYATELDALRANKDNTDP
FT                   KRKVRFLPYGIAVSVLDDPVDEAQ"
FT   gene            complement(384241..384903)
FT                   /locus_tag="MRA_0323"
FT   CDS_pept        complement(384241..384903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0323"
FT                   /product="putative conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72041"
FT                   /db_xref="GOA:A5TZ41"
FT                   /db_xref="InterPro:IPR021417"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ41"
FT                   /protein_id="ABQ72041.1"
FT                   /translation="MIVVWEHLCMNPEDDPEARIRELERPLADVARASELGGSQSGGYT
FT                   YPPGPPPPPYSYGGPFGGPSPRSSSGNRAWWILAAVVVVGVLVLVGGIAAFSAQRLSQG
FT                   NFVVLSPTPSVSRAVPTPTAQPATTLPPAGASLSVSGVNVNRTIACNDSIVSVSGMSNT
FT                   VVITGHCTSLTVSGMRNSVTVDSVDTIEAAGFNNEVTYHSGSPKISNAGGSNSVQQG"
FT   gene            384964..385848
FT                   /locus_tag="MRA_0324"
FT   CDS_pept        384964..385848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0324"
FT                   /product="putative beta-glucanase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72042"
FT                   /db_xref="GOA:A5TZ42"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ42"
FT                   /protein_id="ABQ72042.1"
FT                   /translation="MLMPEMDRRRMMMMAGFGALAAALPAPTAWADPSRPAAPAGPTPA
FT                   PAAPAAATGGLLFHDEFDGPAGSVPDPSKWQVSNHRTPIKNPVGFDRPQFFGQYRDSRQ
FT                   NVFLDGNSNLVLRATREGNRYFGGLVHGLWRGGIGTTWEARIKFNCLAPGMWPAWWLSN
FT                   DDPGRSGEIDLIEWYGNGTWPSGTTVHANPDGTAFETCPIGVDGGWHNWRVTWNPSGMY
FT                   FWLDYADGIEPYFSVPATGIEDLNEPIREWPFNDPGYKVFPVLNLAVGGSGGGDPATGS
FT                   YPQEMLVDWVRVF"
FT   gene            385897..386511
FT                   /locus_tag="MRA_0325"
FT   CDS_pept        385897..386511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0325"
FT                   /product="putative muconolactone isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72043"
FT                   /db_xref="GOA:A5TZ43"
FT                   /db_xref="InterPro:IPR003464"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR026029"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ43"
FT                   /protein_id="ABQ72043.1"
FT                   /translation="MEFLVTMTTRVPDSMPADAVERVRAREAARSRELAAQGKLLRLWR
FT                   PPLRPGEWRTLGLFAADDNGELEQLLASMPPRSWRTDDVTPLGAHPNDPVGQGITIAPG
FT                   KGPEFLIATTIMVPPGTPAQVVDDTVAREARRAPELAGRGHLVRLWALPDGPDGQRTLG
FT                   LWRARDPGELMAILESLPLAGWMTIETTPLSPHPDDPIRMP"
FT   gene            complement(386535..387305)
FT                   /gene="glpQ2"
FT                   /locus_tag="MRA_0326"
FT   CDS_pept        complement(386535..387305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpQ2"
FT                   /locus_tag="MRA_0326"
FT                   /product="putative glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /note="glycerophosphodiester phosphodiesterase; GlpQ2"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72044"
FT                   /db_xref="GOA:A5TZ44"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ44"
FT                   /protein_id="ABQ72044.1"
FT                   /translation="MEFLRHGGRIAMAHRGFTSFRLPMNSMGAFQEAAKLGFRYIETDV
FT                   RATRDGVAVILHDRRLAPGVGLSGAVDRLDWRDVRKAQLGAGQSIPTLEDLLTALPDMR
FT                   VNIDIKAASAIEPTVNVIERCNAHNRVLIGSFSERRRRRALRLLTKRVASSAGTGALLA
FT                   WLTARPLGSRAYAWRMMRDIDCVQLPSRLGGVPVITPARVRGFHAAGRQVHAWTVDEPD
FT                   VMHTLLDMDVDGIITDRADLLRDVLIARGEWDGA"
FT   gene            complement(387566..387636)
FT                   /locus_tag="MRA_t04"
FT   tRNA            complement(387566..387636)
FT                   /locus_tag="MRA_t04"
FT                   /product="tRNA-Gly"
FT   gene            complement(387667..388461)
FT                   /locus_tag="MRA_0327"
FT   CDS_pept        complement(387667..388461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0327"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72045"
FT                   /db_xref="GOA:A5TZ45"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ45"
FT                   /protein_id="ABQ72045.1"
FT                   /translation="MSLAVTMFKRARAEIFDRNREVGISNVTTAASLVTFPVLAGILGG
FT                   VVPSVRTPSAAMVSGVQHFAAGIVMAAVAGEVLPDLRSRGPLWLIVVGFSAGVAVLVAL
FT                   RRFDGHGEHQDGDDVGELPVGFLTVVAVDLFIDGLLVATGATVSSRTAIIITIALTVEV
FT                   LFLGLAVALRLAGSGMPRIRAAATTSALSLVIAVGGVSGAVALGRAGNTVLTLVLAFAA
FT                   GALLWLVVEELLVEAHETPERPWMAVMFFAGFLILYGLGVME"
FT   gene            388510..389178
FT                   /gene="pcp"
FT                   /locus_tag="MRA_0328"
FT   CDS_pept        388510..389178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcp"
FT                   /locus_tag="MRA_0328"
FT                   /product="pyrrolidone-carboxylate peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72046"
FT                   /db_xref="GOA:A5TZ46"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR029762"
FT                   /db_xref="InterPro:IPR033693"
FT                   /db_xref="InterPro:IPR033694"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TZ46"
FT                   /protein_id="ABQ72046.1"
FT                   /translation="MSKVLVTGFGPYGVTPVNPAQLTAEELDGRTIAGATVISRIVPNT
FT                   FFESIAAAQQAIAEIEPALVIMLGEYPGRSMITVERLAQNVNDCGRYGLADCAGRVLVG
FT                   EPTDPAGPVAYHATVPVRAMVLAMRKAGVPADVSDAAGTFVCNHLMYGVLHHLAQKGLP
FT                   VRAGWIHLPCLPSVAALDHNLGVPSMSVQTAVAGVTAGIEAAIRQSADIREPIPSRLQI
FT                   "
FT   gene            389250..389912
FT                   /locus_tag="MRA_0329"
FT   CDS_pept        389250..389912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0329"
FT                   /product="putative conserved exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72047"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ47"
FT                   /protein_id="ABQ72047.1"
FT                   /translation="MGRHELARDRRKSSAVLAAVLAPAAVFFATGGDVSTLAARADANP
FT                   VLGDDAPCCVQIVPVAPLAFSSQISGGEIGTGLAASQFASASRWRIVSRYLPVGVAPEQ
FT                   GLQVKTVLTARSISAAFPEIREIGGVRPDALRWHPNGLALDVMVPNPGTAEGIALGNEI
FT                   VAFVLKNATRFGMQDVIWRGAYYTPNGARTTGAGHYDHIHITTVGGGYPTGEELYIR"
FT   gene            389944..390516
FT                   /gene="dcd"
FT                   /locus_tag="MRA_0330"
FT   CDS_pept        389944..390516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcd"
FT                   /locus_tag="MRA_0330"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72048"
FT                   /db_xref="GOA:A5TZ48"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TZ48"
FT                   /protein_id="ABQ72048.1"
FT                   /translation="MLLSDRDLRAEISSGRLGIDPFDDTLVQPSSIDVRLDCLFRVFNN
FT                   TRYTHIDPAKQQDELTSLVQPVDGEPFVLHPGEFVLGSTLELFTLPDNLAGRLEGKSSL
FT                   GRLGLLTHSTAGFIDPGFSGHITLELSNVANLPITLWPGMKIGQLCMLRLTSPSEHPYG
FT                   SSRAGSKYQGQRGPTPSRSYQNFIRST"
FT   gene            390622..391953
FT                   /gene="udgA"
FT                   /locus_tag="MRA_0331"
FT   CDS_pept        390622..391953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="udgA"
FT                   /locus_tag="MRA_0331"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72049"
FT                   /db_xref="GOA:A5TZ49"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ49"
FT                   /protein_id="ABQ72049.1"
FT                   /translation="MRCSVFGTGYLGATHAVGMAQLGHEVVGVDIDPGKVAKLAGGDIP
FT                   FYEPGLRKLLTDNLAAGRLRFTTDYDMAADFADVHFLGVGTPQKIGEYGADLRHVHAVI
FT                   DALVPRLVRASILVGKSTVPVGTAAELGHRAGALAPRGVDVEIAWNPEFLREGFAVHDT
FT                   LNPDRIVLGVQDDSTRAEVAVRELYAPLLAAGVPFLVTDLQTAELVKVSANAFLATKIS
FT                   FINAISEVCEAAGADVSQLADALGYDPRIGRQCLNAGLGFGGGCLPKDIRAFMARAGEL
FT                   GADQALTFLREVDSINMRRRTKMVELATTACGGSLLGANIAVLGAAFKPESDDVRDSPA
FT                   LNVAGQLQLNGATVHVYDPKALDNAHRLFPTLNYAVSVAEACERADAVLVLTEWREFID
FT                   LEPADLANRVRARVIVDGRNCLDVTRWRRAGWRVFRLGVPRLGH"
FT   gene            complement(391942..392613)
FT                   /locus_tag="MRA_0332"
FT   CDS_pept        complement(391942..392613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72050"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ50"
FT                   /protein_id="ABQ72050.1"
FT                   /translation="MNSCNRLPCAHEVLAVFAHPDDESFGLGAVLGDFTAQGTRLRGLC
FT                   FTHGEASTLGRTDRNLGEVRREELAAAAQVLGVDHVQLLAYPDNGLAQIPLNELTQRVV
FT                   DALAGADLLLVFDDNGVTGHPDHRRATEAALAAASTPGIPVLAWALPQPIADRLNAEFS
FT                   ASFGGRGHGHLDIMIEVDRSRQLAAIGCHFTQSADNPVLWRRLELLGDREYLRWLRRSV
FT                   P"
FT   gene            392714..393394
FT                   /locus_tag="MRA_0333"
FT   CDS_pept        392714..393394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0333"
FT                   /product="ArsR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72051"
FT                   /db_xref="GOA:A5TZ51"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ51"
FT                   /protein_id="ABQ72051.1"
FT                   /translation="MAGQSDRKAALLDQVARVGKALANGRRLQILDLLAQGERAVEAIA
FT                   TATGMNLTTASANLQALKSGGLVEARREGTRQYYRIAGEDVARLFALVQVVADEHLADV
FT                   AVAAADVLGSPEDAITRAELLRRREAGEVTLVDVRPHEEYQAGHIPGAINIPIAELADR
FT                   LAELTGDRDIVAYCRGAYCVMAPDAVRIARDAGREVKRLDDGMLEWRLAGLPVDEGAPV
FT                   GHGD"
FT   gene            393401..393625
FT                   /locus_tag="MRA_0334"
FT   CDS_pept        393401..393625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72052"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ52"
FT                   /protein_id="ABQ72052.1"
FT                   /translation="MGPKGSLRLVKRQPELLVAQHEHWQDTYRAHPVLYGTRPSEPGVY
FT                   AAEVFNADGVQRVLELAAGHGRDTLYFAG"
FT   gene            393635..394090
FT                   /locus_tag="MRA_0335"
FT   CDS_pept        393635..394090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72053"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ53"
FT                   /protein_id="ABQ72053.1"
FT                   /translation="MVATDFSDVAVAQLRRSAQARGVSARVQPIVHDLRQPLPVKTGSI
FT                   DGAFAHMALCMALSTSEIHAVVAEVGRVLRPGGKFIYTVRHTGDAHYGAGQAHGDDIFE
FT                   CAGFAVHFFRRELVARLATGWVLEEVHDFEEGELPRRLWRVTVTKPA"
FT   gene            complement(394058..395407)
FT                   /gene="cyp135A1"
FT                   /locus_tag="MRA_0336"
FT   CDS_pept        complement(394058..395407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyp135A1"
FT                   /locus_tag="MRA_0336"
FT                   /product="putative cytochrome p450 135A1 Cyp135A1"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72054"
FT                   /db_xref="GOA:A5TZ54"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ54"
FT                   /protein_id="ABQ72054.1"
FT                   /translation="MASTLTTGLPPGPRLPRYLQSVLYLRFREWFLPAMHRKYGDVFSL
FT                   RVPPYADNLVVYTRPEHIKEIFAADPRSLHAGEGNHILGFVMGEHSVLMTDEAEHARMR
FT                   SLLMPAFTRAALRGYRDMIASVAREHITRWRPHATINSLDHMNALTLDIILRVVFGVTD
FT                   PKVKAELTSRLQQIINIHPAILAGVPYPSLKRMNPWKRFFHNQTKIDEILYREIASRRI
FT                   DSDLTARTDVLSRLLQTKDTPTKPLTDAELRDQLITLLLAGHETTAAALSWTLWELAHA
FT                   PEIQSQVVWAAVGGDDGFLEAVLKEGMRRHTVIASTARKVTAPAEIGGWRLPAGTVVNT
FT                   SILLAHASEVSHPKPTEFRPSRFLDGSVAPNTWLPFGGGVRRCLGFGFALTEGAVILQE
FT                   IFRRFTITAAGPSKGETPLVRNITTVPKHGAHLRLIPQRRLGGLGDSDPP"
FT   gene            395473..396075
FT                   /locus_tag="MRA_0337"
FT   CDS_pept        395473..396075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0337"
FT                   /product="TetR/AcrR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72055"
FT                   /db_xref="GOA:A5TZ55"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ55"
FT                   /protein_id="ABQ72055.1"
FT                   /translation="MQQQRTNRDKLLDGALACLRERGYGNTSSRDIARAAGVNIASINY
FT                   HFGSKDALLDDALGRCFSTWNQRVQEAFDHSRAAGPAGQILAVLEATVDSFEQIRPAVY
FT                   ACVESYAPALRSEALRERLAAGYADVRQHSVDLAGAALAGTDIAPPENLSTIVSVLMAV
FT                   IDGLMIQWIADPSATPRSTEVIRALASIGAVVTSQLR"
FT   gene            complement(396056..396682)
FT                   /locus_tag="MRA_0338"
FT   CDS_pept        complement(396056..396682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0338"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72056"
FT                   /db_xref="GOA:A5TZ56"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ56"
FT                   /protein_id="ABQ72056.1"
FT                   /translation="MRLTHPARRYLSSQAARPTGAFGRLLGRIWRAETADVNRIAVELL
FT                   APGPGERVCEIGFGPGRTLGLLAAAGAQVSGVEVSTTMIAIAAHHNAKAIAAGLISLYH
FT                   GDGVTLPVADHSLDKVLGVHNFYFWPDPRASLCDIARALRPGGRLVLTSISDDQPLAAR
FT                   FDPAIYRVPPTLDTAAWLGAAGFIDVGIKRSADHPATVWFTATAT"
FT   gene            complement(396709..397449)
FT                   /locus_tag="MRA_0339"
FT   CDS_pept        complement(396709..397449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0339"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72057"
FT                   /db_xref="GOA:A5TZ57"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ57"
FT                   /protein_id="ABQ72057.1"
FT                   /translation="MARSIPADRFSAIVAASARVFIAHGYQRTQVQDVADALALAKGTL
FT                   YGYAQGKAALFAAAVRYGDAQEALPLASELPVAAPVAGEIAAVVSARLAGEVTDMRLTH
FT                   ALRATLPPGATTGDARAELAGIVTDLYSRLARHRIALKLVDRCAPELPDLAEVWFGTGR
FT                   NAQVDAVQAYLVHRERAGLLILPGPAPMVARTIVELCALWAVHLHFDPSPEPWSIVQPG
FT                   VIDDDAIAATLAEFVVRATTASSD"
FT   gene            397563..398729
FT                   /locus_tag="MRA_0340"
FT   CDS_pept        397563..398729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0340"
FT                   /product="putative phage tail component protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72058"
FT                   /db_xref="GOA:A5TZ58"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ58"
FT                   /protein_id="ABQ72058.1"
FT                   /translation="MSKTVLILGAGVGGLTTADTLRQLLPPEDRIILVDRSFDGTLGLS
FT                   LLWVLRGWRRPDDVRVRPTAASLPGVEMVTATVAHIDIAAQVVHTDNSVIGYDALVIAL
FT                   GAALNTDAVPGLSDALDADVAGQFYTLDGAAELRAKVEALEHGRIAVAIAGVPFKCPAA
FT                   PFEAAFLIAAQLGDRYATGTVQIDTFTPDPLPMPVAGPEVGEALVSMLKDHGVGFHPRK
FT                   ALARVDEAARTMHFGDGTSEPFDLLAVVPPHVPSAAARSAGLSESGWIPVDPRTLSTSA
FT                   DNVWAIGDATVLTLPNGKPLPKAAVFAEAQAAVVAHGVARHLGYDVAERHFTGTGACYV
FT                   ETGDHQAAKGDGDFFAPSAPSVTLYPPSREFHEEKVAQELAWLTRWKT"
FT   gene            398804..399589
FT                   /locus_tag="MRA_0341"
FT   CDS_pept        398804..399589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72059"
FT                   /db_xref="GOA:A5TZ59"
FT                   /db_xref="InterPro:IPR010872"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ59"
FT                   /protein_id="ABQ72059.1"
FT                   /translation="MRKPASSLAKVDYSSAYLEQTHAFGELIRNVDQSTPVPTCPGWSL
FT                   GQLFRHVGRGDRWAAQIVRDRLDHFLDPRSVEGGKPPPDPDDAISWLYGGARLLVDAVE
FT                   QTGVETPVWTFLGPRPAGWWVRRRLHEVAVHRADVAITVGGEFTLEPNVAADGISEFLE
FT                   RIAVQAGSGGTPLPLEDDDTLHLHATDPGLLEAGEWTVRRDERGVTWSHRHGKGAVALR
FT                   GGATELLLAMVRRLSVADTGIELLGDAGVWQKWLDRTPL"
FT   gene            399616..399990
FT                   /locus_tag="MRA_0342"
FT   CDS_pept        399616..399990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72060"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ60"
FT                   /protein_id="ABQ72060.1"
FT                   /translation="MTTSEIATVLAWHDALNAADIETLVALSTDDIDIGDAHGAVQGHD
FT                   ALRGWASSLTTTAELGRMYVHHGVVVVEQKITSGEDPGIARTGAAAFRVVQDHVASVFR
FT                   HEDLASALAATELTEDDLVD"
FT   gene            400020..400886
FT                   /gene="rmlA"
FT                   /locus_tag="MRA_0343"
FT   CDS_pept        400020..400886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rmlA"
FT                   /locus_tag="MRA_0343"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72061"
FT                   /db_xref="GOA:A5TZ61"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ61"
FT                   /protein_id="ABQ72061.1"
FT                   /translation="MRGIILAGGSGTRLYPITMGISKQLLPVYDKPMIYYPLTTLMMAG
FT                   IRDIQLITTPHDAPGFHRLLGDGAHLGVNISYATQDQPDGLAQAFVIGANHIGADSVAL
FT                   VLGDNIFYGPGLGTSLKRFQSISGGAIFAYWVANPSAYGVVEFGAEGMALSLEEKPVTP
FT                   KSNYAVPGLYFYDNDVIEIARGLKKSARGEYEITEVNQVYLNQGRLAVEVLARGTAWLD
FT                   TGTFDSLLDAADFVRTLERRQGLKVSIPEEVAWRMGWIDDEQLVQRARALVKSGYGNYL
FT                   LELLERN"
FT   gene            complement(400897..401412)
FT                   /locus_tag="MRA_0344"
FT   CDS_pept        complement(400897..401412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0344"
FT                   /product="PE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72062"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ62"
FT                   /protein_id="ABQ72062.1"
FT                   /translation="MRSMGFLHRACRAPSSLPAPLMARPGRSVLARPAATPPGPLCATT
FT                   RPRPPQGNQPPASRISNFPPKRHKTRVLAAAEDEVSAAVAALISAHGRRHHSLNNQAAA
FT                   FHGQFAQNLNVGAGSCASAETTADAPTQALLGPADRQRRQRRAVRQWLVRWAAHPGRAT
FT                   RGFHNHRQ"
FT   gene            401554..403065
FT                   /locus_tag="MRA_0345"
FT   CDS_pept        401554..403065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0345"
FT                   /product="conserved 13E12 repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72063"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ63"
FT                   /protein_id="ABQ72063.1"
FT                   /translation="MPSPEAIAHFDERFECHAPRTTRVSAAFIDRICSATRAENRAAAA
FT                   QLVALGELFAYRWSRCGGREEWVMDTMAAVAAEVAAALRISQGLAASRLRYARAMRERL
FT                   PKTAEVFSAGDIGYLMFATIVYRTDLIVDPDVLAAVDAQLAANVARWPSMTKARLAGQV
FT                   DKIVARADADAVRRRKEYQAQRQFWVGESQDGVCQIGGSLLAVDAHALDARLSALAGTV
FT                   CEHDPRSREQRRADALGALAGGADRLGCGCGRADCAAGKRPAAPPVVIHLIAEAATING
FT                   TGSAPASQMNADGLITAELVAELAKTATLVPLVHPGDAPPEPGYAPSKALADFVRCRDL
FT                   TCRWPGCDEPATNCDLDHTIPYAAGGPTHASNLKCYCRTHHLVKTFWGWRDQQLPDGTL
FT                   ILTSPSGHTYVSTPGSALLFPSLCHFSGGIPAPEADPPYDHCDQRTAMMPKRRRTRAQD
FT                   RAYRIATERRQNHAARQRAQVLTQTAAATDTHGPPPDPNDDPPPF"
FT   gene            complement(403235..404524)
FT                   /gene="aspC"
FT                   /locus_tag="MRA_0346"
FT   CDS_pept        complement(403235..404524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspC"
FT                   /locus_tag="MRA_0346"
FT                   /product="aspartate aminotransferase AspC"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72064"
FT                   /db_xref="GOA:A5TZ64"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ64"
FT                   /protein_id="ABQ72064.1"
FT                   /translation="MDNDGTIVDVTTHQLPWHTASHQRQRAFAQSAKLQDVLYEIRGPV
FT                   HQHAARLEAEGHRILKLNIGNPAPFGFEAPDVIMRDIIQALPYAQGYSDSQGILSARRA
FT                   VVTRYELVPGFPRFDVDDVYLGNGVSELITMTLQALLDNGDQVLIPSPDYPLWTASTSL
FT                   AGGTPVHYLCDETQGWQPDIADLESKITERTKALVVINPNNPTGAVYSCEILTQMVDLA
FT                   RKHQLLLLADEIYDKILYDDAKHISLASIAPDMLCLTFNGLSKAYRVAGYRAGWLAITG
FT                   PKEHASSFIEGIGLLANMRLCPNVPAQHAIQVALGGHQSIEDLVLPGGRLLEQRDIAWT
FT                   KLNEIPGVSCVKPAGALYAFPRLDPEVYDIDDDEQLVLDLLLSEKILVTQGTGFNWPAP
FT                   DHLRLVTLPWSRDLAAAIERLGNFLVSYRQ"
FT   gene            complement(404555..407203)
FT                   /locus_tag="MRA_0347"
FT   CDS_pept        complement(404555..407203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0347"
FT                   /product="putative iron-sulfur-binding reductase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72065"
FT                   /db_xref="GOA:A5TZ65"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ65"
FT                   /protein_id="ABQ72065.1"
FT                   /translation="MTTQTLIRLILGMSMTAVVGVFALRRVWWLYKLVMSGQPASGRTD
FT                   NLGTRIWTQISEVLGQRRLLKWSIPGLAHFFTMWGFFILLTVYIEAYGLLFEERFHIPV
FT                   IGRWDALGFLQDFFATAVFLGITTFAIIRILRNPREIGRSSRFYGSHNGGAWLVLLMIF
FT                   NVIWTYVLVRGSAVNNGTLPYGNGAFLSQLFGAILRPLGQPANEIIETTALLLHIGVML
FT                   AFLILVLHSKHLHIFLAPINVTFKRLPDGLGPLLPLEADGKPIDFENPSEDAVFGRGKI
FT                   EDFTWKGMLDFATCTECGRCQSQCPAWNTGKPLSPKLVIMDLRDHWMAKAPYILGQKDA
FT                   SAGGEAGHQEHHHVPESGFGRVPGHGPEQATRPLVGTEEQGGVIDPDVLWSCVTCGACV
FT                   EQCPVDIEHVDHIVDMRRYQVMMESEFPSELSVLFKNLETKGNPWGQNASDRTNWIDEV
FT                   DFDVPVYGQDVDSFDGYEYLFWVGCAGAYDDKAKKTTKAVAELLAVARVKYLVLGAGET
FT                   CNGDSARRSGNEFLFQQLAQQAVETLDGLFEGVETVDRKIVVTCPHCFNTIGKEYRQLG
FT                   ANYTVLHHTQLLNRLVRDKRLVPVTPVSQDITYHDPCYLGRHNKAYEAPRELIGAAGAS
FT                   LTEMPRHADRSFCCGAGGARMWMEEHIGKRINHERVDEALATDATAIATACPFCRVMVT
FT                   DGVNDRQEEAGRSGVEVLDVAQVLLGSLDHDKAQLPAKGTAAKQAQERAPKAAPKAAAP
FT                   VTPVEAPAEAPQAPAPAAPAAPVKGLGMAAGAKRPGAKKAAPTPAAPAAPAAPVKGLGI
FT                   AAGAKRPGAKKTPPPAPGLAEPAAQPQPEAKPQPEPAAPPKPQTDGDPAAPAAPVKGLG
FT                   IARGARPPGKR"
FT   gene            complement(407312..409810)
FT                   /locus_tag="MRA_0348"
FT   CDS_pept        complement(407312..409810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0348"
FT                   /product="LuxR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72066"
FT                   /db_xref="GOA:A5TZ66"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ66"
FT                   /protein_id="ABQ72066.1"
FT                   /translation="MQHRGCKNRGQAYDASVTDSLTEVPPAARRALLELANAPTVPVKV
FT                   LITGGIGTGKTTVLAAARDTLRRSGLTVLACPPPDGEPPETALVIDDAQLLTDTELLRL
FT                   TERVADSRLTVVAAAEAREHHRALRALTMALERDRPRISLGPLPVAEHLRDCTAGLPFL
FT                   IHAVSARAQAPAQAAKVALIERLRRLDEPTLDTLLMMSLTHELGVSDVAAALGISVTDA
FT                   RGLVDRAHASGLIESSHTAAFLQSVHDAIAQIVGNAHHHEVETSLLRSQLDISPVSAEL
FT                   ALRLAEHGLRDERLADILTRYAADTRDASVRCARLYRAAVHAGAKGLTVRLADALARTG
FT                   DCTAAATLADDLLSSPDATERAAAVRVAASVAVHDGNTGHAAELFGWLGPHPDTMVSSA
FT                   ATIVFAANGDLATARATLRLKDAGPPTMAARCARNLAEGLLLTMDQPYPVAMAKLGQAI
FT                   ATEQSLSQVIPDSPAALVTLAAIHAGDPVRARSVIGRAVRAGADPLFQRRHLLLSGWIK
FT                   MQEGQLPSASADVAAASAGTHLHRRDALWAAALQTAISRRTGDIGALQQHWYAAMEALA
FT                   EYSLDLFALLPLGELWVAAARMRQVDQLQHTLDQALTLLDSLGNPALWSNSLHWAGVHA
FT                   GILANSPESVAPHGQALGAMVAHSTLAQALSDAGRTWLRVLAENVDADEVTAAARSLSH
FT                   VGLTSDATRLAGQAALQTSDARVSGAMLQLARDLKLGNDFGEPPSGAGDTEPASGTPPA
FT                   PRQPPAGSPLSDREREVAELLLLGMPYRDIGARLFISAKTVEHHVARIRQRLGAGSRSE
FT                   MLSMLRAMLAPESLTADERR"
FT   gene            409996..410535
FT                   /locus_tag="MRA_0349"
FT   CDS_pept        409996..410535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0349"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72067"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ67"
FT                   /protein_id="ABQ72067.1"
FT                   /translation="MANSLLDFVISLVRDPEAAARYAANPERSIAEAHLTDVTRADVNS
FT                   LIPVVSDSLSMSEPIGAAGGAHAGDRGNVWASGAATAALDAFAPHADAGVVQQHGAVGS
FT                   VLNQPTPPGPGVTPTDPRPFRAGPHETSALLTSAEIPDTTSEDGGLPTDHPAVWNHPVV
FT                   DPHTVEPDHHGYDIHG"
FT   gene            410724..412163
FT                   /gene="iniB"
FT                   /locus_tag="MRA_0350"
FT   CDS_pept        410724..412163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iniB"
FT                   /locus_tag="MRA_0350"
FT                   /product="isoniazid inductible gene protein IniB"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72068"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ68"
FT                   /protein_id="ABQ72068.1"
FT                   /translation="MTSLIDYILSLFRSEDAARSFVAAPGRAMTSAGLIDIAPHQISSV
FT                   AANVVPGLNLGAGDPMSGLRQAVAARHGFAQDVANVGFAGDAGAGVASVITTDVGAGLA
FT                   SGLGAGFLGQGGLALAASSGGFGGQVGLAAQVGLGFTAVIEAEVGAQVGAGLGIGTGLG
FT                   AQAGMGFGGGVGLGLGGQAGGVIGGSAAGAIGAGVGGRLGGNGQIGVAGQGAVGAGVGA
FT                   GVGGQAGIASQIGVSAGGGLGGVGNVSGLTGVSSNAVLASNASGQAGLIASEGAALNGA
FT                   AMPHLSGPLAGVGVGGQAGAAGGAGLGFGAVGHPTPQPAALGAAGVVAKTEAAAGVVGG
FT                   VGGATAAGVGGAHGDILGHEGAALGSVDTVNAGVTPVEHGLVLPSGPLIHGGTGGYGGM
FT                   NPPVTDAPAPQVPARAQPMTTAAEHTPAVTQPQHTPVEPPVHDKPPSHSVFDVGHEPPV
FT                   THTPPAPIELPSYGLFGLPGF"
FT   gene            412200..414122
FT                   /gene="iniA"
FT                   /locus_tag="MRA_0351"
FT   CDS_pept        412200..414122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iniA"
FT                   /locus_tag="MRA_0351"
FT                   /product="isoniazid inductible gene protein IniA"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72069"
FT                   /db_xref="GOA:A5TZ69"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ69"
FT                   /protein_id="ABQ72069.1"
FT                   /translation="MVPAGLCAYRDLRRKRARKWGDTVTQPDDPRRVGVIVELIDHTIA
FT                   IAKLNERGDLVQRLTRARQRITDPQVRVVIAGLLKQGKSQLLNSLLNLPAARVGDDEAT
FT                   VVITVVSYSAQPSARLVLAAGPDGTTAAVDIPVDDISTDVRRAPHAGGREVLRVEVGAP
FT                   SPLLRGGLAFIDTPGVGGLGQPHLSATLGLLPEADAVLVVSDTSQEFTEPEMWFVRQAH
FT                   QICPVGAVVATKTDLYPRWREIVNANAAHLQRARVPMPIIAVSSLLRSHAVTLNDKELN
FT                   EESNFPAIVKFLSEQVLSRATERVRAGVLGEIRSATEQLAVSLGSELSVVNDPNLRDRL
FT                   ASDLERRKREAQQAVQQTALWQQVLGDGFNDLTADVDHDLRTRFRTVTEDAERQIDSCD
FT                   PTAHWAEIGNDVENAIATAVGDNFVWAYQRSEALADDVARSFADAGLDSVLSAELSPHV
FT                   MGTDFGRLKALGRMESKPLRRGHKMIIGMRGSYGGVVMIGMLSSVVGLGLFNPLSVGAG
FT                   LILGRMAYKEDKQNRLLRVRSEAKANVRRFVDDISFVVSKQSRDRLKMIQRLLRDHYRE
FT                   IAEEITRSLTESLQATIAAAQVAETERDNRIRELQRQLGILSQVNDNLAGLEPTLTPRA
FT                   SLGRA"
FT   gene            414119..415600
FT                   /gene="iniC"
FT                   /locus_tag="MRA_0352"
FT   CDS_pept        414119..415600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iniC"
FT                   /locus_tag="MRA_0352"
FT                   /product="isoniazid inductible gene protein IniC"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72070"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ70"
FT                   /protein_id="ABQ72070.1"
FT                   /translation="MSTSDRVRAILHATIQAYRGAPAYRQRGDVFCQLDRIGARLAEPL
FT                   RIALAGTLKAGKSTLVNALVGDDIAPTDATEATRIVTWFRHGPTPRVTANHRGGRRANV
FT                   PITRRGGLSFDLRRINPAELIDLEVEWPAEELIDATIVDTPGTSSLACDASERTLRLLV
FT                   PADGVPRVDAVVFLLRTLNAADVALLKQIGGLVGGSVGALGIIGVASRADEIGAGRIDA
FT                   MLSANDVAKRFTRELNQMGICQAVVPVSGLLALTARTLRQTEFIALRKLAGAERTELNR
FT                   ALLSVDRFVRRDSPLPVDAGIRAQLLERFGMFGIRMSIAVLAAGVTDSTGLAAELLERS
FT                   GLVALRNVIDQQFAQRSDMLKAHTALVSLRRFVQTHPVPATPYVIADIDPLLADTHAFE
FT                   ELRMLSLLPSRATTLNDDEIASLRRIIGGSGTSAAARLGLDPANSREAPRAALAAAQHW
FT                   RRRAAHPLNDPFTTRACRAAVRSAEAMVAEFSARR"
FT   gene            complement(415743..416303)
FT                   /gene="lpqJ"
FT                   /locus_tag="MRA_0353"
FT   CDS_pept        complement(415743..416303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpqJ"
FT                   /locus_tag="MRA_0353"
FT                   /product="putative lipoprotein LpqJ"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72071"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ71"
FT                   /protein_id="ABQ72071.1"
FT                   /translation="MRLSLIARGMAALLAATALVAGCNTTIDGRPVASPGSGPTEPTFP
FT                   TPRPTTAPPGTTAPTLPTTPVSPTAPAGAIPLPPDSNGYVFIETKSGMTRCQINRDSVG
FT                   CEAPFTNSPLRDGEHANGIHITAGGSVQWVLGNLGAIPTVSIDYRTYEAQGWTIDATTD
FT                   GTRFTNNRTGHGMFVSIEKVDTF"
FT   gene            416412..416822
FT                   /locus_tag="MRA_0354"
FT   CDS_pept        416412..416822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0354"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72072"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ72"
FT                   /protein_id="ABQ72072.1"
FT                   /translation="MLPSTVVGVLLAAGAGRWYGKPKVLVDGWLDTAVGALRDGGCNDV
FT                   ILVLGAVEVSAPAGVTAITAPDWQQGLSASVRAGLAQADREHADYAVLHVIDTPDVNAK
FT                   VVARVLGRALVSRSGLAGRGRIPAHSARRRGC"
FT   gene            complement(416864..418327)
FT                   /gene="ansP2"
FT                   /locus_tag="MRA_0355"
FT   CDS_pept        complement(416864..418327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ansP2"
FT                   /locus_tag="MRA_0355"
FT                   /product="L-asparagine permease"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72073"
FT                   /db_xref="GOA:A5TZ73"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ73"
FT                   /protein_id="ABQ72073.1"
FT                   /translation="MPPLDITDERLTREDTGYHKGLHSRQLQMIALGGAIGTGLFLGAG
FT                   GRLASAGPGLFLVYGICGIFVFLILRALGELVLHRPSSGSFVSYAREFYGEKVAFVAGW
FT                   MYFLNWAMTGIVDTTAIAHYCHYWRAFQPIPQWTLALIALLVVLSMNLISVRLFGELEF
FT                   WASLIKVIALVTFLIVGTVFLAGRYKIDGQETGVSLWSSHGGIVPTGLLPIVLVTSGVV
FT                   FAYAAIELVGIAAGETAEPAKIMPRAINSVVLRIACFYVGSTVLLALLLPYTAYKEHVS
FT                   PFVTFFSKIGIDAAGSVMNLVVLTAALSSLNAGLYSTGRILRSMAINGSGPRFTAPMSK
FT                   TGVPYGGILLTAGIGLLGIILNAIKPSQAFEIVLHIAATGVIAAWATIVACQLRLHRMA
FT                   NAGQLQRPKFRMPLSPFSGYLTLAFLAGVLILMYFDEQHGPWMIAATVIGVPALIGGWY
FT                   LVRNRVTAVAHHAIDHTKSVAVVHSADPI"
FT   gene            418666..419652
FT                   /locus_tag="MRA_0356"
FT   CDS_pept        418666..419652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0356"
FT                   /product="putative conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72074"
FT                   /db_xref="GOA:A5TZ74"
FT                   /db_xref="InterPro:IPR026349"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ74"
FT                   /protein_id="ABQ72074.1"
FT                   /translation="MPGARELTLRVERGALFRRRWAASAASSARAAIRRDPRRCALGTR
FT                   PRWVSFLVIVLVIMNVVTAHPKYPNDPLALVLIELRHPRTEPPVPSAISILKEELARWT
FT                   PILEQEEVRQVNLETGEHTAHSQKKLVARDRRTAITFRPDAMTLEVTDYPGWEEFRSIV
FT                   HAMVTARQDVAPVDGCIRIGLRYINEIRASLAEPSGWAYWVAESLLGPGTQLADLKLTT
FT                   TAQRHVIQCEGPEPGDSLTLRYAGARGAVIQSTPFLQRLKEPPAEGDFFLIDIDSAWSD
FT                   PCKGIPALDAHLVDEVAERLHTPIGPLFESLITSELRTKVLQQPGQE"
FT   gene            419655..420308
FT                   /locus_tag="MRA_0357"
FT   CDS_pept        419655..420308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0357"
FT                   /product="putative transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72075"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ75"
FT                   /protein_id="ABQ72075.1"
FT                   /translation="MTISFSSSNLRDDATSGNGDYRLDKLPETTPSTSVFDRADVTYRQ
FT                   FTELHGQARDTRREAHVVELESKTGERARCAPMHALEQLADYGFAWRDIARVVGVSVPA
FT                   ITKWRKGAGVTGENRLKIARLLALIDMLSDRFIGEPASWLEMPIQAGVGITRMDLLERG
FT                   RYDLVLALASTHTGDGTVEYVLNETDKDWRETVVDNAFESYTAEDGVISIRPKR"
FT   gene            420311..420970
FT                   /locus_tag="MRA_0358"
FT   CDS_pept        420311..420970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72076"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ76"
FT                   /protein_id="ABQ72076.1"
FT                   /translation="MPELETPDDPESIYLARLEDVGEHRPTFTGDIYRLGDGRMVMILQ
FT                   HPCALRHGVDLHPRLLVAPVRPDSLRSNWARAPFGTMPLPKLIDGQDHSADFINLELID
FT                   SPTLPTCERIAVLSQSGVNLVMQRWVYHSTRLAVPTHTYSDSTVGPFDEADLIEEWVTD
FT                   RVDDGADPQAAEHECASWLDERISGRTRRALLSDRQHASSIRREARSHRKSVKLAD"
FT   gene            421197..423074
FT                   /gene="dnaK"
FT                   /locus_tag="MRA_0359"
FT   CDS_pept        421197..423074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="MRA_0359"
FT                   /product="molecular chaperone DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72077"
FT                   /db_xref="GOA:A5TZ77"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TZ77"
FT                   /protein_id="ABQ72077.1"
FT                   /translation="MARAVGIDLGTTNSVVSVLEGGDPVVVANSEGSRTTPSIVAFARN
FT                   GEVLVGQPAKNQAVTNVDRTVRSVKRHMGSDWSIEIDGKKYTAPEISARILMKLKRDAE
FT                   AYLGEDITDAVITTPAYFNDAQRQATKDAGQIAGLNVLRIVNEPTAAALAYGLDKGEKE
FT                   QRILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLGGDDWDQRVVDWLVDKFKGTSGI
FT                   DLTKDKMAMQRLREAAEKAKIELSSSQSTSINLPYITVDADKNPLFLDEQLTRAEFQRI
FT                   TQDLLDRTRKPFQSVIADTGISVSEIDHVVLVGGSTRMPAVTDLVKELTGGKEPNKGVN
FT                   PDEVVAVGAALQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTRLIERNTTIPTKRSET
FT                   FTTADDNQPSVQIQVYQGEREIAAHNKLLGSFELTGIPPAPRGIPQIEVTFDIDANGIV
FT                   HVTAKDKGTGKENTIRIQEGSGLSKEDIDRMIKDAEAHAEEDRKRREEADVRNQAETLV
FT                   YQTEKFVKEQREAEGGSKVPEDTLNKVDAAVAEAKAALGGSDISAIKSAMEKLGQESQA
FT                   LGQAIYEAAQAASQATGAAHPGGEPGGAHPGSADDVVDAEVVDDGREAK"
FT   gene            423071..423778
FT                   /gene="grpE"
FT                   /locus_tag="MRA_0360"
FT   CDS_pept        423071..423778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="MRA_0360"
FT                   /product="putative GrpE protein"
FT                   /note="Hsp-70 cofactor"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72078"
FT                   /db_xref="GOA:A5TZ78"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TZ78"
FT                   /protein_id="ABQ72078.1"
FT                   /translation="MTDGNQKPDGNSGEQVTVTDKRRIDPETGEVRHVPPGDMPGGTAA
FT                   ADAAHTEDKVAELTADLQRVQADFANYRKRALRDQQAAADRAKASVVSQLLGVLDDLER
FT                   ARKHGDLESGPLKSVADKLDSALTGLGLVAFGAEGEDFDPVLHEAVQHEGDGGQGSKPV
FT                   IGTVMRQGYQLGEQVLRHALVGVVDTVVVDAAELESVDDGTAVADTAENDQADQGNSAD
FT                   TSGEQAESEPSGS"
FT   gene            423814..425001
FT                   /gene="dnaJ1"
FT                   /locus_tag="MRA_0361"
FT   CDS_pept        423814..425001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ1"
FT                   /locus_tag="MRA_0361"
FT                   /product="chaperone protein DnaJ1"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72079"
FT                   /db_xref="GOA:A5TZ79"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ79"
FT                   /protein_id="ABQ72079.1"
FT                   /translation="MAQREWVEKDFYQELGVSSDASPEEIKRAYRKLARDLHPDANPGN
FT                   PAAGERFKAVSEAHNVLSDPAKRKEYDETRRLFAGGGFGGRRFDSGFGGGFGGFGVGGD
FT                   GAEFNLNDLFDAASRTGGTTIGDLFGGLFGRGGSARPSRPRRGNDLETETELDFVEAAK
FT                   GVAMPLRLTSPAPCTNCHGSGARPGTSPKVCPTCNGSGVINRNQGAFGFSEPCTDCRGS
FT                   GSIIEHPCEECKGTGVTTRTRTINVRIPPGVEDGQRIRLAGQGEAGLRGAPSGDLYVTV
FT                   HVRPDKIFGRDGDDLTVTVPVSFTELALGSTLSVPTLDGTVGVRVPKGTADGRILRVRG
FT                   RGVPKRSGGSGDLLVTVKVAVPPNLAGAAQEALEAYAAAERSSGFNPRAGWAGNR"
FT   gene            425001..425381
FT                   /gene="hspR"
FT                   /locus_tag="MRA_0362"
FT   CDS_pept        425001..425381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hspR"
FT                   /locus_tag="MRA_0362"
FT                   /product="heat shock protein transcriptional repressor
FT                   HspR"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72080"
FT                   /db_xref="GOA:A5TZ80"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ80"
FT                   /protein_id="ABQ72080.1"
FT                   /translation="MAKNPKDGESRTFLISVAAELAGMHAQTLRTYDRLGLVSPRRTSG
FT                   GGRRYSLHDVELLRQVQHLSQDEGVNLAGIKRIIELTSQVEALQSRLQEMAEELAVLRA
FT                   NQRREVAVVPKSTALVVWKPRR"
FT   gene            complement(425506..426063)
FT                   /locus_tag="MRA_0363"
FT   CDS_pept        complement(425506..426063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0363"
FT                   /product="PPE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72081"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ81"
FT                   /protein_id="ABQ72081.1"
FT                   /translation="MRVSVCVIYIPFKGCVKHVSVTIPITTEHLGPYEIDASTINPDQP
FT                   IDTAFTQTLDFAGSGTVGAFPFGFGWQQSPGFFNSTTTPSSGFFNSGAGGASGFLNDAA
FT                   AAVSGLGNVFTETSGFFNAGGVGNSGFQNFGNLLSGWANLGNTVSGFYNTSMLDLATQA
FT                   LISGFGNHGARLSGILNNGSGP"
FT   gene            complement(426140..436042)
FT                   /locus_tag="MRA_0364"
FT   CDS_pept        complement(426140..436042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0364"
FT                   /product="PPE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72082"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR002989"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ82"
FT                   /protein_id="ABQ72082.1"
FT                   /translation="MSFAVLPPEINSARLYVGAGLAPMLDAAAAWDGLADELGSAAASF
FT                   SAVTAGLAGSSWLGAASTAMTGAAAPYLGWLSAAAAQAQQAATQTRLAAAAFEAALAAT
FT                   VHPAIISANRALFVSLVVSNLLGQNAPAIAATEAAYEQMWAQDVAAMFGYHAGASAAVS
FT                   ALTPFGQALPTVAGGGALVSAAAAQVTTRVFRNLGLANVGEGNVGNGNVGNFNLGSANI
FT                   GNGNIGSGNIGSSNIGFGNVGPGLTAALNNIGFGNTGSNNIGFGNTGSNNIGFGNTGDG
FT                   NRGIGLTGSGLLGFGGLNSGTGNIGLFNSGTGNVGIGNSGTGNWGIGNSGNSYNTGFGN
FT                   SGDANTGFFNSGIANTGVGNAGNYNTGSYNPGNSNTGGFNMGQYNTGYLNSGNYNTGLA
FT                   NSGNVNTGAFITGNFNNGFLWRGDHQGLIFGSPGFFNSTSAPSSGFFNSGAGSASGFLN
FT                   SGANNSGFFNSSSGAIGNSGLANAGVLVSGVINSGNTVSGLFNMSLVAITTPALISGFF
FT                   NTGSNMSGFFGGPPVFNLGLANRGVVNILGNANIGNYNILGSGNVGDFNILGSGNLGSQ
FT                   NILGSGNVGSFNIGSGNIGVFNVGSGSLGNYNIGSGNLGIYNIGFGNVGDYNVGFGNAG
FT                   DFNQGFANTGNNNIGFANTGNNNIGIGLSGDNQQGFNIASGWNSGTGNSGLFNSGTNNV
FT                   GIFNAGTGNVGIANSGTGNWGIGNPGTDNTGILNAGSYNTGILNAGDFNTGFYNTGSYN
FT                   TGGFNVGNTNTGNFNVGDTNTGSYNPGDTNTGFFNPGNVNTGAFDTGDFNNGFLVAGDN
FT                   QGQIAIDLSVTTPFIPINEQMVIDVHNVMTFGGNMITVTEASTVFPQTFYLSGLFFFGP
FT                   VNLSASTLTVPTITLTIGGPTVTVPISIVGALESRTITFLKIDPAPGIGNSTTNPSSGF
FT                   FNSGTGGTSGFQNVGGGSSGVWNSGLSSAIGNSGFQNLGSLQSGWANLGNSVSGFFNTS
FT                   TVNLSTPANVSGLNNIGTNLSGVFRGPTGTIFNAGLANLGQLNIGSANLGDFNLGSGNV
FT                   GSFNVFSGNQGSYNIGPANLGNYNIGFANLGNYNIGFGNAGDFNQGFANTGNNNIGFAN
FT                   TGNNNIGIGLSGDNQQGFNFAGGWNSGTANIGLFNSGTNNVGIGNSGTGNWGIGNSGSG
FT                   NTGIGNTGSTNTGFFNTGIVNTGVANAGSYNTGWYNTGDTNTGIANLGDFNTGFYNTGN
FT                   FSTGFANQGDIATGAFITGDMGNGAFWRGDQQGLFSAGYRVHVPEIPAHVTVEVPVNIP
FT                   ITASFTNTVYSGITLEQINFGFTIDIAGIPLLAGAISKAVLPPITGTGPAITVNIGDPG
FT                   GSTAIRIPATASVGPFDVTFVNIAATTGFFNATTDPSSGFFNGGPGTVSGIANIGANIS
FT                   GFQNVANSATSGFNNYGSLQSGLANLGDTVSGVFNTGIGAPANVSGMFNIGSNLAGFFH
FT                   DQATGMSMFNLGLGNIGQFNVGFSNVGDSNAGLANIGSFNLGSGNLGSFNVFGGNQGSY
FT                   NIGPANLGNYNIGLGNLGSYNFGFGNAGDFNLGFANTGNNNIGFANTGNNNIGIGLSGD
FT                   NQQGFNFAGGWNSGSGNSGLFNSGTNNIGLFNSGTGNIGIGNSGTGNWGIANTGDTNTG
FT                   IFNTGDVNTGLLNAGNVNTGIFNTGHYNTGSFNAGSFNTAGFNPGSYNTGYLNTGSYNT
FT                   GLANSGDVNTGGFITGNYSNGFWWRGDYQGLAGISQTITVPDTAVPVKLHVPIFLDIPV
FT                   TGTLGTFTVHGFRFPEITGDIFLIGIPFNAATLDAFSFPNISIVLPNIGINLGSGPDPL
FT                   IDIAGTGGLLPIKIPLIDIPAAPGFGNSTTTPSSGFFNAGTGTVSGVGNVGSNSSGFFN
FT                   LTSGSSGISGVQNFGELISGGFNFGNTVSGLVNASTLGLSMPANLSGGGNVGATVAGFV
FT                   NNTQILNLGFGNVGSGNVGHGNIGDSNVGLGNLGNANVGHGNIGSFNVFSGNRGSYNIG
FT                   PANLGNYNIGLGNLGSYNFGFGNAGDFNLGFANSGSNNIGFANTGNNNIGIGLSGHNQQ
FT                   GFGSWNSGTANTGLFNSGTNNIGLFNSGTGNIGIGNSGIGNTGIGNPGVGNTGLGNSGT
FT                   GNWGLWNPGTGNMGVANVGTYNTGGYNVGSTNTGIANVGIANTGSYNTGSTNTGSFNDG
FT                   DFNTGFYNTGDYNTGFYNTGDVNTGAFIGGNFSNGAFWQSDHQGQWGAHYAITVPQIPL
FT                   LNFSLNIPVNIPIHLDFGTLAVNGFQIPAITLRALGVTHFSVGPIIVPRIAGTLPVIDI
FT                   NIGDPGGSSSIPITITSGAGPVVIPLLDIPPAPGFGNSTTGPSSGFFNSGTGSSSGFGN
FT                   VGANNSGFWNTAFAGIGNSGLQNFGSLQSGWANLGNTVSGFYNTSAADFATPANLSGLS
FT                   NVGADLTGVLRGPNGSTFNAGLANLGQFNVGSANLGSANLGSANLGSANLGNSNVGFGN
FT                   IGNANIGGANIGDFNVGIANTGPGLTAAVNNIGIGNTGNYNIGVGNTGNYNIGFGNTGN
FT                   NNIGIGLSGDNQIGFGPLNAGIANMGLFNLGDNNFGMANAGNFNQGIANTGNNNIGLFN
FT                   TGNNNVGIGLTGDGLSGFSSLNSGAGNTGFFNSGTANTGLFNSGTGNTGLFNSGTGNVG
FT                   IGNMGTGGFGVGLSGDSQVGIGGTNSGSFNIGLFNSGTGNVGIGNSGTGNVGIGNTGTG
FT                   NTGIGNSGNYNTGLLNAGLVNTGIANPGNHNTGLFNIGTFNTGIANPGHYNTGSYNTGS
FT                   YNTGMANAGDYGTGAFITGSMNNGLLWRADRQGLLAANYTITIERPAAFLNVDIPVNIP
FT                   ITGDITNVSIPAITFPRIDASGSVDIGILSGTVLAPVGPITLHGGDASAPLDTPIEIDF
FT                   GPSPAINLNIGKPDGSTVINIVGGAGAGPISIPIIDLRPAPGFFNATTGPSSGFLNWGA
FT                   GSASGLLNFGNNSGLYNFATSSMGNSGFQNYGSLQSGWANLGNSISGIYNTGLGAPANV
FT                   SGLLNIGTNLAGWLQNGPTETTFSVGLANLGFWNLGSANIGNYNLGSANIGVYNLGSAN
FT                   IGDFNLGSANIGDFNLGSANIGSSNIGFGNVGPGLTAAIGNIGFGNTGNGNIGIGNTGT
FT                   GNIGFGNTGNGNIGIGLTGDTMTGFGGWNSGTGNIGLFNSGTGNIGFGNSGTGNWGIGN
FT                   SGDYNTGIGNTGSTNSGFFNTGLVNTGIGNSGDYNTGLFNAGNTNTGSFNPGDYNTGGF
FT                   NPGNYNTGYFNPGNSNTGIANSGDVNTGAFNSGNYSNGFFWRGDYQGLGGFAYQSAVSE
FT                   IPWSYDRFQH"
FT   gene            complement(436193..436837)
FT                   /locus_tag="MRA_0365"
FT   CDS_pept        complement(436193..436837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0365"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72083"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ83"
FT                   /protein_id="ABQ72083.1"
FT                   /translation="MTDASVHPDELDPEYHHHGGFPEYGPASPGAGFGQFVATMRRLQD
FT                   LAVAADPGDAVWDEAAERAAALVELLSPFEADEGKAPAGRTPGLPGMGSLLLPPWTVTR
FT                   YGTDGVEMRGSFSRFHVGGNSAVHGGVLPLLFDHMFGMISHAAGRPISRTAFLHVDYRR
FT                   ITPIDVPLIVRGRVTNTEGRKAFVCAELFDSDETLLAEGNGLMVRLLPGQP"
FT   gene            complement(436834..438132)
FT                   /gene="purA"
FT                   /locus_tag="MRA_0366"
FT   CDS_pept        complement(436834..438132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="MRA_0366"
FT                   /product="adenylosuccinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72084"
FT                   /db_xref="GOA:A5TZ84"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TZ84"
FT                   /protein_id="ABQ72084.1"
FT                   /translation="MPAIVLIGAQWGDEGKGKATDLLGGRVQWVVRYQGGNNAGHTVVL
FT                   PTGENFALHLIPSGVLTPGVTNVIGNGVVIDPGVLLNELRGLQDRGVDTAKLLISADAH
FT                   LLMPYHIAIDKVTERYMGSKKIGTTGRGIGPCYQDKIARIGIRVADVLDPEQLTHKVEA
FT                   ACEFKNQVLVKIYNRKALDPAQVVDALLEQAEGFKHRIADTRLLLNAALEAGETVLLEG
FT                   SQGTLLDVDHGTYPYVTSSNPTAGGAAVGSGIGPTRIGTVLGILKAYTTRVGSGPFPTE
FT                   LFDEHGEYLSKTGREFGVTTGRRRRCGWFDAVIARYAARVNGITDYFLTKLDVLSSLES
FT                   VPVCVGYEIDGRRTRDMPMTQRDLCRAKPVYEELPGWWEDISGAREFDDLPAKARDYVL
FT                   RLEQLAGAPVSCIGVGPGREQTIVRRDVLQDRP"
FT   gene            438223..438870
FT                   /locus_tag="MRA_0367"
FT   CDS_pept        438223..438870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72085"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ85"
FT                   /protein_id="ABQ72085.1"
FT                   /translation="MYTAENAPGVAVLLSGDADVPGPLTGLPTHQDNLDTVIGRYSRLI
FT                   VVGADADLGAVLTRLLRTDRLDVEVGYVPRRRSPATRAYRLPAGRRAARRARCGVARRV
FT                   PLIRDETGSVIVGRAQWLPAEEQALIHGEAVVDDTVLFDGDVAGVCIEPTLTLPGLRAA
FT                   VDGAGKWRRWIGGRAAQLGTTGAAVLRDGVAAPRPVRRSTFYRNVEGWLLVR"
FT   gene            438881..439660
FT                   /locus_tag="MRA_0368"
FT   CDS_pept        438881..439660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0368"
FT                   /product="putative conserved integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72086"
FT                   /db_xref="GOA:A5TZ86"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ86"
FT                   /protein_id="ABQ72086.1"
FT                   /translation="MSETGQRESVRPSPIFLGLLGLTAVGGALAWLAGETVQPLAYAGV
FT                   FVMVIAGWLVSLCLHEFGHAFTAWRFGDHDVAVRGYLTLDPRRYSHPMLSLGLPMLFIA
FT                   LGGIGLPGAAVYVHTWFMTTARRTLVSLAGPTVNLALAMLLLAATRLLFDPIHAVLWAG
FT                   VAFLAFLQLTALVLNLLPIPGLDGYAALEPHLRPETQRALAPAKQFALVFLLVLFLAPT
FT                   LNGWFFGVVYWLFDLSGVSHRLAAAGSVLARFWSIWF"
FT   gene            complement(439665..440102)
FT                   /locus_tag="MRA_0369"
FT   CDS_pept        complement(439665..440102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0369"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72087"
FT                   /db_xref="InterPro:IPR014487"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ87"
FT                   /protein_id="ABQ72087.1"
FT                   /translation="MTKRTITPMTSMGDLLGPEPILLPGDSDAEAELLANESPSIVAAA
FT                   HPSASVAWAVLAEGALADDKTVTAYAYARTGYHRGLDQLRRHGWKGFGPVPYSHQPNRG
FT                   FLRCVAALARAAAAIGETDEYGRCLDLLDDCDPAARPALGL"
FT   gene            440185..441012
FT                   /locus_tag="MRA_0370"
FT   CDS_pept        440185..441012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72088"
FT                   /db_xref="GOA:A5TZ88"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ88"
FT                   /protein_id="ABQ72088.1"
FT                   /translation="MSNAPEPDRSAGESGSEPAGERSADPGEERTESYPLVPHDAETET
FT                   VVITTSDNDAAVTQPEAQRERRFTAPGFDAKETQVIVTAHEAATEVFQTNQAPTTPPRM
FT                   PTGMPPKTAVPQSIPPRTEATSVRQRTWGWALAVVVIVLALAAIAILGTVLLTRGKHSK
FT                   MSQEDQVRQAIQSLDIAIQTGDLTALRSLTCGSTRDGYVDYDERDWAETYRRVSAAKQY
FT                   PVIASIDQVVVNGAHAEANVTTFMAFDPQVRSTRSLDLQFRDDQWKICQSSSN"
FT   gene            441234..442616
FT                   /gene="mgtE"
FT                   /locus_tag="MRA_0371"
FT   CDS_pept        441234..442616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgtE"
FT                   /locus_tag="MRA_0371"
FT                   /product="Mg2+ transport transmembrane protein MgtE"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72089"
FT                   /db_xref="GOA:A5TZ89"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ89"
FT                   /protein_id="ABQ72089.1"
FT                   /translation="MSIRPAENSTLDIRHVIGIGTPKAVDLWLDVVTELPDRARELGSL
FT                   SKAELGKLGPLLDGTNAVELFESIDDKLAAEALHAMDPSLAATFLEALDSDHAANILRE
FT                   FKEPKREALLTLLPLERAMVLRGLLSWPEDCAAAHMVPETLTVRPNMTVSQAVASVRER
FT                   ASGLRSDARTTAYVYVTDADSHLLGVIAFRALVLANPEQRVRELMGDDLIVVSPLTDKE
FT                   LAAQTIMGHNLMAVPVVDADNRLLGIIAEDEAIDIAEEEATEDAERQGGSAPLEVPYLR
FT                   ASPWLLWRKRVVWLLVLFAAEAYTGSVLRAFSDEMEAVIALAFFIPLLIGTGGNTGTQI
FT                   ATTLVRAMATGQVRFRDVPAVLAKELSTGVLVGLTMAAAAVVRAWTLGVGPQVTLTVAL
FT                   TVAAIVVWSSLVAAVLPPLLKKLRIDPAIVSGPMIATIVDGTGLLIYFLVAHLTLTELH
FT                   GL"
FT   gene            complement(442628..443662)
FT                   /gene="fba"
FT                   /locus_tag="MRA_0372"
FT   CDS_pept        complement(442628..443662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fba"
FT                   /locus_tag="MRA_0372"
FT                   /product="fructose-bisphosphate aldolase Fba"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72090"
FT                   /db_xref="GOA:A5TZ90"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ90"
FT                   /protein_id="ABQ72090.1"
FT                   /translation="MPIATPEVYAEMLGQAKQNSYAFPAINCTSSETVNAAIKGFADAG
FT                   SDGIIQFSTGGAEFGSGLGVKDMVTGAVALAEFTHVIAAKYPVNVALHTDHCPKDKLDS
FT                   YVRPLLAISAQRVSKGGNPLFQSHMWDGSAVPIDENLAIAQELLKAAAAAKIILEIEIG
FT                   VVGGEEDGVANEINEKLYTSPEDFEKTIEALGAGEHGKYLLAATFGNVHGVYKPGNVKL
FT                   RPDILAQGQQVAAAKLGLPADAKPFDFVFHGGSGSLKSEIEEALRYGVVKMNVDTDTQY
FT                   AFTRPIAGHMFTNYDGVLKVDGEVGVKKVYDPRSYLKKAEASMSQRVVQACNDLHCAGK
FT                   SLTH"
FT   gene            443758..444441
FT                   /locus_tag="MRA_0373"
FT   CDS_pept        443758..444441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0373"
FT                   /product="putative conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72091"
FT                   /db_xref="GOA:A5TZ91"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ91"
FT                   /protein_id="ABQ72091.1"
FT                   /translation="MSTAVTAMPDILDPMYWLGANGVFGSAVLPGILIIVFIETGLLFP
FT                   LLPGESLLFTGGLLSASPAPPVTIGVLAPCVALVAVLGDQTAYFIGRRIGPALFKKEDS
FT                   RFFKKHYVTESHAFFEKYGKWTIILARFVPIARTFVPVIAGVSYMRYPVFLGFDIVGGV
FT                   AWGAGVTLAGYFLGSVPFVHMNFQLIILAIVFVSLLPALVSAARVYRARRNAPQSDPDP
FT                   LVLPE"
FT   gene            complement(444430..445560)
FT                   /locus_tag="MRA_0374"
FT   CDS_pept        complement(444430..445560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0374"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72092"
FT                   /db_xref="GOA:A5TZ92"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR014512"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ92"
FT                   /protein_id="ABQ72092.1"
FT                   /translation="MNLANRAASAETAVTQRHLRRLWALPGTQLAVVAWPSTRRDRLFG
FT                   SWHYWWQAHLLDCLVDAQLRDPQPQRRARINRQVRSHRVRNNFSWLNSYYDDMAWLALA
FT                   LERADRVAGVRRRRALPKLTNQFVEAWVPEDGGGIPWRKQDQFFNAPANGPAGLFLARY
FT                   PDQYGKRLKRAEQMADWIDRTLIDPETHLVFDGIKAGSLVRAQYTYCQGVVLGLETELA
FT                   VRTGPAARARHCARVHRLVAAVNEHMAPLGVLRGAGGGDGGLFAGITARYLALVATTLP
FT                   GDSADDAAARDTARAIVLASAQSAWDYRQTVDGLPVFGAFWDREAELPTAGGEQARSVR
FT                   GAVHSSAIAERDLSVQLSGWMLMEAAHSAAAVSSLG"
FT   gene            complement(445585..446178)
FT                   /locus_tag="MRA_0375"
FT   CDS_pept        complement(445585..446178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72093"
FT                   /db_xref="GOA:A5TZ93"
FT                   /db_xref="InterPro:IPR010488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ93"
FT                   /protein_id="ABQ72093.1"
FT                   /translation="MKRLDLVAGPNGAGKSTFVALTLAPLLPGIVFVNADEIAKQRWPD
FT                   DPTSHAYQAAQVAADTRARLIDLGRPFIAETVFSHPSKLELIRTARTAGYTVVLHVLVI
FT                   PEGLAVERVRHRVAAGGHDVPETKIRERHRRLAELVAQAITLADGATVYDNSRLAGPRI
FT                   VAQFSGGGIIGRACWPSWTPPPLMSRWSNRPETA"
FT   gene            446189..446617
FT                   /locus_tag="MRA_0376"
FT   CDS_pept        446189..446617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72094"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ94"
FT                   /protein_id="ABQ72094.1"
FT                   /translation="MSSSWRSRRGRQHDRGAVWPVLDDVARVVQGDRGDALRGEHVAVV
FT                   GSRQALLDSCGDLGVEHHALLQRQVRHRQMPRERSFHAAPRRRVLVRHRPTDAGPVVEL
FT                   LLGRTALTSTLGRRAVHQIRGDARDAVDGFGHDISPRV"
FT   gene            complement(446677..447888)
FT                   /locus_tag="MRA_0377"
FT   CDS_pept        complement(446677..447888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72095"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR011195"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ95"
FT                   /protein_id="ABQ72095.1"
FT                   /translation="MATPALLPGVDLAAFAAALAARLRDAGIPVSASGQASLVQALQQL
FT                   VPRTPAALYWGARLTLVSRVDELATFDAVFASLFGVFGSAEPDGANRPPPPIAGPRTPV
FT                   AGVGHRAKRRSCAAQAQNLPWDTRSLTMASAGQGGPSRTLPDVLPSRIVARADEPFDQF
FT                   DPDDLRLLGAWLEATMARWPRRRSMRFESSPHGKRIDLRATMNASRSTGWESVLLARIR
FT                   PRRRPRRVLLLCDVSRSMQPYAAIYLRLMRAAVLRRAGGHPEVFAFSTSLTRLTSVLSH
FT                   RSAEMALHRANARVTDRYGGTFIGRSVAALLAPPHGNALRGAVVIIASDGWDSDPPDVL
FT                   VHALTRVRRRAELLVWLNPRAAHPEFQPRAGSMAAALPYCDLFLPAHSLAGLHQLLLAL
FT                   AGAR"
FT   gene            complement(447894..448409)
FT                   /locus_tag="MRA_0378"
FT   CDS_pept        complement(447894..448409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0378"
FT                   /product="putative membrane oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72096"
FT                   /db_xref="GOA:A5TZ96"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ96"
FT                   /protein_id="ABQ72096.1"
FT                   /translation="MPGAQLIGHEGDEYLGKVKVKVGPVTSEFSGKVHFVEQDRNQHRA
FT                   VFDAKGKEARGTGNAAATVAAQLHEVGERTRVTVDTDLKIVGKLAQFGSGMLQQVSEKL
FT                   LGQFVDSLEAELAAQSSESPQGTPPATEAAPIDLLQLADGGQLKKYGSALLAALTVLLL
FT                   IWVLRRRR"
FT   gene            complement(448510..449406)
FT                   /locus_tag="MRA_0379"
FT   CDS_pept        complement(448510..449406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0379"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72097"
FT                   /db_xref="GOA:A5TZ97"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ97"
FT                   /protein_id="ABQ72097.1"
FT                   /translation="MTFASPDDVIRRFDEQNYLLDTGTASAIYLAVTLGRPLLLEGEPG
FT                   VGKTTAAKTLAVVLDTTLIRLQCYEGLTANEALYDWNYQRQLLSIRLAEARGKGISDIS
FT                   EADLYTEAYLVDRPILRCVRHRGPTPPVLLIDEIDRADDEFEALLLEFLGESAVTVPEL
FT                   GTFLAECPPIAVLTSNRSRDLHDALRRRCLYHWIDYPGPDRAAAIVRRTVPGATAPLIE
FT                   NATQFVCTARDLDLDKPPGVAETIDWVAALVALGVADLTAADSSPALASLGALAKTPDD
FT                   RTQIRDAYQAFTECSHA"
FT   gene            complement(449403..449996)
FT                   /locus_tag="MRA_0380"
FT   CDS_pept        complement(449403..449996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72098"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ98"
FT                   /protein_id="ABQ72098.1"
FT                   /translation="MTATQITGVVLAAGRSNRLGTPKQLLPYRDTTVLGATLDVARQAG
FT                   FDQLILTLGGAASAVRAAMALDGTDVVVVEDVERGCAASLRVALARVHPRATGIVLMLG
FT                   DQPQVAPATLRRIIDVGPATEIMVCRYADGVGHPFWFSRTVFGELARLHGDKGVWKLVH
FT                   SGRHPVRELAVDGCVPLDVDTWDDYRRLLESVPS"
FT   gene            complement(449993..450748)
FT                   /locus_tag="MRA_0381"
FT   CDS_pept        complement(449993..450748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72099"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZ99"
FT                   /protein_id="ABQ72099.1"
FT                   /translation="MSISDRAAQLVAARTPFVRATVVRAQQPTSARPGDEAILLADGTI
FT                   EGFVGGHCAQNSVRKAAMGVLQAGESVLLRVLPDGDVHFPEAPGACVVVNPCLAGGSLE
FT                   IFLTPQLPAPLIQIYGETPIADALIELCGLLGYDARRDTDPADTDALPTAIVIASHGGP
FT                   EAEIIRTALDNGVGYVGLVASTVRGASILDSLDLSDAERARVHTPVGLAIGAKTPAEIA
FT                   VSIAAELIATLRGGGPRGRKALADENGGA"
FT   gene            complement(450767..453166)
FT                   /locus_tag="MRA_0382"
FT   CDS_pept        complement(450767..453166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0382"
FT                   /product="putative carbon monoxide dehydrogenase large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72100"
FT                   /db_xref="GOA:A5TZA0"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012780"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZA0"
FT                   /protein_id="ABQ72100.1"
FT                   /translation="MTTIESRPPSPEDLADNAQQPCGHGRMMRKEDPRFIRGRGTYVDD
FT                   VALPGMLHLAILRSPYAHARIVRIDVTAAQAHPKVKAVVTGADLAAKGLAWMPTLANDV
FT                   QAVLATDKTRFQGQEVAFVVAEDRYSARDACELVDVDYEPRDPVVDARTALDPSAPVIR
FT                   TDLEGKSDNHIFDWETGDAAATEAVFAKADVVVQQEIVYPRVHPAPMETCGAVADLDPV
FT                   TGKLTLWTTSQAPHAHRTLYALVAGLPEHKIRVISPDIGGGFGNKVPIYPGYVCAIVAS
FT                   LLLDKPVKWMEDRSENLTSTGFARDYIMVGEIAANRDGKILAIRSNVLADHGAFNAQAA
FT                   PAKYPAGFFGVFTGSYDIEAAYCHMTAVYTNKAPGGVAYACSFRITEAVYFVERLVDCL
FT                   AFELKMDPAELRLRNLLRPNQFPYQSKTGWVYDSGDYETTMRKAMNMIGYEALRAEQKQ
FT                   RRARGELMGIGMSFFTEAVGAGPRKDMDILGLGMADGCELRVHPTGKAVLRLSVQTQGQ
FT                   GHETTFAQIVAEELGIAPDDIEVVHGDTDQTPFGLGTYGSRSTPVSGGAAALVARKVRD
FT                   KAKIIASGMLEVSVADLQWEKGKFHVKGDPSAAVTIADIAMRAHGAGDLPEGIEGGLDA
FT                   EVCYNPSNLTYPYGAYFCVVDIDPGTAVVKVRRFLAVDDCGTRINPMIIEGQVHGGIVD
FT                   GIGMALMEMIAFDEDGNCLGGSLMDYLIPTALEVPHLETGHTVTPSPHHPIGAKGIGES
FT                   ATVGSPPAVVNAVVDALAPFGVRHADMPLTPSRVWEAMQGRATPPI"
FT   gene            complement(453163..453642)
FT                   /locus_tag="MRA_0383"
FT   CDS_pept        complement(453163..453642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0383"
FT                   /product="putative carbon monoxide dehydrogenase small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72101"
FT                   /db_xref="GOA:A5TZA1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZA1"
FT                   /protein_id="ABQ72101.1"
FT                   /translation="MQVNMTVNGEPVTAEVEPRMLLVHFLRDQLRLTGTHWGCDTSNCG
FT                   TCVVEVDGVPVKSCTMLAVMASGHSIRTVEGLAGPDGQLDPVQEGFMRCHGLQCGFCTP
FT                   GMLITARALLDRNPDPDEQTIREAISGQICRCTGYTTIVRSIQWAAAHQTVKAQS"
FT   gene            complement(453657..454517)
FT                   /locus_tag="MRA_0384"
FT   CDS_pept        complement(453657..454517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0384"
FT                   /product="putative carbon monoxide dehydrogenase medium
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72102"
FT                   /db_xref="GOA:A5TZA2"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZA2"
FT                   /protein_id="ABQ72102.1"
FT                   /translation="MDHAIGLLDRLGEGARVVAGGHSLLPMMKLRIANPEYLVDINDLA
FT                   PELGYVVVGGINNPNLVRLGAMTRHREILDSDALAAVCPIFRDAERVIADPVVRNRGTL
FT                   GGSLCQADPAEDLSTVCTVLDAVCLAKGPSGEREIAIDDFLVGPYETALAHNEVLIEVR
FT                   IPLRHNTSSAYAKVERRVGDWAITAAGAAVTLDGQTILAARVGLTAVNPDPVALAELSA
FT                   GLVGQPATEEVFAEAGRRAAQACTPVTDVRGTAEYKRHLAGELTVRTLRTAAGRVLGAP
FT                   AAPEA"
FT   gene            complement(454593..455735)
FT                   /locus_tag="MRA_0385"
FT   CDS_pept        complement(454593..455735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72103"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZA3"
FT                   /protein_id="ABQ72103.1"
FT                   /translation="MAIWAAGDTAGVATVVRTLRSAPRPPGAAMVVAPDGSVSGSVSGG
FT                   CVEGAVYELAAEVAQTGIPRLEHYGVSDDTAFAVGLTCGGIIDVFVEPVSRATFPELGE
FT                   LADDIGAQRPVAIATVIAHPDERRVGRRLVIRPDTKSPVTGSLGSARADAAVIDDARGL
FT                   LAVGRSEILEYGPDGQRRGEGMEVFVSSHAPRPRMLVFGAIDFAAALARQGSFLGYRVT
FT                   VCDARAVFATPARFPTADDVVVAWPHRYLAAQAEAGGIDERTVICVLTHDPKFDVPVLE
FT                   VALRLGVGYVGAMGSRKTHDDRMDRLRAAGLTDAELSRLSSPIGLDLGARTPEETAVSI
FT                   AADIIARRWGGGGRPLADIAGRIHHDAQVAGEFKDYLTRH"
FT   gene            455784..456749
FT                   /locus_tag="MRA_0386"
FT   CDS_pept        455784..456749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0386"
FT                   /product="LysR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72104"
FT                   /db_xref="GOA:A5TZA4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZA4"
FT                   /protein_id="ABQ72104.1"
FT                   /translation="MTPAQLRAYSAVVRLGSVRAAAAELGLSDAGVSMHVAALRKELDD
FT                   PLFTRTGAGLAFTPGGLRLASRAVEILGLQQQTAIEVTEAAHGRRLLRIAASSAFAEHA
FT                   APGLIELFSSRADDLSVELSVHPTSRFRELICSRAVDIAIGPASESSIGSDGSIFLRPF
FT                   LKYQIITVVAPNSPLAAGIPMPALLRHQQWMLGPSAGSVDGEIATMLRGLAIPESQQRI
FT                   FQSDAAALEEVMRVGGATLAIGFAVAKDLAAGRLVHVTGPGLDRAGEWCVATLAPSARQ
FT                   PAVSELVGFISTPRCIQAMIPGSGVGVTRFRPKVHVTLWS"
FT   gene            457000..457221
FT                   /locus_tag="MRA_0386A"
FT   CDS_pept        457000..457221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0386A"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0386A"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72105"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZA5"
FT                   /protein_id="ABQ72105.1"
FT                   /translation="MSGRWEAGNADGNGGSAGLIGSGGAGGDGGSGGATGAGGEGGDAG
FT                   ASGSINGNAGDPGNSGERGAVGKPGAPG"
FT   gene            457340..457555
FT                   /gene="secE2"
FT                   /locus_tag="MRA_0387"
FT   CDS_pept        457340..457555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE2"
FT                   /locus_tag="MRA_0387"
FT                   /product="putative protein transport protein SecE2"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72106"
FT                   /db_xref="InterPro:IPR009923"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036694"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZA6"
FT                   /protein_id="ABQ72106.1"
FT                   /translation="MSVYKVIDIIGTSPTSWEQAAAEAVQRARDSVDDIRVARVIEQDM
FT                   AVDSAGKITYRIKLEVSFKMRPAQPR"
FT   gene            complement(457631..458293)
FT                   /locus_tag="MRA_0388"
FT   CDS_pept        complement(457631..458293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0388"
FT                   /product="RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72107"
FT                   /db_xref="GOA:A5TZA7"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZA7"
FT                   /protein_id="ABQ72107.1"
FT                   /translation="MDLAMSALGPGPTEWGAPTGGVGPWAGDLPDDPRYDPVLLRDGDA
FT                   RNVVDAYRYWTREAIIADIDTRRHPLHVAIENFGHDANIGSVVRTANAFAVHTVHIVGR
FT                   RRWNRRGAMVTDRYQRLCHHDSTTGLLEFAAGAGLTVVAVDNVPGAARLEQTALPRECL
FT                   LLFGQEGPGITDDARAGAAVTVSIAQFGSTRSINAGVAAGIAMHAWIRQHADLGRAW"
FT   gene            complement(458278..459186)
FT                   /locus_tag="MRA_0389"
FT   CDS_pept        complement(458278..459186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72108"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZA8"
FT                   /protein_id="ABQ72108.1"
FT                   /translation="MRILVAWATCGAVVLSGLTGCSGSSHSGRTYGAQSARTGESLAVL
FT                   GWNMSVSNLRWSGDYVLIDVDASPTDPHAPHAKPEDIRFGLYGALAHPMESAALGSCGD
FT                   AMAHVRDVVSPLSAPAGRLTGTVCLGPLKERSAVRGVYTYSPRDRIPGTAAAYPAAFPV
FT                   GMLPTNQNDAGLVVKTTSVSAWRADGMQLGKPQLGDPVAFTGNGYMLLGLEVDAVPDRY
FT                   RDDSAARGGPMMLLAAPTLPGRGLSPACATYGSSVLILPDALLDAVHISASLCTQGEIN
FT                   EALLYATVATVGTHAALWTSR"
FT   gene            complement(459204..459743)
FT                   /gene="pyrE"
FT                   /locus_tag="MRA_0390"
FT   CDS_pept        complement(459204..459743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="MRA_0390"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72109"
FT                   /db_xref="GOA:A5TZA9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TZA9"
FT                   /protein_id="ABQ72109.1"
FT                   /translation="MAGPDRAELAELVRRLSVVHGRVTLSSGREADYYVDLRRATLHHR
FT                   ASALIGRLMRELTADWDYSVVGGLTLGADPVATAIMHAPGRPIDAFVVRKSAKAHGMQR
FT                   LIEGSEVTGQRVLVVEDTSTTGNSALTAVHAVQDVGGEVVGVATVVDRATGAAEAIEAE
FT                   GLRYRSVLGLADLGLD"
FT   gene            complement(459824..460678)
FT                   /locus_tag="MRA_0391"
FT   CDS_pept        complement(459824..460678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0391"
FT                   /product="putative conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72110"
FT                   /db_xref="GOA:A5TZB0"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZB0"
FT                   /protein_id="ABQ72110.1"
FT                   /translation="MVPLWFTLSALCFVGAVVLLYVDIDRRRGRSRRRKSWARSHGFDY
FT                   ERESTEILKRWTRGVMSTVGDVAAHNVVLGQIRGEAVYIFDLEEVATVIALHRKVGTNV
FT                   VVDLRLKGLKEPRESDIWLLGAIGPRMVYSTNLDAARRACDRRMVTFAHTAPDCAEIMW
FT                   NEQNWTLVSMPIASTRAQWDEGLRTVRQFNDLLRVLPPLPQEMPQQTGVGPRGAAPGRP
FT                   VAPGGPAELPPRRAQPDPATTVLPDPARRAPEPIRRDEGRSEGVRRPPPAGRNGQQATN
FT                   YQH"
FT   gene            complement(460764..463310)
FT                   /gene="clpB"
FT                   /locus_tag="MRA_0392"
FT   CDS_pept        complement(460764..463310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpB"
FT                   /locus_tag="MRA_0392"
FT                   /product="ATP-dependent Clp protease ATP-binding subunit
FT                   ClpB"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72111"
FT                   /db_xref="GOA:A5TZB1"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZB1"
FT                   /protein_id="ABQ72111.1"
FT                   /translation="MDSFNPTTKTQAALTAALQAASTAGNPEIRPAHLLMALLTQNDGI
FT                   AAPLLEAVGVEPATVRAETQRLLDRLPQATGASTQPQLSRESLAAITTAQQLATELDDE
FT                   YVSTEHVMVGLATGDSDVAKLLTGHGASPQALREAFVKVRGSARVTSPEPEATYQALQK
FT                   YSTDLTARAREGKLDPVIGRDNEIRRVVQVLSRRTKNNPVLIGEPGVGKTAIVEGLAQR
FT                   IVAGDVPESLRDKTIVALDLGSMVAGSKYRGEFEERLKAVLDDIKNSAGQIITFIDELH
FT                   TIVGAGATGEGAMDAGNMIKPMLARGELRLVGATTLDEYRKHIEKDAALERRFQQVYVG
FT                   EPSVEDTIGILRGLKDRYEVHHGVRITDSALVAAATLSDRYITARFLPDKAIDLVDEAA
FT                   SRLRMEIDSRPVEIDEVERLVRRLEIEEMALSKEEDEASAERLAKLRSELADQKEKLAE
FT                   LTTRWQNEKNAIEIVRDLKEQLEALRGESERAERDGDLAKAAELRYGRIPEVEKKLDAA
FT                   LPQAQAREQVMLKEEVGPDDIADVVSAWTGIPAGRLLEGETAKLLRMEDELGKRVIGQK
FT                   AAVTAVSDAVRRSRAGVSDPNRPTGAFMFLGPTGVGKTELAKALADFLFDDERAMVRID
FT                   MSEYGEKHTVARLIGAPPGYVGYEAGGQLTEAVRRRPYTVVLFDEIEKAHPDVFDVLLQ
FT                   VLDEGRLTDGHGRTVDFRNTILILTSNLGSGGSAEQVLAAVRATFKPEFINRLDDVLIF
FT                   EGLNPEELVRIVDIQLAQLGKRLAQRRLQLQVSLPAKRWLAQRGFDPVYGARPLRRLVQ
FT                   QAIGDQLAKMLLAGQVHDGDTVPVNVSPDADSLILG"
FT   gene            463443..464615
FT                   /locus_tag="MRA_0393"
FT   CDS_pept        463443..464615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0393"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72112"
FT                   /db_xref="GOA:A5TZB2"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZB2"
FT                   /protein_id="ABQ72112.1"
FT                   /translation="MGLEDRDALRVLQNAFKLDDPELVRRFYAHWFALDASVRDLFPPD
FT                   MGAQRAAFGQALHWVYGELVAQRAEEPVAFLAQLGRDHRKYGVLPTQYDTLRRALYTTL
FT                   RDYLGHPSRGAWTDAVDEAAGQSLNLIIGVMSGAADADDAPAWWDGTVVEHIRVSRDLA
FT                   VARLQLDRPLHYYPGQYVNVHVPQCPRRWRYLSPAIPADPNGRIEFHVRVVPGGLVSNA
FT                   IVGETRPGDRWRLSGPHGAFRVDRDGGDVLMVAGSTGLAPLRALIIDLSRFAVNPRVHL
FT                   FFGARYACELYDLPTLWQIAAHNPWLSVSPVSEYNGDPAWAADYPDVSAPRGLHVRQTG
FT                   RLPDVVSRYGGWGDRQILICGGPAMVRATKAALIAKGAPPERIQHDPLSR"
FT   gene            464719..467976
FT                   /locus_tag="MRA_0394"
FT   CDS_pept        464719..467976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0394"
FT                   /product="LuxR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72113"
FT                   /db_xref="GOA:A5TZB3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZB3"
FT                   /protein_id="ABQ72113.1"
FT                   /translation="MSKLLPRGTVTLLLADVEGSTWLWETHPDDMGAAVARLDKAVSGV
FT                   IAAHDGVRPVEQGEGDSFVLAFACASDAVAAALDLQRARLAPIRLRIGVHTGEVALRDE
FT                   GNYAGPTINRTARLRDLAHGGQTVLSGVTESLVIDRLPDKAWLVDLGTHALRDLSRPER
FT                   VMQLCHPELRIDFPPLRVANDDVAHGLPVHLTRFVGRGAQITEVHRLVTDNRLVTLTGA
FT                   GGVGKTRLAAQLAAQIAGEFGRAWFVDLAPITDPDLVPVTVAGALGLHDQPGRSTTDTV
FT                   LRFLGGRPALVVLDNCEHLLDATAALVLALVKACRGVRLLATCREPLRVEGEVSYRVPS
FT                   LSLSDEAVEMFCYRAQRVRPDFRLTDDNSAAVTEICKRLDGLPLAIELAAARLRSMTLD
FT                   EIIDGLRDRFALLTGGARTAAHRQQTLWASVDWSYTLLTEPERTLFRRLAVFVGCFFVD
FT                   DAQAVACSGDVQRYQVLDEITLLVDKSLVMADDNSGRTCYRLCETMRHYALEKLSEAGE
FT                   VDAVFARHRDYYTALAARVDNPGPSDYSHCLDQAETEIDNLRAAFVWNRENSDTEGALA
FT                   LASSLLRVWMTRGRIQEGRAWFDSILADENARHLEVAAAVRARALADKALLDIFVDAAA
FT                   GMEQAQQALVIAREVDEPALLSRALTACGLIAVAVARADAAASYFAEAIDLARAVDDRW
FT                   RLAQILTFQAVDAVVAGDPVAARPAAQEARELAAAIGDHSNALWCRWCLGYAQLMRGEL
FT                   AAAAAQFGEVVDEAEASQEVLHKANSLQGLAFALAYQGELSAARAAADAALEAAELGEY
FT                   FAGMGYSALTTAALAAGDVQTAQHASEAAWRNLSLALPLSAAVQRAFNAQAALAGGDLS
FT                   AARRWCDDAVQSMTGHHLAMALATRARIAVAEGKREEAERDAHKALACAAESGAHLDLP
FT                   DVLECLAGLASDAGTHHAAARLFGAAEAIRQQIGSVRFAIYRSDYVQSVTALRDAMGEK
FT                   DFDAAWAEGAALSIKETIAYAQRGHSWRKRPATGWESLTPTEIDVVRLVGEGLANKDIA
FT                   TRLFVSPRTVQTHLTHVYTKLGFTSRLQLAQAAARRT"
FT   gene            complement(467980..469311)
FT                   /locus_tag="MRA_0395"
FT   CDS_pept        complement(467980..469311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0395"
FT                   /product="PPE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72114"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR022171"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZB4"
FT                   /protein_id="ABQ72114.1"
FT                   /translation="MDFGALPPEINSARIYSGPGSRPLMQAAAAWQRLANELTATAASY
FT                   SSVISGLTGDDWLGPSALSMAAAAVPYVAWMRATAASAEQAAAQAVAAANAYESAYAAT
FT                   VPPTVIAANRRTMLSLVKTNVFGQNTPAIATSEAQYGEMWAQDIVAMEGYAGASAAASQ
FT                   LPPFTPPPATTSGAGSLSDAAATAAQAVVPAAAATDVSLLPTLQSFLPPPFDAIPNPIE
FT                   DLDVLVAAAVAVAAGSLGVSAAQLGEIYRHDVVDEAQKAPHCPAESDQTPAGAAGDGDL
FT                   PEVGGRVTSPPQPPVAALTGYSANIGGLSVPHSWNLPPAVRQVAAMFPGATPMYMTGSS
FT                   DGSYAGLAAAGLAGTGLAGLAARGGSAPTPAAAAPAGAGGAGPAATRPAAQQTPAVPAA
FT                   AAGSAIPGLPPGLPPGVVANLAATLAAIPGATIIVVPPSPNANQ"
FT   gene            469645..470904
FT                   /gene="purT"
FT                   /locus_tag="MRA_0396"
FT   CDS_pept        469645..470904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purT"
FT                   /locus_tag="MRA_0396"
FT                   /product="5'-phosphoribosylglycinamide transformylase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72115"
FT                   /db_xref="GOA:A5TZB5"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005862"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZB5"
FT                   /protein_id="ABQ72115.1"
FT                   /translation="MIDGWTEEQHEPTVRHERPAAPQDVRRVMLLGSAEPSRELAIALQ
FT                   GLGAEVIAVDGYVGAPAHRIADQSVVVTMTDAEELTAVIRRLQPDFLVTVTAAVSVDAL
FT                   DAVEQADGECTELVPNARAVRCTADREGLRRLAADQLGLPTAPFWFVGSLGELQAVAVH
FT                   AGFPLLVSPVAGVAGQGSSVVAGPNEVEPAWQRAAGHQVQPQTGGVSPRVCAESVVEIE
FT                   FLVTMIVVCSQGPNGPLIEFCAPIGHRDADAGELESWQPQKLSTAALDAAKSIAARIVK
FT                   ALGGRGVFGVELMINGDEVYFADVTVCPAGSAWVTVRSQRLSVFELQARAILGLAVDTL
FT                   MISPGAARVINPDHTAGRAAVGAAPPADALTGALGVPESDVVIFGRGLGVALATAPEVA
FT                   IARERAREVASRLNVPDSRE"
FT   gene            470901..471323
FT                   /locus_tag="MRA_0397"
FT   CDS_pept        470901..471323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72116"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZB6"
FT                   /protein_id="ABQ72116.1"
FT                   /translation="MSYAGDITPLQAWEMLSDNPRAVLVDVRCEAEWRFVGVPDLSSLG
FT                   REVVYVEWATSDGTHNDNFLAELRDRIPADADQHERPVIFLCRSGNRSIGAAEVATEAG
FT                   ITPAYNVLDGFEGHLDAEGHRGATGWRAVGLPWRQG"
FT   gene            471320..472540
FT                   /gene="metZ"
FT                   /locus_tag="MRA_0398"
FT   CDS_pept        471320..472540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metZ"
FT                   /locus_tag="MRA_0398"
FT                   /product="O-succinylhomoserine sulfhydrylase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72117"
FT                   /db_xref="GOA:A5TZB7"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006234"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZB7"
FT                   /protein_id="ABQ72117.1"
FT                   /translation="MTDESSVRTPKALPDGVSQATVGVRGGMLRSGFEETAEAMYLTSG
FT                   YVYGSAAVAEKSFAGELDHYVYSRYGNPTVSVFEERLRLIEGAPAAFATASGMAAVFTS
FT                   LGALLGAGDRLVAARSLFGSCFVVCSEILPRWGVQTVFVDGDDLSQWERALSVPTQAVF
FT                   FETPSNPMQSLVDIAAVTELAHAAGAKVVLDNVFATPLLQQGFPLGVDVVVYSGTKHID
FT                   GQGRVLGGAILGDREYIDGPVQKLMRHTGPAMSAFNAWVLLKGLETLAIRVQHSNASAQ
FT                   RIAEFLNGHPSVRWVRYPYLPSHPQYDLAKRQMSGGGTVVTFALDCPEDVAKQRAFEVL
FT                   DKMRLIDISNNLGDAKSLVTHPATTTHRAMGPEGRAAIGLGDGVVRISVGLEDTDDLIA
FT                   DIDRALS"
FT   gene            complement(472537..473949)
FT                   /gene="ndhA"
FT                   /locus_tag="MRA_0399"
FT   CDS_pept        complement(472537..473949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhA"
FT                   /locus_tag="MRA_0399"
FT                   /product="membrane NADH dehydrogenase NdhA"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72118"
FT                   /db_xref="GOA:A5TZB8"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZB8"
FT                   /protein_id="ABQ72118.1"
FT                   /translation="MTLSSGEPSAVGGRHRVVIIGSGFGGLNAAKALKRADVDITLISK
FT                   TTTHLFQPLLYQVATGILSEGDIAPTTRLILRRQKNVRVLLGEVNAIDLKAQTVTSKLM
FT                   DMTTVTPYDSLIVAAGAQQSYFGNDEFATFAPGMKTIDDALELRGRILGAFEAAEVSTD
FT                   HAERERRLTFVVVGAGPTGVEVAGQIVELAERTLAGAFRTITPSECRVILLDAAPAVLP
FT                   PMGPKLGLKAQRRLEKMDVEVQLNAMVTAVDYKGITIKEKDGGERRIECACKVWAAGVA
FT                   ASPLGKMIAEGSDGTEIDRAGRVIVEPDLTVKGHPNVFVVGDLMFVPGVPGVAQGAIQG
FT                   ARYATTVIKHMVKGNDDPANRKPFHYFNKGSMATISRHSAVAQVGKLEFAGYFAWLAWL
FT                   VLHLVYLVGYRNRIAALFAWGISFMGRARGQMAITSQMIYARLVMTLMEQQAQGALAAA
FT                   EQAEHAEQEAAG"
FT   gene            474091..475416
FT                   /locus_tag="MRA_0400"
FT   CDS_pept        474091..475416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0400"
FT                   /product="conserved 13E12 repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72119"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZB9"
FT                   /protein_id="ABQ72119.1"
FT                   /translation="MAVGRCAIPRFDQAASGSAINGGQVHLSDGSTSPARQLPAPWPGD
FT                   AGAAAEGRAGVCCRGNRLPHVSDVGVSHRFDHRPAGVGAGGCRAGAAGAGLAVDDPGQL
FT                   AAAIDRIVAVADPDAVRQVRERARDREVSIWNSADGMGEVYAQLYATDAQALDARLNAL
FT                   VATVCAGDPRSTDQRRADALGALAAGADRLACRCDNPDCAAEGRPVSAVVIHVVAEQAS
FT                   VKGHGQAPAALLGGDGLIPAELVAELAKTAGLQPIPVPAGTEPGYRPSVKLAAFVRARD
FT                   LTCRAPGCDRPATQCDLDHTIAFADGGATHAANLKCLCRLHHLLATFCGWRAQQLPDGT
FT                   VIWTLPGNQTYVTTPGSALLFPALCTPTGDPPAPEPARADRRGQRTAMMPRRASTRTQN
FT                   RAHCIAAERHRNHQARRIAQAAVIATETHGPPPDPDDDPPPF"
FT   gene            complement(475432..476151)
FT                   /locus_tag="MRA_0401"
FT   CDS_pept        complement(475432..476151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0401"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72120"
FT                   /db_xref="GOA:A5TZC0"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZC0"
FT                   /protein_id="ABQ72120.1"
FT                   /translation="MTEPRPVFAVVISAGLSAIPMVGGPLQTVFDAIEERTRHRAETTT
FT                   REICESVGGADTVLSRIDKNPELEPLLSQAIEAATRTSMEAKRRLLAQAAAAALEDDQK
FT                   VEPASLIVATLSQLEPVHIHALVRLAKAAKSSPDQDEIQRREVMRAASKVEPVPVLAAL
FT                   IQTGVAIATTTVWHGNGTGTPAEESGHILIHDVSDFGHRLLAYLRAADAGAELLILPSG
FT                   GSAPTGDHPTPHPSTSR"
FT   gene            476250..476654
FT                   /locus_tag="MRA_0401A"
FT   CDS_pept        476250..476654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0401A"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0401A"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72121"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZC1"
FT                   /protein_id="ABQ72121.1"
FT                   /translation="MDWMPLGDYETFRHWSGKPRAWGPQESGWRAWFGGKIVDGLCEVL
FT                   DEHLAVRRRGVPAAIGCVPWLSSEAVAETLLALSVFCVVIDKGTSFPSRLRNPDKGFPN
FT                   VALLRLRDMAPSEHGSRCSSARGRLCLSMS"
FT   gene            476660..477052
FT                   /locus_tag="MRA_0402"
FT   CDS_pept        476660..477052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72122"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZC2"
FT                   /protein_id="ABQ72122.1"
FT                   /translation="MRALGWLREDRKPLLNAKLLVLGHLALNVYDPDNGYGEEVLDFEP
FT                   RTVWWGSANWTVRAGSHLEVGFACDDPTLVEEATAFVADVIAFSEPIDTTCAGPEPNLV
FT                   QVEFDDAAMAEAMEEMAEPDDDGEDW"
FT   gene            complement(477093..477563)
FT                   /locus_tag="MRA_0403"
FT   CDS_pept        complement(477093..477563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72123"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZC3"
FT                   /protein_id="ABQ72123.1"
FT                   /translation="MKYNNIRTPCLYPIPVFWAGAYRLEGRRVVVGIGWWAVSLGGGCG
FT                   GLGDHVGNPAGLVVAVAFGGDVVGAVLRSGAGPARHHRGALPAAVGAGRVGSRWVTGGG
FT                   AQRREQQRAARGGDIGLVTRQRPNHGAVGQLLGAPAPEGGQQMMAPITRRTF"
FT   gene            complement(477989..478630)
FT                   /locus_tag="MRA_0404"
FT   CDS_pept        complement(477989..478630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0404"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72124"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZC4"
FT                   /protein_id="ABQ72124.1"
FT                   /translation="MGVIARVVGVAACGLSLAVLAAAPTAGAEPTGALPPMTSSGSGPV
FT                   IGDGDAALRQRISQQLFSFGDPTVQEVDGSDAAQFITAAAAVADRDVASVFLPLQRVLG
FT                   CQQNTAGSGAGFGARAYRRTDGQWGGAMLVVAKSTVSDVDALKACVKSGWRKATAGTPT
FT                   SMCNNGWTYPPFADTRRGEEGYFVLLAGTASDFCSAPNANYRTTASSWPG"
FT   gene            complement(478637..479866)
FT                   /gene="lpqK"
FT                   /locus_tag="MRA_0405"
FT   CDS_pept        complement(478637..479866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpqK"
FT                   /locus_tag="MRA_0405"
FT                   /product="putative conserved lipoprotein LpqK"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72125"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZC5"
FT                   /protein_id="ABQ72125.1"
FT                   /translation="MPVLRRLGCSVLALGLLAGCAPPRTGPASSPTNNGAKADAVIRIV
FT                   RDFMTQAHLKAVLVRVTVAGKEVVTRAVGDSMTGVPATTAMHFRNGAVAISYVATLLLK
FT                   LVDEKKLRLDDKLSRWLPDFPHADRVTLGQLAQMTSGYPDYVLGNEAFDAELYANPFRQ
FT                   WTTQELLDQISSRPLLYDPGTNWNYAHTNYLLLGLALEKAAGQDMPTLLQRKVLSPLGL
FT                   TATANSDTPAIPEPALHAFTSERRAALKIPAGVPFYEESTFWNPSWTITHGAIQTTTIY
FT                   DMEATAVGIGSGRLLSADSYKKMVSTELRGKTRAQPGCPTCFEQNDGYSYGLGIVISGH
FT                   WLLQNPMFAGYAAVEAYLPSQRVAVAVAVTYAPEAFDDQGNYRNQADILFRKIGAEVAP
FT                   NDAPPMPPGR"
FT   gene            complement(479876..481063)
FT                   /gene="fadE7"
FT                   /locus_tag="MRA_0406"
FT   CDS_pept        complement(479876..481063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadE7"
FT                   /locus_tag="MRA_0406"
FT                   /product="putative glutaryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72126"
FT                   /db_xref="GOA:A5TZC6"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZC6"
FT                   /protein_id="ABQ72126.1"
FT                   /translation="MSTPTPPALDRDDPLGLDASLSSDEIAVRDTVRRFCAEHVTPHVA
FT                   AWFEDGDLPVARDLAKQFGELGLLGMQLHGHGCGGASAVHYGLACRELEAADSGIRSLV
FT                   SVQGSLAMFAIASFGSDEQKRQWLPGMATGDLLGCFGLTEPDVGSDPAAMKTRARRDGP
FT                   DWVITGGKMWITNGSVADVAIVWAATDDGIRGFIVPTDTPGFTANTIGHKLSLRASITS
FT                   ELVLDNVRLPADAMLPGATGLRAPLACLSEARYGIVWGAMGAARSAWQCALDYARQRTQ
FT                   FGRPIAGFQLTQAKLVDMAVELHKGQLLSLHLGRLKDRVGLRPDQVSFGKLNNTREALK
FT                   ICRTARTILGGNGISLEYPVIRHMVNLESVLTYEGTPEMHQLVLGQAFTGLAAFR"
FT   gene            481099..481470
FT                   /locus_tag="MRA_0407"
FT   CDS_pept        481099..481470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0407"
FT                   /product="putative conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72127"
FT                   /db_xref="GOA:A5TZC7"
FT                   /db_xref="InterPro:IPR021414"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZC7"
FT                   /protein_id="ABQ72127.1"
FT                   /translation="MRPRRALAGLAADVVAVLVFCAVGRRSHAEGLSVTGLAATAWPFL
FT                   TGTGIGWVLARGWRRPTALAPTGVIVWLCTIVVGMVLRKVSSAGVAASFVVVASAVTAV
FT                   LLLGWRAAVALMAPHRADG"
FT   gene            complement(481665..484541)
FT                   /gene="mmpL1"
FT                   /locus_tag="MRA_0408"
FT   CDS_pept        complement(481665..484541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmpL1"
FT                   /locus_tag="MRA_0408"
FT                   /product="transmembrane transport protein MmpL1"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72128"
FT                   /db_xref="GOA:A5TZC8"
FT                   /db_xref="InterPro:IPR004707"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZC8"
FT                   /protein_id="ABQ72128.1"
FT                   /translation="MRSQRLAGHLSAAARTIHALSLPIILFWVALTIVVNVVAPQLQSV
FT                   ARTHSVALGPHDAPSLIAMKRIGKDFQQFDSDTTAMVLLEGQEKLGDEAHRFYDVLVTK
FT                   LSQDTTHVQHIENFWGDPLTAAGSQSADGKAAYVQLNLTGDQGGSQANESVAAVQRIVD
FT                   SVPPPPGIKAYVTGPGPLGADRVVYGDRSLHTITGISIAVIAIMLFIAYRSLSAALIML
FT                   LTVGLELLAVRGIISTFAVNDLMGLSTFTVNVLVALTIAASTDYIIFLVGRYQEARATG
FT                   QNREAAYYTMFGGTAHVVLASGLTVAGAMYCLGFTRLPYFNTLASPCAIGLVTVMLASL
FT                   TLAPAIIAVASRFGLFDPKRATTKRRWRRIGTVVVRWPGPVLAATLLIALIGLLALPKY
FT                   QTNYNERYYIPSAAPSNIGYLASDRHFPQARMEPEVLMVEADHDLRNPTDMLILDRIAK
FT                   TVFHTPGIARVQSITRPLGAPIDHSSIPFQLGMQSTMTIENLQNLKDRVADLSTLTDQL
FT                   QRMIDITQRTQELTRQLTDATHDMNAHTRQMRDNANELRDRIADFDDFWRPLRSFTYWE
FT                   RHCFDIPICWSMRSLLNSMDNVDKLTEDLANLTDDTERMDTTQRQLLAQLDPTIATMQT
FT                   VKDLAQTLTSAFSGLVTQMEDMTRNATVMGRTFDAANNDDSFYLPPEAFQNPDFQRGLK
FT                   LFLSPDGTCARFVITHRGDPASAEGISHIDPIMQAADEAVKGTPLQAASIYLAGTSSTY
FT                   KDIHEGTLYDVMIAVVASLCLIFIIMLGITRSVVASAVIVGTVALSLGSAFGLSVLIWQ
FT                   HILHMPLHWLVLPMAIIVMLAVGSDYNLLLIARFQEEIGAGLKTGMIRAMAGTGRVVTI
FT                   AGLVFAFTMGSMVASDLRVVGQIGTTIMIGLLFDTLVVRSYMTPALATLLGRWFWWPRR
FT                   VDRLARQPQVLGPRRTTALSAERAALLQ"
FT   gene            complement(484538..484966)
FT                   /gene="mmpS1"
FT                   /locus_tag="MRA_0409"
FT   CDS_pept        complement(484538..484966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmpS1"
FT                   /locus_tag="MRA_0409"
FT                   /product="putative conserved membrane protein MmpS1"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72129"
FT                   /db_xref="InterPro:IPR008693"
FT                   /db_xref="InterPro:IPR038468"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZC9"
FT                   /protein_id="ABQ72129.1"
FT                   /translation="MFGVAKRFWIPMVIVIVVAVAAVTVSRLHSVFGSHQHAPDTGNLD
FT                   PIIAFYPKHVLYEVFGPPGTVASINYLDADAQPHEVVNAAVPWSFTIVTTLTAVVANVV
FT                   ARGDGASLGCRITVNEVIREERIVNAYHAHTSCLVKSA"
FT   gene            485287..487044
FT                   /gene="fadD30"
FT                   /locus_tag="MRA_0410"
FT   CDS_pept        485287..487044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD30"
FT                   /locus_tag="MRA_0410"
FT                   /product="fatty-acid-CoA ligase FadD30"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72130"
FT                   /db_xref="GOA:A5TZD0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZD0"
FT                   /protein_id="ABQ72130.1"
FT                   /translation="MSVISTLRDRATTTPSDEAFVFMDYDTKTGDQIDRMTWSQLYSRV
FT                   TAVSAYLISYGRHADRRRTAAISAPQGLDYVAGFLGALCAGWTPVPLPEPLGSLRDKRT
FT                   GLAVLDCAADVVLTTSQAETRVRATIATHGASVTTPVIALDTLDEPSGDNCDLDSQLSD
FT                   WSSYLQYTSGSTANPRGVVLSMRNVTENVDQIIRNYFRHEGGAPRLPSSVVSWLPLYHD
FT                   MGLMVGLFIPLFVGCPVILTSPEAFIRKPARWMQLLAKHQAPFSAAPNFAFDLAVAKTS
FT                   EEDMAGLDLGHVNTIINGAEQVQPNTITKFLRRFRPYNLMPAAVKPSYGMAEAVVYLAT
FT                   TKAGSPPTSTEFDADSLARGHAELSTFETERATRLIRYHSDDKEPLLRIVDPDSNIELG
FT                   PGRIGEIWIHGKNVSTGYHNADDALNRDKFQASIREASAGTPRSPWLRTGDLGFIVGDE
FT                   FYIVGRMKDLIIQDGVNHYPDDIETTVKEFTGGRVAAFSVSDDGVEHLVIAAEVRTEHG
FT                   PDKVTIMDFSTIKRLVVSALSKLHGLHVTDFLLVPPGALPKTTSGKISRAACAKQYGAN
FT                   KLQRVATFP"
FT   gene            487041..491249
FT                   /gene="pks6"
FT                   /locus_tag="MRA_0411"
FT   CDS_pept        487041..491249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pks6"
FT                   /locus_tag="MRA_0411"
FT                   /product="membrane bound polyketide synthase Pks6"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72131"
FT                   /db_xref="GOA:A5TZD1"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZD1"
FT                   /protein_id="ABQ72131.1"
FT                   /translation="MTDGSVTADKLQKWFREYLSTHIECHPNEVSLDVPIRDLGLKSID
FT                   VLAIPGDLGDRFGFCIPDLAVWDNPSANDLIDSLLNQRSADSLRESHGHADRNTQGRGS
FT                   INEPVAVIGVGCRFPGDIDGPERLWDFLTEKKCAITAYPDRGFTNAGTFAESGGFLKDV
FT                   AGFDNRFFDIPPDEALRMDPQQRLLLEVSWEALEHAGIIPESLRLSRTGVFVGVSSTDY
FT                   VRLVSASAQQKSTIWDNTGGSSSIIANRISYFLDIQGPSIVIDTACSSSLVAVHLACRS
FT                   LSTWDCDIALVGGTNVLISPEPWGGFREAGILSQTGCCHAFDKSADGMVRGEGCGVIVL
FT                   QRLSDARLEGRRILAILTGSAVNQDGKSNGIMAPNPSAQIGVLENACKSARVDPLEIGY
FT                   VEAHGTGTSLGDRIEAHALGMVFGRKRPGSGPLMIGSIKPNIGHLEGAAGIAGLIKAVL
FT                   MVERGSLLPSGGFTEPNPAIPFTELGLRVVDELQEWPVVAGRPRRAGVSSFGFGGTNAH
FT                   VIVEEAGSVGADTVSGRADVGGSGGGVVAWVISGKTASALAAQAGRLGRYVRARPALDV
FT                   VDVGYSLVSTRSVFDHRAVVVGQTRDELLAGLAGVVAGRPEAGVVCGVGKPAGKTAFVF
FT                   AGQGSQWLGMGSELYAAYPVFAEALDAVVDELDRHLRYPLRDVIWGHDQDLLNTTEFAQ
FT                   PALFAVEVALYRLLMSWGVRPGLVLGHSVGELAAAHVAGALCLPDAAMLVAARGRLMQA
FT                   LPAGGAMFAVQAREDEVAPMLGHDVSIAAVNGPASVVISGAHDAVSAIADRLRGQGRRV
FT                   HRLAVSHAFHSALMEPMIAEFTAVAAELSVGLPTIPVISNVTGQLVADDFASADYWARH
FT                   IRAVVRFGDSVRSAHCAGASRFIEVGPGGGLTSLIEASLADAQIVSVPTLRKDRPEPVS
FT                   VMTAAAQGFVSGMGLDWASVFSGYRPKRVELPTYAFQHQKFWLAPAPSVSDPTAAGQIG
FT                   ASDGGAELLASSGFAARLAGRSADEQLAAAIEVVCEHAAAVLGRDGAAGLDAGQAFADS
FT                   GFNSLSAVELRNRLTAVTAVTLPATAIFDHPTPTELAQYLITQIDGHGSSAAAAANPAE
FT                   RIDALTDLFLQACDAGRDADGWKMVALASNTRERMSSPVRNNVSKNVALLADGISDVVV
FT                   ICIPTLTVLSDQREYRDIANAMTGRHSVYSLTLPGFDSSDALPQNADMIVETVSNAIID
FT                   VVGGSCRFVLSGYSSGGVLAYALCSHLSVKHQRNPLGVALIDTYLPSQIANPSMNEGFS
FT                   PNDTGKGLSREVIRVARMLNRLTATRLTAAATYAAIFQAWEPGRSMAPVLNIVAKDRIA
FT                   TVENLREERINRWRTAAAEAAYSVAEVPGDHFGMMSTSSEAIATEIHDWISGLVRGPHR
FT                   "
FT   gene            complement(491197..492015)
FT                   /locus_tag="MRA_0412"
FT   CDS_pept        complement(491197..492015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0412"
FT                   /product="beta lactamase like protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72132"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZD2"
FT                   /protein_id="ABQ72132.1"
FT                   /translation="MVATRGTRLAALALAPRLAGMAELVQITDKVHLARGHAVNWVLVT
FT                   DDTGVLLIDAGYPGDRAEVLASLNKLGYTPGDVRAIVLTHAHIDHLGSAIWFAREHSTP
FT                   VYCHAEEVGHAKREYRENASVFDVALRSWRPRVAVWGIHLLRRGGLTGDGIPTAQPLTA
FT                   EAAAGLPGQPMAIFTPGHTSGHCSYVVDGVLASGDALITGHPMLRHRGPQLLPAVFSHS
FT                   QQNSIRSLAALALLETNILAPGHGELWHGPIRKATDEALERAQKSNHVFR"
FT   gene            492093..493103
FT                   /gene="fgd1"
FT                   /locus_tag="MRA_0413"
FT   CDS_pept        492093..493103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fgd1"
FT                   /locus_tag="MRA_0413"
FT                   /product="putative f420-dependent glucose-6-phosphate
FT                   dehydrogenase Fgd1"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72133"
FT                   /db_xref="GOA:A5TZD3"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019944"
FT                   /db_xref="InterPro:IPR019945"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZD3"
FT                   /protein_id="ABQ72133.1"
FT                   /translation="MAELKLGYKASAEQFAPRELVELAVAAEAHGMDSATVSDHFQPWR
FT                   HQGGHAPFSLSWMTAVGERTNRLLLGTSVLTPTFRYNPAVIAQAFATMGCLYPNRVFLG
FT                   VGTGEALNEIATGYEGAWPEFKERFARLRESVGLMRQLWSGDRVDFDGDYYRLKGASIY
FT                   DVPDGGVPVYIAAGGPAVAKYAGRAGDGFICTSGKGEELYTEKLMPAVREGAAAADRSV
FT                   DGIDKMIEIKISYDPDPELALNNTRFWAPLSLTAEQKHSIDDPIEMEKAADALPIEQIA
FT                   KRWIVASDPDEAVEKVGQYVTWGLNHLVFHAPGHDQRRFLELFQSDLAPRLRRLG"
FT   gene            493096..495168
FT                   /gene="pta"
FT                   /locus_tag="MRA_0414"
FT   CDS_pept        493096..495168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pta"
FT                   /locus_tag="MRA_0414"
FT                   /product="phosphate acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72134"
FT                   /db_xref="GOA:A5TZD4"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR016475"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZD4"
FT                   /protein_id="ABQ72134.1"
FT                   /translation="MADSSAIYLAAPESQTGKSTIALGLLHRLTAMVAKVGVFRPITRL
FT                   SAERDYILELLLAHTSAGLPYERCVGVTYQQLHADRDDAIAEIVDSYHAMADECDAVVV
FT                   VGSDYTDVTSPTELSVNGRIAVNLGAPVLLTVRAKDRTPDQVASVVEVCLAELDTQRAH
FT                   TAAVVANRCELSAIPAVTDALRRFTPPSYVVPEEPLLSAPTVAELTQAVNGAVVSGDVA
FT                   LREREVMGVLAAGMTADHVLERLTDGMAVITPGDRSDVVLAVASAHAAEGFPSLSCIVL
FT                   NGGFQLHPAIAALVSGLRLRLPVIATALGTYDTASAAASARGLVTATSQRKIDTALELM
FT                   DRHVDVAGLLAQLTIPIPTVTTPQMFTYRLLQQARSDLMRIVLPEGDDDRILKSAGRLL
FT                   QRGIVDLTILGDEAKVRLRAAELGVDLDGATVIEPCASELHDQFADQYAQLRKAKGITV
FT                   EHAREIMNDATYFGTMLVHNCHADGMVSGAAHTTAHTVRPALEIIKTVPGISTVSSIFL
FT                   MCLPDRVLAYGDCAIIPNPTVEQLADIAICSARTAAQFGIEPRVAMLSYSTGDSGKGAD
FT                   VDKVRAATELVRAREPQLPVEGPIQYDAAVEPSVAATKLRDSPVAGRATVLIFPDLNTG
FT                   NNTYKAVQRSAGAIAIGPVLQGLRKPVNDLSRGALVDDIVNTVAITAIQAQGVHE"
FT   gene            495161..496318
FT                   /gene="ackA"
FT                   /locus_tag="MRA_0415"
FT   CDS_pept        495161..496318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ackA"
FT                   /locus_tag="MRA_0415"
FT                   /product="acetate/propionate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72135"
FT                   /db_xref="GOA:A5TZD5"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZD5"
FT                   /protein_id="ABQ72135.1"
FT                   /translation="MSSTVLVINSGSSSLKFQLVEPVAGMSRAAGIVERIGERSSPVAD
FT                   HAQALHRAFKMLAEDGIDLQTCGLVAVGHRVVHGGTEFHQPTLLDDTVIGKLEELSALA
FT                   PLHNPPAVLGIKVARRLLANVAHVAVFDTAFFHDLPPAAATYAIDRDVADRWHIRRYGF
FT                   HGTSHQYVSERAAAFLGRPLDGLNQIVLHLGNGASASAIARGRPVETSMGLTPLEGLVM
FT                   GTRSGDLDPGVISYLWRTARMGVEDIESMLNHRSGMLGLAGERDFRRLRLVIETGDRSA
FT                   QLAYEVFIHRLRKYLGAYLAVLGHTDVVSFTAGIGENDAAVRRDALAGLQGLGIALDQD
FT                   RNLGPGHGARRISSDDSPIAVLVVPTNEELAIARDCLRVLGGRRA"
FT   gene            complement(496372..498624)
FT                   /gene="pknG"
FT                   /locus_tag="MRA_0416"
FT   CDS_pept        complement(496372..498624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pknG"
FT                   /locus_tag="MRA_0416"
FT                   /product="serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72136"
FT                   /db_xref="GOA:A5TZD6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR031634"
FT                   /db_xref="InterPro:IPR031636"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZD6"
FT                   /protein_id="ABQ72136.1"
FT                   /translation="MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDN
FT                   FPHPTLGPDTEPQDRMATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKR
FT                   FCWNCGRPVGRSDSETKGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLG
FT                   WIYLALDRNVNGRPVVLKGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDR
FT                   HGDPVGYIVMEYVGGQSLKRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPEN
FT                   IMLTEEQLKLIDLGAVSRINSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTL
FT                   DLPTRNGRYVDGLPEDDPVLKTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREV
FT                   VAQDTGVPRPGLSTIFSPSRSTFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLV
FT                   DPTDVAASVLQATVLSQPVQTLDSLRAARHGALDADGVDFSESVELPLMEVRALLDLGD
FT                   VAKATRKLDDLAERVGWRWRLVWYRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLAL
FT                   AATAELAGNTDEHKFYQTVWSTNDGVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRH
FT                   FTTARLTSAVTLLSGRSTSEVTEEQIRDAARRVEALPPTEPRVLQIRALVLGGALDWLK
FT                   DNKASTNHILGFPFTSHGLRLGVEASLRSLARVAPTQRHRYTLVDMANKVRPTSTF"
FT   gene            complement(498624..499610)
FT                   /gene="glnH"
FT                   /locus_tag="MRA_0417"
FT   CDS_pept        complement(498624..499610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnH"
FT                   /locus_tag="MRA_0417"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72137"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZD7"
FT                   /protein_id="ABQ72137.1"
FT                   /translation="MTRRALLARAAAPLAPLALAMVLASCGHSETLGVEATPTLPLPTP
FT                   VGMEIMPPQPPLPPDSSSQDCDPTASLRPFATKAEADAAVADIRARGRLIVGLDIGSNL
FT                   FSFRDPITGEITGFDVDIAGEVARDIFGVPSHVEYRILSAAERVTALQKSQVDIVVKTM
FT                   SITCERRKLVNFSTVYLDANQRILAPRDSPITKVSDLSGKRVCVARGTTSLRRIREIAP
FT                   PPVIVSVVNWADCLVALQQREIDAVSTDDTILAGLVEEDPYLHIVGPDMADQPYGVGIN
FT                   LDNTGLVRFVNGTLERIRNDGTWNTLYRKWLTVLGPAPAPPTPRYVD"
FT   gene            complement(499610..500929)
FT                   /locus_tag="MRA_0418"
FT   CDS_pept        complement(499610..500929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0418"
FT                   /product="putative conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72138"
FT                   /db_xref="GOA:A5TZD8"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZD8"
FT                   /protein_id="ABQ72138.1"
FT                   /translation="MTVELAHPSTEPLGSRSPAEPAHPRRWFISTTPGRIMTIGIVLAA
FT                   LGVASAFATSTTIEHRQQVLTAVLDHTEPLSFAAGRLYTTLSVADAAAATAFIAQAEPG
FT                   GVRLRYEQAITDASVAVTRASSGLTDESLVQLLGRINAELAVYTGLVEIARANNRAGNP
FT                   VGSSYLSEASGLMQSTILPDAQRLYQATSARVDRETTASTQIPAPVILVVATTVVFGAF
FT                   AHRWLARRTRRRINPGLVVGALGILVMVVWVGTALTISTTASRSAKDTAAESLKTITNL
FT                   AITAQQARADETLSLIRRGDEEVRKQAFYQRIDAMQRQLNDYMARRHAVDKPDLQGADQ
FT                   LLVRWRQANDRINSDISVGNYRAATQVALGKGEDDATPAFDKLDEALTKAMGQSRTQLR
FT                   HDILNAHRGLAGAQVGGVVLSLGAAIAVALGLWPRLKEYR"
FT   gene            501023..501676
FT                   /gene="mutT3"
FT                   /locus_tag="MRA_0419"
FT   CDS_pept        501023..501676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT3"
FT                   /locus_tag="MRA_0419"
FT                   /product="putative mutator protein MutT3"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72139"
FT                   /db_xref="GOA:A5TZD9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZD9"
FT                   /protein_id="ABQ72139.1"
FT                   /translation="MPSCPPAYSEQVRGDGDGWVVSDSGVAYWGRYGAAGLLLRAPRPD
FT                   GTPAVLLQHRALWSHQGGTWGLPGGARDSHETPEQTAVRESSEEAGLSAERLEVRATVV
FT                   TAEVCGVDDTHWTYTTVVADAGELLDTVPNRESAELRWVAENEVADLPLHPGFAASWQR
FT                   LRTAPATVPLARCDERRQRLPRTIQIEAGVFLWCTPGDADQAPSPLGRRISSLL"
FT   gene            complement(501660..502328)
FT                   /gene="thiE"
FT                   /locus_tag="MRA_0420"
FT   CDS_pept        complement(501660..502328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="MRA_0420"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72140"
FT                   /db_xref="GOA:A5TZE0"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TZE0"
FT                   /protein_id="ABQ72140.1"
FT                   /translation="MHESRLASARLYLCTDARRERGDLAQFAEAALAGGVDIIQLRDKG
FT                   SPGELRFGPLQARDELAACEILADAAHRYGALFAVNDRADIARAAGADVLHLGQRDLPV
FT                   NVARQILAPDTLIGRSTHDPDQVAAAAAGDADYFCVGPCWPTPTKPGRAAPGLGLVRVA
FT                   AELGGDDKPWFAIGGINAQRLPAVLDAGARRIVVVRAITSADDPRAAAEQLRSALTAAN
FT                   "
FT   gene            502458..503480
FT                   /gene="thiO"
FT                   /locus_tag="MRA_0421"
FT   CDS_pept        502458..503480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiO"
FT                   /locus_tag="MRA_0421"
FT                   /product="putative amino acid oxidase flavoprotein ThiO"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72141"
FT                   /db_xref="GOA:A5TZE1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR012727"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZE1"
FT                   /protein_id="ABQ72141.1"
FT                   /translation="MASDLHTGSLAVIGGGVIGLSVARRAAQAGWPVRVHRSDERGASW
FT                   VAGGMLAPHSEGWPGEERLLRLGLQSLRLWREGSFLDGLGPQLVTAHESLVVAVDRADV
FT                   ADLRTVADWLSAQGHPVIWESAARDVEPLLAQGIRHGFRAPTELAVDNRALLDALCRDC
FT                   ERLGVRWSSQVSSLSDVDAHTVVIANGIDAPALWPGLPIRPVKGEVLRLRWRPGCMPLP
FT                   QRVIRARVRGRQVYLVPRSDGVVVGATQYEHGRDTAPVVSGVRDLLDDACTVLPALGEY
FT                   ELAECEAGLRPMTPDNLPLVQRLDSRTLVAAGHGRSGFLLAPWTAEQIVSELVSVGAAS
FT                   "
FT   gene            503477..503683
FT                   /gene="thiS"
FT                   /locus_tag="MRA_0422"
FT   CDS_pept        503477..503683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiS"
FT                   /locus_tag="MRA_0422"
FT                   /product="sulfur carrier protein ThiS"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72142"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZE2"
FT                   /protein_id="ABQ72142.1"
FT                   /translation="MIVVVNEQQVEVDEQTTIAALLDSLGFGDRGIAVALNFSVLPRSD
FT                   WATKICELRKPVRLEVVTAVQGG"
FT   gene            503676..504434
FT                   /gene="thiG"
FT                   /locus_tag="MRA_0423"
FT   CDS_pept        503676..504434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="MRA_0423"
FT                   /product="thiazole synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72143"
FT                   /db_xref="GOA:A5TZE3"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TZE3"
FT                   /protein_id="ABQ72143.1"
FT                   /translation="MAESKLVIGDRSFASRLIMGTGGATNLAVLEQALIASGTELTTVA
FT                   IRRVDADGGTGLLDLLNRLGITPLPNTAGSRSAAEAVLTAQLAREALNTNWVKLEVIAD
FT                   ERTLWPDAVELVRAAEQLVDDGFVVLPYTTDDPVLARRLEDTGCAAVMPLGSPIGTGLG
FT                   IANPHNIEMIVAGARVPVVLDAGIGTASDAALAMELGCDAVLLASAVTRAADPPAMAAA
FT                   MAAAVTAGYLARCAGRIPKRFWAQASSPAR"
FT   gene            504806..506308
FT                   /gene="lpqL"
FT                   /locus_tag="MRA_0424"
FT   CDS_pept        504806..506308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpqL"
FT                   /locus_tag="MRA_0424"
FT                   /product="putative lipoprotein aminopeptidase LpqL"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72144"
FT                   /db_xref="GOA:A5TZE4"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="InterPro:IPR041756"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZE4"
FT                   /protein_id="ABQ72144.1"
FT                   /translation="MVNKSRMMPAVLAVAVVVAFLTTGCIRWSTQSRPVVNGPAAAEFA
FT                   VALRNRVSTDAMMAHLSKLQDIANANDGTRAVGTPGYQASVDYVVNTLRNSGFDVQTPE
FT                   FSARVFKAEKGVVTLGGNTVEARALEYSLGTPPDGVTGPLVAAPADDSPGCSPSDYDRL
FT                   PVSGAVVLVDRGVCPFAQKEDAAAQRGAVALIIADNIDEQAMGGTLGANTDVKIPVVSV
FT                   TKSVGFQLRGQSGPTTVKLTASTQSFKARNVIAQTKTGSSANVVMAGAHLDSVPEGPGI
FT                   NDNGSGVAAVLETAVQLGNSPHVSNAVRFAFWGAEEFGLIGSRNYVESLDIDALKGIAL
FT                   YLNFDMLASPNPGYFTYDGDQSLPLDARGQPVVPEGSAGIERTFVAYLKMAGKTAQDTS
FT                   FDGRSDYDGFTLAGIPSGGLFSGAEVKKSAEQAELWGGTADEPFDPNYHQKTDTLDHID
FT                   RTALGINGAGVAYAVGLYAQDLGGPNGVPVMADRTRHLIAKP"
FT   gene            506396..507892
FT                   /gene="lpqM"
FT                   /locus_tag="MRA_0425"
FT   CDS_pept        506396..507892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpqM"
FT                   /locus_tag="MRA_0425"
FT                   /product="putative lipoprotein peptidase LpqM"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72145"
FT                   /db_xref="GOA:A5TZE5"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZE5"
FT                   /protein_id="ABQ72145.1"
FT                   /translation="MHGRGRYRPLVRCVRPRRVAASVRTPIACLAAVVVIAGCTTVVDG
FT                   RALSILNDPFRVGGLPATNGPSGARPDAPAASGTVINTNNGAIDKLSLLSVNDIEDYWM
FT                   AVYSESLKGTFRPVGKLVSYDSNDPSSPIVCHIDTYQLVNAFFSSRCNLIAWDRGVFMA
FT                   VAQEYFGDMSVNGVLAHEFGHALQVMANLVTRKDPTIVREQQADCFAGVYLWWVAEGKS
FT                   TRFTLSTADGLDHVLAGIITTRDPVMEADAENDDEHGSALDRVSAFQLGFINGTPACAA
FT                   IDEDEVERRRGDLPTALRVDASGNPETGEVGINEETLSTLMELMGKIFSPKNPPTLSYQ
FT                   PAGCPDAKPSPPAAYCPATNTIVVDLPALARMGKVASAAEHSLPQGDDTSLSIVMSRYA
FT                   LAVQHERGLPMQSPWTALRTACLTGVAHRKMAVPIDLPSGQQLVLTAGDLDEAVSGLLT
FT                   NRMVASDADGVSVPAGFTRIAAFRAGVGGDMDACYARYPG"
FT   gene            complement(507871..508281)
FT                   /locus_tag="MRA_0426"
FT   CDS_pept        complement(507871..508281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0426"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72146"
FT                   /db_xref="GOA:A5TZE6"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZE6"
FT                   /protein_id="ABQ72146.1"
FT                   /translation="MRLHDASAAAPESRMHIARHGEAVNRRQMFIGITGLLLAVIGLMA
FT                   LWFPVYLDQYDAYGIKVTCGSGWRSNLTQALYADGNDNTQALVTRCDTALLVRRAWAIP
FT                   SVALGWLLVTGFLVMWVHNDQHQGQSYPGYRA"
FT   gene            complement(508442..509071)
FT                   /locus_tag="MRA_0427"
FT   CDS_pept        complement(508442..509071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0427"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72147"
FT                   /db_xref="InterPro:IPR026555"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZE7"
FT                   /protein_id="ABQ72147.1"
FT                   /translation="MNLDQIAGVAHQPAGPPHGVVVLTHGAGGSRESTLLQQVCAEWTR
FT                   RGWLAVRYNLPYRRRRPTGPPSGSGSGDRAGIVEAIQLCRGLAEGPLIAGGHSYGGRQT
FT                   SMVVAAGQAPVDVLTLFSYPVHPPGKPERVRTEHLPGIAVPTVFTHGTADPFGTLAQVR
FT                   SAAAMVSAPTEVVEITGARHDLGSKTLDVARLAVDAALRLSAGQIA"
FT   gene            complement(509068..509865)
FT                   /gene="thiD"
FT                   /locus_tag="MRA_0428"
FT   CDS_pept        complement(509068..509865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="MRA_0428"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72148"
FT                   /db_xref="GOA:A5TZE8"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZE8"
FT                   /protein_id="ABQ72148.1"
FT                   /translation="MTPPRVLSIAGSDSGGGAGIQADMRTMALLGVHACVAVTAVTVQN
FT                   TLGVKDIHEVPNDVVAGQIEAVVTDIGVQAAKTGMLASSRIVATVAATWRRLELSVPLV
FT                   VDPVCASMHGDPLLAPSALDSLRGQLFPLATLLTPNLDEARLLVDIEVVDAESQRAAAK
FT                   ALHALGPQWVLVKGGHLRSSDGSCDLLYDGVSCYQFDAQRLPTGDDHGGGDTLATAIAA
FT                   ALAHGFTVPDAVDFGKRWVTECLRAAYPLGRGHGPVSPLFRLS"
FT   gene            complement(509892..511535)
FT                   /gene="thiC"
FT                   /locus_tag="MRA_0429"
FT   CDS_pept        complement(509892..511535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="MRA_0429"
FT                   /product="thiamine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72149"
FT                   /db_xref="GOA:A5TZE9"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TZE9"
FT                   /protein_id="ABQ72149.1"
FT                   /translation="MTITVEPSVTTGPIAGSAKAYREIEAPGSGATLQVPFRRVHLSTG
FT                   DHFDLYDTSGPYTDTDTVIDLTAGLPHRPGVVRDRGTQLQRARAGEITAEMAFIAARED
FT                   MSAELVRDEVARGRAVIPANHHHPESEPMIIGKAFAVKVNANIGNSAVTSSIAEEVDKM
FT                   VWATRWGADTIMDLSTGKNIHETREWILRNSPVPVGTVPIYQALEKVKGDPTELTWEIY
FT                   RDTVIEQCEQGVDYMTVHAGVLLRYVPLTAKRVTGIVSRGGSIMAAWCLAHHRESFLYT
FT                   NFEELCDIFARYDVTFSLGDGLRPGSIADANDAAQFAELRTLGELTKIAKAHGAQVMIE
FT                   GPGHIPMHKIVENVRLEEELCEEAPFYTLGPLATDIAPAYDHITSAIGAAIIAQAGTAM
FT                   LCYVTPKEHLGLPDRKDVKDGVIAYKIAAHAADLAKGHPRAQERDDALSTARFEFRWND
FT                   QFALSLDPDTAREFHDETLPAEPAKTAHFCSMCGPKFCSMRITQDVREYAAEHGLETEA
FT                   DIEAVLAAGMAEKSREFAEHGNRVYLPITQ"
FT   gene            complement(511687..511962)
FT                   /locus_tag="MRA_0429A"
FT   CDS_pept        complement(511687..511962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0429A"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0429A"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72150"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZF0"
FT                   /protein_id="ABQ72150.1"
FT                   /translation="MAEKNTRRATSQREAVAKIREAETIVMNLPICGQVKIPRPEHLAY
FT                   YGGLAALAALELIDWPVALVIATGHILANNHHNRVLEELGEAMEEA"
FT   gene            complement(512012..516631)
FT                   /gene="ctpH"
FT                   /locus_tag="MRA_0430"
FT   CDS_pept        complement(512012..516631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctpH"
FT                   /locus_tag="MRA_0430"
FT                   /product="metal cation transporting P-type ATPase CtpH"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72151"
FT                   /db_xref="GOA:A5TZF1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZF1"
FT                   /protein_id="ABQ72151.1"
FT                   /translation="MPVRAVATGFRATATLTGASITAATAVSATLAKTGVGTGMKVAII
FT                   PLRAGAKALSGELSRETLGRNCWRGERRAWIEVRGLRSGGDDELGRVVLNAIQAHPGVG
FT                   SASLNYPLSRVVVAIDDPDTSLRELCRIVDDAEKAERHRHPDQAADQLAQSPGSLPGDG
FT                   VLLAVRAVTVAATAAGLGLALGGRALRWPRFPLVIEAAVAAVDHQPLLRRLLEDRIGTE
FT                   ATATVLELAMAAAHTVTLSPAALSVDLTIQALKAAECRAGARAWRRHEPQLALHADEPA
FT                   DQPQSLWPRPARSTQPVQRSVARFALIQALSAVLVGAGTRDADMAATATLVATPKASRT
FT                   TPEAFAAALGQGLADQHAVLPLRPESLRRLDRVDAIVIDPRVLCTDDLRVARIRGCGAD
FT                   ELSTAWNRAQLVLTESGLRPGWHRVPGVSASGSDSAVEALFRPMHDRLASAVVAEAHRT
FT                   GADLVSVDVDALGELRPVFDDIRPLDDGASGSLDEALARAVAELRQAGRTVAVLSSVGK
FT                   QALSAADVALGVLPPPGAGAPPWYADVLLPDLGAAWRVLHAIPAARAARQRGNEISGGA
FT                   SALGALLMLPGVRGLGPGPVTTGAAAGLLSGYLLARKVVDAQAPRPAPAHEWHAMSVEQ
FT                   VRKALPSPDEQAPAKAPPSPYPARALAGGLHTAKRGAQITQAPLNALWQLTKAMRAELS
FT                   DPLTPMLALGAMASAVLGSPVDAVMVGSVLTGNSILAASQRLRAESRLNRLLAQQIPPA
FT                   RKVLAGADDQPRYIEVRAEELRPGDIIEVRTHEVVPADARVIEEVDVEVDESALTGESL
FT                   SVTKQVEPTPGVDLIERRCMLYAGTTVVSGTAVAVVTAVGPDTQERRAAELVSGDLSSV
FT                   GLQHQLSRLTNQAWPVSMTGGALVTGLGLLRRRGLRQAVASGIAVTVAAVPEGMPLVAT
FT                   LAQQASARRLSHFGALVRIPRSVEALGRVDMVCFDKTGTLSENRLRVAQVRPVAGHSRE
FT                   EVLRCAAHAAPASNGPQVHATDVAIVQAAAAAAASGTDGAEPGAAEPAAHLPFRSGRSF
FT                   SASVSGTELTVKGAPEVVLAACEGIGSSMDDAVAELAANGLRVIAVAHRQLTAQQAQSV
FT                   VDDPDEIARLCRDELSLVGFLGLSDTPRAQAAALLADLHEHDLDIRLITGDHPITAAAI
FT                   AEELGMQVSPEQVISGAEWDALSRKDQERAVAERVIFARMTPENKVQIVQTLEHSGRVC
FT                   AMVGDGSNDAAAIRAATVGIGVVAHGSDPARVAADLVLVDGRIESLLPAILEGRQLWQR
FT                   VQAAVSVLLGGNAGEVAFAIIGSAITGTSPLNTRQLLLVNMLTDALPAAALAVSKPSDP
FT                   VTPATRGPDQRELWRAVGIRGATTAAAATVAWVMAGFTGLPRRASTVALVALVAAQLGQ
FT                   TLVDSHAWLVVLTALGSLAALATLISIPVVSQLLGCTPLDPLGWAQATAAATAATVAVA
FT                   VLNRVLTGRDKSGQPNPQPPETDALSRDASPGAPPGPRRRRRATARRKAPVKAPSATRQ
FT                   TTKPKGPPAHRSSSTYPRR"
FT   gene            complement(516683..517126)
FT                   /locus_tag="MRA_0431"
FT   CDS_pept        complement(516683..517126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72152"
FT                   /db_xref="GOA:A5TZF2"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZF2"
FT                   /protein_id="ABQ72152.1"
FT                   /translation="MSVVGGTVRTVGRTVSGAATATTAAAGAVGGAAVSGIVGGVTGAA
FT                   KGIQKGLSSGSKSTAAAALAIGAIGVAGLVDWPILLAVGGGALLLRKLNRTPEVAAPPV
FT                   KAKLAPVPDKPAAAKEAPAKASKTTARKTSGRRAGTAELRSTN"
FT   gene            complement(517327..518202)
FT                   /gene="xthA"
FT                   /locus_tag="MRA_0432"
FT   CDS_pept        complement(517327..518202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xthA"
FT                   /locus_tag="MRA_0432"
FT                   /product="exodeoxyribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72153"
FT                   /db_xref="GOA:A5TZF3"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZF3"
FT                   /protein_id="ABQ72153.1"
FT                   /translation="MPDGTIDGGHPQRPASPRLRSPLLRLATWNVNSIRTRLDRVLDWL
FT                   GRADVDVLAMQETKCPDGQFPALPLFELGYDVAHVGFDQWNGVAIASRVGLDDVRVGFD
FT                   GQPSWSGKPEVAATTEARALGATCGGIRVWSLYVPNGRALDDPHYTYKLDWLAALRDTA
FT                   EGWLRDDPAAPIALMGDWNIAPTDDDVWSTEFFAGCTHVSEPERKAFNAIVDAQFTDVV
FT                   RPFTPGPGVYTYWDYTQLRFPKKQGMRIDFILGSPALAARVMDAQIVREERKGKAPSDH
FT                   APVLVDLHAG"
FT   gene            complement(518205..519113)
FT                   /locus_tag="MRA_0433"
FT   CDS_pept        complement(518205..519113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0433"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72154"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZF4"
FT                   /protein_id="ABQ72154.1"
FT                   /translation="MVSWPGLGTRVTVRYRRPAGSMPPLTDAVGRLLAVDPTVRVQTKT
FT                   GTIVEFSPVDVVALRVLTDAPVRTAAIRALEHAAAAAWPGVERTWLDGWLLRAGHGAVL
FT                   AANSAVPLDISAHTNTITEISAWYASRDLQPWLAVPDRLLPLPADLAGERREQVLVRDV
FT                   STGEPDRSVTLLDHPDDTWLRLYHQRLPLDMATPVIDGELAFGSYLGVAVARAAVTDAP
FT                   DGTRWVGLSAMRAADEQSATGSAGRQLWEALLGWGAGRGATRGYVRVHDTATSVLAESL
FT                   GFRLHHHCRYLPAQSVGWDTF"
FT   gene            complement(519113..519706)
FT                   /gene="def"
FT                   /locus_tag="MRA_0434"
FT   CDS_pept        complement(519113..519706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="MRA_0434"
FT                   /product="peptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72155"
FT                   /db_xref="GOA:A5TZF5"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TZF5"
FT                   /protein_id="ABQ72155.1"
FT                   /translation="MAVVPIRIVGDPVLHTATTPVTVAADGSLPADLAQLIATMYDTMD
FT                   AANGVGLAANQIGCSLRLFVYDCAADRAMTARRRGVVINPVLETSEIPETMPDPDTDDE
FT                   GCLSVPGESFPTGRAKWARVTGLDADGSPVSIEGTGLFARMLQHETGHLDGFLYLDRLI
FT                   GRYARNAKRAVKSHGWGVPGLSWLPGEDPDPFGH"
FT   gene            520043..520351
FT                   /locus_tag="MRA_0435"
FT   CDS_pept        520043..520351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72156"
FT                   /db_xref="InterPro:IPR021678"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZF6"
FT                   /protein_id="ABQ72156.1"
FT                   /translation="MDSAMARAIRSGDDAEVADGLTRREHDILAFERQWWKFAGVKEEA
FT                   IKELFSMSATRYYQVLNALVDRPEALAADPMLVKRLRRLRASRQKARAARRLGFEVT"
FT   gene            520383..520877
FT                   /locus_tag="MRA_0436"
FT   CDS_pept        520383..520877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0436"
FT                   /product="tuberculin related peptide"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72157"
FT                   /db_xref="GOA:A5TZF7"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZF7"
FT                   /protein_id="ABQ72157.1"
FT                   /translation="MLVTVGSMNERVPDSSGLPLRAMVMVLLFLGVVFLLLVWQALGSS
FT                   PNSEDDSSAISTMTTTTAAPTSTSVKPAAPRAEVRVYNISGTEGAAARTADRLKAAGFT
FT                   VTDVGNLSLPDVAATTVYYTEVEGERATADAVGRTLGAAVELRLPELSDQPPGVIVVVT
FT                   G"
FT   gene            520910..521632
FT                   /gene="sodC"
FT                   /locus_tag="MRA_0437"
FT   CDS_pept        520910..521632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sodC"
FT                   /locus_tag="MRA_0437"
FT                   /product="superoxide dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72158"
FT                   /db_xref="GOA:A5TZF8"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZF8"
FT                   /protein_id="ABQ72158.1"
FT                   /translation="MPKPADHRNHAAVSTSVLSALFLGAGAALLSACSSPQHASTVPGT
FT                   TPSIWTGSPAPSGLSGHDEESPGAQSLTSTLTAPDGTKVATAKFEFANGYATVTIATTG
FT                   VGKLTPGFHGLHIHQVGKCEPNSVAPTGGAPGNFLSAGGHYHVPGHTGTPASGDLASLQ
FT                   VRGDGSAMLVTTTDAFTMDDLLSGAKTAIIIHAGADNFANIPPERYVQVNGTPGPDETT
FT                   LTTGDAGKRVACGVIGSG"
FT   gene            521634..522764
FT                   /locus_tag="MRA_0438"
FT   CDS_pept        521634..522764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72159"
FT                   /db_xref="GOA:A5TZF9"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TZF9"
FT                   /protein_id="ABQ72159.1"
FT                   /translation="MPARRSAARIDFAGSPRPTLGVEWEFALVDSQTRDLSNEATAVIA
FT                   EIGENPRVHKELLRNTVEIVSGICECTAEAMQDLRDTLGPARQIVRDRGMELFCAGTHP
FT                   FARWSAQKLTDAPRYAELIKRTQWWGRQMLIWGVHVHVGIRSAHKVMPIMTSLLNYYPH
FT                   LLALSASSPWWGGEDTGYASNRAMMFQQLPTAGLPFHFQRWAEFEGFVYDQKKTGIIDH
FT                   MDEIRWDIRPSPHLGTLEVRICDGVSNLRELGALVALTHCLIVDLDRRLDAGETLPTMP
FT                   PWHVQENKWRAARYGLDAVIILDADSNERLVTDDLADVLTRLEPVAKSLNCADELAAVS
FT                   DIYRDGASYQRQLRVAQQHDGDLRAVVDALVAELVI"
FT   gene            522824..523477
FT                   /locus_tag="MRA_0439"
FT   CDS_pept        522824..523477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72160"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZG0"
FT                   /protein_id="ABQ72160.1"
FT                   /translation="MADFAPVELAMFPLESAPLPDEDLPLHIFEPRYAALVRDCMDTAD
FT                   PRFGVVLISRGREVGGGDTRCDVGTLARITECADAGSGRYMLRCRVGERIRVCDWLPDD
FT                   PYPRAKVRFWPDQPGHPVTAAQLLEVEDRVVALFERIAAARGVRLPAREVVLGYPVVDP
FT                   ADTGQRLYALACRVPMGPADRYAVLATPSAADRLVRLGDALDSVAAMVEFELST"
FT   gene            complement(523657..525843)
FT                   /locus_tag="MRA_0440"
FT   CDS_pept        complement(523657..525843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0440"
FT                   /product="putative cell division control protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72161"
FT                   /db_xref="GOA:A5TZG1"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZG1"
FT                   /protein_id="ABQ72161.1"
FT                   /translation="MTHPDPARQLTLTARLNTSAVDSRRGVVRLHPNAIAALGIREWDA
FT                   VSLTGSRTTAAVAGLAAADTAVGTVLLDDVTLSNAGLREGTEVIVSPVTVYGARSVTLS
FT                   GSTLATQSVPPVTLRQALLGKVMTVGDAVSLLPRDLGPGTSTSAASRALAAAVGISWTS
FT                   ELLTVTGVDPDGPVSVQPNSLVTWGAGVPAAMGTSTAGQVSISSPEIQIEELKGAQPQA
FT                   AKLTEWLKLALDEPHLLQTLGAGTNLGVLVSGPAGVGKATLVRAVCDGRRLVTLDGPEI
FT                   GALAAGDRVKAVASAVQAVRHEGGVLLITDADALLPAAAEPVASLILSELRTAVATAGV
FT                   VLIATSARPDQLDARLRSPELCDRELGLPLPDAATRKSLLEALLNPVPTGDLNLDEIAS
FT                   RTPGFVVADLAALVREAALRAASRASADGRPPMLHQDDLLGALTVIRPLSRSASDEVTV
FT                   GDVTLDDVGDMAAAKQALTEAVLWPLQHPDTFARLGVEPPRGVLLYGPPGCGKTFVVRA
FT                   LASTGQLSVHAVKGSELMDKWVGSSEKAVRELFRRARDSAPSLVFLDELDALAPRRGQS
FT                   FDSGVSDRVVAALLTELDGIDPLRDVVMLGATNRPDLIDPALLRPGRLERLVFVEPPDA
FT                   AARREILRTAGKSIPLSSDVDLDEVAAGLDGYSAADCVALLREAALTAMRRSIDAANVT
FT                   AADLATARETVRASLDPLQVASLRKFGTKGDLRS"
FT   gene            complement(525840..526700)
FT                   /gene="pssA"
FT                   /locus_tag="MRA_0441"
FT   CDS_pept        complement(525840..526700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pssA"
FT                   /locus_tag="MRA_0441"
FT                   /product="CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72162"
FT                   /db_xref="GOA:A5TZG2"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZG2"
FT                   /protein_id="ABQ72162.1"
FT                   /translation="MIGKPRGRRGVNLQILPSAMTVLSICAGLTAIKFALEHQPKAAMA
FT                   LIAAAAILDGLDGRVARILDAQSRMGAEIDSLADAVNFGVTPALVLYVSMLSKWPVGWV
FT                   VVLLYAVCVVLRLARYNALQDDGTQPAYAHEFFVGMPAPAGAVSMIGLLALKMQFGEGW
FT                   WTSGWFLSFWVTGTSILLVSGIPMKKMHAVSVPPNYAAALLAVLAICAAAAVLAPYLLI
FT                   WVIIIAYMCHIPFAVRSQRWLAQHPEVWDDKPKQRRAVRRASRRAHPYRPSMARLGLRK
FT                   PGRRL"
FT   gene            complement(526697..527392)
FT                   /gene="psd"
FT                   /locus_tag="MRA_0442"
FT   CDS_pept        complement(526697..527392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psd"
FT                   /locus_tag="MRA_0442"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72163"
FT                   /db_xref="GOA:A5TZG3"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TZG3"
FT                   /protein_id="ABQ72163.1"
FT                   /translation="MARRPRPDGPQHLLALVRSAVPPVHPAGRPFIAAGLAIAAVGHRY
FT                   RWLRGTGLLAAAACAGFFRHPQRVPPTRPAAIVAPADGVICAIDSAAPPAELSMGDTPL
FT                   PRVSIFLSILDAHVQRAPVSGEVIAVQHRPGRFGSADLPEASDDNERTSVRIRMPNGAE
FT                   VVAVQIAGLVARRIVCDAHVGDKLAIGDTYGLIRFGSRLDTYLPAGAEPIVNVGQRAVA
FT                   GETVLAECR"
FT   gene            complement(527453..528670)
FT                   /gene="moeA2"
FT                   /locus_tag="MRA_0443"
FT   CDS_pept        complement(527453..528670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moeA2"
FT                   /locus_tag="MRA_0443"
FT                   /product="molybdopterin biosynthesis protein MoeA2"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72164"
FT                   /db_xref="GOA:A5TZG4"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZG4"
FT                   /protein_id="ABQ72164.1"
FT                   /translation="MRSVQEHQRVVAEMMRACRPITVPLTQAQGLVLGGDVVAPLSLPV
FT                   FDNSAMDGYAVRAEDTSGATPQNPVMLPVAEDIPAGRADMLTLQPVTAHRIMTGAPVPT
FT                   GATAIVPVEATDGGVDSVAIRQQATPGKHIRRSGEDVAAGTTVLHNGQIVTPAVLGLAA
FT                   ALGLAELPVLPRQRVLVISTGSELASPGTPLQPGQIYESNSIMLAAAVRDAGAAVVATA
FT                   TAGDDVAQFGAILDRYAVDADLIITSGGVSAGAYEVVKDAFGSADYRGGDHGVEFVKVA
FT                   MQPGMPQGVGRVAGTPIVTLPGNPVSALVSFEVFIRPPLRMAMGLPDPYRPHRSAVLTA
FT                   SLTSPRGKRQFRRAILDHQAGTVISYGPPASHHLRWLASANGLLDIPEDVVEVAAGTQL
FT                   QVWDLT"
FT   gene            complement(528689..529624)
FT                   /locus_tag="MRA_0444"
FT   CDS_pept        complement(528689..529624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0444"
FT                   /product="putative dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72165"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZG5"
FT                   /protein_id="ABQ72165.1"
FT                   /translation="MTANDNKTRKWSAADVPDQSGRVVVVTGANTGIGYHTAAVFADRG
FT                   AHVVLAVRNLEKGNAARARIMAARPGAHVTLQQLDLCSLDSVRAAADALRTAYPRIDVL
FT                   INNAGVMWTPKQVTKDGFELQFGTNHLGHFALTGLVLDHMLPVPGSRVVTVSSQGHRIH
FT                   AAIHFDDLQWERRYNRVAAYGQAKLANLLFTYELQRRLGEAGKSTIAVAAHPGGSNTEL
FT                   TRNLPRLIRPVATVLGPLLFQSPEMGALPTLRAATDPTTQGGQYYGPDGFGEQRGHPKV
FT                   VQSSAQSHDKDLQRRLWTVSEELTGVSFGV"
FT   gene            529918..531540
FT                   /gene="groEL1"
FT                   /locus_tag="MRA_0445"
FT   CDS_pept        529918..531540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL1"
FT                   /locus_tag="MRA_0445"
FT                   /product="chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72166"
FT                   /db_xref="GOA:A5TZG6"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TZG6"
FT                   /protein_id="ABQ72166.1"
FT                   /translation="MAKTIAYDEEARRGLERGLNALADAVKVTLGPKGRNVVLEKKWGA
FT                   PTITNDGVSIAKEIELEDPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVREGLR
FT                   NVAAGANPLGLKRGIEKAVEKVTETLLKGAKEVETKEQIAATAAISAGDQSIGDLIAEA
FT                   MDKVGNEGVITVEESNTFGLQLELTEGMRFDKGYISGYFVTDPERQEAVLEDPYILLVS
FT                   SKVSTVKDLLPLLEKVIGAGKPLLIIAEDVEGEALSTLVVNKIRGTFKSVAVKAPGFGD
FT                   RRKAMLQDMAILTGGQVISEEVGLTLENADLSLLGKARKVVVTKDETTIVEGAGDTDAI
FT                   AGRVAQIRQEIENSDSDYDREKLQERLAKLAGGVAVIKAGAATEVELKERKHRIEDAVR
FT                   NAKAAVEEGIVAGGGVTLLQAAPTLDELKLEGDEATGANIVKVALEAPLKQIAFNSGLE
FT                   PGVVAEKVRNLPAGHGLNAQTGVYEDLLAAGVADPVKVTRSALQNAASIAGLFLTTEAV
FT                   VADKPEKEKASVPGGGDMGGMDF"
FT   gene            complement(531606..532034)
FT                   /locus_tag="MRA_0446"
FT   CDS_pept        complement(531606..532034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0446"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72167"
FT                   /db_xref="InterPro:IPR020145"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZG7"
FT                   /protein_id="ABQ72167.1"
FT                   /translation="MGAKKVDLKRLAAALPDYPFAYLITVDDGHRVHTVAVEPVLRELP
FT                   DGPDGPRAVVDVGLIGGRTRQNLAHRSEVTLLWPPSDPSGYSLIVDGRAQASDAGPDDD
FT                   TARCGVVPIRALLHRDAAPDSPTAAKGCLHDCVVFSVP"
FT   gene            complement(532061..533524)
FT                   /locus_tag="MRA_0447"
FT   CDS_pept        complement(532061..533524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0447"
FT                   /product="PPE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72168"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR002989"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZG8"
FT                   /protein_id="ABQ72168.1"
FT                   /translation="MTSPHFAWLPPEINSALMFAGPGSGPLIAAATAWGELAEELLASI
FT                   ASLGSVTSELTSGAWLGPSAAAMMAVATQYLAWLSTAAAQAEQAAAQAMAIATAFEAAL
FT                   AATVQPAVVAANRGLMQLLAATNWFGQNAPALMDVEAAYEQMWALDVAAMAGYHFDASA
FT                   AVAQLAPWQQVLRNLGIDIGKNGQINLGFGNTGSGNIGNNNIGNNNIGSGNTGTGNIGS
FT                   GNTGSGNLGLGNLGDGNIGFGNTGSGNIGFGITGDHQMGFGGFNSGSGNIGFGNSGTGN
FT                   VGLFNSGSGNIGIGNSGSLNSGIGTSGTINAGLGSAGSLNTSFWNAGMQNAALGSAAGS
FT                   EAALVSSAGYATGGMSTAALSSGILASALGSTGGLQHGLANVLNSGLTNTPVAAPASAP
FT                   VGGLDSGNPNPGSGSAAAGSGANPGLRSPGTSYPSFVNSGSNDSGLRNTAVREPSTPGS
FT                   GIPKSNFYPSPDRESAYASPRIGQPVGSE"
FT   gene            533706..534221
FT                   /locus_tag="MRA_0448"
FT   CDS_pept        533706..534221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72169"
FT                   /db_xref="InterPro:IPR007061"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZG9"
FT                   /protein_id="ABQ72169.1"
FT                   /translation="MASTDAAAQELLRDAFTRLIEHVDELTDGLTDQLACYRPTPSANS
FT                   IAWLLWHSARVQDIQVAHVAGVEEVWTRDGWVDRFGLDLPRHDTGYGHRPEDVAKVRAP
FT                   ADLLSGYYHAVHKLTLEYIAGMTADELSRVVDTSWNPPVTVSARLVSIVDDCAQHLGQA
FT                   AYLRGIAR"
FT   gene            complement(534401..535099)
FT                   /locus_tag="MRA_0449"
FT   CDS_pept        complement(534401..535099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72170"
FT                   /db_xref="GOA:A5TZH0"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TZH0"
FT                   /protein_id="ABQ72170.1"
FT                   /translation="MTEHTDFELLELATPYALNAVSDDERADIDRRVAAAPSPVAAAFN
FT                   DEVRAVRETMAVVSAATTAEPPAHLRTAILDATKPEVRRQSRWRTAAFASAAAIAVGLG
FT                   AFGLGVLTRPSPPPTVAEQVLTAPDVRTVSRPLGAGTATVVFSRDRNTGLLVMNNVAPP
FT                   SRGTVYQMWLLGGAKGPRSAGTMGTAAVTPSTTATLTDLGASTALAFTVEPGTGSPQPT
FT                   GTILAELPLG"
FT   gene            complement(535143..535706)
FT                   /gene="sigK"
FT                   /locus_tag="MRA_0450"
FT   CDS_pept        complement(535143..535706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigK"
FT                   /locus_tag="MRA_0450"
FT                   /product="RNA polymerase sigma-70 factor"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72171"
FT                   /db_xref="GOA:A5TZH1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TZH1"
FT                   /protein_id="ABQ72171.1"
FT                   /translation="MTGPPRLSSDLDALLRRVAGHDQAAFAEFYDHTKSRVYGLVMRVL
FT                   RDTGYSEETTQEIYLEVWRNASEFDSAKGSALAWLLTMAHRRAVDRVRCEQAGNQREVR
FT                   YGAANVDPASDVVADLAIAGDERRRVTECLKALTDTQRQCIELAYYGGLTYVEVSRRLA
FT                   ANLSTIKSRMRDALRSLRNCLDVS"
FT   gene            complement(535755..536525)
FT                   /locus_tag="MRA_0451"
FT   CDS_pept        complement(535755..536525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72172"
FT                   /db_xref="GOA:A5TZH2"
FT                   /db_xref="InterPro:IPR001104"
FT                   /db_xref="InterPro:IPR010721"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZH2"
FT                   /protein_id="ABQ72172.1"
FT                   /translation="MVTSVSALAVAVVHSVAFAIGRRIGRYNVVDVVWGLGFVAVAVAA
FT                   ATLGHGDPVRRWLLLALVSTWGLRLSWHMYRKTAGQGEDPRYADLLRGATPVQALRKVF
FT                   GLQGLLTLFVSFPLQLSAVTGPTPKPLLAVGGVGLAVWLVGITFEAVGDWQLWVFKSDP
FT                   ANRGVIMDRGLWAWTRHPNYFGDACVWWGLWLITINDWAPLATVGSPLLMTYLLVDVSG
FT                   ARLTERYLKGRPGFAEYQRRTAYFVPRPPRSARR"
FT   gene            complement(536534..537817)
FT                   /gene="ufaA1"
FT                   /locus_tag="MRA_0452"
FT   CDS_pept        complement(536534..537817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ufaA1"
FT                   /locus_tag="MRA_0452"
FT                   /product="cyclopropane-fatty-acyl-phospholipid synthase
FT                   UfaA1"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72173"
FT                   /db_xref="GOA:A5TZH3"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZH3"
FT                   /protein_id="ABQ72173.1"
FT                   /translation="MTVETSQTPSAAIDSDRWPAVAKVPRGPLAAASAAIANRLLRRTA
FT                   THLPLRLVYSDGTATGAADPRAPSLFIHRPDALARRIGRHGLIGFGESYMAGEWSSKEL
FT                   TRVLTVLAGSVDELVPRSLHWLRPITPTFRPSWPDHSRDQARRNIAVHYDLSNDLFAAF
FT                   LDETMTYSCAMFTDLLAQPTPAWTELAAAQRRKIDRLLDVAGVQQGSHVLEIGTGWGEL
FT                   CIRAAARGAHIRSVTLSVEQQRLARQRVAAAGFGHRVEIDLCDYRDVDGQYDSVVSVEM
FT                   IEAVGYRSWPRYFAALEQLVRPGGPVAIQAITMPHHRMLATRHTQTWIQKYIFPGGLLP
FT                   STQAIIDITGQHTGLRIVDAASLRPHYAETLRLWRERFMQRRDGLAHLGFDEVFARMWE
FT                   LYLAYSEAGFRSGYLDVYQWTLIREGPP"
FT   gene            complement(537814..538479)
FT                   /locus_tag="MRA_0453"
FT   CDS_pept        complement(537814..538479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72174"
FT                   /db_xref="InterPro:IPR010775"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZH4"
FT                   /protein_id="ABQ72174.1"
FT                   /translation="MHHSFAYRSYSWYVDVDNLPQLPWWLRPFARFHADDHFADPFSCP
FT                   PHSSLRDRLDAFFAARGLAVPDGRITALLQARVLGYVFNPLSIFWCHDRDGQLRHVIAE
FT                   VHNTYGGRHAYLLPPADLPVVTAKNFYVSPFHQLAGYYLIRAPRPDRELDVTVTLHRDR
FT                   RQVCPEFTATLRGQRRPATTRQIAMMQIISPLAPMVVAARIRIQGIRLWLRRVPVVPR"
FT   gene            complement(538539..539858)
FT                   /locus_tag="MRA_0454"
FT   CDS_pept        complement(538539..539858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0454"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72175"
FT                   /db_xref="GOA:A5TZH5"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZH5"
FT                   /protein_id="ABQ72175.1"
FT                   /translation="MQQSLRRSVAVVGSGVAGLTAAYILSGRDRVTLYEADGRLGGHAH
FT                   THYLDNGGGPRGTDVVGVDSAFLVHNDRTYPTLCRLFAELGVATQESEMSMSVRADDIG
FT                   LEYAGALGARGLFACRQSLRPRYLCMLAEILRFHRAAARLLREETDNAEDKPETLEAFL
FT                   SRHHFSQYFVDYFITPLVAAVWSCGGADALRYPARYLFVFLDHHGMLSVFGSPTWRTVT
FT                   GGSANYVQAIAAQLDEVSTRTPVHSLRRLPDGVLVGAGDGPSRRFDAAVVAVHPDQALL
FT                   LLDEPTPAERAVLGAIAYSTNSAQLHTDESVLPRHHRARASWNYLVTPGQHQVVVSYDI
FT                   SRLMRLDGGRRYLVTLGGHDRVDPSSVIAEMTYSHPLYTPESVAAQRLLPTLGDNRVVF
FT                   AGAYHGWGFHEDGAASGLRAARRLGADWPAAIPQEAMVAC"
FT   gene            complement(539898..542801)
FT                   /gene="mmpL4"
FT                   /locus_tag="MRA_0455"
FT   CDS_pept        complement(539898..542801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmpL4"
FT                   /locus_tag="MRA_0455"
FT                   /product="transmembrane transport protein MmpL4"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72176"
FT                   /db_xref="GOA:A5TZH6"
FT                   /db_xref="InterPro:IPR004707"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZH6"
FT                   /protein_id="ABQ72176.1"
FT                   /translation="MSTKFANDSNTNARPEKPFIARMIHAFAVPIILGWLAVCVVVTVF
FT                   VPSLEAVGQERSVSLSPKDAPSFEAMGRIGMVFKEGDSDSFAMVIIEGNQPLGDAAHKY
FT                   YDGLVAQLRADKKHVQSVQDLWGDPLTAAGVQSNDGKAAYVQLSLAGNQGTPLANESVE
FT                   AVRSIVESTPAPPGIKAYVTGPSALAADMHHSGDRSMARITMVTVAVIFIMLLLVYRSI
FT                   ITVVLLLITVGVELTAARGVVAVLGHSGAIGLTTFAVSLLTSLAIAAGTDYGIFIIGRY
FT                   QEARQAGEDKEAAYYTMYRGTAHVILGSGLTIAGATFCLSFARMPYFQTLGIPCAVGML
FT                   VAVAVALTLGPAVLHVGSRFGLFDPKRLLKVRGWRRVGTVVVRWPLPVLVATCAIALVG
FT                   LLALPGYKTSYNDRDYLPDFIPANQGYAAADRHFSQARMKPEILMIESDHDMRNPADFL
FT                   VLDKLAKGIFRVPGISRVQAITRPEGTTMDHTSIPFQISMQNAGQLQTIKYQRDRANDM
FT                   LKQADEMATTIAVLTRMHSLMAEMASTTHRMVGDTEEMKEITEELRDHVADFDDFWRPI
FT                   RSYFYWEKHCYGIPICWSFRSIFDALDGIDKLSEQIGVLLGDLREMDRLMPQMVAQIPP
FT                   QIEAMENMRTMILTMHSTMTGIFDQMLEMSDNATAMGKAFDAAKNDDSFYLPPEVFKNK
FT                   DFQRAMKSFLSSDGHAARFIILHRGDPQSPEGIKSIDAIRTAAEESLKGTPLEDAKIYL
FT                   AGTAAVFHDISEGAQWDLLIAAISSLCLIFIIMLIITRAFIAAAVIVGTVALSLGASFG
FT                   LSVLLWQHILAIHLHWLVLAMSVIVLLAVGSDYNLLLVSRFKQEIGAGLKTGIIRSMGG
FT                   TGKVVTNAGLVFAVTMASMAVSDLRVIGQVGTTIGLGLLFDTLIVRSFMTPSIAALLGR
FT                   WFWWPLRVRSRPARTPTVPSETQPAGRPLAMSSDRLG"
FT   gene            complement(542798..543220)
FT                   /gene="mmpS4"
FT                   /locus_tag="MRA_0456"
FT   CDS_pept        complement(542798..543220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmpS4"
FT                   /locus_tag="MRA_0456"
FT                   /product="putative conserved membrane protein MmpS4"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72177"
FT                   /db_xref="GOA:A5TZH7"
FT                   /db_xref="InterPro:IPR008693"
FT                   /db_xref="InterPro:IPR038468"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZH7"
FT                   /protein_id="ABQ72177.1"
FT                   /translation="MLMRTWIPLVILVVVIVGGFTVHRIRGFFGSENRPSYSDTNLENS
FT                   KPFNPKHLTYEIFGPPGTVADISYFDVNSEPQRVDGAVLPWSLHITTNDAAVMGNIVAQ
FT                   GNSDSIGCRITVDGKVRAERVSNEVNAYTYCLVKSA"
FT   gene            543452..544162
FT                   /locus_tag="MRA_0457"
FT   CDS_pept        543452..544162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0457"
FT                   /product="putative transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72178"
FT                   /db_xref="GOA:A5TZH8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041483"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZH8"
FT                   /protein_id="ABQ72178.1"
FT                   /translation="MRYPLAVAQLGFQRARTEENKRQRAAALVEAARSLALETGVASVT
FT                   LTAVAGRAGIHYSAVRRYFTSHKEVLLHLAAEGWARWSGTVCEQLGEPGPMSAPRVAEA
FT                   LANGLAADPLFCDLLANLHLHLEQEVDVDRVIEVKRTSIAAVIALVDAIESALPALGRS
FT                   GAFDILLAAYSLAATLWQIANPPERLTDAYAEEPELLPPEWNLDFAAALTRLLTATLLG
FT                   LLAGSPCECRSPTR"
FT   gene            544505..546040
FT                   /locus_tag="MRA_0458"
FT   CDS_pept        544505..546040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0458"
FT                   /product="PPE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72179"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZH9"
FT                   /protein_id="ABQ72179.1"
FT                   /translation="MASPPEVHSALLSSGPGPGPVLAAATGWSSLGREYAAVAEELGAL
FT                   LAAVQAGVWQGPSAESFAAACLPYLSWLTQASADCAAAAARLEAVTAAYAAALVAMPTL
FT                   AELAANHATHGAMVATNFFGINTIPIAVNEADYVRMWLQAATTMATYQAVADSAVRSIP
FT                   DSVPPPRILKSNAQSQHSSSNNSGGADPVDDFIAEILKIITGGRVIWDPEAGTVNGLPY
FT                   DAYTNPGTLMWWIARSLELLQDFQEFAKLLFTNPVKAFQFLVDLILFDWPTHMLQLATW
FT                   LAENPQLLVAALTPAISGLGAVSGLAGLTGLVPQPPVVPAPAPDAVVPTVLPLAGTATP
FT                   TTAPASAPAAGAAPGPPAGTATATSASVPTSAGGFPPYLVGSGPGIDFDAGTPAGSRRA
FT                   QPAADNVTAVAAAQVSARHQARRRRRAAAKERGNADEFVDMDSGPAIPPSGERDAWASN
FT                   SGVGGLGFAGTASNETVAAPAGLTTLADDEFQCGPRMPMLPGAWDLGTWDRGD"
FT   gene            complement(546046..546600)
FT                   /locus_tag="MRA_0459"
FT   CDS_pept        complement(546046..546600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0459"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72180"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZI0"
FT                   /protein_id="ABQ72180.1"
FT                   /translation="MGPSAAVRRIDSGDQLRNSHIHHPRNSTTYRVPLGLRPCPTSLLV
FT                   AQPPPATRRDTMPLRGRGKHRGPHGLDTGARRMSQAPGNEIPHTLAALDWGGITCQSGA
FT                   GCTNRASYVVHLHAVDECNDPDLDPFGNTVEILCIACLWHVEAKVLLQVGRLTRSPGAF
FT                   CLTCGAPVREPTDIMRDVAAL"
FT   gene            complement(546685..547131)
FT                   /locus_tag="MRA_0460"
FT   CDS_pept        complement(546685..547131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72181"
FT                   /db_xref="InterPro:IPR031702"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZI1"
FT                   /protein_id="ABQ72181.1"
FT                   /translation="MSRLSSILRAGAAFLVLGIAAATFPQSAAADSTEDFPIPRRMIAT
FT                   TCDAEQYLAAVRDTSPVYYQRYMIDFNNHANLQQATINKAHWFFSLSPAERRDYSEHFY
FT                   NGDPLTFAWVNHMKIFFNNKGVVAKGTEVCNGYPAGDMSVWNWA"
FT   gene            complement(547199..548113)
FT                   /gene="echA2"
FT                   /locus_tag="MRA_0461"
FT   CDS_pept        complement(547199..548113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="echA2"
FT                   /locus_tag="MRA_0461"
FT                   /product="enoyl-CoA hydratase EchA2"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72182"
FT                   /db_xref="GOA:A5TZI2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZI2"
FT                   /protein_id="ABQ72182.1"
FT                   /translation="MPTPDFQTLLYTTAGPVATITLNRPEQLNTIVPPMPDEIEAAIGL
FT                   AERDQDIKVIVLRGAGRAFSGGYDFGGGFQHWGDAMMTDGRWDPGKDFAMVTARETGPT
FT                   QKFMAIWRASKPVIAQVHGWCVGGASDYALCADIVIASEDAVIGTPYSRMWGAYLTGMW
FT                   LYRLSLAKVKWHSLTGRPLTGVQAAEAELINEAVPFERLEARVAEIATELARIPLSQLQ
FT                   AQKLIVNQAYENMGLASTQLLGGILDGLMRNTPDALEFIRTAQTQGVRAAVERRDGPFG
FT                   DYSQAPPELRPDPTHVITPDGSM"
FT   gene            complement(548386..548667)
FT                   /locus_tag="MRA_0462"
FT   CDS_pept        complement(548386..548667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72183"
FT                   /db_xref="GOA:A5TZI3"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZI3"
FT                   /protein_id="ABQ72183.1"
FT                   /translation="MLRGEIWQVDLDPARGSAANMRRPAVIVSNDRANAAAIRLDRGVV
FT                   PVVPVTSNTEKVPIPGVVAGSERWPGRRFEGAGPAGWIRRCATSPLPS"
FT   gene            complement(548896..550917)
FT                   /locus_tag="MRA_0463"
FT   CDS_pept        complement(548896..550917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0463"
FT                   /product="prolyl oligopeptidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72184"
FT                   /db_xref="GOA:A5TZI4"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZI4"
FT                   /protein_id="ABQ72184.1"
FT                   /translation="MTFEPAPDGADPYLWLEDVTGAEALDWVRARNKPTTAAFCDAEFE
FT                   RMRVEALEVLDTDARIPYVNRRGNYLYNFWRDAANPRGLWRRTTLDSYRTDSPGWDVLI
FT                   DVDELGRADDQKWVWGGAGVIEPDYTRALIGLSPGGSDASIVREFDMLTREFVEDGFQL
FT                   PPAKSQITWEDPDTVLLGTDFGGDSLTTSGYPRVIKRWRRGKPLADAETIFEGAGTDVR
FT                   VNASADRTPGFERTLLGRALDFWNEEVYELRGSELIRIEAPTDASVSIHRDWLLIELRT
FT                   DWTVATTRYTAGSLLAAEYDEFLAGSAELQVVFEPDEHTALYQYAWTRDRLLIVTLADV
FT                   ASRVEIATPGSWRREPLSGIPAATNTVIVSADSHGDEFFLDSSGFDTPSRLMRGTDDGR
FT                   LAEIKSAPAFFDAENMAVTQYFATSDDGTSIPYFVVRRTDADNPGPTLLNGYGGFETSR
FT                   TPTYDGVLGRLWLARGGTYALANIRGGGEYGPGWHTQAMREGRDKVAQDFAAVATDLVT
FT                   RGITTAEQLGARGGSNGGLLMGIMLTGYPEKFGALVCDVPLLDMKRYHLLLAGASWMAE
FT                   YGDPDNPDDWKFISEYSPYQNISANRKYPPVLMTTSTRDDRVHPGHARKMTAALQAAGH
FT                   PVWYYENIEGGHAGAADNAQIAFKSALSFAFLWRMLAG"
FT   gene            550985..552508
FT                   /locus_tag="MRA_0464"
FT   CDS_pept        550985..552508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0464"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72185"
FT                   /db_xref="GOA:A5TZI5"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZI5"
FT                   /protein_id="ABQ72185.1"
FT                   /translation="MTVFSRPGSAGALMSYESRYQNFIGGQWVAPVHGRYFENPTPVTG
FT                   QPFCEVPRSDAADIDKALDAAHAAAPGWGKTAPAERAAILNMIADRIDKNAAALAVAEV
FT                   WDNGKPVREALAADIPLAVDHFRYFAAAIRAQEGALSQIDEDTVAYHFHEPLGVVGQII
FT                   PWNFPILMAAWKLAPALAAGNTAVLKPAEQTPASVLYLMSLIGDLLPPGVVNVVNGFGA
FT                   EAGKPLASSDRIAKVAFTGETTTGRLIMQYASHNLIPVTLELGGKSPNIFFADVLAAHD
FT                   DFCDKALEGFTMFALNQGEVCTCPSRSLIQADIYDEFLELAAIRTKAVRQGDPLDTETM
FT                   LGSQASNDQLEKVLSYIEIGKQEGAVIIAGGERAELGGDLSGGYYMQPTIFTGTNNMRI
FT                   FKEEIFGPVVAVTSFTDYDDAIGIANDTLYGLGAGVWSRDGNTAYRAGRDIQAGRVWVN
FT                   CYHLYPAHAAFGGYKQSGIGREGHQMMLQHYQHTKNLLVSYSDKALGFF"
FT   gene            552508..552999
FT                   /locus_tag="MRA_0465"
FT   CDS_pept        552508..552999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72186"
FT                   /db_xref="InterPro:IPR008497"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZI6"
FT                   /protein_id="ABQ72186.1"
FT                   /translation="MNAPAGVLITAEAAALLAGLQDRHGPVMFHQSGGCCDGSAPMCYP
FT                   RADFLVGDRDILLGVLDVGEDGVPVWISGPQYQAWKHTQLIIDVVPGRGGGFSLEAPEG
FT                   VRFLSRGRVFSDAEKAMREAAPVITGAAYECGERPLVRGLVVDLDDPDATPGVCRASRR
FT                   "
FT   gene            553059..553298
FT                   /locus_tag="MRA_0466"
FT   CDS_pept        553059..553298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72187"
FT                   /db_xref="GOA:A5TZI7"
FT                   /db_xref="InterPro:IPR031614"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZI7"
FT                   /protein_id="ABQ72187.1"
FT                   /translation="MLVGNAIGLLAGVACSVLVHARIRPDIVIAMVVGIPSAIGLLVIL
FT                   FSGRRWVTMLGAFILALAPGWFGVLVAIQVASSG"
FT   gene            553336..553860
FT                   /locus_tag="MRA_0467"
FT   CDS_pept        553336..553860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0467"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72188"
FT                   /db_xref="GOA:A5TZI8"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZI8"
FT                   /protein_id="ABQ72188.1"
FT                   /translation="MPDFDTGAHSQRFLSLAGQQDRAGKSWPGSTPKPQEDPVGVAPSA
FT                   SVEVLGSEPAATLAHSVTVPGRYTYLKWWKFVLVVLGVWIGAGEVGLSLFYWWYHTLDK
FT                   TAAVFVVLVYVVACTVGGLILALVPGRPLITALSLGVMSGPFASVAAAAPLYGYYYCER
FT                   MSHCLVGVIPY"
FT   gene            553924..555318
FT                   /gene="lpd"
FT                   /locus_tag="MRA_0468"
FT   CDS_pept        553924..555318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpd"
FT                   /locus_tag="MRA_0468"
FT                   /product="dihydrolipoamide dehydrogenase Lpd"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72189"
FT                   /db_xref="GOA:A5TZI9"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZI9"
FT                   /protein_id="ABQ72189.1"
FT                   /translation="MTHYDVVVLGAGPGGYVAAIRAAQLGLSTAIVEPKYWGGVCLNVG
FT                   CIPSKALLRNAELVHIFTKDAKAFGISGEVTFDYGIAYDRSRKVAEGRVAGVHFLMKKN
FT                   KITEIHGYGTFADANTLLVDLNDGGTESVTFDNAIIATGSSTRLVPGTSLSANVVTYEE
FT                   QILSRELPKSIIIAGAGAIGMEFGYVLKNYGVDVTIVEFLPRALPNEDADVSKEIEKQF
FT                   KKLGVTILTATKVESIADGGSQVTVTVTKDGVAQELKAEKVLQAIGFAPNVEGYGLDKA
FT                   GVALTDRKAIGVDDYMRTNVGHIYAIGDVNGLLQLAHVAEAQGVVAAETIAGAETLTLG
FT                   DHRMLPRATFCQPNVASFGLTEQQARNEGYDVVVAKFPFTANAKAHGVGDPSGFVKLVA
FT                   DAKHGELLGGHLVGHDVAELLPELTLAQRWDLTASELARNVHTHPTMSEALQECFHGLV
FT                   GHMINF"
FT   gene            555326..555619
FT                   /locus_tag="MRA_0469"
FT   CDS_pept        555326..555619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0469"
FT                   /product="putative conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72190"
FT                   /db_xref="GOA:A5TZJ0"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZJ0"
FT                   /protein_id="ABQ72190.1"
FT                   /translation="MTRRASTDTPQIIMGAIGGVVTGYILWLAAISVGDGLTTVSQWSR
FT                   VVLLLSVLVAVCGAAGGLRLRSRGKLAWSAFAFSLPIPPVVLTVAVLADIYL"
FT   gene            complement(555623..556195)
FT                   /locus_tag="MRA_0470"
FT   CDS_pept        complement(555623..556195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72191"
FT                   /db_xref="GOA:A5TZJ1"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZJ1"
FT                   /protein_id="ABQ72191.1"
FT                   /translation="MTGQNGQVARISPGKFRQLGPVNWLVAKLAARAVGAPQMHLFTTL
FT                   GYRQYLFWTFAIYTGRLLHGRLPGVDTELVILRVAHLRSCEYELQHHRRMARRRGLDAN
FT                   TQATIFAWPDVPDGDGPRKVLSARQQALLQATDELIKDRTITAGTWERLATHLDPRLLI
FT                   EFCLLATQYDAIAATITALAIPPDNPQ"
FT   gene            complement(556192..557616)
FT                   /locus_tag="MRA_0471"
FT   CDS_pept        complement(556192..557616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0471"
FT                   /product="putative transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72192"
FT                   /db_xref="GOA:A5TZJ2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR018653"
FT                   /db_xref="InterPro:IPR026281"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZJ2"
FT                   /protein_id="ABQ72192.1"
FT                   /translation="MSKTYVGSRVRQLRNERGFSQAALAQMLEISPSYLNQIEHDVRPL
FT                   TVAVLLRITEVFGVDATFFASQDDTRLVAELREVTLDRDLDIAIDPHEVAEMVSAHPGL
FT                   ACAVVNLHRRYRITTAQLAAATEERFSDGSGRGSITMPHEEVRDYFYQRQNYLHALDTA
FT                   AEDLTAQMRMHHGDLARELTRRLTEVHGVRINKRIDLGDTVLHRYDPATNTLEISSHLS
FT                   PGQQVFKMAAELAYLEFGDLIDAMVTDGKFTSAESRTLARLGLANYFAAATVLPYRQFH
FT                   DVAENFRYDVERLSAFYSVSYETIAHRLSTLQRPSMRGVPFTFVRVDRAGNMSKRQSAT
FT                   GFHFSSSGGTCPLWNVYETFANPGKILVQIAQMPDGRNYLWVARTVELRAARYGQPGKT
FT                   FAIGLGCELRHAHRLVYSEGLDLSGDPNTAATPIGAGCRVCERDNCPQRAFPALGRALD
FT                   LDEHRSTVSPYLVKQL"
FT   gene            557768..558562
FT                   /locus_tag="MRA_0472"
FT   CDS_pept        557768..558562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72193"
FT                   /db_xref="GOA:A5TZJ3"
FT                   /db_xref="InterPro:IPR002864"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZJ3"
FT                   /protein_id="ABQ72193.1"
FT                   /translation="MSLDKKLMPVPDGHPDVFDREWPLRVGDIDRAGRLRLDAACRHIQ
FT                   DIGQDQLREMGFEETHPLWIVRRTMVDLIRPIEFGDMLRCRRWCSGTSNRWCEMRVRVD
FT                   GRKGGLIESEAFWIHVNRETEMPARIADDFLAGLHRTTSVDRLRWKGYLKPGSRDDASE
FT                   IHEFPVRVTDIDLFDHMNNAVYWSVIEDYLASHAELLRGPLRVTIEHEAPVALGDKLEI
FT                   ISHVHPAGSTEIFGPGLVDRAVTTLTYVVGDEPKAVASLFNL"
FT   gene            558837..560123
FT                   /gene="icl"
FT                   /locus_tag="MRA_0473"
FT   CDS_pept        558837..560123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icl"
FT                   /locus_tag="MRA_0473"
FT                   /product="isocitrate lyase Icl"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72194"
FT                   /db_xref="GOA:A5TZJ4"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZJ4"
FT                   /protein_id="ABQ72194.1"
FT                   /translation="MSVVGTPKSAEQIQQEWDTNPRWKDVTRTYSAEDVVALQGSVVEE
FT                   HTLARRGAEVLWEQLHDLEWVNALGALTGNMAVQQVRAGLKAIYLSGWQVAGDANLSGH
FT                   TYPDQSLYPANSVPQVVRRINNALQRADQIAKIEGDTSVENWLAPIVADGEAGFGGALN
FT                   VYELQKALIAAGVAGSHWEDQLASEKKCGHLGGKVLIPTQQHIRTLTSARLAADVADVP
FT                   TVVIARTDAEAATLITSDVDERDQPFITGERTREGFYRTKNGIEPCIARAKAYAPFADL
FT                   IWMETGTPDLEAARQFSEAVKAEYPDQMLAYNCSPSFNWKKHLDDATIAKFQKELAAMG
FT                   FKFQFITLAGFHALNYSMFDLAYGYAQNQMSAYVELQEREFAAEERGYTATKHQREVGA
FT                   GYFDRIATTVDPNSSTTALTGSTEEGQFH"
FT   gene            560205..561065
FT                   /gene="fadB2"
FT                   /locus_tag="MRA_0474"
FT   CDS_pept        560205..561065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadB2"
FT                   /locus_tag="MRA_0474"
FT                   /product="3-hydroxybutyryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72195"
FT                   /db_xref="GOA:A5TZJ5"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZJ5"
FT                   /protein_id="ABQ72195.1"
FT                   /translation="MSDAIQRVGVVGAGQMGSGIAEVSARAGVEVTVFEPAEALITAGR
FT                   NRIVKSLERAVSAGKVTERERDRALGLLTFTTDLNDLSDRQLVIEAVVEDEAVKSEIFA
FT                   ELDRVVTDPDAVLASNTSSIPIMKVAAATKQPQRVLGLHFFNPVPVLPLVELVRTLVTD
FT                   EAAAARTEEFASTVLGKQVVRCSDRSGFVVNALLVPYLLSAIRMVEAGFATVEDVDKAV
FT                   VAGLSHPMGPLRLSDLVGLDTLKLIADKMFEEFKEPHYGPPPLLLRMVEAGQLGKKSGR
FT                   GFYTY"
FT   gene            561198..562058
FT                   /gene="umaA"
FT                   /locus_tag="MRA_0475"
FT   CDS_pept        561198..562058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="umaA"
FT                   /locus_tag="MRA_0475"
FT                   /product="putative mycolic acid synthase UmaA"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72196"
FT                   /db_xref="GOA:A5TZJ6"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZJ6"
FT                   /protein_id="ABQ72196.1"
FT                   /translation="MTELRPFYEESQSIYDVSDEFFSLFLDPTMAYTCAYFEREDMTLE
FT                   EAQNAKFDLALDKLHLEPGMTLLDIGCGWGGGLQRAIENYDVNVIGITLSRNQFEYSKA
FT                   KLAKIPTERSVQVRLQGWDEFTDKVDRIVSIGAFEAFKMERYAAFFERSYDILPDDGRM
FT                   LLHTILTYTQKQMHEMGVKVTMSDVRFMKFIGEEIFPGGQLPAQEDIFKFAQAADFSVE
FT                   KVQLLQQHYARTLNIWAANLEANKDRAIALQSEEIYNKYMHYLTGCEHFFRKGISNVGQ
FT                   FTLTK"
FT   gene            complement(562158..563021)
FT                   /gene="pcaA"
FT                   /locus_tag="MRA_0476"
FT   CDS_pept        complement(562158..563021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaA"
FT                   /locus_tag="MRA_0476"
FT                   /product="mycolic acid synthase PcaA"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72197"
FT                   /db_xref="GOA:A5TZJ7"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZJ7"
FT                   /protein_id="ABQ72197.1"
FT                   /translation="MSVQLTPHFGNVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTL
FT                   QEAQIAKIDLALGKLNLEPGMTLLDIGCGWGATMRRAIEKYDVNVVGLTLSENQAGHVQ
FT                   KMFDQMDTPRSRRVLLEGWEKFDEPVDRIVSIGAFEHFGHQRYHHFFEVTHRTLPADGK
FT                   MLLHTIVRPTFKEGREKGLTLTHELVHFTKFILAEIFPGGWLPSIPTVHEYAEKVGFRV
FT                   TAVQSLQLHYARTLDMWATALEANKDQAIAIQSQTVYDRYMKYLTGCAKLFRQGYTDVD
FT                   QFTLEK"
FT   gene            complement(563164..563604)
FT                   /locus_tag="MRA_0477"
FT   CDS_pept        complement(563164..563604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72198"
FT                   /db_xref="GOA:A5TZJ8"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZJ8"
FT                   /protein_id="ABQ72198.1"
FT                   /translation="MGAGGWEVVLASLPYGLLCTTVLMGKHIDKIGYDEPLGIRTLPVL
FT                   LGETCARTVTLAMMVGFYLLIAVNVMLAAMPWPRCWSPGRCPGWRKCGPISCDGGPSSR
FT                   HRRFRCGRCGMPRWPGCTCVRPVRCWLWAWRSVPGGAPGDFR"
FT   gene            complement(563535..564023)
FT                   /locus_tag="MRA_0478"
FT   CDS_pept        complement(563535..564023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0478"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72199"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZJ9"
FT                   /protein_id="ABQ72199.1"
FT                   /translation="MPDAGAGSRLRSWAYALRTTNPPADGPTDTVTRWLVVTRAAVLPM
FT                   TLVSGLVAGLLAIGEPGLDWRWLVLWWESHAPHIANNLMNDLYDTDVGTDSATYARARY
FT                   AQHPAATGANRAAYTTPRRTTSCGSPERALEPTTPRWARAVGRSCWRRSPTGCCAPRC"
FT   gene            complement(564033..564737)
FT                   /locus_tag="MRA_0479"
FT   CDS_pept        complement(564033..564737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0479"
FT                   /product="TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72200"
FT                   /db_xref="GOA:A5TZK0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZK0"
FT                   /protein_id="ABQ72200.1"
FT                   /translation="MAERIPAVTVKTDGRKRRWHQHKVERRNELVDGTIEAIRRHGRFL
FT                   SMDEIAAEIGVSKTVLYRYFVDKNDLTTAVMMRFTQTTLIPNMIAALSADMDGFELTRE
FT                   IIRVYVETVAAQPEPYRFVMANSSASKSKVIADSERIIARMLAVMLRRRMQEAGMDTGG
FT                   VEPWAYLIVGGVQLATHSWMSDPRMSSDELIDYLTMLSWSALCGIVEAGGSLEKFREQP
FT                   HPSPIVPAWGQV"
FT   gene            564874..566244
FT                   /locus_tag="MRA_0480"
FT   CDS_pept        564874..566244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72201"
FT                   /db_xref="GOA:A5TZK1"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZK1"
FT                   /protein_id="ABQ72201.1"
FT                   /translation="MVAHRAEVSGSPPPRLNLSTQPTVARRVRASFAESFAAADPEADA
FT                   ARRMALRRMKVVAVGFLVGATGVFLACRWAQADGADHAWLGYLGAAAEAGMVGALADWF
FT                   AVTALFKHPLGIPIPHTAIIKRKKDQLGEGLGTFVRENFLSPPVVETKLRDAQIPSRLG
FT                   KWLSEATHAQRVAAETATVLRVLVELLRDEDIQQVIDRMIVRRIAEPQWGPPAGRVLAT
FT                   LLAENRQEAFIQLLADRAFQWSLNAGVVIQRVVERDSPSWSPRFIDHLVGDRIHRELME
FT                   FTDKVRRNPDHELRRSATRFLFDFADDLQHDPATVARADAIKEELMARDEIATAAAAAW
FT                   KTLKRLVLEGVDDPSSALRTRITDAVIRIGESLRDDADLRDKVDSWTVRAAQHLVSEYG
FT                   VEITAIITETIERWDAEEASRRIELHVGRDLQFIRINGTVVGAMAGLAIYAIAQLLF"
FT   gene            566331..566753
FT                   /locus_tag="MRA_0481"
FT   CDS_pept        566331..566753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0481"
FT                   /product="PbsX family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72202"
FT                   /db_xref="GOA:A5TZK2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZK2"
FT                   /protein_id="ABQ72202.1"
FT                   /translation="MSSEEKLAAKVSTKASDVASDIGSFIRSQRETAHVSMRQLAERSG
FT                   VSNPYLSQVERGLRKPSADVLSQIAKALRVSAEVLYVRAGILEPSETSQVRDAIITDTA
FT                   ITERQKQILLDIYASFTHQNEATREECPSDPTPTDD"
FT   gene            567107..567706
FT                   /gene="hbhA"
FT                   /locus_tag="MRA_0482"
FT   CDS_pept        567107..567706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hbhA"
FT                   /locus_tag="MRA_0482"
FT                   /product="iron-regulated heparin binding hemagglutinin
FT                   Hbha"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72203"
FT                   /db_xref="GOA:A5TZK3"
FT                   /db_xref="InterPro:IPR020340"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TZK3"
FT                   /protein_id="ABQ72203.1"
FT                   /translation="MAENSNIDDIKAPLLAALGAADLALATVNELITNLRERAEETRTD
FT                   TRSRVEESRARLTKLQEDLPEQLTELREKFTAEELRKAAEGYLEAATSRYNELVERGEA
FT                   ALERLRSQQSFEEVSARAEGYVDQAVELTQEALGTVASQTRAVGERAAKLVGIELPKKA
FT                   APAKKAAPAKKAAPAKKAAAKKAPAKKAAAKKVTQK"
FT   gene            567818..568081
FT                   /locus_tag="MRA_0483"
FT   CDS_pept        567818..568081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0483"
FT                   /product="putative conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72204"
FT                   /db_xref="GOA:A5TZK4"
FT                   /db_xref="InterPro:IPR019662"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZK4"
FT                   /protein_id="ABQ72204.1"
FT                   /translation="MLVLLVAVLVTAVYAFVHAALQRPDAYTAADKLTKPVWLVILGAA
FT                   VALASILYPVLGVLGMAMSACASGVYLVDVRPKLLEIQGKSR"
FT   gene            568086..568532
FT                   /locus_tag="MRA_0484"
FT   CDS_pept        568086..568532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0484"
FT                   /product="putative conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72205"
FT                   /db_xref="InterPro:IPR019719"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZK5"
FT                   /protein_id="ABQ72205.1"
FT                   /translation="MKALVAVSAVAVVALLGVSSAQADPEADPGAGEANYGGPPSSPRL
FT                   VDHTEWAQWGSLPSLRVYPSQVGRTASRRLGMAAADAAWAEVLALSPEADTAGMRAQFI
FT                   CHWQYAEIRQPGKPSWNLEPWRPVVDDSEMLASGCNPGSPEESF"
FT   gene            568532..569206
FT                   /gene="deoC"
FT                   /locus_tag="MRA_0485"
FT   CDS_pept        568532..569206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoC"
FT                   /locus_tag="MRA_0485"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72206"
FT                   /db_xref="GOA:A5TZK6"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TZK6"
FT                   /protein_id="ABQ72206.1"
FT                   /translation="MLGQPTRAQLAALVDHTLLKPETTRADVAALVAEAAELGVYAVCV
FT                   SPSMVPVAVQAGGVRVAAVTGFPSGKHVSSVKAHEAAAALASGASEIDMVIDIGAALCG
FT                   DIDAVRSDIEAVRAAAAGAVLKVIVESAVLLGQSNAHTLVDACRAAEDAGADFVKTSTG
FT                   CHPAGGATVRAVELMAETVGPRLGVKASGGIRTAADAVAMLNAGATRLGLSGTRAVLDG
FT                   LS"
FT   gene            complement(569231..570277)
FT                   /locus_tag="MRA_0486"
FT   CDS_pept        complement(569231..570277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0486"
FT                   /product="putative conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72207"
FT                   /db_xref="GOA:A5TZK7"
FT                   /db_xref="InterPro:IPR021373"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZK7"
FT                   /protein_id="ABQ72207.1"
FT                   /translation="MTNPQGPPNDPSPWARPGDQGPLARPPASSEASTGRLRPGEPAGH
FT                   IQEPVSPPTQPEQQPQTEHLAASHAHTRRSGRQAAHQAWDPTGLLAAQEEEPAAVKTKR
FT                   RARRDPLTVFLVLIIVFSLVLAGLIGGELYARHVANSKVAQAVACVVKDQATASFGVAP
FT                   LLLWQVATRHFTNISVETAGNQIRDAKGMQIKLTIQNVRLKNTPNSRGTIGALDATITW
FT                   SSEGIKESVQNAIPILGAFVTSSVVTHPADGTVELKGLLNNITAKPIVAGKGLELQIIN
FT                   FNTLGFSLPKETVQSTLNEFTSSLTKNYPLGIHADSVQVTSTGVVSRFSTRDAAIPTGI
FT                   QNPCFSHI"
FT   gene            complement(570274..571116)
FT                   /locus_tag="MRA_0487"
FT   CDS_pept        complement(570274..571116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0487"
FT                   /product="carbon-nitrogen hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72208"
FT                   /db_xref="GOA:A5TZK8"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZK8"
FT                   /protein_id="ABQ72208.1"
FT                   /translation="MRIALAQIRSGTDPAANLQLVGKYAGEAATAGAQLVVFPEATMCR
FT                   LGVPLRQVAEPVDGPWANGVRRIATEAGITVIAGMFTPTGDGRVTNTLIAAGPGTPNQP
FT                   DAHYHKIHLYDAFGFTESRTVAPGREPVVVVVDGVRVGLTVCYDIRFPALYTELARRGA
FT                   QLIAVCASWGSGPGKLEQWTLLARARALDSMSYVAAAGQADPGDARTGVGASSAAPTGV
FT                   GGSLVASPLGEVVVSAGTQPQLLVADIDVDNVAAARDRIAVLRNQTDFVQIDKAQSRG"
FT   gene            complement(571298..571822)
FT                   /locus_tag="MRA_0488"
FT   CDS_pept        complement(571298..571822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72209"
FT                   /db_xref="InterPro:IPR019639"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZK9"
FT                   /protein_id="ABQ72209.1"
FT                   /translation="MPRSFDMSADYEGSVEEVHRAFYEADYWKARLAETPVDVATLESI
FT                   RVGGDSGDDGTIEVVTLQMVRSHNLPGLVTQLHRGDLSVRREETWGPVKEGIATASIAG
FT                   SIVDAPVNLWGTAVLSPIPESGGSRMTLQVTIQVRIPFIGGKLERLIGTQLSQLVTIEQ
FT                   RFTTLWITNNV"
FT   gene            571849..572958
FT                   /gene="murB"
FT                   /locus_tag="MRA_0489"
FT   CDS_pept        571849..572958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="MRA_0489"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72210"
FT                   /db_xref="GOA:A5TZL0"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TZL0"
FT                   /protein_id="ABQ72210.1"
FT                   /translation="MKRSGVGSLFAGAHIAEAVPLAPLTTLRVGPIARRVITCTSAEQV
FT                   VAALRHLDSAAKTGADRPLVFAGGSNLVIAENLTDLTVVRLANSGITIDGNLVRAEAGA
FT                   VFDDVVVRAIEQGLGGLECLSGIPGSAGATPVQNVGAYGAEVSDTITRVRLLDRCTGEV
FT                   RWVSARDLRFGYRTSVLKHADGLAVPTVVLEVEFALDPSGRSAPLRYGELIAALNATSG
FT                   ERADPQAVREAVLALRARKGMVLDPTDHDTWSVGSFFTNPVVTQDVYERLAGDAATRKD
FT                   GPVPHYPAPDGVKLAAGWLVERAGFGKGYPDAGAAPCRLSTKHALALTNRGGATAEDVV
FT                   TLARAVRDGVHDVFGITLKPEPVLIGCML"
FT   gene            573020..574375
FT                   /gene="lprQ"
FT                   /locus_tag="MRA_0490"
FT   CDS_pept        573020..574375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lprQ"
FT                   /locus_tag="MRA_0490"
FT                   /product="putative conserved lipoprotein LprQ"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72211"
FT                   /db_xref="GOA:A5TZL1"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="InterPro:IPR041280"
FT                   /db_xref="PDB:4Z7A"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZL1"
FT                   /protein_id="ABQ72211.1"
FT                   /translation="MVIRVLFRPVSLIPVNNSSTPQSQGPISRRLALTALGFGVLAPNV
FT                   LVACAGKVTKLAEKRPPPAPRLTFRPADSAADVVPIAPISVEVGDGWFQRVALTNSAGK
FT                   VVAGAYSRDRTIYTITEPLGYDTTYTWSGSAVGHDGKAVPVAGKFTTVAPVKTINAGFQ
FT                   LADGQTVGIAAPVIIQFDSPISDKAAVERALTVTTDPPVEGGWAWLPDEAQGARVHWRP
FT                   REYYPAGTTVDVDAKLYGLPFGDGAYGAQDMSLHFQIGRRQVVKAEVSSHRIQVVTDAG
FT                   VIMDFPCSYGEADLARNVTRNGIHVVTEKYSDFYMSNPAAGYSHIHERWAVRISNNGEF
FT                   IHANPMSAGAQGNSNVTNGCINLSTENAEQYYRSAVYGDPVEVTGSSIQLSYADGDIWD
FT                   WAVDWDTWVSMSALPPPAAKPAATQIPVTAPVTPSDAPTPSGTPTTTNGPGG"
FT   gene            complement(574356..575111)
FT                   /locus_tag="MRA_0491"
FT   CDS_pept        complement(574356..575111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0491"
FT                   /product="putative short-chain type
FT                   dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72212"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZL2"
FT                   /protein_id="ABQ72212.1"
FT                   /translation="MTTIGTRKRVAVVTGASSGIGEATARTLAAQGFHVVAVARRADRI
FT                   TALANQIGGTAIVADVTDDAAVEALARALSRVDVLVNNAGGAKGLQFVADADLEHWRWM
FT                   WDTNVLGTLRVTRALLPKLIDSGDGLIVTVTSIAAIEVYDGGAGYTAAKHAQGALHRTL
FT                   RGELLGKPVRLTEIAPGAVETEFSLVRFDGDQQRADAVYAGMTPLVAADVAEVIGFVAT
FT                   RPSHVNLDQIVIRPRDQASASRRATHPVR"
FT   gene            575294..576610
FT                   /locus_tag="MRA_0492"
FT   CDS_pept        575294..576610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0492"
FT                   /product="NagC-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72213"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZL3"
FT                   /protein_id="ABQ72213.1"
FT                   /translation="MYSTNRTSQSLSRKPGRKHQLRSHRYVMPPSLHLSDSAAASVFRA
FT                   VRLRGPVGRDVIAGSTSLSIATVNRQVIALLEAGLLRERADLAVSGAIGRPRVPVEVNH
FT                   EPFVTLGIHIGARTTSIVATDLFGRTLDTVETPTPRNAAGAALTSLADSADRYLQRWRR
FT                   RRALWVGVTLGGAVDSATGHVDHPRLGWRQAPVGPVLADALGLPVSVASHVDAMAGAEL
FT                   MLGMRRFAPSSSTSLYVYARETVGYALMIGGRVHCPASGPGTIAPLPVHSEMLGGTGQL
FT                   ESTVSDEAVLAAARRLRIIPGIASRTRTGGSATAITDLLRVARAGNQQAKELLAERARV
FT                   LGGAVALLRDLLNPDEVVVGGQAFTEYPEAMEQVEAAFTAGSVLAPRDIRVTVFGNRVQ
FT                   EAGAGIVSLSGLYADPLGALRRSGALDARLQDTAPEALA"
FT   gene            576658..578100
FT                   /locus_tag="MRA_0493"
FT   CDS_pept        576658..578100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0493"
FT                   /product="glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72214"
FT                   /db_xref="GOA:A5TZL4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR017814"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TZL4"
FT                   /protein_id="ABQ72214.1"
FT                   /translation="MAGVRHDDGSGLIAQRRPVRGEGATRSRGPSGPSNRNVSAADDPR
FT                   RVALLAVHTSPLAQPGTGDAGGMNVYMLQSALHLARRGIEVEIFTRATASADPPVVRVA
FT                   PGVLVRNVVAGPFEGLDKYDLPTQLCAFAAGVLRAEAVHEPGYYDIVHSHYWLSGQVGW
FT                   LARDRWAVPLVHTAHTLAAVKNAALADGDGPEPPLRTVGEQQVVDEADRLIVNTDDEAR
FT                   QVISLHGADPARIDVVHPGVDLDVFRPGDRRAARAALGLPVDERVVAFVGRIQPLKAPD
FT                   IVLRAAAKLPGVRIIVAGGPSGSGLASPDGLVRLADELGISARVTFLPPQSHTDLATLF
FT                   RAADLVAVPSYSESFGLVAVEAQACGTPVVAAAVGGLPVAVRDGITGTLVSGHEVGQWA
FT                   DAIDHLLRLCAGPRGRVMSRAAARHAATFSWENTTDALLASYRRAIGEYNAERQRRGGE
FT                   VISDLVAVGKPRHWTPRRGVGA"
FT   gene            578097..578648
FT                   /locus_tag="MRA_0494"
FT   CDS_pept        578097..578648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72215"
FT                   /db_xref="InterPro:IPR019660"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZL5"
FT                   /protein_id="ABQ72215.1"
FT                   /translation="MTSSLPTVQRVIQNALEVSQLKYSQHPRPGGAPPALIVELPGERK
FT                   LKINTILSVGEHSVRVEAFVCRKPDENREDVYRFLLRRNRRLYGVAYTLDNVGDIYLVG
FT                   QMALSAVDADEVDRVLGQVLEVVDSDFNALLELGFRSSIQREWQWRLSRGESLQNLQAF
FT                   AHLRPTTMQSAQRDEKELGG"
FT   gene            578974..579579
FT                   /locus_tag="MRA_0495"
FT   CDS_pept        578974..579579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0495"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72216"
FT                   /db_xref="GOA:A5TZL6"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="InterPro:IPR004777"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZL6"
FT                   /protein_id="ABQ72216.1"
FT                   /translation="MMTLKVAIGPQNAFVLRQGIRREYVLVIVALCGIADGALIAAGVG
FT                   GFAALIHAHPNMTLVARFGGAAFLIGYALLAARNAWRPSGLVPSESGPAALIGVVQMCL
FT                   VVTFLNPHVYLDTVVLIGALANEESDLRWFFGAGAWAASVVWFAVLGFSAGRLQPFFAT
FT                   PAAWRILDALVAVTMIGVAVVVLVTSPSVPTANVALII"
FT   gene            579736..580485
FT                   /gene="gpm1"
FT                   /locus_tag="MRA_0496"
FT   CDS_pept        579736..580485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpm1"
FT                   /locus_tag="MRA_0496"
FT                   /product="phosphoglyceromutase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72217"
FT                   /db_xref="GOA:A5TZL7"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TZL7"
FT                   /protein_id="ABQ72217.1"
FT                   /translation="MANTGSLVLLRHGESDWNALNLFTGWVDVGLTDKGQAEAVRSGEL
FT                   IAEHDLLPDVLYTSLLRRAITTAHLALDSADRLWIPVRRSWRLNERHYGALQGLDKAET
FT                   KARYGEEQFMAWRRSYDTPPPPIERGSQFSQDADPRYADIGGGPLTECLADVVARFLPY
FT                   FTDVIVGDLRVGKTVLIVAHGNSLRALVKHLDQMSDDEIVGLNIPTGIPLRYDLDSAMR
FT                   PLVRGGTYLDPEAAAAGAAAVAGQGRG"
FT   gene            580659..581891
FT                   /gene="senX3"
FT                   /locus_tag="MRA_0497"
FT   CDS_pept        580659..581891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="senX3"
FT                   /locus_tag="MRA_0497"
FT                   /product="putative two component sensor histidine kinase
FT                   SenX3"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72218"
FT                   /db_xref="GOA:A5TZL8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZL8"
FT                   /protein_id="ABQ72218.1"
FT                   /translation="MTVFSALLLAGVLSALALAVGGAVGMRLTSRVVEQRQRVATEWSG
FT                   ITVSQMLQCIVTLMPLGAAVVDTHRDVVYLNERAKELGLVRDRQLDDQAWRAARQALGG
FT                   EDVEFDLSPRKRSATGRSGLSVHGHARLLSEEDRRFAVVFVHDQSDYARMEAARRDFVA
FT                   NVSHELKTPVGAMALLAEALLASADDSETVRRFAEKVLIEANRLGDMVAELIELSRLQG
FT                   AERLPNMTDVDVDTIVSEAISRHKVAADNADIEVRTDAPSNLRVLGDQTLLVTALANLV
FT                   SNAIAYSPRGSLVSISRRRRGANIEIAVTDRGIGIAPEDQERVFERFFRGDKARSRATG
FT                   GSGLGLAIVKHVAANHDGTIRVWSKPGTGSTFTLALPALIEAYHDDERPEQAREPELRS
FT                   NRSQREEELSR"
FT   gene            582119..582802
FT                   /gene="regX3"
FT                   /locus_tag="MRA_0498"
FT   CDS_pept        582119..582802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="regX3"
FT                   /locus_tag="MRA_0498"
FT                   /product="two component sensory transduction protein RegX3"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72219"
FT                   /db_xref="GOA:A5TZL9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZL9"
FT                   /protein_id="ABQ72219.1"
FT                   /translation="MTSVLIVEDEESLADPLAFLLRKEGFEATVVTDGPAALAEFDRAG
FT                   ADIVLLDLMLPGMSGTDVCKQLRARSSVPVIMVTARDSEIDKVVGLELGADDYVTKPYS
FT                   ARELIARIRAVLRRGGDDDSEMSDGVLESGPVRMDVERHVVSVNGDTITLPLKEFDLLE
FT                   YLMRNSGRVLTRGQLIDRVWGADYVGDTKTLDVHVKRLRSKIEADPANPVHLVTVRGLG
FT                   YKLEG"
FT   gene            complement(582799..584688)
FT                   /locus_tag="MRA_0499"
FT   CDS_pept        complement(582799..584688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0499"
FT                   /product="GMC-type oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72220"
FT                   /db_xref="GOA:A5TZM0"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZM0"
FT                   /protein_id="ABQ72220.1"
FT                   /translation="MSRLADRAKSYPLASFGAALLPPELGGPLPAQFVQRVDRYVTRLP
FT                   ATSRFAVRAGLASLAAASYLTTGRSLPRLHPDERARVLHRIAALSPEVAAAVEGLKAIV
FT                   LLANGADTYAHELLARAQEHDAARPDAELTVILSADSPSVTRADAVVVGSGAGGAMVAR
FT                   TLARAGLDVVVLEEGRRWTVEEFRSTHPVDRYAGLYRGAGATVALGRPAVVLPMGRAVG
FT                   GTTVVNSGTCFRPSLAVQRRWRDEFGLGLADPDQLGRRLDDAEQTLRVAPVPLEIMGRN
FT                   GRLLLQAAKSLGWRAAPIPRNAPGCRGCCQCAIGCPSNAKFGVHLNALPQACAAGARII
FT                   SWARVERILHRAGRAYGVRARRPDGTTLDVLADAVVVAAGATETPGLLRRSGLGGHPRL
FT                   GHNLALHPATMLAGLFDDDVFAWRGVLQSAAVHEFHESDGVLIEATSTPPGMGSMVFPG
FT                   YGAELLRWLDRAPQIATFGAMVADRGVGTVRSVRGETVVRYDIAPGEIAKLRVALQAIG
FT                   RLLFAAGAVEVLTGIPGAPPMRSLPELQDVLRRANPRSLHLAAFHPTGTAAAGADEQLC
FT                   PVDATGRLRGVEGVWVADASILPSCPEVNPQLSIMAMALAVADQTVAKVVGVR"
FT   gene            complement(584685..585014)
FT                   /locus_tag="MRA_0499A"
FT   CDS_pept        complement(584685..585014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0499A"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0499A"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72221"
FT                   /db_xref="GOA:A5TZM1"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZM1"
FT                   /protein_id="ABQ72221.1"
FT                   /translation="MSFLLDPPLLFVCGVLIERRLPVDRRDAAEAAALGVFFGASFGLY
FT                   HNVPGLGMLWRPFRAQNGRDFMWNSGVFSVDVARAEWPLHAMAAAIFATYPFFIKLGRR
FT                   LGRRI"
FT   gene            complement(585011..586000)
FT                   /locus_tag="MRA_0500"
FT   CDS_pept        complement(585011..586000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72222"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZM2"
FT                   /protein_id="ABQ72222.1"
FT                   /translation="MGESTTQPAGGAAVDDETRSAALPRWRGAAGRLEVWYATLSDPLT
FT                   RTGLWVHCETVAPTTGGPYAHGWVTWFPPDAPPGTERFGPQPAQPAAGPAWFDIAGVRM
FT                   APAELTGRTRSLAWELSWKDTAAPLWTFPRVAWERELLPGAQVVIAPTAVFAGSLAVGE
FT                   TTHRVDSWRGSVAHIYGHGNAKRWGWIHADLGDGDVLEVVTAVSHKPGLRRLAPLAFVR
FT                   FRIDGKDWPASPLPSLRMRTTLGVRHWQLEGRIGGREALIRVDQPPERCVSLGYTDPDG
FT                   AKAVCTNTEQADIHIELGGRHWSVLGTGHAEVGLRGTAAPAIKEGTPA"
FT   gene            586005..586733
FT                   /locus_tag="MRA_0501"
FT   CDS_pept        586005..586733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0501"
FT                   /product="GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72223"
FT                   /db_xref="GOA:A5TZM3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZM3"
FT                   /protein_id="ABQ72223.1"
FT                   /translation="MVEPMNQSSVFQPPDRQRVDERIATTIADAILDGVFPPGSTLPPE
FT                   RDLAERLGVNRTSLRQGLARLQQMGLIEVRHGSGSVVRDPEGLTHPAVVEALVRKLGPD
FT                   FLVELLEIRAALGPLIGRLAAARSTPEDAEALCAALEVVQQADTAAARQAADLAYFRVL
FT                   IHSTRNRALGLLYRWVEHAFGGREHALTGAYDDADPVLTDLRAINGAVLAGDPAAAAAT
FT                   VEAYLNASALRMVKSYRDRA"
FT   gene            complement(586734..587624)
FT                   /locus_tag="MRA_0502"
FT   CDS_pept        complement(586734..587624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0502"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72224"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZM4"
FT                   /protein_id="ABQ72224.1"
FT                   /translation="MWRPAQGARWHVPAVLGYGGIPRRASWSNVESVANSRRRPVHPGQ
FT                   EVELDFAREWVEFYDPDNPEHLIAADLTWLLSRWACVFGTPACQGTVAGRPNDGCCSHG
FT                   AFLSDDDDRTRLADAVHKLTDDDWQFRAKGLRRKGYLELDEHDGQPQHRTRKHKGACIF
FT                   LNRPGFAGGAGCALHSKALKLGVPPLTMKPDVCWQLPIRRSQEWVTRPDGTEILKTTLT
FT                   EYDRRGWGSGGADLHWYCTGDPAAHVGTKQVWQSLADELTELLGEKAYGELAAMCKRRS
FT                   QLGLIAVHPATRAAQ"
FT   gene            587704..588690
FT                   /locus_tag="MRA_0503"
FT   CDS_pept        587704..588690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72225"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZM5"
FT                   /protein_id="ABQ72225.1"
FT                   /translation="MVDAHRGGHPTPMSSTKATLRLAEATDSSGKITKRGADKLISTID
FT                   EFAKIAISSGCAELMAFATSAVRDAENSEDVLSRVRKETGVELQALRGEDESRLTFLAV
FT                   RRWYGWSAGRILNLDIGGGSLEVSSGVDEEPEIALSLPLGAGRLTREWLPDDPPGRRRV
FT                   AMLRDWLDAELAEPSVTVLEAGSPDLAVATSKTFRSLARLTGAAPSMAGPRVKRTLTAN
FT                   GLRQLIAFISRMTAVDRAELEGVSADRAPQIVAGALVAEASMRALSIEAVEICPWALRE
FT                   GLILRKLDSEADGTALIESSSVHTSVRAVGGQPADRNAANRSRGSKP"
FT   gene            588687..589619
FT                   /locus_tag="MRA_0504"
FT   CDS_pept        588687..589619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0504"
FT                   /product="putative conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72226"
FT                   /db_xref="GOA:A5TZM6"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZM6"
FT                   /protein_id="ABQ72226.1"
FT                   /translation="MTGPHPETESSGNRQISVAELLARQGVTGAPARRRRRRRGDSDAI
FT                   TVAELTGEIPIIRDDHHHAGPDAHASQSPAANGRVQVGEAAPQSPAEPVAEQVAEEPTR
FT                   TVYWSQPEPRWPKSPPQDRRESGPELSEYPRPLRHTHSDRAPAGPPSGAEHMSPDPVEH
FT                   YPDLWVDVLDTEVGEAEAETEVREAQPGRGERHAAAAAAGTDVEGDGAAEARVARRALD
FT                   VVPTLWRGALVVLQSILAVAFGAGLFIAFDQLWRWNSIVALVLSVMVILGLVVSVRAVR
FT                   KTEDIASTLIAVAVGALITLGPLALLQSG"
FT   gene            589635..590477
FT                   /locus_tag="MRA_0505"
FT   CDS_pept        589635..590477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72227"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZM7"
FT                   /protein_id="ABQ72227.1"
FT                   /translation="MRPAIKVGLSTASVYPLRAEAAFEYADRLGYDGVELMVWGESVSQ
FT                   DIDAVRKLSRRYRVPVLSVHAPCLLISQRVWGANPILKLDRSVRAAEQLGAQTVVVHPP
FT                   FRWQRRYAEGFSDQVAALEAASTVMVAVENMFPFRADRFFGAGQSRERMRKRGGGPGPA
FT                   ISAFAPSYDPLDGNHAHYTLDLSHTATAGTDSLDMARRMGPGLVHLHLCDGSGLPADEH
FT                   LVPGRGTQPTAEVCQMLAGSGFVGHVVLEVSTSSARSANERESMLAESLQFARTHLLR"
FT   gene            590493..591368
FT                   /locus_tag="MRA_0506"
FT   CDS_pept        590493..591368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0506"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72228"
FT                   /db_xref="GOA:A5TZM8"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZM8"
FT                   /protein_id="ABQ72228.1"
FT                   /translation="MNALFTTAMALRPLDSDPGNPACRVFEGELNEHWTIGPKVHGGAM
FT                   VALCANAARTAYGAAGQQPMRQPVAVSASFLWAPDPGTMRLVTSIRKRGRRISVADVEL
FT                   TQGGRTAVHAVVTLGEPEHFLPGVDGSGGASGTAPLLSANPVVELMAPEPPEGVVPIGP
FT                   GHQLAGLVHLGEGCDVRPVLSTLRSATDGRPPVIQLWARPRGVAPDALFALLCGDLSAP
FT                   VTFAVDRTGWAPTVALTAYLRALPADGWLRVLCTCVEIGQDWFDEDHIVVDRLGRIVVQ
FT                   TRQLAMVPAQ"
FT   gene            591393..592280
FT                   /gene="proC"
FT                   /locus_tag="MRA_0507"
FT   CDS_pept        591393..592280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="MRA_0507"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72229"
FT                   /db_xref="GOA:A5TZM9"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZM9"
FT                   /protein_id="ABQ72229.1"
FT                   /translation="MLFGMARIAIIGGGSIGEALLSGLLRAGRQVKDLVVAERMPDRAN
FT                   YLAQTYSVLVTSAADAVENATFVVVAVKPADVEPVIADLANATAAAENDSAEQVFVTVV
FT                   AGITIAYFESKLPAGTPVVRAMPNAAALVGAGVTALAKGRFVTPQQLEEVSALFDAVGG
FT                   VLTVPESQLDAVTAVSGSGPAYFFLLVEALVDAGVGVGLSRQVATDLAAQTMAGSAAML
FT                   LERMEQDQGGANGELMGLRVDLTASRLRAAVTSPGGTTAAALRELERGGFRMAVDAAVQ
FT                   AAKSRSEQLRITPE"
FT   gene            592421..592657
FT                   /locus_tag="MRA_0508"
FT   CDS_pept        592421..592657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0508"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72230"
FT                   /db_xref="GOA:A5TZN0"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZN0"
FT                   /protein_id="ABQ72230.1"
FT                   /translation="MTSTNGPSARDTGFVEGQQAKTQLLTVAEVAALMRVSKMTVYRLV
FT                   HNGELPAVRVGRSFRVHAKAVHDMLETSYFDAG"
FT   gene            592964..594094
FT                   /gene="galE2"
FT                   /locus_tag="MRA_0509"
FT   CDS_pept        592964..594094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE2"
FT                   /locus_tag="MRA_0509"
FT                   /product="NAD-dependent epimerase/dehydratase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72231"
FT                   /db_xref="GOA:A5TZN1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZN1"
FT                   /protein_id="ABQ72231.1"
FT                   /translation="MSSSNGRGGAGGVGGSSEHPQYPKVVLVTGACRFLGGYLTARLAQ
FT                   NPLINRVIAVDAIAPSKDMLRRMGRAEFVRADIRNPFIAKVIRNGEVDTVVHAAAASYA
FT                   PRSGGSAALKELNVMGAMQLFAACQKAPSVRRVVLKSTSEVYGSSPHDPVMFTEDSSSR
FT                   RPFSQGFPKDSLDIEGYVRALGRRRPDIAVTILRLANMIGPAMDTTLSRYLAGPLVPTI
FT                   FGRDARLQLLHEQDALGALERAAMAGKAGTFNIGADGILMLSQAIRRAGRIPVPVPGFG
FT                   VWALDSLRRANHYTELNREQFAYLSYGRVMDTTRMRVELGYQPKWTTVEAFDDYFRGRG
FT                   LTPIIDPHRVRSWEGRAVGLAQRWGSRNPIPWSGLR"
FT   gene            594101..595177
FT                   /locus_tag="MRA_0510"
FT   CDS_pept        594101..595177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0510"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72232"
FT                   /db_xref="GOA:A5TZN2"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR016676"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZN2"
FT                   /protein_id="ABQ72232.1"
FT                   /translation="MGNVAGETRANVIPLHTNRSRVAARRRAGQRAESRQHPSLLSDPN
FT                   DRASAEQIAAVVREIDEHRRAAGATTSSTEATPNDLAQLVAAVAGFLRQRLTGDYSVDE
FT                   FGFDPHFNSAIVRPLLRFFFKSWFRVEVSGVENIPRDGAALVVANHAGVLPFDGLMLSV
FT                   AVHDEHPAHRDLRLLAADMVFDLPVIGEAARKAGHTMACTTDAHRLLASGELTAVFPEG
FT                   YKGLGKRFEDRYRLQRFGRGGFVSAALRTKAPIVPCSIIGSEEIYPMLTDVKLLARLFG
FT                   LPYFPITPLFPLAGPVGLVPLPSKWRIAFGEPICTADYASTDADDPMVTFELTDQVRET
FT                   IQQTLYRLLAGRRNIFFG"
FT   gene            complement(595181..596089)
FT                   /gene="cmaA2"
FT                   /locus_tag="MRA_0511"
FT   CDS_pept        complement(595181..596089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmaA2"
FT                   /locus_tag="MRA_0511"
FT                   /product="cyclopropane-fatty-acyl-phospholipid synthase 2"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72233"
FT                   /db_xref="GOA:A5TZN3"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZN3"
FT                   /protein_id="ABQ72233.1"
FT                   /translation="MTSQGDTTSGTQLKPPVEAVRSHYDKSNEFFKLWLDPSMTYSCAY
FT                   FERPDMTLEEAQYAKRKLALDKLNLEPGMTLLDIGCGWGSTMRHAVAEYDVNVIGLTLS
FT                   ENQYAHDKAMFDEVDSPRRKEVRIQGWEEFDEPVDRIVSLGAFEHFADGAGDAGFERYD
FT                   TFFKKFYNLTPDDGRMLLHTITIPDKEEAQELGLTSPMSLLRFIKFILTEIFPGGRLPR
FT                   ISQVDYYSSNAGWKVERYHRIGANYVPTLNAWADALQAHKDEAIALKGQETYDIYMHYL
FT                   RGCSDLFRDKYTDVCQFTLVK"
FT   gene            complement(596112..596612)
FT                   /locus_tag="MRA_0512"
FT   CDS_pept        complement(596112..596612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72234"
FT                   /db_xref="InterPro:IPR016709"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZN4"
FT                   /protein_id="ABQ72234.1"
FT                   /translation="MTVPEEAQTLIGKHYRAPDHFLVGREKIREFAVAVKDDHPTHYSE
FT                   PDAAAAGYPALVAPLTFLAIAGRRVQLEIFTKFNIPINIARVFHRDQKFRFHRPILAND
FT                   KLYFDTYLDSVIESHGTVLAEIRSEVTDAEGKPVVTSVVTMLGEAAHHEADADATVAAI
FT                   ASI"
FT   gene            complement(596774..597895)
FT                   /gene="serB1"
FT                   /locus_tag="MRA_0513"
FT   CDS_pept        complement(596774..597895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serB1"
FT                   /locus_tag="MRA_0513"
FT                   /product="putative phosphoserine phosphatase SerB1"
FT                   /note="o-phosphoserine phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72235"
FT                   /db_xref="GOA:A5TZN5"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZN5"
FT                   /protein_id="ABQ72235.1"
FT                   /translation="MGLTCWPRTAAGRVHDESRCGLANFDTALGLQINPRQPRAPPRIC
FT                   RIGLITAAASATGQAPRLGVMMVSSHLGSPDQAGHVDLASPADPPPPDASASHSPVDMP
FT                   APVAAAGSDRQPPIDLTAAAFFDVDNTLVQGSSAVHFGRGLAARHYFTYRDVLGFLYAQ
FT                   AKFQLLGKENSNDVAAGRRKALAFIEGRSVAELVALGEEIYDEIIADKIWDGTRELTQM
FT                   HLDAGQQVWLITATPYELAATIARRLGLTGALGTVAESVDGIFTGRLVGEILHGTGKAH
FT                   AVRSLAIREGLNLKRCTAYSDSYNDVPMLSLVGTAVAINPDARLRSLARERGWEIRDFR
FT                   IARKAARIGVPSALALGAAGGALAALASRRQSR"
FT   gene            598069..598512
FT                   /gene="mmpS2"
FT                   /locus_tag="MRA_0514"
FT   CDS_pept        598069..598512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmpS2"
FT                   /locus_tag="MRA_0514"
FT                   /product="putative conserved membrane protein MmpS2"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72236"
FT                   /db_xref="InterPro:IPR008693"
FT                   /db_xref="InterPro:IPR038468"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZN6"
FT                   /protein_id="ABQ72236.1"
FT                   /translation="MRMISVSGAVKRMWLLLAIVVVAVVGGLGIYRLHSIFGVHEQPTV
FT                   MVKPDFDVPLFNPKRVTYEVFGPAKTAKIAYLDPDARVHRLDSVSLPWSVTVETTLPAV
FT                   SVNLMAQSNADVISCRIIVNGAVKDERSETSPRALTSCQVSSG"
FT   gene            598509..601415
FT                   /gene="mmpL2"
FT                   /locus_tag="MRA_0515"
FT   CDS_pept        598509..601415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmpL2"
FT                   /locus_tag="MRA_0515"
FT                   /product="transmembrane transport protein MmpL2"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72237"
FT                   /db_xref="GOA:A5TZN7"
FT                   /db_xref="InterPro:IPR004707"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZN7"
FT                   /protein_id="ABQ72237.1"
FT                   /translation="MSERHAALTSLPPILPRLIRRFAVVIVLLWLGFTAFVNLAVPQLE
FT                   VVGKAHSVSMSPSDAASIQAIKRVGQVFGEFDSDNAVTIVLEGDQPLGGDAHRFYSDLM
FT                   RKLSADTRHVAHIQDFWGDPLTAAGSQSADDRAAYVVVYLVGNNETEAYDSVHAVRHMV
FT                   DTTPPPHGVKAYVTGPAALNADQAEAGDKSIAKVTAITSMVIAAMLLVIYRSVITAVLV
FT                   LIMVGIDLGAIRGFIALLADHNIFSLSTFATNLLVLMAIAASTDYAIFMLGRYHESRYA
FT                   GEDRETAFYTMFHGTAHVILGSGLTIAGAMYCLSFARLPYFETLGAPIAIGMLVAVLAA
FT                   LTLGPAVLTVGSFFKLFDPKRRMNTRRWRRVGTAIVRWPGPVLAATCLVASIGLLALPS
FT                   YRTTYDLRKFMPASMPSNVGDAAAGRRFSRARLNPEVLLIETDHDMRNPVDMLVLDKVA
FT                   KNIYHSPGIEQVKAITRPLGTTIKHTSIPFIISMQGVNSSEQMEFMKDRIDDILVQVAA
FT                   MNTSIETMHRMYALMGEVIDNTVDMDHLTHDMSDITATLRDHLADFEDFFRPIRSYFYW
FT                   EKHCFDVPLCWSIRSIFDMFDSVDQLSEKLEYLVKDMDILITLLPQMRAQMPPMISAMT
FT                   TMRDMMLIWHGTLGAFYKQQERNNKDPGAMGRVFDAAQIDDSFYLPQSAFENPDFKRGL
FT                   KMFLSPDGKAARFVIALEGDPATPEGISRVEPIKREAREAIKGTPLQGAAIYLGGTAAT
FT                   FKDIREGARYDLLIAGVAAISLILIIMMIITRSVVAAVVIVGTVVLSMGASFGLSVLVW
FT                   QDILGIELYWMVLAMSVILLLAVGSDYNLLLISRLKEEIGAGLNTGIIRAMAGTGGVVT
FT                   AAGMVFAVTMSLFVFSDLRIIGQIGTTIGLGLLFDTLVVRSFMTPSIAALLGRWFWWPL
FT                   RVRPRPASQMLRPFAPRRLVRALLLPSGQHPSATGAHE"
FT   gene            601408..601701
FT                   /locus_tag="MRA_0515A"
FT   CDS_pept        601408..601701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0515A"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0515A"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72238"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZN8"
FT                   /protein_id="ABQ72238.1"
FT                   /translation="MSRPQVELLTRAGCAICVRVAEQLAELSSELGFDMMTIDVDVAAS
FT                   TGNPGLRAEFGDRLPVVLLDGREHSYWEVDEHRLRADIARSTFGSPPDKRLP"
FT   gene            601751..603157
FT                   /gene="hemA"
FT                   /locus_tag="MRA_0516"
FT   CDS_pept        601751..603157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemA"
FT                   /locus_tag="MRA_0516"
FT                   /product="glutamyl-tRNA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72239"
FT                   /db_xref="GOA:A5TZN9"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TZN9"
FT                   /protein_id="ABQ72239.1"
FT                   /translation="MSVLLFGVSHRSAPVVVLEQLSIDESDQVKIIDRVLASPLVTEAM
FT                   VLSTCNRVEVYAVVDAFHGGLSVIGQVLAEHSGMSMGELTKYAYVRYSEAAVEHLFAVA
FT                   SGLDSAVIGEQQVLGQVRRAYAVAESNRTVGRVLHELAQRALSVGKRVHSETAIDAAGA
FT                   SVVSVALGMAERKLGSLAGTTAVVIGAGAMGALSAVHLTRAGVGHIQVLNRSLSRAQRL
FT                   ARRIRESGVPAEALALDRLANVLADADVVVSCTGAVRPVVSLADVHHALAAARRDEATR
FT                   PLVICDLGMPRDVDPAVARLPCVWVVDVDSVQHEPSAHAAAADVEAARHIVAAEVASYL
FT                   VGQRMAEVTPTVTALRQRAAEVVEAELLRLDNRLPGLQSVQREEVARTVRRVVDKLLHA
FT                   PTVRIKQLASAPGGDSYAEALRELFELDQTAVDAVATAGELPVVPSGFDAESRRGGGDM
FT                   QSSPKRSPSN"
FT   gene            603167..604096
FT                   /gene="hemC"
FT                   /locus_tag="MRA_0517"
FT   CDS_pept        603167..604096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="MRA_0517"
FT                   /product="porphobilinogen deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72240"
FT                   /db_xref="GOA:A5TZP0"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TZP0"
FT                   /protein_id="ABQ72240.1"
FT                   /translation="MIRIGTRGSLLATTQAATVRDALIAGGHSAELVTISTEGDRSMAP
FT                   IASLGVGVFTTALREAMEAGLVDAAVHSYKDLPTAADPRFTVAAIPPRNDPRDAVVARD
FT                   GLTLGELPVGSLVGTSSPRRAAQLRALGLGLEIRPLRGNLDTRLNKVSSGDLDAIVVAR
FT                   AGLARLGRLDDVTETLEPVQMLPAPAQGALAVECRAGDSRLVAVLAELDDADTRAAVTA
FT                   ERALLADLEAGCSAPVGAIAEVVESIDEDGRVFEELSLRGCVAALDGSDVIRASGIGSC
FT                   GRARELGLSVAAELFELGARELMWGVRH"
FT   gene            604129..605826
FT                   /gene="hemD"
FT                   /locus_tag="MRA_0518"
FT   CDS_pept        604129..605826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemD"
FT                   /locus_tag="MRA_0518"
FT                   /product="uroporphyrin-III
FT                   C-methyltransferase/uroporphyrinogen-III synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72241"
FT                   /db_xref="GOA:A5TZP1"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZP1"
FT                   /protein_id="ABQ72241.1"
FT                   /translation="MTRGRKPRPGRIVFVGSGPGDPGLLTTRAAAVLANAALVFTDPDV
FT                   PEPVVALIGTDLPPVSGPAPAEPVAGNGDAAGGGSAQEHGRAASAVVSGGPDIRPALGD
FT                   PADVAKTLTAEARSGVDVVRLVAGDPLTVDAVISEVNAVARTHLHIEIVPGLAASSAVP
FT                   TYAGLPLGSSHTVADVRIDPENTDWDALAAAPGPLILQATASHLAESARSLIDHQLAES
FT                   TPCVVTAHGTTCQQRSVETTLQGLTDPAVLGATDPACSANGRDSQAGPLIVTIGKTVTS
FT                   RAKLNWWESRALYGWTVLVPRTKDQAGEMSERLTSYGALPVEVPTIAVEPPRSPAQMER
FT                   AVKGLVDGRFQWIVFTSTNAVRAVWEKFGEFGLDARAFSGVKIACVGESTADRVRAFGI
FT                   SPELVPSGEQSSLGLLDDFPPYDSVFDPVNRVLLPRADIATETLAEGLRERGWEIEDVT
FT                   AYRTVRAAPPPATTREMIKTGGFDAVCFTSSSTVRNLVGIAGKPHARTIIACIGPKTAE
FT                   TAAEFGLRVDVQPDTAAIGPLVDALAEHAARLRAEGALPPPRKKSRRR"
FT   gene            605912..606901
FT                   /gene="hemB"
FT                   /locus_tag="MRA_0519"
FT   CDS_pept        605912..606901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="MRA_0519"
FT                   /product="delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72242"
FT                   /db_xref="GOA:A5TZP2"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZP2"
FT                   /protein_id="ABQ72242.1"
FT                   /translation="MSMSSYPRQRPRRLRSTVAMRRLVAQTSLEPRHLVLPMFVADGID
FT                   EPRPITSMPGVVQHTRDSLRRAAAAAVAAGVGGLMLFGVPRDQDKDGVGSAGIDPDGIL
FT                   NVALRDLAKDLGEATVLMADTCLDEFTDHGHCGVLDDRGRVDNDATVARYVELAVAQAE
FT                   SGAHVVGPSGMMDGQVAAIRDGLDAAGYIDVVILAYAAKFASAFYGPFREAVSSSLSGD
FT                   RRTYQQEPGNAAEALREIELDLDEGADIVMVKPAMGYLDVVAAAADVSPVPVAAYQVSG
FT                   EYAMIRAAAANNWIDERAAVLESLTGIRRAGADIVLTYWAVDAAGWLT"
FT   gene            606914..607462
FT                   /locus_tag="MRA_0520"
FT   CDS_pept        606914..607462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0520"
FT                   /product="putative conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72243"
FT                   /db_xref="GOA:A5TZP3"
FT                   /db_xref="InterPro:IPR016844"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZP3"
FT                   /protein_id="ABQ72243.1"
FT                   /translation="MTPTGDTKPKLLFYEPGASWYWVLTGPLAAVSVLLLEISSGAGVG
FT                   LITPAIFLVMVSAFVALQVKAARIHTSVELTHDALRQGTETIRLAEIVKIYPEADGRET
FT                   SGEEPAKWQSARTLGELVGVPRGRVGIGLKLTGGRTAQAWARRHQQLRAALTPLVQERL
FT                   GPVDSDVADVNGDDAGPAR"
FT   gene            607459..607758
FT                   /locus_tag="MRA_0521"
FT   CDS_pept        607459..607758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0521"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72244"
FT                   /db_xref="GOA:A5TZP4"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZP4"
FT                   /protein_id="ABQ72244.1"
FT                   /translation="MIARYRAGAELFLACAALAGSAASWSRTRSTVAVAPVIDGQPVTL
FT                   SVVYHPQPLVLTLLLATIAGVLSVVGTARLRRARAGLNAHPDGLNQRPPGGWCH"
FT   gene            607861..609372
FT                   /locus_tag="MRA_0522"
FT   CDS_pept        607861..609372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0522"
FT                   /product="conserved 13E12 repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72245"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZP5"
FT                   /protein_id="ABQ72245.1"
FT                   /translation="MPSPEAIAHFDERFECHAPRTTRVSAAFIDRICSATRAENRAAAA
FT                   QLVALGELFAYRWSRCGGREEWVMDTMAAVAAEVAAALRISQGLAASRLRYARAMRERL
FT                   PKTAEVFSAGDIGYLMFATIVYRTDLIVDPDVLAAVDAQLAANVARWPSMTKARLAGQV
FT                   DKIVARADADAVRRRKEYQAQRQFWVGESQDGVCQIGGSLLAVDAHALDARLSALAGTV
FT                   CEHDPRSREQRRADALGALAGGADRLGCGCGRADCAAGKRPAAPPVVIHLIAEAATING
FT                   TGSAPASQMNADGLITAELVAELAKTATLVPLVHPGDAPPEPGYAPSKALADFVRCRDL
FT                   TCRWPGCDEPATNCDLDHTIPYAAGGPTHASNLKCYCRTHHLVKTFWGWRDQQLPDGTL
FT                   ILTSPSGHTYVSTPGSALLFPSLCHFSGGIPAPEADPPYDHCDQRTAMMPKRRRTRAQD
FT                   RAYRIATERRQNHAARQRAQVLTQTAAATDTHGPPPDHNDDPPPF"
FT   gene            complement(609369..609845)
FT                   /locus_tag="MRA_0523"
FT   CDS_pept        complement(609369..609845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72246"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZP6"
FT                   /protein_id="ABQ72246.1"
FT                   /translation="MTTTIPTSKSACSVTTRPGNAAVDYGGAQIRAYLHHLATVVTIRG
FT                   EIDAANVEQISEHVRRFSLGTNPMVLDLSELSHFSGAGISLLCILDEDCRAAGVQWALV
FT                   ASPAVVEQLGGRCDQGEHESMFPMARSVHKALHDLADAIDRRRQLVLPLISRSA"
FT   gene            610056..611366
FT                   /locus_tag="MRA_0524"
FT   CDS_pept        610056..611366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0524"
FT                   /product="putative membrane acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72247"
FT                   /db_xref="GOA:A5TZP7"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZP7"
FT                   /protein_id="ABQ72247.1"
FT                   /translation="MAGGMDQPPGQPRRRTRQQSSDGKNGVRAAEITGEIRALTGLRIV
FT                   AAVWVVLFHFRPMLGDASPGFRDALAPVLDCGAQGVDLFFILSGFVLTWNYLDRMGRSW
FT                   SVRANLHFLWLRLARVWPVYLVTLHLAAVWVIFTLHVGHVPSPEAGQLTAISYVRQILL
FT                   VQLWFQPYFDGSSWDGPAWSISAEWLAYLLFGLLILVIFRMKHATRARGLMWLAFAASL
FT                   PPVVLLLASGQFYTPWSWLPRIVTQFAAGALACAAVRRLRPTDRARRIAGYLSVLVGVA
FT                   IVGILYLLHAHPLAGVEDSGGVVDVLFVPLVISLAIGVGSLPALLSTRLMVFGGQISFC
FT                   LYMVHELVHTAWGWAVQQYELALQDQPWKWNVVGLLAIALGAAILLYHFVEEPGRRWMR
FT                   RMVDVKAASARSEPGEPVGSTRYQIDDALEGVSARAV"
FT   gene            611498..612193
FT                   /locus_tag="MRA_0525"
FT   CDS_pept        611498..612193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0525"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72248"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZP8"
FT                   /protein_id="ABQ72248.1"
FT                   /translation="MSRPGTYVIGLTLLVGLVVGNPGCPRSYRPLTLDYRLNPVAVIGD
FT                   SYTTGTDEGGLGSKSWTARTWQMLAARGVRIAADVAAEGRAGYGVPGDHGNVFEDLTAR
FT                   AVQPDDALVVFFGSRNDQGMDPEDPEMLAEKVRDTFDLARHRAPSASLLVIAPPWPTAD
FT                   VPGPMLRIRDVLGAQARAAGAVFVDPIADHWFVDRPELIGADGVHPNDAGHEYLADKIA
FT                   PLISMELVG"
FT   gene            complement(612482..613384)
FT                   /locus_tag="MRA_0526"
FT   CDS_pept        complement(612482..613384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0526"
FT                   /product="putative conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72249"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZP9"
FT                   /protein_id="ABQ72249.1"
FT                   /translation="MLRRGCAGNTDRRGIMTPMADLTRRALLRWGAGAGAGAAGVWAFG
FT                   ALVDPLEPQAAPAPFEPPTAGSSLPTRISGSFISAARGGIKTNWVISMPPGQSGQLRPV
FT                   IALHGKDGNAGMMLDLGVEQGLARLVKEGKPAFAVVGVDGGNTYWHRRSSGGDSGAMVL
FT                   DELLPMLTSMGMDTSRVGFLGWSMGGYGALLLGARLGPARTAGICAISPALFTSFTGST
FT                   PGAFDSYDDYVQHSVLGLPALNSIPLRVDCGTSDRFYFATRQFVNQLHQPPAGSFSPGG
FT                   HDASYWREQLPGELAWMAS"
FT   gene            613565..613915
FT                   /locus_tag="MRA_0527"
FT   CDS_pept        613565..613915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0527"
FT                   /product="putative methyltransferase/methylase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72250"
FT                   /db_xref="GOA:A5TZQ0"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZQ0"
FT                   /protein_id="ABQ72250.1"
FT                   /translation="MGGCSITCLNISEVPNETNRKKNRQAGLDRSIRVIHGSFDDIPEP
FT                   DSGYDVVWSQDAILHAPDRRKVLEEAFRVLRPGGELIFTDPMQADDVPDGVLQPVYDRL
FT                   NLRDLGSMRFYA"
FT   gene            613908..614213
FT                   /locus_tag="MRA_0528"
FT   CDS_pept        613908..614213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0528"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72251"
FT                   /db_xref="InterPro:IPR023143"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZQ1"
FT                   /protein_id="ABQ72251.1"
FT                   /translation="MREAAQALGFEVLDQRDLVRNLRTHYSRVFEELEARRLELEGKSS
FT                   QEYLDKMRVGLKNWVEAADNGHSRVGHPTFPRTRLTPICQLPTAAIDSTAGRRRYR"
FT   gene            614348..615652
FT                   /gene="gabP"
FT                   /locus_tag="MRA_0529"
FT   CDS_pept        614348..615652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabP"
FT                   /locus_tag="MRA_0529"
FT                   /product="gaba permease GabP"
FT                   /note="4-amino butyrate transport carrier"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72252"
FT                   /db_xref="GOA:A5TZQ2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZQ2"
FT                   /protein_id="ABQ72252.1"
FT                   /translation="MIAIGGVIGAGLFVGSGVVIRATGPAAFLTYALCGALIVLVMRML
FT                   GEMAAANPSTGAFADYAAKALGGWAGFSVGWLYWYFWVIVVGFEAVAGGKVLTYWIDAP
FT                   LWLASLCLMMMMTATNLVSVSSFGEFEFWFAGVKVATIVGFLVLGTAFAFGLLPGHGMD
FT                   FSNLSAHGGFFPDGVGAVFAAIVVAIFSMTGTEVVTIAAAEAPDPQRAVQRAMSTVVAR
FT                   IVIFFVGSVFLLTVILPWNSLELGASPYVAALRHMGIGGADQIMNAVVLTAVLSCLNSG
FT                   LYTASRMLFVLAARQEAPAQLVKVNRRGVPTFAIMGSSVVGFLCVIMAWVSPATVFVFL
FT                   LNSSGAVILFVYLLIALSQIVLRRQTSGQNLGVRMWLFPGLSIVTVTGIVAVLARMAFD
FT                   YAARSQLWLSLLSWAVVVGCYLVTTLVRRPLNRPW"
FT   gene            complement(615636..616031)
FT                   /locus_tag="MRA_0530"
FT   CDS_pept        complement(615636..616031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72253"
FT                   /db_xref="GOA:A5TZQ3"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZQ3"
FT                   /protein_id="ABQ72253.1"
FT                   /translation="MQLPQWLARFNRYVTNPIQRLWAGWLPAFAILEHVGRRSGKPYRT
FT                   PLNVFSADVDGRAGVAILLTYGPNRDWLKNITAAGGGRMRRYGKTFGVANPRRLTKAEA
FT                   APYVSSRWRPVFARLPFDEAVLLTKAD"
FT   gene            616145..617533
FT                   /gene="hemL"
FT                   /locus_tag="MRA_0531"
FT   CDS_pept        616145..617533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="MRA_0531"
FT                   /product="glutamate-1-semialdehyde aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72254"
FT                   /db_xref="GOA:A5TZQ4"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TZQ4"
FT                   /protein_id="ABQ72254.1"
FT                   /translation="MGSTEQATSRVRGAARTSAQLFEAACSVIPGGVNSPVRAFTAVGG
FT                   TPRFITEAHGCWLIDADGNRYVDLVCSWGPMILGHAHPAVVEAVAKAAARGLSFGAPTP
FT                   AETQLAGEIIGRVAPVERIRLVNSGTEATMSAVRLARGFTGRAKIVKFSGCYHGHVDAL
FT                   LADAGSGVATLGLCDDPQRPASPRSQSSRGLPSSPGVTGAAAADTIVLPYNDIDAVQQT
FT                   FARFGEQIAAVITEASPGNMGVVPPGPGFNAALRAITAEHGALLILDEVMTGFRVSRSG
FT                   WYGIDPVPADLFAFGKVMSGGMPAAAFGGRAEVMQRLAPLGPVYQAGTLSGNPVAVAAG
FT                   LATLRAADDAVYTALDANADRLAGLLSEALTDAVVPHQISRAGNMLSVFFGETPVTDFA
FT                   SARASQTWRYPAFFHAMLDAGVYPPCSAFEAWFVSAALDDAAFGRIANALPAAARAAAQ
FT                   ERPA"
FT   gene            617533..618141
FT                   /locus_tag="MRA_0532"
FT   CDS_pept        617533..618141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0532"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72255"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZQ5"
FT                   /protein_id="ABQ72255.1"
FT                   /translation="MPEETQVHVVRHGEVHNPTGILYGRLPGFHLSATGAAQAAAVADA
FT                   LADRDIVAVIASPLQRAQETAAPIAARHDLAVETDPDLIESANFFEGRRVGPGDGAWRD
FT                   PRVWWQLRNPFTPSWGEPYVDIAARMTTAVDKARVRGAGHEVVCVSHQLPVWTLRLYLT
FT                   GKRLWHDPRRRDCALASVTSLIYDGDRLVDVVYSQPAAL"
FT   gene            618156..618806
FT                   /locus_tag="MRA_0533"
FT   CDS_pept        618156..618806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0533"
FT                   /product="putative thioredoxin protein"
FT                   /note="thiol-disulfide interchange protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72256"
FT                   /db_xref="GOA:A5TZQ6"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZQ6"
FT                   /protein_id="ABQ72256.1"
FT                   /translation="MQSRATRRSGALTMRRLVIAAAVSALLLTGCSGRDAVAQGGTFEF
FT                   VSPGGKTDIFYDPPASRGRPGPLSGPELADPARSVSLDDFPGQVVVVNVWGQWCGPCRA
FT                   EVSQLQRVYDATRGAGVSFLGIDVRDNNRQAPQDFINDRHVTYPSIYDPAMRTLIAFGG
FT                   KYPTSVIPSTLVLDRQHRVAAVFLRELLAADLQPVVERVAEEEPSGRAPVGAQ"
FT   gene            618803..619582
FT                   /gene="ccdA"
FT                   /locus_tag="MRA_0534"
FT   CDS_pept        618803..619582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccdA"
FT                   /locus_tag="MRA_0534"
FT                   /product="putative cytochrome C biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72257"
FT                   /db_xref="GOA:A5TZQ7"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZQ7"
FT                   /protein_id="ABQ72257.1"
FT                   /translation="MTGFTEIAAVGPLLVAVGVCLLAGLVSFASPCVVPLVPGYLSYLA
FT                   AVVGVDEQLPAGVVKPPVAARWRVAGSAALFVAGFTTVFVLGTVAVLGMTTTLITNQLL
FT                   LQRVGGVLIVVMGLVFVGFIGALQRQARFTPRQLTSVAGAPVLGAVFALGWTPCLGPTL
FT                   TGVITVASATEGASVARGIVLVIAYCLGLGIPFVLLAFGSAWAVAGLGWLRRHTRAIQI
FT                   FGGALLIAVGAALVTGVWNDVVSWLRDAFVSDVRLPI"
FT   gene            619615..621204
FT                   /locus_tag="MRA_0535"
FT   CDS_pept        619615..621204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0535"
FT                   /product="putative conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72258"
FT                   /db_xref="GOA:A5TZQ8"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZQ8"
FT                   /protein_id="ABQ72258.1"
FT                   /translation="MWRSLTSMGTALVLLFLLALAAIPGALLPQRGLNAAKVDDYLAAH
FT                   PLIGPWLDELQAFDVFSSFWFTAIYVLLFVSLVGCLAPRTIEHARSLRATPVAAPRNLA
FT                   RLPKHAHARLAGEPAALAATITGRLRGWRSITRQQGDSVEVSAEKGYLREFGNLVFHFA
FT                   LLGLLVAVAVGKLFGYEGNVIVIADGGPGFCSASPAAFDSFRAGNTVDGTSLHPICVRV
FT                   NNFQAHYLPSGQATSFAADIDYQADPATADLIANSWRPYRLQVNHPLRVGGDRVYLQGH
FT                   GYAPTFTVTFPDGQTRTSTVQWRPDNPQTLLSAGVVRIDPPAGSYPNPDERRKHQIAIQ
FT                   GLLAPTEQLDGTLLSSRFPALNAPAVAIDIYRGDTGLDSGRPQSLFTLDHRLIEQGRLV
FT                   KEKRVNLRAGQQVRIDQGPAAGTVVRFDGAVPFVNLQVSHDPGQSWVLVFAITMMAGLL
FT                   VSLLVRRRRVWARITPTTAGTVNVELGGLTRTDNSGWGAEFERLTGRLLAGFEARSPDM
FT                   AEAAAGTGRDVD"
FT   gene            621201..622175
FT                   /gene="ccsA"
FT                   /locus_tag="MRA_0536"
FT   CDS_pept        621201..622175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccsA"
FT                   /locus_tag="MRA_0536"
FT                   /product="cytochrome c assembly family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72259"
FT                   /db_xref="GOA:A5TZQ9"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR017562"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZQ9"
FT                   /protein_id="ABQ72259.1"
FT                   /translation="MNTLHVNVGLARYSDWAFTSAVVALVVALLLLAFEFAQVRGRGLA
FT                   PLAVPAGSVATDSATPGIVADQRHRPFDERVGRGGLAVAYLGIGLLLACVVLRGLATQR
FT                   VPWGNMYEFINLTCLSGLIAGAVVLRRARYRPLWVFLLVPVLILLTVSGRWLYANAAPV
FT                   MPALQSYWLPIHVSVVSLGSGVFLVAGVASILFLVRTSRLGEPTGEGALAGMVRRLPDA
FT                   QTLDGIAYRTTIFAFPVFGFGVIFGAIWAEEAWGRYWGWDPKETVSFVAWVVYAAYLHA
FT                   RSTAGWRDRKAAWINVAGFVAMVFNLFFVNLVTVGLHSYAGVG"
FT   gene            622217..623434
FT                   /locus_tag="MRA_0537"
FT   CDS_pept        622217..623434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72260"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZR0"
FT                   /protein_id="ABQ72260.1"
FT                   /translation="MLVTEHPRTGVGAPDSGNGGTDHPTVQLPPVPSVGAPPAAAGGET
FT                   PTRSVAGFRTQRLDPTAYGAYYSGPDEGPASPAERPPYRLEPVPHTPYPELATTTLLRP
FT                   VKPPPSEGWRRLLYLLSGRLINAGEGPRAAHLNDLVAQVNRPLRGCYRIAVLSLKGGVG
FT                   KTTITATLGATFADLRGDRVVAVDANPDRGTLSQKVPLETPATVRHLLRDADGIERYSD
FT                   VRGYTSKGPSGLEVLASDSDPASSDAFSADDYTRTLDILERFYGLVLTDCGTGLLHSAM
FT                   SAVLPRSDVLVVVSSGSIDGARSAAATLDWLQAHGHDDQVRNSIAVVNAVRPRAGKVDV
FT                   GKVVEHFSRRCRAVRVVPFDPHLEEGAEIALDRLRRETREALTELAAVVAAGFPGDPRR
FT                   CKPSFT"
FT   gene            623639..623956
FT                   /locus_tag="MRA_0538"
FT   CDS_pept        623639..623956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0538"
FT                   /product="putative conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72261"
FT                   /db_xref="GOA:A5TZR1"
FT                   /db_xref="InterPro:IPR025323"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZR1"
FT                   /protein_id="ABQ72261.1"
FT                   /translation="MSEAPNDKTTRGVVDILVYATARLLLVVAVSAAIFGVARLIGLTE
FT                   FPVVVATLFGLIIAMPLGIWVFSPLRRRATAALAVAGERRRAERERLRARLRGESLPEE
FT                   Q"
FT   gene            624103..625887
FT                   /locus_tag="MRA_0539"
FT   CDS_pept        624103..625887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0539"
FT                   /product="PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72262"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZR2"
FT                   /protein_id="ABQ72262.1"
FT                   /translation="MSNLLVTPELVAAAAADLAGIGSAIGAANAAAGAPTMALLAAGAD
FT                   EVSAAVAAVFSSYAQQYQALSAAAAAFHDQFVRALAAGAGAYAGAEAANVEQQLLNAIN
FT                   APTLALLGRPLIGNGADGAAGTGQAGGAGGLLYGNGGNGGSGAAGQAGGAGGAAGLIGH
FT                   GGTGGAVTGVSTTGGPGGHGGDAGLYGFGGAGGAGGFGQSGAAGGAGGAGGWLYGDGGD
FT                   GGAGGNGGNESGTGVSGVGGVGGAGGAGGLLFGNGGDGGVGGDGGDGSSTQDSGGDGGA
FT                   GGAGGAGGWLLGNGGAGGAGGAASIKVATGGLGGDGGDAGLFGFGGDGGWGGRGVDARF
FT                   GAAGGAAGAGGAGGWLYGDGGAGGVGGVGGAVFSLSSGDGGAGGAGGGGGWLFGNGGDG
FT                   GAGGGGGGRFGSGSGAGGDGAVGGAGGAGAWFGNGGAGGVGGGGGRGTTAIGGDGGAGG
FT                   AGGAGGWLYGDGGAGGAGGGGGRGGTGNDGGDGGDGGRGGDAQLLGNGGDGGAGGAGGP
FT                   AGLALPPGPARPAGAAVPAVRCSAAPARPARTADPWLAPIFARSTLRHSHHLGGIAQTG
FT                   AVADQQGQIAGLGRAGRQ"
FT   gene            complement(625783..626790)
FT                   /gene="fabH"
FT                   /locus_tag="MRA_0540"
FT   CDS_pept        complement(625783..626790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabH"
FT                   /locus_tag="MRA_0540"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase 3 FabH"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72263"
FT                   /db_xref="GOA:A5TZR3"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TZR3"
FT                   /protein_id="ABQ72263.1"
FT                   /translation="MTEIATTSGARSVGLLSVGAYRPERVVTNDEICQHIDSSDEWIYT
FT                   RTGIKTRRFAADDESAASMATEACRRALSNAGLSAADIDGVIVTTNTHFLQTPPAAPMV
FT                   AASLGAKGILGFDLSAGCAGFGYALGAAADMIRGGGAATMLVVGTEKLSPTIDMYDRGN
FT                   CFIFADGAAAVVVGETPFQGIGPTVAGSDGEQADAIRQDIDWITFAQNPSGPRPFVRLE
FT                   GPAVFRWAAFKMGDVGRRAMDAAGVRPDQIDVFVPHQANSRINELLVKNLQLRPDAVVA
FT                   NDIEHTGNTSAASIPLAMAELLTTGAAKPGDLALLIGYGAGLSYAAQVVRMPKG"
FT   gene            complement(626872..627750)
FT                   /gene="menA"
FT                   /locus_tag="MRA_0541"
FT   CDS_pept        complement(626872..627750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menA"
FT                   /locus_tag="MRA_0541"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72264"
FT                   /db_xref="GOA:A5TZR4"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR004657"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZR4"
FT                   /protein_id="ABQ72264.1"
FT                   /translation="MASFAQWVSGARPRTLPNAIAPVVAGTGAAAWLHAAVWWKALLAL
FT                   AVAVALVIGVNYANDYSDGIRGTDDDRVGPVRLVGSRLATPRSVLTAAMTSLALGALAG
FT                   LVLALLSAPWLIAVGAICIAGAWLYTGGSKPYGYAGFGELAVFVFFGPVAVLGTQYTQA
FT                   LRVDWVGLAQAVATGALSCSVLVANNLRDIPTDARADKITLAVRLGDARTRMLYQGLLA
FT                   VAGVLTFVLMLATPWCVVGLVAAPLALRAAGPVRSGRGGRELIPVLRDTGLAMLVWALA
FT                   VAGALAFGQLS"
FT   gene            627767..628561
FT                   /gene="pnp"
FT                   /locus_tag="MRA_0542"
FT   CDS_pept        627767..628561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnp"
FT                   /locus_tag="MRA_0542"
FT                   /product="5'-methylthioadenosine phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72265"
FT                   /db_xref="GOA:A5TZR5"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010044"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZR5"
FT                   /protein_id="ABQ72265.1"
FT                   /translation="MHNNGRMLGVIGGSGFYTFFGSDTRTVNSDTPYGQPSAPITIGTI
FT                   GVHDVAFLPRHGAHHQYSAHAVPYRANMWALRALGVRRVFGPCAVGSLDPELEPGAVVV
FT                   PDQLVDRTSGRADTYFDFGGVHAAFADPYCPTLRAAVTGLPGVVDGGTMVVIQGPRFST
FT                   RAESQWFAAAGCNLVNMTGYPEAVLARELELCYAAIALVTDVDAGVAAGDGVKAADVFA
FT                   AFGENIELLKRLVRAAIDRVADERTCTHCQHHAGVPLPFELP"
FT   gene            628558..629598
FT                   /gene="galE3"
FT                   /locus_tag="MRA_0543"
FT   CDS_pept        628558..629598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE3"
FT                   /locus_tag="MRA_0543"
FT                   /product="NAD-dependent epimerase/dehydratase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72266"
FT                   /db_xref="GOA:A5TZR6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZR6"
FT                   /protein_id="ABQ72266.1"
FT                   /translation="MRVLLTGAAGFIGSRVDAALRAAGHDVVGVDALLPAAHGPNPVLP
FT                   PGCQRVDVRDASALAPLLAGVDLVCHQAAMVGAGVNAADAPAYGGHNDFATTVLLAQMF
FT                   AAGVRRLVLASSMVVYGQGRYDCPQHGPVDPLPRRRADLDNGVFEHRCPGCGEPVIWQL
FT                   VDEDAPLRPRSLYAASKTAQEHYALAWSEASGGSVVALRYHNVYGPGMPRDTPYSGVAA
FT                   IFRSAVEKGKPPKVFEDGGQMRDFVHVDDVAAANLAAVHLGEADRDGFTAVNVCSGRPI
FT                   SILQVATAICDARGGSMSPAITGHYRSGDVRHIVADPARAARVLGFRAAVDPGEGLREF
FT                   AFAPLR"
FT   gene            complement(629608..631041)
FT                   /locus_tag="MRA_0544"
FT   CDS_pept        complement(629608..631041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0544"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72267"
FT                   /db_xref="GOA:A5TZR7"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZR7"
FT                   /protein_id="ABQ72267.1"
FT                   /translation="MGLSSDDTRRREVVRDLAAGALLIGALFFPWNLYFGFRIPDSSKT
FT                   VFGLLLAVTSLSLASLAVTFAGRRSQLRLGLNVPYLLLVLAFVVFDAIQTIRLGGTVHV
FT                   PGGVGPGGWLGITGALLSAQPALTGATTDEGSHSRWLRATQFLGYASMLGAALSTGFNL
FT                   SWRVRYALEPAAGASGFGKQNLAVIDTAVVYGVVALAAVLVASRWLLRPTAAEALSTVA
FT                   LGGSTLIAGSIVWSLPIGREIDAFHGIAQNTSTAGVGYEGYLVWAAAAAMCAPLTLFRS
FT                   PNAPPIDKTVWRAASRNGLLLIAVWCLGSVAMRLTDLVVAVLLNYPFSRYDSMALAAFD
FT                   LATAVLAIWLRFNMATEALPARLISSLCGLLCTFTVSRVIVGVVLAPRFQASSGGSAHP
FT                   VYGNDLAQQITSTFDVVLCGLALSILAAAIVIGRLRQLPQPPHTPALSRPAGSPRIFRS
FT                   AGSTHPVRPKIYRPPDHSS"
FT   gene            631350..632996
FT                   /locus_tag="MRA_0545"
FT   CDS_pept        631350..632996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0545"
FT                   /product="putative conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72268"
FT                   /db_xref="GOA:A5TZR8"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZR8"
FT                   /protein_id="ABQ72268.1"
FT                   /translation="MDVALGVAVTDRVARLALVDSAAPGTVIDQFVLDVAEHPVEVLTE
FT                   TVVGTDRSLAGENHRLVATRLCWPDQAKADELQHALQDSGVHDVAVISEAQAATALVGA
FT                   AHAGSAVLLVGDETATLSVVGDPDAPPTMVAVAPVAGADATSTVDTLMARLGDQALAPG
FT                   DVFLVGRSAEHTTVLADQLRAASTMRVQTPDDPTFALARGAAMAAGAATMAHPALVADA
FT                   TTSLPRAEAGQSGSEGEQLAYSQASDYELLPVDEYEEHDEYGAAADRSAPLSRRSLLIG
FT                   NAVVAFAVIGFASLAVAVAVTIRPTAASKPVEGHQNAQPGKFMPLLPTQQQAPVPPPPP
FT                   DDPTAGFQGGTIPAVQNVVPRPGTSPGVGGTPASPAPEAPAVPGVVPAPVPIPVPIIIP
FT                   PFPGWQPGMPTIPTAPPTTPVTTSATTPPTTPPTTPVTTPPTTPPTTPVTTPPTTPPTT
FT                   PVTTPPTTVAPTTVAPTTVAPTTVAPTTVAPATATPTTVAPQPTQQPTQQPTQQMPTQQ
FT                   QTVAPQTVAPAPQPPSGGRNGSGGGDLFGGF"
FT   gene            633029..633685
FT                   /locus_tag="MRA_0546"
FT   CDS_pept        633029..633685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0546"
FT                   /product="glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72269"
FT                   /db_xref="GOA:A5TZR9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZR9"
FT                   /protein_id="ABQ72269.1"
FT                   /translation="MAGDAVTVVLPCLNEEESLPAVLAAIPAGYRALVVDNNSTDDTAT
FT                   VAARHGAQVVVEPRPGYGSAVHAGVLAATTPIVAVIDADGSMDAGDLPKLVAELDKGAD
FT                   LVTGRRRPVAGLHWPWVARVGTVVMSWRLRTRHRLPVHDIAPMRVARREALLDLGVVDR
FT                   RSGYPLELLVRAAAAGWRVVELDVSYGPRTGGKSKVSGSLRGSIIAILDFWKVIS"
FT   gene            633682..634344
FT                   /locus_tag="MRA_0547"
FT   CDS_pept        633682..634344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72270"
FT                   /db_xref="InterPro:IPR018641"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZS0"
FT                   /protein_id="ABQ72270.1"
FT                   /translation="MSCLPVSVLVVAKAPEPGRVKTRLAAAIGDKVAADIAAAALLDTL
FT                   DAVAAAPVTARAVALTGDLDSAADSAEIRRRLKSFTVFRQRGDAFADRLANAHVDAADG
FT                   YPVLQIGMDTPQVTAELLADCARLLLQIPAVLGLAFDGGWWVLGIRTPTAAECLRAVPM
FT                   SQPDTGELTLKALRDNGIDVTLVQRLGDFDIVDDIALVRDCCAPGSRFAQATRAAGL"
FT   gene            complement(634365..635714)
FT                   /locus_tag="MRA_0548"
FT   CDS_pept        complement(634365..635714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0548"
FT                   /product="putative conserved integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72271"
FT                   /db_xref="GOA:A5TZS1"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZS1"
FT                   /protein_id="ABQ72271.1"
FT                   /translation="MRIGRREGLAVAIGFVLVGAAFVLPRLNLGIKPRSDIGLERFATR
FT                   AGAAPIFGYWDAHVGWGTAPAVLTAVAVVAWGPVVAHRLPWRVLTLSTWATAAAWAFSL
FT                   AMIDGWQRGFAGRLTTRDEYLWQVPGIADIPATLRTFTSRILDFQPNSWVTHVSGHPPG
FT                   ALLTFVWLDRIGLRGGGWAGLVCLLVGSSAAAAVLIAVRVLASEQMARRTAPFVAVAPT
FT                   AIWIAVSADGYFAGVAAWGIALLAVAVHGATRFPALVAAGAGLLLGWGVFLNYGLVLIV
FT                   LPGMAVLAAADWRPVLRALGPAVLAALVVAVSFAVAGFSWFDGYTLVQQRYWQGIAKDR
FT                   PFGYWSWANLACVVCAIGLGSVAGLSRVFDRAAISRRSGCHLLLLAVLAAIALADLSML
FT                   SKAETERIWLPFTIWLTAAPALLPPRSHRLWLAVNAAGALLLNSIIFTNW"
FT   gene            complement(635726..636814)
FT                   /gene="menE"
FT                   /locus_tag="MRA_0549"
FT   CDS_pept        complement(635726..636814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menE"
FT                   /locus_tag="MRA_0549"
FT                   /product="O-succinylbenzoic acid--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72272"
FT                   /db_xref="GOA:A5TZS2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZS2"
FT                   /protein_id="ABQ72272.1"
FT                   /translation="MLGGSDPALVAVPTQHESLLGALRVGEQIDDDVALVVTTSGTTGP
FT                   PKGAMLTAAALTASASAAHDRLGGPGSWLLAVPPYHIAGLAVLVRSVIAGSVPVELNVS
FT                   AGFDVTELPNAIKRLGSGRRYTSLVAAQLAKALTDPAATAALAELDAVLIGGGPAPRPI
FT                   LDAAAAAGITVVRTYGMSETSGGCVYDGVPLDGVRLRVLAGGRIAIGGATLAKGYRNPV
FT                   SPDPFAEPGWFHTDDLGALESGDSGVLTVLGRADEAISTGGFTVLPQPVEAALGTHPAV
FT                   RDCAVFGLADDRLGQRVVAAIVVGDGCPPPTLEALRAHVARTLDVTAAPRELHVVNVLP
FT                   RRGIGKVDRAALVRRFAGEADQ"
FT   gene            complement(636883..637185)
FT                   /locus_tag="MRA_0550"
FT   CDS_pept        complement(636883..637185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72273"
FT                   /db_xref="InterPro:IPR021784"
FT                   /db_xref="PDB:2KVC"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZS3"
FT                   /protein_id="ABQ72273.1"
FT                   /translation="MNRFLTSIVAWLRAGYPEGIPPTDSFAVLALLCRRLSHDEVKAVA
FT                   NELMRLGDFDQIDIGVVITHFTDELPSPEDVERVRARLAAQGWPLDDVRDREEHA"
FT   gene            complement(637245..637523)
FT                   /locus_tag="MRA_0551"
FT   CDS_pept        complement(637245..637523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0551"
FT                   /product="putative conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72274"
FT                   /db_xref="GOA:A5TZS4"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZS4"
FT                   /protein_id="ABQ72274.1"
FT                   /translation="MSAWFNYTATLKILIFSLLAGALLPGLFAVGVRLQAAGDGADATA
FT                   RRRPLLVAVSWAIFALVLAVVIIGVLYIARDFIAHHTGWAFLGATPK"
FT   gene            complement(637520..638773)
FT                   /gene="pitA"
FT                   /locus_tag="MRA_0552"
FT   CDS_pept        complement(637520..638773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pitA"
FT                   /locus_tag="MRA_0552"
FT                   /product="low-affinity inorganic phosphate transporter
FT                   integral membrane protein PitA"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72275"
FT                   /db_xref="GOA:A5TZS5"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZS5"
FT                   /protein_id="ABQ72275.1"
FT                   /translation="MNLQLFLLLIVVVTALAFDFTNGFHDTGNAMATSIASGALAPRVA
FT                   VALPAVLNLIGAFLSTAVAATIAKGLIDANLVTLELVFAGLVGGIVWNLLTWLLGIPSS
FT                   SSHALIGGIVGATIAAVGLRGVIWSGVVSKVIVPAVVAALLATLVGAVGTWLVYRTTRG
FT                   VAEKRTERGFRRGQIGSASLVSLAHGTNDAQKTMGVIFLALMSYGAVSTTASVPPLWVI
FT                   VSCAVAMAAGTYLGGWRIIRTLGKGLVEIKPPQGMAAESSSAAVILLSAHFGYALSTTQ
FT                   VATGSVLGSGVGKPGAEVRWGVAGRMVVAWLVTLPLAGLVGAFTYGLVHFIGGYPGAIL
FT                   GFALLWLTATAIWLRSRRAPIDHTNVNADWEGNLTAGLEAGAQPLADQRPPVPAPPAPT
FT                   PPPNHRAPQFGVTTRNAP"
FT   gene            complement(638893..639279)
FT                   /locus_tag="MRA_0553"
FT   CDS_pept        complement(638893..639279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72276"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZS6"
FT                   /protein_id="ABQ72276.1"
FT                   /translation="MEILASRMLLRPADYQRSLSFYRDQIGLAIAREYGAGTVFFAGQS
FT                   LLELAGYGEPDHSRGPFPGALWLQVRDLEATQTELVSRGVSIAREPRREPWGLHEMHVT
FT                   DPDGITLIFVEVPEGHPLRTDTRA"
FT   gene            complement(639342..640349)
FT                   /locus_tag="MRA_0554"
FT   CDS_pept        complement(639342..640349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0554"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72277"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZS7"
FT                   /protein_id="ABQ72277.1"
FT                   /translation="MEPVSALFLTRPFAEAVVAEQKPDEWDTTVTTGSAKLDSPAVSKR
FT                   PLRWLTEQITLAGMRPPISPQLLINRPAMQPVDLTGKRILLTGASSGIGAAATKQFGLH
FT                   RAVVVAVARRKDLLDAVADRITGDGGTAMSLPCDLSDMEAIDALVEDVEKRIGGIDILI
FT                   NNAGRSIRRPLAESLERWHDVERTMVLNYYAPLRLIRGLAPGMLERGDGHIINVATWGV
FT                   LSEASPLFSVYNASKAALSAVSRIIETEWGSQGVHSTTLYYPLVATPMIAPTKAYDGLP
FT                   ALTAAEAAEWMVTAARTRPVRIAPRVAVAVNALDSIGPRWVNALMQRRNEQLNP"
FT   gene            complement(640322..641266)
FT                   /gene="menB"
FT                   /locus_tag="MRA_0555"
FT   CDS_pept        complement(640322..641266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menB"
FT                   /locus_tag="MRA_0555"
FT                   /product="naphthoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72278"
FT                   /db_xref="GOA:A5TZS8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR010198"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZS8"
FT                   /protein_id="ABQ72278.1"
FT                   /translation="MVAPAGEQGRSSTALSDNPFDAKAWRLVDGFDDLTDITYHRHVDD
FT                   ATVRVAFNRPEVRNAFRPHTVDELYRVLDHARMSPDVGVVLLTGNGPSPKDGGWAFCSG
FT                   GDQRIRGRSGYQYASGDTADTVDVARAGRLHILEVQRLIRFMPKVVICLVNGWAAGGGH
FT                   SLHVVCDLTLASREYARFKQTDADVGSFDGGYGSAYLARQVGQKFAREIFFLGRTYTAE
FT                   QMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLKFAFNLLDDGLVGQQLFAGE
FT                   ATRLAYMTDEAVEGRDAFLQKRPPDWSPFPRYF"
FT   gene            complement(641538..641951)
FT                   /locus_tag="MRA_0556"
FT   CDS_pept        complement(641538..641951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72279"
FT                   /db_xref="GOA:A5TZS9"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZS9"
FT                   /protein_id="ABQ72279.1"
FT                   /translation="MRASPTSPPEQVVVDASAMVDLLARTSDRCSAVRARLARTAMHAP
FT                   AHFDAEVLSALGRMQRAGALTVAYVDAALEELRQVPVTRHGLSSLLAGAWSRRDTLRLT
FT                   DALYVELAETAGLVLLTTDERLARAWPSAHAIG"
FT   gene            complement(641948..642214)
FT                   /locus_tag="MRA_0557"
FT   CDS_pept        complement(641948..642214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72280"
FT                   /db_xref="InterPro:IPR009956"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZT0"
FT                   /protein_id="ABQ72280.1"
FT                   /translation="MLSRRTKTIVVCTLVCMARLNVYVPDELAERARARGLNVSALTQA
FT                   AISAELENSATDAWLEGLEPRSTGARHDDVLGAIDAARDEFEA"
FT   gene            complement(642406..644121)
FT                   /gene="fadD8"
FT                   /locus_tag="MRA_0558"
FT   CDS_pept        complement(642406..644121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD8"
FT                   /locus_tag="MRA_0558"
FT                   /product="fatty-acid-CoA ligase FadD8"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72281"
FT                   /db_xref="GOA:A5TZT1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZT1"
FT                   /protein_id="ABQ72281.1"
FT                   /translation="MSTAGDDAVGVPPACGGRSDAVGVPQLARESGAMRDQDCSGELLR
FT                   SPTHNGHLLVGALKRHQNKPVLFLGDTRLTGGQLADRISQYIQAFEALGAGTGVAVGLL
FT                   SLNRPEVLMIIGAGQARGYRRTALHPLGSLADHAYVLNDAGISSLIIDPNPMFVERALA
FT                   LLEQVDSLQQILTIGPVPDALKHVAVDLSAEAAKYQPQPLVAADLPPDQVIGLTYTGGT
FT                   TGKPKGVIGTAQSIATMTSIQLAEWEWPANPRFLMCTPLSHAGAAFFTPTVIKGGEMIV
FT                   LAKFDPAEVLRIIEEQRITATMLVPSMLYALLDHPDSHTRDLSSLETVYYGASAINPVR
FT                   LAEAIRRFGPIFAQYYGQSEAPMVITYLAKGDHDEKRLTSCGRPTLFARVALLDEHGKP
FT                   VKQGEVGEICVSGPLLAGGYWNLPDETSRTFKDGWLHTGDLAREDSDGFYYIVDRVKDM
FT                   IVTGGFNVFPREVEDVVAEHPAVAQVCVVGAPDEKWGEAVTAVVVLRSNAARDEPAIEA
FT                   MTAEIQAAVKQRKGSVQAPKRVVVVDSLPLTGLGKPDKKAVRARFWEGAGRAVG"
FT   gene            644199..645803
FT                   /locus_tag="MRA_0559"
FT   CDS_pept        644199..645803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72282"
FT                   /db_xref="GOA:A5TZT2"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZT2"
FT                   /protein_id="ABQ72282.1"
FT                   /translation="MADADLVMTGTVLTVDDARPTAEAIAVADGRVIAVGDRSEVAGLV
FT                   GANTRVIDLGAGCVMPGFVEAHGHPLLEAVVLSDRFVDIRPVTMRDADDVVAAIRGEVA
FT                   RRGPAGAYLVGWDPLLQSGLGEPTLTWLDSLAPNGPLVIIHNSGHKAYFNSHAAWLNGL
FT                   TRDTADPKGAKYGRDGNGELDGTAEEIGAILPLLAGVADPSNFGAMLRAECARLNRAGL
FT                   TTCSEMAFDPGYRPMVEAVRAELTVRLCTYEISNARMCTDATPGQGDDMLRQVGIKIWV
FT                   DGSPWVGNIDLTFPYLDTPATRAIGVPPGSRGCANYTREQLAEIVGAYFPRGWQIACHV
FT                   HGDGGVDTILDVYEEALRRNPRDDHRLRLEHVGAIRPDQLRRAAELGVTCSIFVDQIHY
FT                   WGDVIVDDLFGAQRGSRWMPAGSAVAAGMRISLHNDPPVTPEEPLRNISVAATRVAPSG
FT                   RVLAPEERLTVEQAIRAQTIDAAWQLFAEDAIGSLQVGKYADMVVLSADPRTVPPEQIA
FT                   DLAVRATFLAGRQVYRR"
FT   gene            645800..646780
FT                   /gene="menC"
FT                   /locus_tag="MRA_0560"
FT   CDS_pept        645800..646780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menC"
FT                   /locus_tag="MRA_0560"
FT                   /product="O-succinylbenzoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72283"
FT                   /db_xref="GOA:A5TZT3"
FT                   /db_xref="InterPro:IPR010196"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="InterPro:IPR041338"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TZT3"
FT                   /protein_id="ABQ72283.1"
FT                   /translation="MIPVLPPLEALLDRLYVVALPMRVRFRGITTREVALIEGPAGWGE
FT                   FGAFVEYQSAQACAWLASAIETAYCAPPPVRRDRVPINATVPAVAAAQVGEVLARFPGA
FT                   RTAKVKVAEPGQSLADDIERVNAVRELVPMVRVDANGGWGVAEAVAAAAALTADGPLEY
FT                   LEQPCATVAELAELRRRVDVPIAADESIRKAEDPLAVVRAQAADIAVLKVAPLGGISAL
FT                   LDIAARIAVPVVVSSALDSAVGIAAGLTAAAALPELDHACGLGTGGLFEEDVAEPAAPV
FT                   DGFLAVARTTPDPARLQALGAPPQRRQWWIDRVKACYSLLVPSFG"
FT   gene            646777..647565
FT                   /gene="bpoC"
FT                   /locus_tag="MRA_0561"
FT   CDS_pept        646777..647565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bpoC"
FT                   /locus_tag="MRA_0561"
FT                   /product="putative bromoperoxidase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72284"
FT                   /db_xref="GOA:A5TZT4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZT4"
FT                   /protein_id="ABQ72284.1"
FT                   /translation="MINLAYDDNGTGDPVVFIAGRGGAGRTWHPHQVPAFLAAGYRCIT
FT                   FDNRGIGATENAEGFTTQTMVADTAALIETLDIAPARVVGVSMGAFIAQELMVVAPELV
FT                   SSAVLMATRGRLDRARQFFNKAEAELYDSGVQLPPTYDARARLLENFSRKTLNDDVAVG
FT                   DWIAMFSMWPIKSTPGLRCQLDCAPQTNRLPAYRNIAAPVLVIGFADDVVTPPYLGREV
FT                   ADALPNGRYLQIPDAGHLGFFERPEAVNTAMLKFFASVKA"
FT   gene            647608..649272
FT                   /gene="menD"
FT                   /locus_tag="MRA_0562"
FT   CDS_pept        647608..649272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menD"
FT                   /locus_tag="MRA_0562"
FT                   /product="2-oxoglutarate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72285"
FT                   /db_xref="GOA:A5TZT5"
FT                   /db_xref="InterPro:IPR004433"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TZT5"
FT                   /protein_id="ABQ72285.1"
FT                   /translation="MNPSTTQARVVVDELIRGGVRDVVLCPGSRNAPLAFALQDADRSG
FT                   RIRLHVRIDERTAGYLAIGLAIGAGAPVCVAMTSGTAVANLGPAVVEANYARVPLIVLS
FT                   ANRPYELLGTGANQTMEQLGYFGTQVRASISLGLAEDAPERTSALNATWRSATCRVLAA
FT                   ATGARTANAGPVHFDIPLREPLVPDPEPLGAVTPPGRPAGKPWTYTPPVTFDQPLDIDL
FT                   SVDTVVISGHGAGVHPNLAALPTVAEPTAPRSGDNPLHPLALPLLRPQQVIMLGRPTLH
FT                   RPVSVLLADAEVPVFALTTGPRWPDVSGNSQATGTRAVTTGAPRPAWLDRCAAMNRHAI
FT                   AAVREQLAAHPLTTGLHVAAAVSHALRPGDQLVLGASNPVRDVALAGLDTRGIRVRSNR
FT                   GVAGIDGTVSTAIGAALAYEGAHERTGSPDSPPRTIALIGDLTFVHDSSGLLIGPTEPI
FT                   PRSLTIVVSNDNGGGIFELLEQGDPRFSDVSSRIFGTPHDVDVGALCRAYHVESRQIEV
FT                   DELGPTLDQPGAGMRVLEVKADRSSLRQLHAAIKAAL"
FT   gene            649269..649784
FT                   /locus_tag="MRA_0563"
FT   CDS_pept        649269..649784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0563"
FT                   /product="putative conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72286"
FT                   /db_xref="GOA:A5TZT6"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZT6"
FT                   /protein_id="ABQ72286.1"
FT                   /translation="MISPKPLLHILIHGLSDELPDTRGRIVLRWLRIAVLIVTGLVTLQ
FT                   SVLLVAGAWRNDIAIQRNMGVAQAEVLSAGPRRSTIEFVTPDRITYRPQLGVLYPSELS
FT                   TGMRIYVEYNKRDPNLVRVQHRNAGLAIIPAGSIAVVAWLIAAAALVVLAVLDKRLERR
FT                   ENSASATG"
FT   gene            649846..650982
FT                   /gene="pimB"
FT                   /locus_tag="MRA_0564"
FT   CDS_pept        649846..650982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pimB"
FT                   /locus_tag="MRA_0564"
FT                   /product="Mannosyltransferase PimB"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72287"
FT                   /db_xref="GOA:A5TZT7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZT7"
FT                   /protein_id="ABQ72287.1"
FT                   /translation="MCGVRVAIVAESFLPQVNGVSNSVVKVLEHLRRTGHEALVIAPDT
FT                   PPGEDRAERLHDGVRVHRVPSRMFPKVTTLPLGVPTFRMLRALRGFDPDVVHLASPALL
FT                   GYGGLHAARRLGVPTVAVYQTDVPGFASSYGIPMTARAAWAWFRHLHRLADRTLAPSTA
FT                   TMESLIAQGIPRVHRWARGVDVQRFAPSARNEVLRRRWSPDGKPIVGFVGRLAPEKHVD
FT                   RLTGLAASGAVRLVIVGDGIDRARLQSAMPTAVFTGARYGKELAEAYASMDVFVHSGEH
FT                   ETFCQVVQEALASGLPVIAPDAGGPRDLITPHRTGLLLPVGEFEHRLPDAVAHLVHERQ
FT                   RYALAARRSVLGRSWPVVCDELLGHYEAVRGRRTTQAA"
FT   gene            650999..651703
FT                   /gene="menH"
FT                   /locus_tag="MRA_0565"
FT   CDS_pept        650999..651703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menH"
FT                   /locus_tag="MRA_0565"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72288"
FT                   /db_xref="GOA:A5TZT8"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TZT8"
FT                   /protein_id="ABQ72288.1"
FT                   /translation="MSRAALDKDPRDVASMFDGVARKYDLTNTVLSLGQDRYWRRATRS
FT                   ALRIGPGQKVLDLAAGTAVSTVELTKSGAWCVAADFSVGMLAAGAARKVPKVAGDATRL
FT                   PFGDDVFDAVTISFGLRNVANQQAALREMARVTRPGGRLLVCEFSTPTNALFATAYKEY
FT                   LMRALPRVARAVSSNPEAYEYLAESIRAWPDQAVLAHQISRAGWSGVRWRNLTGGIVAL
FT                   HAGYKPGKQTPQ"
FT   gene            complement(651717..652055)
FT                   /locus_tag="MRA_0566"
FT   CDS_pept        complement(651717..652055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0566"
FT                   /product="putative conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72289"
FT                   /db_xref="InterPro:IPR007969"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZT9"
FT                   /protein_id="ABQ72289.1"
FT                   /translation="MKGTKLAVVVGMTVAAVSLAAPAQADDYDAPFNNTIHRFGIYGPQ
FT                   DYNAWLAKISCERLSRGVDGDAYKSATFLQRNLPRGTTQGQAFQFLGAAIDHYCPEHVG
FT                   VLQRAGTR"
FT   gene            complement(652089..652814)
FT                   /locus_tag="MRA_0567"
FT   CDS_pept        complement(652089..652814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0567"
FT                   /product="putative benzoquinone methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72290"
FT                   /db_xref="GOA:A5TZU0"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TZU0"
FT                   /protein_id="ABQ72290.1"
FT                   /translation="MSTVLTYIRAVDIYEHMTESLDLEFESAYRGESVAFGEGVRPPWS
FT                   IGEPQPELAALIVQGKFRGDVLDVGCGEAAISLALAERGHTTVGLDLSPAAVELARHEA
FT                   AKRGLANASFEVADASSFTGYDGRFDTIVDSTLFHSMPVESREGYLQSIVRAAAPGASY
FT                   FVLVFDRAAIPEGPINAVTEDELRAAVSKYWIIDEIKPARLYARFPAGFAGMPALLDIR
FT                   EEPNGLQSIGGWLLSAHLG"
FT   gene            complement(652839..654065)
FT                   /locus_tag="MRA_0568"
FT   CDS_pept        complement(652839..654065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0568"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72291"
FT                   /db_xref="GOA:A5TZU1"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZU1"
FT                   /protein_id="ABQ72291.1"
FT                   /translation="MSVDDSADVVVVGAGPAGSAAAAWAARAGRDVLVIDTATFPRDKP
FT                   CGDGLTPRAVAELHQLGLGKWLADHIRHRGLRMSGFGGEVEVDWPGPSFPSYGSAVARL
FT                   ELDDRIRKVAEDTGARMLLGAKAVAVHHDSSRRVVSLTLADGTEVGCRQLIVADGARSP
FT                   LGRKLGRRWHRETVYGVAVRGYLSTAYSDDPWLTSHLELRSPDGAVLPGYGWIFPLGNG
FT                   EVNIGVGALSTSRRPADLALRPLISYYTDLRRDEWGFTGQPRAVSSALLPMGGAVSGVA
FT                   GSNWMLIGDAAACVNPLNGEGIDYGLETGRLAAELLDSRDLARLWPSLLADRYGRGFSV
FT                   ARRLALLLTFPRFLPTTGPITMRSTALMNIAVRVMSNLVTDDDRDWVARVWRGGGQLSR
FT                   LVDRRPPFS"
FT   gene            654081..655088
FT                   /gene="grcC1"
FT                   /locus_tag="MRA_0569"
FT   CDS_pept        654081..655088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grcC1"
FT                   /locus_tag="MRA_0569"
FT                   /product="putative polyprenyl-diphosphate synthase GrcC1"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72292"
FT                   /db_xref="GOA:A5TZU2"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZU2"
FT                   /protein_id="ABQ72292.1"
FT                   /translation="MRTPATVVAGVDLGDAVFAAAVRAGVARVEQLMDTELRQADEVMS
FT                   DSLLHLFNAGGKRFRPLFTVLSAQIGPQPDAAAVTVAGAVIEMIHLATLYHDDVMDEAQ
FT                   VRRGAPSANAQWGNNVAILAGDYLLATASRLVARLGPEAVRIIADTFAQLVTGQMRETR
FT                   GTSENVDSIEQYLKVVQEKTGSLIGAAGRLGGMFSGATDEQVERLSRLGGVVGTAFQIA
FT                   DDIIDIDSESDESGKLPGTDVREGVHTLPMLYALRESGPDCARLRALLNGPVDDDAEVR
FT                   EALTLLRASPGMARAKDVLAQYAAQARHELALLPDVPGRRALAALVDYTVSRHG"
FT   gene            655189..656049
FT                   /gene="htpX"
FT                   /locus_tag="MRA_0570"
FT   CDS_pept        655189..656049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpX"
FT                   /locus_tag="MRA_0570"
FT                   /product="heat shock protein HtpX"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72293"
FT                   /db_xref="GOA:A5TZU3"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TZU3"
FT                   /protein_id="ABQ72293.1"
FT                   /translation="MTWHPHANRLKTFLLLVGMSALIVAVGALFGRTALMLAALFAVGM
FT                   NVYVYFNSDKLALRAMHAQPVSELQAPAMYRIVRELATSAHQPMPRLYISDTAAPNAFA
FT                   TGRNPRNAAVCCTTGILRILNERELRAVLGHELSHVYNRDILISCVAGALAAVITALAN
FT                   MAMWAGMFGGNRDNANPFALLLVALLGPIAATVIRMAVSRSREYQADESGAVLTGDPLA
FT                   LASALRKISGGVQAAPLPPEPQLASQAHLMIANPFRAGERIGSLFSTHPPIEDRIRRLE
FT                   AMARG"
FT   gene            complement(656234..657259)
FT                   /gene="gpsA1"
FT                   /locus_tag="MRA_0571"
FT   CDS_pept        complement(656234..657259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA1"
FT                   /locus_tag="MRA_0571"
FT                   /product="NAD(P)H-dependent glycerol-3-phosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72294"
FT                   /db_xref="GOA:A5TZU4"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZU4"
FT                   /protein_id="ABQ72294.1"
FT                   /translation="MAANKREPKVVVLGGGSWGTTVASICARRGPTLQWVRSAVTAQDI
FT                   NDNHRNSRYLGNDVVLSDTLRATTDFTEAANCADVVVMGVPSHGFRGVLVELSKELRPW
FT                   VPVVSLVKGLEQGTNMRMSQIIEEVLPGHPAGILAGPNIAREVAEGYAAAAVLAMPDQH
FT                   LATRLSAMFRTRRFRVYTTDDVVGVETAGALKNVFAIAVGMGYSLGIGENTRALVIARA
FT                   LREMTKLGVAMGGKSETFPGLAGLGDLIVTCTSQRSRNRHVGEQLGAGKPIDEIIASMS
FT                   QVAEGVKAAGVVMEFANEFGLNMPIAREVDAVINHGSTVEQAYRGLIAEVPGHEVHGSG
FT                   F"
FT   gene            complement(657320..658780)
FT                   /locus_tag="MRA_0572"
FT   CDS_pept        complement(657320..658780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0572"
FT                   /product="putative monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72295"
FT                   /db_xref="GOA:A5TZU5"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZU5"
FT                   /protein_id="ABQ72295.1"
FT                   /translation="MSVTPNAGCVDVVIVGAGISGLGAAYRIIERNPQLTYTILERRAR
FT                   IGGTWDLFRYPGVRSDSSIFTLSFPYEPWTREEGIADGAHIREYLTDMAHKYGIDRHIE
FT                   FNSYVRAADWDSSTDTWTVTFEQNGVHKHYRSRFVFFGSGYYNYDEGYTPDFGGIEKFG
FT                   GAVVHPQHWPEDLDYTGKKIVVIGSGATAVTLIPSLTDRAEKVTMLQRSPTYLISASKY
FT                   STFAAVVRKALPPKTSHLIVRMYNALLEAVFWFLSRKTPVFVKWLLRRTAIKNLPEGYD
FT                   IETHFTPRYNPWDQRLCLIPDADLYNAITSGRAEVVTDHIDHFDATGIALKSGGHLDAD
FT                   IIVTATGLQLQALGGAAISLDGVEIDPRDRFVYKAHMLEDVPNLFWCVGYTNASWTLRA
FT                   DMTARATAKLLAHMAAHGHTRAAPHLGDEPMDEKPSWDIQAGYVKRAPYALPKSGTKRP
FT                   WNVRQNYLADAIDYRFDRIEEAMVFGAA"
FT   gene            complement(658858..659349)
FT                   /locus_tag="MRA_0573"
FT   CDS_pept        complement(658858..659349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72296"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5TZU6"
FT                   /protein_id="ABQ72296.1"
FT                   /translation="MADSSFDIVSKVDRQEVDNALNQAAKELATRFDFRGTDTKIAWKG
FT                   DEAVELTSSTEERVKAAVDVFKEKLIRRDISLKAFEAGEPQASGKTYKVTGALKQGISS
FT                   ENAKKITKLIRDAGPKNVKTQIQGDEVRVTSKKRDDLQAVIAMLKKADLDVALQFVNYR
FT                   "
FT   gene            659419..659499
FT                   /locus_tag="MRA_t05"
FT   tRNA            659419..659499
FT                   /locus_tag="MRA_t05"
FT                   /product="tRNA-Tyr"
FT   gene            659631..660650
FT                   /locus_tag="MRA_0574"
FT   CDS_pept        659631..660650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0574"
FT                   /product="tetracenpmycin polyketide synthesis
FT                   8-o-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72297"
FT                   /db_xref="GOA:A5TZU7"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031725"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZU7"
FT                   /protein_id="ABQ72297.1"
FT                   /translation="MELSPDRIMAIGGGYGPSKVLLTAVGLGLFTELGDEAMTAEAIAD
FT                   RLGLLKRPAIDFLDALVSLDLLARDGDGPGSHYRNTPETAHFLDEARPTYAGGLLKIWN
FT                   ERNYRFWADLTEALKTGKAQSEVKQTGRPFFEALYADPRRLEAFMAAMDAASRRNIELL
FT                   AKRFPFERYRRLCDVGCADGLLSRIVAAAHPHLQCVSFDLPAVTEIARRKLTAEGLGER
FT                   VQACAGDFLADPLPAADVITMGQILHDWNLDRKQQLVAKAYEALSKEGAFIVIETLIDD
FT                   ARRENTTGLMMSLNMLIEFGDAFDYSAADFRGWCGEAGFRSFEVIPLAGGSSAAVAYK"
FT   gene            660760..662178
FT                   /gene="cyp135B1"
FT                   /locus_tag="MRA_0575"
FT   CDS_pept        660760..662178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyp135B1"
FT                   /locus_tag="MRA_0575"
FT                   /product="putative cytochrome p450 135B1 Cyp135B1"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72298"
FT                   /db_xref="GOA:A5TZU8"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZU8"
FT                   /protein_id="ABQ72298.1"
FT                   /translation="MSGTSSMGLPPGPRLSGSVQAVLMLRHGLRFLTACQRRYGSVFTL
FT                   HVAGFGHMVYLSDPAAIKTVFAGNPSVFHAGEANSMLAGLLGDSSLLLIDDDVHRDRRR
FT                   LMSPPFHRDAVARQAGPIAEIAAANIAGWPMAKAFAVAPKMSEITLEVILRTVIGASDP
FT                   VRLAALRKVMPRLLNVGPWATLALANPSLLNNRLWSRLRRRIEEADALLYAEIADRRAD
FT                   PDLAARTDTLAMLVRAADEDGRTMTERELRDQLITLLVAGHDTTATGLSWALERLTRHP
FT                   VTLAKAVQAADASAAGDPAGDEYLDAVAKETLRIRPVVYDVGRVLTEAVEVAGYRLPAG
FT                   VMVVPAIGLVHASAQLYPDPERFDPDRMVGATLSPTTWLPFGGGNRRCLGATFAMVEMR
FT                   VVLREILRRVELSTTTTSGERPKLKHVIMVPHRGARIRVRATRDVSATSQATAQGAGCP
FT                   AARGGGPSRAVGSQ"
FT   gene            662313..662579
FT                   /locus_tag="MRA_0576"
FT   CDS_pept        662313..662579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72299"
FT                   /db_xref="InterPro:IPR015035"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZU9"
FT                   /protein_id="ABQ72299.1"
FT                   /translation="MKAKVGDWLVIKGATIDQPDHRGLIIEVRSSDGSPPYVVRWLETD
FT                   HVATVIPGPDAVVVTAEEQNAADERAQHRFGAVQSAILHARGT"
FT   gene            662605..664683
FT                   /gene="nrdZ"
FT                   /locus_tag="MRA_0577"
FT   CDS_pept        662605..664683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdZ"
FT                   /locus_tag="MRA_0577"
FT                   /product="putative ribonucleoside-diphosphate reductase
FT                   subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72300"
FT                   /db_xref="GOA:A5TZV0"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZV0"
FT                   /protein_id="ABQ72300.1"
FT                   /translation="MGVSWPAKVRRRDGTLVPFDIARIEAAVTRAAREVACDDPDMPGT
FT                   VAKAVADALGRGIAPVEDIQDCVEARLGEAGLDDVARVYIIYRQRRAELRTAKALLGVR
FT                   DELKLSLAAVTVLRERYLLHDEQGRPAESTGELMDRSARCVAAAEDQYEPGSSRRWAER
FT                   FATLLRNLEFLPNSPTLMNSGTDLGLLAGCFVLPIEDSLQSIFATLGQAAELQRAGGGT
FT                   GYAFSHLRPAGDRVASTGGTASGPVSFLRLYDSAAGVVSMGGRRRGACMAVLDVSHPDI
FT                   CDFVTAKAESPSELPHFNLSVGVTDAFLRAVERNGLHRLVNPRTGKIVARMPAAELFDA
FT                   ICKAAHAGGDPGLVFLDTINRANPVPGRGRIEATNPCGEVPLLPYESCNLGSINLARML
FT                   ADGRVDWDRLEEVAGVAVRFLDDVIDVSRYPFPELGEAARATRKIGLGVMGLAELLAAL
FT                   GIPYDSEEAVRLATRLMRRIQQAAHTASRRLAEERGAFPAFTDSRFARSGPRRNAQVTS
FT                   VAPTGTISLIAGTTAGIEPMFAIAFTRAIVGRHLLEVNPCFDRLARDRGFYRDELIAEI
FT                   AQRGGVRGYPRLPAEVRAAFPTAAEIAPQWHLRMQAAVQRHVEAAVSKTVNLPATATVD
FT                   DVRAIYVAAWKAKVKGITVYRYGSREGQVLSYAAPKPLLAQADTEFSGGCAGRSCEF"
FT   gene            complement(664797..666128)
FT                   /locus_tag="MRA_0578"
FT   CDS_pept        complement(664797..666128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0578"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72301"
FT                   /db_xref="GOA:A5TZV1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZV1"
FT                   /protein_id="ABQ72301.1"
FT                   /translation="MKLFDDRGDAGRQLAQRLAQLSGKAVVVLGLPRGGVPVAFEVAKS
FT                   LQAPLDVLVVRKLGVPFQPELAFGAIGEDGVRVLNDDVVRGTHLDAAAMDAVERKQLIE
FT                   LQRRAERFRRGRDRIPLTGRIAVIVDDGIATGATAKAACQVARAHGADKVVLAVPIGPD
FT                   DIVARFAGYADEVVCLATPALFFAVGQGYRNFTQTSDDEVVAFLDRAHRDFAEAGAIDA
FT                   AADPPLRDEEVQVVAGPVPVAGHLTVPEKPRGIVVFAHGSGSSRHSIRNRYVAEVLTGA
FT                   GFATLLFDLLTPEEERNRANVFDIELLASRLIDVTGWLATQPDTASLPVGYFGASTGAG
FT                   AALVAAADPRVNVRAVVSRGGRPDLAGDSLGSVVAPTLLIVGGRDQVVLELNQRAQAVI
FT                   PGKCQLTVVPGATHLFEEPGTLEQVAKLACDWFIDHLCGPGPSG"
FT   gene            complement(666352..666693)
FT                   /locus_tag="MRA_0579"
FT   CDS_pept        complement(666352..666693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72302"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZV2"
FT                   /protein_id="ABQ72302.1"
FT                   /translation="MGEHAIKRHMRQRKPTKHPLAQKRGARILVFTDDPRRSVLIVPGC
FT                   HLDSMRREKNAYYFQDGNALVGMVVSGGTVEYDADDRTYVVQLTDGRHTTESSFEHSSP
FT                   SRSPQSDDL"
FT   gene            complement(667161..668552)
FT                   /locus_tag="MRA_0580"
FT   CDS_pept        complement(667161..668552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0580"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72303"
FT                   /db_xref="GOA:A5TZV3"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZV3"
FT                   /protein_id="ABQ72303.1"
FT                   /translation="MAIRQHVGALFTDLYEVTMAQAYWAERMSGTAVFEIFFRKLPPGR
FT                   SYIMAAGLADVVEFLEAFRFDEQDLRYLRGLGQFSDEFLRWLAGVRFTGDVWAAPEGTV
FT                   IFPNEPAVQLIAPIIEAQLVETFVLNQIHLQSVLASKAARVVAAARGRPVVDFGARRAH
FT                   GTDAACKVARTSYLAGAAGTSNLLAARQYGIPTFGTMAHSFVQAFDSEVAAFEAFARLY
FT                   PATMLLVDTYDTLRGVDHVIELAKRLGNRFDVRAVRLDSGDLDELSKATRARLDTAGLE
FT                   QVEIFASSGLDENRIAALLAARCPIDGFGVGTQLVVAQDAPALDMAYKLVAYDGSGRTK
FT                   FSSGKVIYPGRKQVFRKLEHGVFCGDTLGEHGENLPGDPLLVPIMTNGRRIRQHAPTLD
FT                   GARDWARQQIDALPPELRSLEDTGYSYPVAVSDRIVGELARLRHADTAEAHPGSNVVGA
FT                   KAKRP"
FT   gene            complement(668562..669704)
FT                   /locus_tag="MRA_0581"
FT   CDS_pept        complement(668562..669704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0581"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72304"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZV4"
FT                   /protein_id="ABQ72304.1"
FT                   /translation="MAGNPDVVTVLLGGDVMLGRGVDQILPHPGKPQLRERYMRDATGY
FT                   VRLAERVNGRIPLPVDWRWPWGEALAVLENTATDVCLINLETTITADGEFADRKPVCYR
FT                   MHPDNVPALTALRPHVCALANNHILDFGYQGLTDTVAALAGAGIQSVGAGADLLAARRS
FT                   ALVTVGHERRVIVGSVAAESSGVPESWAARRDRPGVWLIRDPAQRDVADDVAAQVLADK
FT                   RPGDIAIVSMHWGSNWGYATAPGDVAFAHRLIDAGIDMVHGHSSHHPRPIEIYRGKPIL
FT                   YGCGDVVDDYEGIGGHESFRSELRLLYLTVTDPASGNLISLQMLPLRVSRMRLQRASQT
FT                   DTEWLRNTIERISRRFGIRVVTRPDNLLEVVPAANLTSKE"
FT   gene            complement(669889..671055)
FT                   /locus_tag="MRA_0582"
FT   CDS_pept        complement(669889..671055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72305"
FT                   /db_xref="GOA:A5TZV5"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZV5"
FT                   /protein_id="ABQ72305.1"
FT                   /translation="MKVAISGAGVAGAALAHWLQRTGHTPTVIERAPKFRTGGYMIDFW
FT                   GVGYQVAKRMGITDQIAAAGYHMEHVRSVGPTGKVKADLGVDVFRRMVGDDFTSLPRGD
FT                   LAAAIYTTIEDQVETIFDDSIATIDEHRDGVRLTFERTAPRDFDLVIGADGLHSNVRRL
FT                   VFGPERDFEHYLGCKVAACVVDGYRPRDERSYVLYNTVDRQLARFALRGDRTMFLFVFR
FT                   AEHDNPGVAPKDELRDQFGDVGWESRDILAALDDVEDLYFDVVSQIRMDRWSRGRVLLI
FT                   GDAAGCISLLGGEGTGLAITEAYVLAGELARAGGDHRRAFDAYEKRLRPFIEGKQASAA
FT                   KFIWFFATRTRFGLWFRNVAMRTMNFGPLATLFAGSVRDDFELPDYTW"
FT   gene            671158..672462
FT                   /locus_tag="MRA_0583"
FT   CDS_pept        671158..672462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0583"
FT                   /product="ArsR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72306"
FT                   /db_xref="GOA:A5TZV6"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR017520"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZV6"
FT                   /protein_id="ABQ72306.1"
FT                   /translation="MLEVAAEPTRRRLLQLLAPGERTVTQLASQFTVTRSAISQHLGML
FT                   AEAGLVTARKQGRERYYRLDERGVLRLRALMESFWSDELDRLVADAAHYPPSQGDCAMP
FT                   FEKAVVVPLDPTSTFALITQPDRLRRWMAVAARIELRTGGAYRWTVTPGHSAAGTVIDV
FT                   DPGKRVVFTWGWEDHGDPPPGGSTVTITLTPVDGGTEVRLVHDGLTAQQAARHAKGWNH
FT                   FLDRLVVAGQRGDAGPDEWAAAPDPLDELSCAEATLAVLQHVLRGIGASDLTRQTPCTE
FT                   YDVSQLADHLLRSLAIIGAAAGAQLAPRDVDAPLETQVADAAQAVMEAWRRRGLAGTVE
FT                   LNSNQVPATVPVGILCLEFLVHAWDFAIATGSQVIASEPVSEYVLAVAGKVITPATRNS
FT                   AGFAAPAAVGSFAPVLDRLIAFTGRQPTAGHVSAT"
FT   gene            672476..673261
FT                   /locus_tag="MRA_0584"
FT   CDS_pept        672476..673261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0584"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72307"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZV7"
FT                   /protein_id="ABQ72307.1"
FT                   /translation="MPKRSEYRQGTPNWVDLQTTDQSAAKKFYTSLFGWGYDDNPVPGG
FT                   GGVYSMATLNGEAVAAIAPMPPGAPEGMPPIWNTYIAVDDVDAVVDKVVPGGGQVMMPA
FT                   FDIGDAGRMSFITDPTGAAVGLWQANRHIGATLVNETGTLIWNELLTDKPDLALAFYEA
FT                   VVGLTHSSMEIAAGQNYRVLKAGDAEVGGCMEPPMPGVPNHWHVYFAVDDADATAAKAA
FT                   AAGGQVIAEPADIPSVGRFAVLSDPQGAIFSVLKPAPQQ"
FT   gene            complement(673306..677226)
FT                   /locus_tag="MRA_0585"
FT   CDS_pept        complement(673306..677226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0585"
FT                   /product="PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72308"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZV8"
FT                   /protein_id="ABQ72308.1"
FT                   /translation="MSFVIATPEMLTTAATDLAKIGSTITAANTAAAAVAKVLPASADE
FT                   VSVAVAALFGTHAQEYQTVSAQVATFHDRFVQTLSAAASSYVAAEAVNVEQSLLAAVNA
FT                   PTQALFGRPLIGNGADGSPGTGQAGGPGGILYGNGGNGGSGAPGQRGGAGGAAGLIGNG
FT                   GNGGAGGVGTTGGAGGHGGAGGWLYGNGGAGGFGGAGAVGGNGGAGGTAGLFGVGGAGG
FT                   AGGNGIAGVTGTSASTPGGSGTAGGAGGIGGNGGAGGAGGVLMGNGGNGGAGGRGGPGG
FT                   AGGAGASGAHATNLGADGQAGGNGGNGGAGGTGGVGGPGGGHGLLGLGGSHGAGGAGGS
FT                   GGDGGAPGDGGNGATGTWGHNLGAGGTGGNGGNPGAGGAGGAGGASVGGSAHGANGAPG
FT                   TTSTSGGNGGDGGKGADAISSGQTGANGGRGGDGGQVGNGGAGGAGGRGGAGGLGFGSE
FT                   APGRPGGAGGTGGAGGNGGTQAGDGGTGGAGGAGGDGGSGGAGSIGFNASAPGAAGSPG
FT                   GNGGNGGPGGAGGEGGAGGLALAASGQNGSQGAGGDGGAGGNGGTPGNGGHGAAGALGV
FT                   NGGVGGAGGHGGDPGVGGAGGQGGSGSTPGANGAPGNTPTSGGNGGNGGRGADATGFGQ
FT                   TGASGGRGGDGGLVGNGGAGGAGGNGSKGLPGLGRLGNPGLDGGTGGNGGAGGSGGAWA
FT                   GNGGTGGAGGTGGVGGTGGSGSDGVNGSSAGADGHPGGTGGVGGTGGKGGDGGDGGAAP
FT                   NGVAGSQGPGGAGGDGGTGGVGGNGGRGIDGADGATAGARGQDGGAGGAGGKGGRGGTG
FT                   GPGGAGPAGTTGSQGAGGNGGSGGTGGDPGDGGNGANGSVFTNNGIGGNGGNGGNAGPS
FT                   GAGGSGGAGSTFGATGSSSSIHVNGGNGGNGGNGDHALSGNGAAGGNGGNGGNGSLRGS
FT                   GGAGGHGGNGGNASRGMGGDGGTGGAGGNAGQIGNGGAGGNGGDGGTGSDGNPGAITGS
FT                   GGRGGDGGVGGQGGSVAGDGADGGRGGAGGTGGTGLRGTTGATGATGTFDAGADGHGGN
FT                   GGTGGVGGTGGAGGGGGNGGAGGKALSPTGNNGSQGAGGDGGAGGAGGTGGTGGDGGRG
FT                   AHGTLFSSLAGTGGTGGNGGTGGTGGTGGAGGAGGTGSTLGATGATGAAGRAGNGGVGG
FT                   SGGLGSAFGPGGTGGMGGAGGTSTVSAGGDGGRGGFGGDGLDASSGGNGGDGGHGGDGF
FT                   RTAGAGGRGGDGGKGADPGGLFPIPGAGGKGGTGGTGGTAHLGPLAIIGQSGQPGQFGS
FT                   PGADGRGGAGGAGGGGGAGGSF"
FT   gene            677548..678306
FT                   /locus_tag="MRA_0586"
FT   CDS_pept        677548..678306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0586"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72309"
FT                   /db_xref="InterPro:IPR002782"
FT                   /db_xref="InterPro:IPR027798"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZV9"
FT                   /protein_id="ABQ72309.1"
FT                   /translation="MVGYVDVRAYAELNEFVELQARGLTVRRPFRSHQTVKDVLEAMGI
FT                   PHTEVDLILVNGDPADFSYRPVAGDRIAAYPMFEALDIGSTARLRPAPLRNPRFVVDVN
FT                   LGQLARLLRLLGFDTRWSSAADDPTLADISLGEQRILLTRDRGLLKRRAITHGLFVHSQ
FT                   HPEEQALEVLRRLDLNGRLAPLSRCLRCNGELAAVSKDEVIGQLEPLTRRYYESFSRCF
FT                   GCGRIYWPGSHHARLVRLVERLRDQLTTST"
FT   gene            complement(678435..678926)
FT                   /locus_tag="MRA_0587"
FT   CDS_pept        complement(678435..678926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72310"
FT                   /db_xref="InterPro:IPR016791"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZW0"
FT                   /protein_id="ABQ72310.1"
FT                   /translation="MTDQSYAVDIAHPPAALLRLVNPILRSLLHTPLAGPLRTQLMVVS
FT                   FTGRKTGRHFSIPLSAHVIDNDLYALTEAGWKHNFSDGAAAQVVYDGKTTAMRGELIRD
FT                   RAVVSELFLRAAQAYGVKRGQRMLGLSFRDRRIPTLEEFAEAVDRLKLVAIRLTPADNS
FT                   "
FT   gene            679020..679235
FT                   /locus_tag="MRA_0588"
FT   CDS_pept        679020..679235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72311"
FT                   /db_xref="GOA:A5TZW1"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZW1"
FT                   /protein_id="ABQ72311.1"
FT                   /translation="MDKTTVYLPDELKAAVKRAARQRGVSEAQVIRESIRAAVGGAKPP
FT                   PRGGLYAGSEPIARRVDELLAGFGER"
FT   gene            complement(679037..679885)
FT                   /locus_tag="MRA_0589"
FT   CDS_pept        complement(679037..679885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72312"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZW2"
FT                   /protein_id="ABQ72312.1"
FT                   /translation="MAARWFIQQERQVADRRAEDGGDSQPRCGVRASTQRRRARRRDDD
FT                   VDGRRQRHRRADDHHALRDGSHAEDEHAAVQHRIGCGLRNDGEAPTADRPQRREVPTVQ
FT                   GEDRARAVSVGQHDVGRIRDPDPLILVFRDDAGGLLDFGGTAVGELPGPAGEFTQDGEL
FT                   GIDTYPGGDEIVEFRYHIRGYDERVCGAIDALRHCGVVWLGGVEIGKQRTRVDDHRSPK
FT                   PASSSSTRRAMGSEPAYRPPRGGGLAPPTAARMDSRITCASETPRCRAARFTAALSSSG
FT                   R"
FT   gene            complement(679699..680385)
FT                   /gene="lpqN"
FT                   /locus_tag="MRA_0590"
FT   CDS_pept        complement(679699..680385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpqN"
FT                   /locus_tag="MRA_0590"
FT                   /product="putative conserved lipoprotein LpqN"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72313"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="InterPro:IPR019674"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZW3"
FT                   /protein_id="ABQ72313.1"
FT                   /translation="MKHFTAAVATVALSLALAGCSFNIKTDSAPTTSPTTTSPTTSTTT
FT                   TSATTSAQAAGPNYTIADYIRDNHIQETPVHHGDPGSPTIDLPVPDDWRLLPESSRAPY
FT                   GGIVYTQPADPNDPPTIVAILSKLTGDIDPAKVLQFAPGELKNLPGFQGSGDGSAATLG
FT                   GFSAWQLGGSYSKNGKLRTVAQKTVVIPSQGAVFVLQLNADALDDETMTLMDAANVIDE
FT                   QTTITP"
FT   gene            680539..683172
FT                   /locus_tag="MRA_0591"
FT   CDS_pept        680539..683172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0591"
FT                   /product="putative conserved exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72314"
FT                   /db_xref="GOA:A5TZW4"
FT                   /db_xref="InterPro:IPR005887"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012939"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR041371"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZW4"
FT                   /protein_id="ABQ72314.1"
FT                   /translation="MRARRLRRALAALLAVAGLFVPFIVGVPTAYDGEPVFVAIPVEHV
FT                   NTLIGTGTGAAIVGEINNFPGASVPFGMVQYSPDTVDNYAGYDYDNPHSTGFSMTHASV
FT                   GCPAFGDISMLPTTTPLGSQPWSAWEEIAHDDTEVGVPGYYTVRFPGTGVIAELTATTR
FT                   TGVGRFRYPRNGWPALFHVRSGASLAGNYAATLQIEDNTTITGSATSGGFCGKKNLYTV
FT                   YFAMKFSQPFSSYGTWDGYAVYPGSHSMNSSYSGGYVGFPAGSVLEVRTALSYVSVDGA
FT                   RANLDAEGGASFDDIRAATSSEWNAALSRIAVAGRGPGDVDTFYTCLYRSLLHPNTFND
FT                   VDGRYIGFDGVIHSVASGHTHYANFSDWDTYRSLAPLQGLLFPQRASDMIQSLVTDAEQ
FT                   SGAYPRWALANSATGMMSGDSVVPLIVNLYAFGARDFDLKSALHYMVNAATQGGVGLDG
FT                   FLERPGIAAYLRLGYGPQTAEFRANGRIAGASVTLEWSVDDFAISRFADSLGDTATAAV
FT                   FQNRSQYWQNLFNPTTGYISPRSAAGFFPDGPGFVAYPSGFGQDGYDEGNAEQYLWWVP
FT                   HNVAGLVTALGGRTAVVKRLDRFTKKLNVGPNEPYLWAGNEPGFGVPWLYNYIGQPWKT
FT                   QRTVDRVRGLFGPTPGGAPGNDDLGALSSWYVWAALGLYPSTPGTTILTVNTPLFDRAV
FT                   IALPTGKSIQITAPGASGRNRLKYIDGLTIDRQPSNQTFLPESIVRTGGDLTFSLAGTP
FT                   NKVWGTAASAAPPSFGAGSSAVTVNIARPIIGIVPGATGTVTVDAQRMIDGVDDYTVTP
FT                   TSYVVGIAAEPLSGQFDDDGAVSASVAITVARSVPSGYYPIYVTTSAGDSARTLIVLVV
FT                   VAEAVE"
FT   gene            complement(683195..685582)
FT                   /locus_tag="MRA_0592"
FT   CDS_pept        complement(683195..685582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0592"
FT                   /product="putative conserved integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72315"
FT                   /db_xref="GOA:A5TZW5"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZW5"
FT                   /protein_id="ABQ72315.1"
FT                   /translation="MRVDGRDIGVSGNLLQPLTRRTNDIIRAVLAAIYLVAVITSSLIT
FT                   RPQWVALEKSISEIVGVLSPSQSDLVYLGYGLAILALPFVILIGLIVSRQWKLLGAYAA
FT                   AGLMAVLPLSISSSRIAAPRWHFDLSDRLATLLAQFLDDPRWIAMLAAVLTVSGPWLPA
FT                   RWRHWWWALLLAFVPIHLVVSAIVPARSLLGLAVGWLVGALVVLVVGTPALEVPLDGAI
FT                   RALAKRGFAVSGLAVVRPAGPGPLVLSAACEQPNAGACSEALIELYGPHQSGGGALRQL
FT                   WLKLTLRGTETAPLQASMRRAVEHRALMAIAFGDLGMANTTVIAVSPLDRGWTLYAHRP
FT                   ARGIGISECTKTTPTAHVWEALRTLHDQQISHGDLCSAEITVDNGAVLFGGFGEAEYGA
FT                   TDAQLQSDLAQLLVTTSALYDAEAAVTAAIDTFGKQAILAASRRLTKSAVPKRIRESIT
FT                   DPNAVIASTRAEVMRQTGADQIKAETITRFSRGQLIQLVLIGALVYVAYPFISTVPTFF
FT                   SQLRTANWWWALLGLAVSALTYVGAAAALWACADGLVGFWKLSIMQVANTFAATTTPAG
FT                   VGGLALSTRFLQKGGLTAVRATAAVALQQSVQVIVHLVLLILFSALAGTSTDLSHFVPN
FT                   ATVLYLIAGVALGIVGTFLFVPKLRRWLATAVRPKLREVTNDLIALAREPKRLALIVLG
FT                   CAGTTLGAALALWASIEAFGGGTTFVTVTVVTMVGGTLASAAPTPGGVGAVEAALIGGL
FT                   AAFGVPAALGVPSVLLYRLLTCWLPVFAGWQVMHWLTRHEMI"
FT   gene            685720..686442
FT                   /locus_tag="MRA_0593"
FT   CDS_pept        685720..686442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0593"
FT                   /product="GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72316"
FT                   /db_xref="GOA:A5TZW6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZW6"
FT                   /protein_id="ABQ72316.1"
FT                   /translation="MALQPVTRRSVPEEVFEQIATDVLTGEMPPGEALPSERRLAELLG
FT                   VSRPAVREALKRLSAAGLVEVRQGDVTTVRDFRRHAGLDLLPRLLFRNGELDISVVRSI
FT                   LEARLRNFPKVAELAAERNEPELAELLQDSLRALDTEEDPIVWQRHTLDFWDHVVDSAG
FT                   SIVDRLMYNAFRAAYEPTLAALTTTMTAAAKRPSDYRKLADAICSGDPTGAKKAAQDLL
FT                   ELANTSLMAVLVSQASRQ"
FT   gene            686439..687236
FT                   /gene="yrbE2A"
FT                   /locus_tag="MRA_0594"
FT   CDS_pept        686439..687236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrbE2A"
FT                   /locus_tag="MRA_0594"
FT                   /product="conserved hypothetical integral membrane protein
FT                   YrbE2a"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72317"
FT                   /db_xref="GOA:A5TZW7"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZW7"
FT                   /protein_id="ABQ72317.1"
FT                   /translation="MTTHAVIITYLRDQTQPAVDAIGGFYRTCVLTGKALVRRPFHWRE
FT                   AIEQGWFITSVSLLPTLAVSIPLTVLIIFTLNILLAEFGAADISGAGAALGAVTQLGPL
FT                   TTVLVIAGAGATAICADLGARTIREEIDAMEVLGIDPIHRLVVPRVVAATIVAALLNGA
FT                   VITIGLVGGFVFSVFIQHVSAGAYVGTLTLVTGLPEVIISVVKSATFGLIAGLVGCYRG
FT                   LTTKGGPKGVGTAVNETLVLCVIALFATNVVLTTIGVRFGTGH"
FT   gene            687238..688125
FT                   /gene="yrbE2B"
FT                   /locus_tag="MRA_0595"
FT   CDS_pept        687238..688125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrbE2B"
FT                   /locus_tag="MRA_0595"
FT                   /product="conserved hypothetical integral membrane protein
FT                   YrbE2b"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72318"
FT                   /db_xref="GOA:A5TZW8"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZW8"
FT                   /protein_id="ABQ72318.1"
FT                   /translation="MVESSTASAAAVLRARYPRTAASLDRYGGGTARRLERTGTFARFT
FT                   RISVVQIGWALRRYRRETLRLVAEIGMGTGAMAVVGGTVAIIGFVTLSGGSLIAIQGFA
FT                   SLGNIGVEAFTGFFAALANTRVAAPIVSGVALAATVGAGATAQLGAMRISEEIDALEVM
FT                   GIKSISFLVSTRILGGLVVIMPLYALALDMAFTSGQVVTTVFYGQSNGTYEHYFRTFLR
FT                   PEDVGWSVVEVVIIAVVVMITHCYYGYTASGGPVGVGQAVGRSMRFSLVSVVVVVLLAE
FT                   LALYGVDPNFNLTV"
FT   gene            688131..689345
FT                   /gene="mce2A"
FT                   /locus_tag="MRA_0596"
FT   CDS_pept        688131..689345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce2A"
FT                   /locus_tag="MRA_0596"
FT                   /product="MCE-family protein Mce2A"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72319"
FT                   /db_xref="GOA:A5TZW9"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZW9"
FT                   /protein_id="ABQ72319.1"
FT                   /translation="MPTLVTRKNRRAWLYVEGVVLLLVGALVLVLVYKQFRGEFTPKTE
FT                   LTMVAFRAGLVMEAGSKVTYNGVEIGRVGSISEIERDGRPAAKLVLDVNPRYISLIPVN
FT                   VVADIEAATLFGNKYVALSAPKIPQQQRISSHDVIDVGSVTTEFNTLFETITSIAEKVD
FT                   PIELNATLSAVAQALDGLGGKFGESIVNGNQILAQLNPRLPQLGYDVRRLADLGEVYVD
FT                   ASPDLWSFLQNALTTARTLTSQQRDLDAALLAATGAGNTGEDVFARGGPYLARAAADLV
FT                   PTATLLDTYSPELFCMIRNFHDAAPKVADAVGGNGYSLAAAGTILGAPNPYVYPDNLPR
FT                   VNAHGGPGGRPGCWQTITRELWPAPYLVMDTGASLAPYNHVELGQPMFTEYVWGRQYGE
FT                   NTINP"
FT   gene            689342..690169
FT                   /gene="mce2B"
FT                   /locus_tag="MRA_0597"
FT   CDS_pept        689342..690169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce2B"
FT                   /locus_tag="MRA_0597"
FT                   /product="MCE-family protein Mce2B"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72320"
FT                   /db_xref="GOA:A5TZX0"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZX0"
FT                   /protein_id="ABQ72320.1"
FT                   /translation="MKTTGTTIKLGIVWLVLSVFTVMIIVVFGQVRFHHTTGYSAVFTH
FT                   VSGLRAGQFVRAAGVEVGKVAKVTLIDGDKQVLVDFTVDRSLSLDQATTASIRYLNLIG
FT                   DRYLELGRGHSGQRLAPGATIPLEHTHPALDLDALLGGFRPLFQTLDPDKVNSIASSII
FT                   TVFQGQGATINDILDQTASLTATLADRDHAIGEVVNNLNTVLATTVKHQTEFDRTVDKL
FT                   EVLITGLKNRADPLAAAAAHISSAAGTLADLLGRIVHCCTAASGTSRASSSRS"
FT   gene            690118..690372
FT                   /locus_tag="MRA_0598"
FT   CDS_pept        690118..690372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0598"
FT                   /product="MCE-family related protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72321"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZX1"
FT                   /protein_id="ABQ72321.1"
FT                   /translation="MLHSSFGHLEGIQQPLIDELAELDHVLGKLPDAYRIIGRAGGIYG
FT                   DFFNFYLCDISLKVNGLQPGGPVRTVKLFGQPTGRCTPQ"
FT   gene            690369..691814
FT                   /gene="mce2C"
FT                   /locus_tag="MRA_0599"
FT   CDS_pept        690369..691814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce2C"
FT                   /locus_tag="MRA_0599"
FT                   /product="MCE-family protein Mce2C"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72322"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZX2"
FT                   /protein_id="ABQ72322.1"
FT                   /translation="MRTLTEFNRGRVGMMGAVVTVLVVGVAQSFTSVPMLFATPTYYAQ
FT                   FADTGGINTGDKVEIAGVNVGLVRSLAIRGNRVLIGFSLPGKTIGMQSRAAIRTDTILG
FT                   RKNLEIEPRGSEPLKPNGFLPLAQTTTPYQIYDAFVDVTKAATGWDIDAVKRSLNVLSE
FT                   TFDQTAPHLSAALEGVKAFSDTVGRRGEQIEQLLANANRIARVLGDRSEQVNGLLVNAK
FT                   TLLAAFKQRSQALRILLTNVSEASAQVSGLITDNPNLNHVLAQLRTVSEELVKRKNELA
FT                   DVAVLLGRYTAALTEAVGSGPFFKAMVVNLLPYQILQPWVDAAFKKRGIDPENFWRSAG
FT                   LPEFRWPDPNGTRFPNGAPPAAPPVREGTPKHPGPAVPPGTPCSYTPAAGALPRPDTPL
FT                   PCAGATVGPFGGPDFPAPLDVQPSPPNPDGPPPTPGILSAGRPGEPAPAVPGIPMPLPP
FT                   NAPPGARTQPLEPFPDGTGGSNQ"
FT   gene            691811..693337
FT                   /gene="mce2D"
FT                   /locus_tag="MRA_0600"
FT   CDS_pept        691811..693337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce2D"
FT                   /locus_tag="MRA_0600"
FT                   /product="MCE-family protein Mce2D"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72323"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZX3"
FT                   /protein_id="ABQ72323.1"
FT                   /translation="MSTIFDIRSLRLPKLSAKVVVVGGLVVVLAVVAAAAGARLYRKLT
FT                   TTTVVAYFSEALALYPGDKVQIMGVRVGSIDKIEPAGDKMRVTLHYSNKYQVPATATAS
FT                   ILNPSLVASRTIQLSPPYTGGPVLQDGAVIPIERTQVPVEWDQLRDSINGILRQLGPTE
FT                   RQPKGPFGDLIESAADNLAGKGRQLNETLNSLSQALTALNEGRGDFVAITRSLALFVSA
FT                   LYQNDQQFVALNENLAEFTDWFTKSDHDLADTVERIDDVLGTVRKFVSDNRSVLAADVN
FT                   NLADATTTLVQPEPRDGLETALHVLPTYASNFNNLYYPLHSSLVGQFVFPNFANPIQLI
FT                   CSAIQAGSRLGYQESAELCAQYLAPVLDALKFNYLPFGSNPFSSAATLPKEVAYSEERL
FT                   RPPPGYKDTTVPGIFSRDTPFSHGNHEPGWVVAPGMQGMQVQPFTANMLTPESLAELLG
FT                   GPDIAPPPPGTNLPGPPNAYDESNPLPPPWYPQPASLPAAGATGQPGPGQ"
FT   gene            693334..694542
FT                   /gene="lprL"
FT                   /locus_tag="MRA_0601"
FT   CDS_pept        693334..694542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lprL"
FT                   /locus_tag="MRA_0601"
FT                   /product="MCE-family lipoprotein LprL"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72324"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZX4"
FT                   /protein_id="ABQ72324.1"
FT                   /translation="MRCGVSAGSANGKPNRWTLRCGVSAGHRGSVFLLAVLLAPVVLTS
FT                   CTWRGIANVPLPVGRGMGPDRMTIYVQMPDTLALNTNSRVRVADVWVGTVRDISLRNWI
FT                   ATLTLELEPTVRLPANATAKIGQTSLLGTQHVELAAPPIPSPQPLKSGDTIGLKNSSAY
FT                   PTVERTLASVALILTGGGIVNLDVIQTEILNILDGHAGQIREFLERLATFTAELNNQRG
FT                   DLTRAIDSTNQLLTIIANRNDTLDRVLTDVPPLIEHFADTGQLFADATESLGRFSEVAN
FT                   RALAATRPNLHQTLQSLQRPLRQLERASPYVVGALKLGLTAPFNIDEVPNVIRGDYVNV
FT                   SATFDVTLSALDNALLSGTGISGMLRALEQAWGRDPDTMIPDVRYTPNPNDAPGGPLVE
FT                   RAE"
FT   gene            694547..696097
FT                   /gene="mce2F"
FT                   /locus_tag="MRA_0602"
FT   CDS_pept        694547..696097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce2F"
FT                   /locus_tag="MRA_0602"
FT                   /product="MCE-family protein Mce2F"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72325"
FT                   /db_xref="GOA:A5TZX5"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZX5"
FT                   /protein_id="ABQ72325.1"
FT                   /translation="MLTRAIKTQLVLLTVLAVIAVVVLGWYFLRIPSLVGIGRYTLYAE
FT                   LPRSGGLYRTANVTYRGITIGKVTGVEPTERGARATMSIDNGYQIPTDASANVHSVSAV
FT                   GEQFVDLVSTRTSGPYLRHGQTITTTTVPSQIGPALDAANRGLAVLPKDRVASVLHEAS
FT                   EAVGGLGSSLNRLIEATQAIAHDVRGSLEDIDDIIERSAPIIDSQVNSGNEIARWAANL
FT                   NTLAAQTAQTDPAVRSILANAAPTADQVNATFSDVRESLPQTLANLEVVIDMLKRYHNG
FT                   VEQALVFLPQSGAIAQSVTTEFPGQAGLGVGGLALNQPPPCLTGFLPASEWRSPADTST
FT                   APLPKGTYCRIPMDASNVVRGARNNPCVDVPGKRAATPRECRSNEAYVPGGTNPWYGDP
FT                   NQMLSCPAPAARCDQPVKPGQVIPAPSVNNGINPLPADQLPGTPPPVNDPLQRPGSGTV
FT                   QCNGQQPNPCVYTPSTFPTTIYDVQSGKVVAPDGVVYSVEASTHAGADGWKVMLAPTG"
FT   gene            complement(696149..696541)
FT                   /locus_tag="MRA_0603"
FT   CDS_pept        complement(696149..696541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0603"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72326"
FT                   /db_xref="GOA:A5TZX6"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZX6"
FT                   /protein_id="ABQ72326.1"
FT                   /translation="MNVRRALADTSVFIGIEATRFDPDRFAGYEWGVSVVTLGELRLGV
FT                   LQASGPEAAARRLSTYQLAQRFEPLGIDEAVSEAWALLVSKLRAAKLRVPINDSWIAAT
FT                   AVAHGIAILTQDNDYAAMPDVEVITI"
FT   gene            complement(696538..696795)
FT                   /locus_tag="MRA_0604"
FT   CDS_pept        complement(696538..696795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0604"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72327"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZX7"
FT                   /protein_id="ABQ72327.1"
FT                   /translation="MSATIPARDLRNHTAEVLRRVAAGEEIEVLKDNRPVARIVPLKRR
FT                   RQWLPAAEVIGELVRLGPDTTNLGEELRETLTQTTDDVRW"
FT   gene            complement(696978..698213)
FT                   /locus_tag="MRA_0605"
FT   CDS_pept        complement(696978..698213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72328"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZX8"
FT                   /protein_id="ABQ72328.1"
FT                   /translation="MGVVERAIAPSVLAALADTPVVVVNGARQVGKTTLVARLDYPGSS
FT                   EVVSLDDVANRDAARDDPRAFVSRPVDTLVIDEAQLEPGLFRAIKAEVDRDRRPGRFLL
FT                   TGSARLLSAPDMADALVGRVEIIELWPFSQGERAGIADGFVDALFTAPRELIHGSDMRR
FT                   ADLVDRIATGGFPDIVARSPSRRRAWFDNYLTTATQSVIREISPIERLAEMPRVLRLCA
FT                   ARTGAELNVSALANDLSIPARTTAGYLALLEAAFLIHRVPAWSTNLSRKVIRRPKLVVS
FT                   DSGLACHLLGVTGATLDRPGRPLGPLLETFVANEIRKQLTWSTERPSLWHFRDRGGAEV
FT                   DLVLEHPDGRVCGIEVKATSTPRAEDLRGLRYLAERLDDRFQFGVLLTAAPEATPFGPT
FT                   LAALPVSTLWAG"
FT   gene            complement(698464..698877)
FT                   /locus_tag="MRA_0606"
FT   CDS_pept        complement(698464..698877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72329"
FT                   /db_xref="GOA:A5TZX9"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZX9"
FT                   /protein_id="ABQ72329.1"
FT                   /translation="MKPPLAVDTSVAIPLLVRTHTAHAAVVAWWAHREAALCGHALAET
FT                   YSVLTRLPRDLRLAPMDAARLLTERFAAPLLLSSRTTEHLPRVLAQFEITGGAVYDALV
FT                   ALAAAEHRAELATRDARAKDTYEKIGVHVVVAA"
FT   gene            complement(698874..699110)
FT                   /locus_tag="MRA_0607"
FT   CDS_pept        complement(698874..699110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0607"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72330"
FT                   /db_xref="GOA:A5TZY0"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZY0"
FT                   /protein_id="ABQ72330.1"
FT                   /translation="MKAVVDAAGRIVVPKPLREALGLQPGSTVEISRYGAGLHLIPTGR
FT                   TARLEEENGVLVATGETTIDDEVVFGLIDSGRK"
FT   gene            complement(699214..699720)
FT                   /locus_tag="MRA_0608"
FT   CDS_pept        complement(699214..699720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0608"
FT                   /product="two component sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72331"
FT                   /db_xref="GOA:A5TZY1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZY1"
FT                   /protein_id="ABQ72331.1"
FT                   /translation="MPITPLLHESVARFAATGADITTRAEPDLFVSIDPDHLRRILTAV
FT                   LDNAITHGDGEIAVTAHARDGAVDIGVRDHGPGFADHFLPVAFDRFTRADTARGGRGSG
FT                   LGLAIVAALTTTHGGHANATNHPDGGAELRITLPTPRPPFHEELPRITSSDTKDPNREH
FT                   DTSDQ"
FT   gene            complement(699834..700304)
FT                   /locus_tag="MRA_0608A"
FT   CDS_pept        complement(699834..700304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0608A"
FT                   /product="putative two component sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0608A"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72332"
FT                   /db_xref="GOA:A5TZY2"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZY2"
FT                   /protein_id="ABQ72332.1"
FT                   /translation="MALVLAAAGAVTVVQFRDAAHEADPDGALRGLTDDITADLVRELV
FT                   TILPIVLVIAAVAAYLLSRAALRPVDRIRAAAQTLTTTPHPDTDAPLPVPPTDDEIAWL
FT                   ATTLNTMLTRLQRALAHEQQFVADASHELRTPLALLTTELELRCAGPDPPTS"
FT   gene            complement(700348..701109)
FT                   /gene="tcrA"
FT                   /locus_tag="MRA_0609"
FT   CDS_pept        complement(700348..701109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tcrA"
FT                   /locus_tag="MRA_0609"
FT                   /product="putative two component DNA binding
FT                   transcriptional regulatory protein TcrA"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72333"
FT                   /db_xref="GOA:A5TZY3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZY3"
FT                   /protein_id="ABQ72333.1"
FT                   /translation="MADETTMRAGRGPGRACGRVSGVRILVVEDEPKMTALLARALTEE
FT                   GHTVDTVADGRHAVAAVDGGDYDAVVLDVMLPGIDGFEVCARLRRQRVWTPVLMLTARG
FT                   AVTDRIAGLDGGADDYLTKPFNLDELFARLRALSRRGPIPRPPTLEAGDLRLDPSEHRV
FT                   WRADTEIRLSHKEFTLLEALIRRPGIVHTRAQLLERCWDAAYEARSNIVDVYIRYLRDK
FT                   IDRPFGVTSLETIRGAGYRLRKDGGRHALPR"
FT   gene            701166..701477
FT                   /locus_tag="MRA_0610"
FT   CDS_pept        701166..701477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0610"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72334"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZY4"
FT                   /protein_id="ABQ72334.1"
FT                   /translation="MNRIVQFGVSAVAAAAIGIGAGSGIAAAFDGEDEVTGPDADRARA
FT                   AAVQAVPGGTAGEVETETGEGAAAYGVLVTRPDGTRVEVHLDRDFRVLDTEPADGDGG"
FT   gene            701549..702499
FT                   /gene="lpqO"
FT                   /locus_tag="MRA_0611"
FT   CDS_pept        701549..702499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpqO"
FT                   /locus_tag="MRA_0611"
FT                   /product="putative conserved lipoprotein LpqO"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72335"
FT                   /db_xref="InterPro:IPR011094"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZY5"
FT                   /protein_id="ABQ72335.1"
FT                   /translation="MIRRRGARMAALLAAAALALTACAGSDDKGEPDDGGDRGASLATT
FT                   SDADWKPVADILGRTGKLNDGSVYKIGFARSDLSVQTKGVTVAPALSLGSWVAFARTPD
FT                   GQTMLMGDLVVTEDELASVTDAVQAGGLQQTALHKHLLEQSPPIWWTHIAGHGDAADLA
FT                   RAVRSALDATDTPPPASATSGQTSLDLDTAAIDEALGRSGTIAGGVYKFFIARRDPVTM
FT                   SGMLIPPSMGLATALNFQPTGNGRAAINGDFVMTAAEVQDVVQALRGGGIDIVAIHNHG
FT                   FDEQPRLFYMHFWAENDAVALARTLRAAVDATAAR"
FT   gene            702716..703324
FT                   /locus_tag="MRA_0612"
FT   CDS_pept        702716..703324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0612"
FT                   /product="IS1536 resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72336"
FT                   /db_xref="GOA:A5TZY6"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR041718"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZY6"
FT                   /protein_id="ABQ72336.1"
FT                   /translation="MACCRNRGMNLAAWAERNGVARVTAYRWFHAGLLPVPARKVGRLI
FT                   LVDELASEAGAQPKTAVYARVSSADQKSDLDRQVARVTSWATAEQIPVDKVVTEVGSVL
FT                   NGHRRKFPAVLRDLSVTRIVVEHRDRFCRFGSEYVHAALAAQGRELVVVDSAEVDDDLV
FT                   WDMTEILTSMCARLYGKRAAQNRAKRAVAAAAVDDHEAA"
FT   gene            703326..704069
FT                   /locus_tag="MRA_0613"
FT   CDS_pept        703326..704069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0613"
FT                   /product="truncated IS1536 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72337"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZY7"
FT                   /protein_id="ABQ72337.1"
FT                   /translation="MPRLEIPNGWCVQAFRFTLDPTAEQAHALARHFGARRKAYNWTVA
FT                   QLKADIQAWRATGAQTAKPSLRVLRKRWNTVKDEVCVNAETGTVWWPECSKEAYADGIA
FT                   GAVDAYWNWQQRRAGKRDGKRMGFPRFKKKGRDADRVSFTTGAMRVEPDRRHLTLPVIG
FT                   CVRTHENTRRIERLIAKDRARVLAITVRRNGTRLDASVRVLVQRPQQPNVELPESRIGV
FT                   DVGVRRLATVATADGACCPVLVPDG"
FT   gene            704123..704509
FT                   /locus_tag="MRA_0614"
FT   CDS_pept        704123..704509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0614"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72338"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZY8"
FT                   /protein_id="ABQ72338.1"
FT                   /translation="MGAWQTADTMGIFQALPDVWGGWRTECWEDRFEEQLIRCNGALRL
FT                   PELDLAAGMDSAREWLRDRIFQRFSDSPAGQILKLSELLADVGPGLVVSDDAVTNGGAR
FT                   PNNEEWARFVAACDLVRGAHAESA"
FT   gene            704554..704799
FT                   /locus_tag="MRA_0615"
FT   CDS_pept        704554..704799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0615"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72339"
FT                   /db_xref="InterPro:IPR011660"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZY9"
FT                   /protein_id="ABQ72339.1"
FT                   /translation="MALNIKDPSVHQAVKQIAKITGESQARAVATAVNERLARLRSDDL
FT                   AARLLAIGHKTASRMSPEAKRLDHDALLYDERGLPA"
FT   gene            704796..705197
FT                   /locus_tag="MRA_0616"
FT   CDS_pept        704796..705197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0616"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72340"
FT                   /db_xref="GOA:A5TZZ0"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZZ0"
FT                   /protein_id="ABQ72340.1"
FT                   /translation="MIVDTSAIIAILRDEDDAAAYADALANADVRRLSAASYLECGIVL
FT                   DSQRDPVISRALDELIEEAEFVVEPVTERQARLARAAYADFGRGSGHPAGLNFGDCLSY
FT                   ALAIDRREPLLWKGNDFGHTGVQRALDRR"
FT   gene            705140..705367
FT                   /locus_tag="MRA_0617"
FT   CDS_pept        705140..705367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0617"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72341"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZZ1"
FT                   /protein_id="ABQ72341.1"
FT                   /translation="MEGQRLWAHRRPKGTGSAVIDVSLARRCEAHGYDYFRSDDPVAAA
FT                   GFVVSAVWSCGRGPGNATGSGRLPKPLRHS"
FT   gene            705650..706069
FT                   /locus_tag="MRA_0618"
FT   CDS_pept        705650..706069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0618"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72342"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZZ2"
FT                   /protein_id="ABQ72342.1"
FT                   /translation="MTDASESGGRTQGRQLAAGDGVSRARNAVRRRPLFLTAAVSSVAI
FT                   SLRRAAGTAFEIEVDMPTSLAGNGVDLGAAIEVAGTFALETQRRVPDDGPFDELVAPAS
FT                   HALLVGHDASPSLRLARLRPALDAQEIHGAAASFT"
FT   gene            complement(706062..707219)
FT                   /locus_tag="MRA_0619"
FT   CDS_pept        complement(706062..707219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0619"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72343"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZZ3"
FT                   /protein_id="ABQ72343.1"
FT                   /translation="MDDELRGLLARYARGELSADDARRAILRYPKWRVAEIDGELETVA
FT                   LDDGTPMLIAESSASDGREYSGLELVRDIAPLVGGLSFDPDEPWGSAFRPGALPELQNW
FT                   ARTVELEDAVAKPGPGQRDLLYEGPWWVAVSPGTGRPAVHRADGLDVITIMTAPDAAAT
FT                   FRRTERHRGLDVVRLGPALWGDLAKRSDFDGVRLNPLRPLAQLWPPHVPAMLVAGCDPR
FT                   PNAEPLPARTVAEIHLWLDQHGARQEKRELSNRATPVGEVTVARAWWNYDRREIAFTRV
FT                   APASDTEGLGSVPSRILCAGKLRQSIQSKLAGLPRLTWRADAWHRQRAALAVGWALELE
FT                   KLVCGERVPFAALRTPEGAHLWHLEPQAFTARAIRKLRDRAASFR"
FT   gene            complement(707271..707654)
FT                   /locus_tag="MRA_0620"
FT   CDS_pept        complement(707271..707654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72344"
FT                   /db_xref="InterPro:IPR032568"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZZ4"
FT                   /protein_id="ABQ72344.1"
FT                   /translation="MPDRPQHPTASRQSSMVSWNHGAAGWLHCVQCGSATNPTACLDWL
FT                   PPIHARSGPMYAEHDVVVLTRDVPDKSLIAGDVGAVVGRYAAGGYEVDFTAANGCTVAV
FT                   VTLAGDDIRPRRRREIPHVREVA"
FT   gene            707634..708239
FT                   /locus_tag="MRA_0621"
FT   CDS_pept        707634..708239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0621"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72345"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZZ5"
FT                   /protein_id="ABQ72345.1"
FT                   /translation="MLGPIRQPRLTVRPGRLPGMIAGVAAKRMNREQFFRAASGLDEDR
FT                   LRKALWNLYWRGTANMRERIEAELASAGRARPARKIKPPADPDIVGWEVDEFVSLARSG
FT                   AYLGGDRRVSPRERSRWRFTFKRLAAEAQDALRAEDAEPAASALEQLIDLAREADGYDY
FT                   FRSDDPVAAAGFVVSDVAAAGHPHFREFAAEIGAAIPP"
FT   gene            complement(708258..710825)
FT                   /locus_tag="MRA_0622"
FT   CDS_pept        complement(708258..710825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0622"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72346"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZZ6"
FT                   /protein_id="ABQ72346.1"
FT                   /translation="MAEAFDATQAVARILAEHGPLSEDDIARRLLDSGVADPDAVLRAL
FT                   RLETEWPARQLVDDRWVWLPTLLAGRVFTHRLGADEAVHDMLGVTPDLDPITTLCEHEE
FT                   YGRLADGSAARIVLAGYDEELLERRGIPDEAIDPGGALLLEPGTLATLGAAAGDLVGVR
FT                   LTAAGLVLERIGTAGADTSVGARLAELVDPDEPAFFPAAVWTACVDDPAAFTEPVAPLR
FT                   EILDQHGLTHEDDWLAPGGFNFDAWRFENRCELLAFRHDLDPNDAVALYTLIKLHETMS
FT                   LLLEATDPDELPRDVLATAAETATETGSDSLVDLLGDIGAALADPLLAELLVAETVGTD
FT                   SGGAAALGLLTEMLEPKVPRAARVAVRWLRAVALDRIGDVEAAERELLAAESMDTEWPL
FT                   PLLDLARIASDRGDAERGLALLRRAGTEPDHPLVRLLERHRAQPRRDLGRNEACWCGSG
FT                   RKYKKCHLGREALPLAERVDWLYAKASQHALSGDWTGLLAEVSYERFRYADSDDEDALA
FT                   AALADPLVLDAVLFEGGAFAEFLEVRGSLLPDDERLLAEQWLLVERSVFEVEHVQPGEG
FT                   VIVRDVRTGDTHEVHERAASRQLRAGQLICARPVPAGDTMVFFGGIEPVALHERAVLIE
FT                   LLDDEPDPVTLVAQLSRRFAPPTLVNTEGDSLAICEASVRVDDPAGIQGALDGVYDRVD
FT                   GEEPPRWIEHVTNDGMLRVRATLVLDGDTLRVETNSEPRMDRVLATLTRLDPAMTVLDD
FT                   DRRPLRNTREAAALAEQMPVTGAGAPDPDSPELAAALEEFIRDYETSWLDQPIPALDGH
FT                   TPRQAADDPTRRADLIKLLDTFPAGAGARGGMDADRLRTALGL"
FT   gene            710666..711658
FT                   /locus_tag="MRA_0623"
FT   CDS_pept        710666..711658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0623"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72347"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZZ7"
FT                   /protein_id="ABQ72347.1"
FT                   /translation="MPAIPFQGEARAGRRPGRPRRCPAGVVRCRPRSMGHVRPGFSPRL
FT                   GSHRTLRPRWPPYAAASRGLTSGTSRWGWPRLGFGVVTAPTRWTLADGRELLFFSLPGP
FT                   RTSGTAAERVARHAQAQTFAGDIRQRAIQLVVSEQEVASKITAATAGIATTTFPETPSI
FT                   DDTIIGNDNRDTGVRLVDVKQDGGTSPPPPFAPWDTPDGTPPPGTGLSPTLQQMILGGD
FT                   PANLTGQGLADNVQRFVQSLPANDPNTAWLRGQVADLQAHVADIEYARTHCSTNDWIDR
FT                   TAQFASGAIVFSIGVLTAETGAGVVAAAAGGVGAATAGVSLLQCLVGSK"
FT   gene            711655..711897
FT                   /locus_tag="MRA_0624"
FT   CDS_pept        711655..711897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0624"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72348"
FT                   /db_xref="GOA:A5TZZ8"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZZ8"
FT                   /protein_id="ABQ72348.1"
FT                   /translation="MMDVLAAGIAAGALTLAAWGAWRPHYRAASYLVAGAVELALIGLL
FT                   VVTGQTLMAISVAFLVALGGPLVVVNHRRAERSRG"
FT   gene            complement(711894..712160)
FT                   /locus_tag="MRA_0625"
FT   CDS_pept        complement(711894..712160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0625"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72349"
FT                   /db_xref="UniProtKB/TrEMBL:A5TZZ9"
FT                   /protein_id="ABQ72349.1"
FT                   /translation="MRIPGNRQCLLVQVLRQVDGSAHRLILTSLHRDARADAHRYSNGT
FT                   DHAGRAADEPAETAHEPCWVAARGLASQASRAMSATYRPSSFI"
FT   gene            712316..712717
FT                   /locus_tag="MRA_0626"
FT   CDS_pept        712316..712717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0626"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72350"
FT                   /db_xref="GOA:A5U000"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR006226"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A5U000"
FT                   /protein_id="ABQ72350.1"
FT                   /translation="MTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSL
FT                   VRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALSFAGVEVAGVVGHRQVTDAYLAQLA
FT                   RSHDGQLATLDSGLAHLHGDVAVLIPTTT"
FT   gene            712846..713541
FT                   /gene="galTa"
FT                   /locus_tag="MRA_0627"
FT   CDS_pept        712846..713541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galTa"
FT                   /locus_tag="MRA_0627"
FT                   /product="putative galactose-1-phosphate
FT                   uridylyltransferase GalTa"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72351"
FT                   /db_xref="GOA:A5U001"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A5U001"
FT                   /protein_id="ABQ72351.1"
FT                   /translation="MSATPPPGGLDASVFIANERGRQLDEALPVGFCVVTAPTRWTLAD
FT                   GRDLLFFSLPGHVPAPVSDRRPLPERDPAPSRLRFDRATGQWVIVAAQRQDRTYKPPAA
FT                   RCPLCPGPTGLSSEVPAPDYDVVVFENRFPSLAGAGIAPIGAPDGDGFVSAPGHGRCEV
FT                   ICFSADHTGSFAGLDPAHARLVVHAWRHRTAELTALPGVAQVFCFENRGEEIGVTLPTR
FT                   TARFTPIRI"
FT   gene            713538..714029
FT                   /gene="galTb"
FT                   /locus_tag="MRA_0628"
FT   CDS_pept        713538..714029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galTb"
FT                   /locus_tag="MRA_0628"
FT                   /product="putative galactose-1-phosphate
FT                   uridylyltransferase GalTb"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72352"
FT                   /db_xref="GOA:A5U002"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR005850"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A5U002"
FT                   /protein_id="ABQ72352.1"
FT                   /translation="MTPRTAAMLRQARRHRKRHGDNLFASLLAREVADGSRIVVRGELF
FT                   TAFVPFAARWPVEVHIYPNRLVRNLTELNDGELDEFARIYLDVLQRFDRMYSSPLPYMS
FT                   ALHQFSEVQRDGYFHVELMSIRRSATKLKYLAAAESAMDAFIADVIPESVATRLRELGP
FT                   "
FT   gene            714026..715117
FT                   /gene="galK"
FT                   /locus_tag="MRA_0629"
FT   CDS_pept        714026..715117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galK"
FT                   /locus_tag="MRA_0629"
FT                   /product="galactokinase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72353"
FT                   /db_xref="GOA:A5U003"
FT                   /db_xref="InterPro:IPR000705"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019539"
FT                   /db_xref="InterPro:IPR019741"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022963"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5U003"
FT                   /protein_id="ABQ72353.1"
FT                   /translation="MTVSYGAPGRVNLIGEHTDYNLGFALPIALPRRTVVTFTPEHTGA
FT                   ITARSDRADGSARIPLDTTPGQVTGWAAYAAGAIWALRGAGHPVPGGAMSITSDVEIGS
FT                   GLSSSAALIGAVLGAVGAATGTRIDRLERARLAQRAENDYVGAPTGLLDHLAALFGAPK
FT                   TALLIDFRDITVRPVAFDPDACDVVLLLMDSRARHCHAGGEYALRRASCERAAADLGVS
FT                   SLRAVQDRGLAALGAIADPIDARRARHVLTENQRVLDFAAALADSDFTAAGQLLTASHE
FT                   SMREDFAITTERIDLIAESAVRAGALGARMTGGGFGGAVIALVPADRARDVADTVRRAA
FT                   VTAGYDEPAVSRTYAAPGAAECR"
FT   gene            715512..716576
FT                   /locus_tag="MRA_0630"
FT   CDS_pept        715512..716576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0630"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72354"
FT                   /db_xref="GOA:A5U004"
FT                   /db_xref="UniProtKB/TrEMBL:A5U004"
FT                   /protein_id="ABQ72354.1"
FT                   /translation="MAGDRGADPGPANVTPGADDHAQHASPTVLCPQGHVNAWDYRFCE
FT                   RCGSPIGVVPWPSEESGTRQTAPARSFVPLVVLAATLLVVAVVVTAVGYAVTRPARNDR
FT                   EEPSSARGAATTGVPFAQAEAASCPDDPVLEAESIDLTSDGLAVSAAFMSACAGGDVES
FT                   NSALEVTVADGRRDVAAGSFDFSADPLRIEPGVPARRTLVFPPGMYWRTPDMLSGAPAL
FT                   AATRKGRSDRSAARGGSARTTMVAAASAAPAYGSINAVAGAVLVELRDSDFPYVRVGIA
FT                   NRWVPQVSSKRVGLVAAGKTWTSADILRDHLALRQRFGGARLVWSGHWTTFSGPDFWVT
FT                   VVGPAQPTAAEANR"
FT   gene            716680..717627
FT                   /locus_tag="MRA_0631"
FT   CDS_pept        716680..717627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0631"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72355"
FT                   /db_xref="GOA:A5U005"
FT                   /db_xref="InterPro:IPR007969"
FT                   /db_xref="UniProtKB/TrEMBL:A5U005"
FT                   /protein_id="ABQ72355.1"
FT                   /translation="MSFCVYCGAELADPTRCGACGAYKIGSTWHRTTTPTVGAATTATG
FT                   WRPDPTGRHEGRYFVAGQPTDLVREGDAEAVDPLGQQQLDQSGAVGVSPSAVSGWVRSG
FT                   HRRLWWALAGVVAFLGLVGAGVVGTLFLNRDRESIDDKYLAALRRSGLTGEFNSDANAI
FT                   ARGKQVCRQLQDGGEQQGMPVDQVAVQYYCPQFSDGFHILETITVTGSFTLKDESPNVY
FT                   APAITVSGSGCSGSAGYADIDRGTQVTVKNGQGDILATAFLQAGQGGRFLCTFPFSFEI
FT                   TEGEDRYVVSVSRRGEMSYSFADLKANGLSLVLG"
FT   gene            717720..717974
FT                   /locus_tag="MRA_0632"
FT   CDS_pept        717720..717974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0632"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72356"
FT                   /db_xref="InterPro:IPR011660"
FT                   /db_xref="UniProtKB/TrEMBL:A5U006"
FT                   /protein_id="ABQ72356.1"
FT                   /translation="MALSIKHPEADRLARALAARTGETLTEAVVTALRERLARETGRAR
FT                   VVPLRDELAAIRHRCAALPVVDNRSAEAILGYDERGLPA"
FT   gene            717974..718369
FT                   /locus_tag="MRA_0633"
FT   CDS_pept        717974..718369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0633"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72357"
FT                   /db_xref="GOA:A5U007"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A5U007"
FT                   /protein_id="ABQ72357.1"
FT                   /translation="MVIDTSALVAMLSDEPDAERFEAAVEADHIRLMSTASYLETALVI
FT                   EARFGEPGGRELDLWLHRAAVDLVAVHADQADAARAAYRTYGKGRHRAGLNYGDCFSYG
FT                   LAKISGQPLLFKGEDFQHTDIATVALP"
FT   gene            complement(718463..719203)
FT                   /locus_tag="MRA_0634"
FT   CDS_pept        complement(718463..719203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0634"
FT                   /product="putative conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72358"
FT                   /db_xref="GOA:A5U008"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A5U008"
FT                   /protein_id="ABQ72358.1"
FT                   /translation="MSTHNDSAPTSRRRHIVRLVVFAGFLVGMFYLVAATDVIDVAAVR
FT                   GAVSATGPAAPLTYVVVSAVLGALFVPGPILAASSGLLFGPLVGVFVTLGATVGTAVVA
FT                   SLVGRRAGRASARALLGGERADRTDALIERCGLWAVVGQRFVPGISDAFASYAFGTFGV
FT                   PLWQMAVGAFIGSAPRAFAYTALGAAIGDRSPLLASCAIAVWCVTAIIGAFAARHGYRQ
FT                   WRAHARGDGADGGVEDPDREVGAR"
FT   gene            719335..719595
FT                   /locus_tag="MRA_0635"
FT   CDS_pept        719335..719595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0635"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72359"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:A5U009"
FT                   /protein_id="ABQ72359.1"
FT                   /translation="MSEVASRELRNDTAGVLRRVRAGEDVTITVSGRPVAVLTPVRPRR
FT                   RRWLSKTEFLSRLRGAQADPGLRNDLAVLAGDTTEDLGPIR"
FT   gene            719592..719999
FT                   /locus_tag="MRA_0636"
FT   CDS_pept        719592..719999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0636"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72360"
FT                   /db_xref="GOA:A5U010"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A5U010"
FT                   /protein_id="ABQ72360.1"
FT                   /translation="MSTTPAAGVLDTSVFIATESGRQLDEALIPDRVATTVVTLAELRV
FT                   GVLAAATTDIRAQRLATLESVADMETLPVDDDAARMWARLRIHLAESGRRVRINDLWIA
FT                   AVAASRALPVITQDDDFAALDGAASVEIIRV"
FT   gene            complement(720071..721222)
FT                   /locus_tag="MRA_0637"
FT   CDS_pept        complement(720071..721222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0637"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72361"
FT                   /db_xref="InterPro:IPR013702"
FT                   /db_xref="InterPro:IPR016741"
FT                   /db_xref="InterPro:IPR019494"
FT                   /db_xref="UniProtKB/TrEMBL:A5U011"
FT                   /protein_id="ABQ72361.1"
FT                   /translation="MRIGVGVSTAPDVRRAAAEAAAHAREELAGGTPALAVLLGSRSHT
FT                   DQAVDLLAAVQASVEPAALIGCVAQGIVAGRHELENEPAVAVWLASGPPAETFHLDFVR
FT                   TGSGALITGYRFDRTAHDLHLLLPDPYSFPSNLLIEHLNTDLPGTTVVGGVVSGGRRRG
FT                   DTRLFRDRDVLTSGLVGVRLPGAHSVSVVSQGCRPIGEPYIVTGADGAVITELGGRPPL
FT                   HRLREIVLGMAPDEQELVSRGLQIGIVVDEHLAVPGQGDFLIRGLLGADPTTGAIGIGE
FT                   VVEVGATVQFQVRDAAAADKDLRLAVERAAAELPGPPVGGLLFTCNGRGRRMFGVTDHD
FT                   ASTIEDLLGGIPLAGFFAAGEIGPVAGHNALHGFTASMALFVD"
FT   gene            complement(721315..723042)
FT                   /gene="recD"
FT                   /locus_tag="MRA_0638"
FT   CDS_pept        complement(721315..723042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recD"
FT                   /locus_tag="MRA_0638"
FT                   /product="putative exonuclease V alpha chain"
FT                   /note="RecD"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72362"
FT                   /db_xref="GOA:A5U012"
FT                   /db_xref="InterPro:IPR006344"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:A5U012"
FT                   /protein_id="ABQ72362.1"
FT                   /translation="MKLTDVDFAVEASGMVRAFNQAGVLDVSDVHVAQRLCALAGESDE
FT                   RVALAVAVAVRALRAGSVCVDLLSIARVAGHDDLPWPDPADWLAAVRASPLLADPPVLH
FT                   LYDDRLLYLDRYWREEEQVCADLLALLTSRRPAGVPDLRRLFPTGFDEQRRAAEIALSQ
FT                   GVTVLTGGPGTGKTTTVARLLALVAEQAELAGEPRPRIALAAPTGKAAARLAEAVRREM
FT                   AKLDATDRARLGDLHAVTLHRLLGAKPGARFRQDRQNRLPHNVIVVDETSMVSLTLMAR
FT                   LAEAVRPGARLILVGDADQLASVEAGAVLADLVDGFSVRDDALVAQLRTSHRFGKVIGT
FT                   LAEAIRAGDGDAVLGLLRSGEERIEFVDDEDPAPRLRAVLVPHALRLREAALLGASDVA
FT                   LATLDEHRLLCAHRDGPTGVLHWNRRVQAWLAEETGQPPWTPWYAGRPLLVTANDYGLR
FT                   VYNGDTGVVLAGPTGLRAVISGASGPLDVATGRLGDVETMHAMTIHKSQGSQVDEVTVL
FT                   MPQEDSRLLTRELLYTAVTRAKRKVRVVGSEASVRAAIARRAVRASGLRMRLQSTGCG"
FT   gene            complement(723039..726323)
FT                   /gene="recB"
FT                   /locus_tag="MRA_0639"
FT   CDS_pept        complement(723039..726323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recB"
FT                   /locus_tag="MRA_0639"
FT                   /product="exodeoxyribonuclease V subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72363"
FT                   /db_xref="GOA:A5U013"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR004586"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:A5U013"
FT                   /protein_id="ABQ72363.1"
FT                   /translation="MDRFELLGPLPREGTTTVLEASAGTGKTFALAGLVTRYLAETAAT
FT                   LDEMLLITFNRAASRELRERVRGQIVEAVGALQGDAPPSGELVEHLLRGSDAERAQKRS
FT                   RLRDALANFDAATIATTHEFCGSVLKSLGVAGDNAADVELKESLTDLVTEIVDDRYLAN
FT                   FGRQETDPELTYAEALALALAVVDDPCAQLRPPDPEPGSKAAVRLRFAAEVLEELERRK
FT                   GRLRAQGFNDLLIRLATALEAADSPARDRMRERWRIVLVDEFQDTDPMQWRVLERAFSR
FT                   HSALILIGDPKQAIYGFRGGDIHTYLKAAGTADARYTLGVNWRSDRALVESLQTVLRDA
FT                   TLGHADIVVRGTDAHHAGHRLASAPRPAPFRLRVVKRHTLGYDGTAHVPIEALRRHIPD
FT                   DLAADVAALLASGATFAGRPVVAADIAVIVEHHKDARACRNALAEAGIPAIYTGDTDVF
FT                   ASQAAKDWLCLLEAFDAPQRSGLVRAAACTMFFGETAESLAAEGDALTDRVAGTLREWA
FT                   DHARHRGVAAVFQAAQLAGMGRRVLSQRGGERDLTDLAHIAQLLHEAAHRERLGLPGLR
FT                   DWLRRQAKAGAGPPEHNRRLDSDAAAVQIMTVFVAKGLQFPIVYLPFAFNRNVRSDDIL
FT                   LYHDDGTRCLYIGGKDGGAQRRTVEGLNRVEAAHDNLRLTYVALTRAQSQVVAWWAPTF
FT                   DEVNGGLSRLLRGRRPGQSQVPDRCTPRVTDEQAWAVFAQWEAAGGPSVEESVIGARSS
FT                   LEKPVPVPGFEVRHFHRRIDTTWRRTSYSDLVRGSEAVTVTSEPAAGGRADEVEIAVVA
FT                   APGSGADLTSPLAALPSGASFGSLVHAVLETADPAAPDLAAELEAQVRRHAPWWTVDVD
FT                   HAQLAPELARALLPMHDTPLGPAAAALTLRQIGVRDRLRELDFEMPLAGGDLRGRSPDV
FT                   SLADVGELLASHLPGDDPLSPYADRLGSAGLGDQPLRGYLAGSIDVVLRLPGQRYLVVD
FT                   YKTNHLGDTAADYGFERLTEAMLHSDYPLQALLYVVVLHRFLRWRQRDYAPARHLGGVL
FT                   YLFVRGMCGAATPVTAGHPAGVFTWNPPTALVVALSDLLDRGRLQS"
FT   gene            complement(726323..729616)
FT                   /gene="recC"
FT                   /locus_tag="MRA_0640"
FT   CDS_pept        complement(726323..729616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recC"
FT                   /locus_tag="MRA_0640"
FT                   /product="exodeoxyribonuclease V subunit gamma"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72364"
FT                   /db_xref="GOA:A5U014"
FT                   /db_xref="InterPro:IPR006697"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041500"
FT                   /db_xref="UniProtKB/TrEMBL:A5U014"
FT                   /protein_id="ABQ72364.1"
FT                   /translation="MALHLHRAERTDLLADGLGALLADPQPDPFAQELVLVAARGVERW
FT                   LSQRLSLVLGCGPGRADGVCAGIAFRNPQSLIAEITGTLDDDPWSPEALAWPLLAVIDA
FT                   SLDEPWCRTLASHLGHFATTDAEAELRRGRRYSVARRLAGLFASYARQRPGLLAAWLDG
FT                   DLGELPGDLAWQPPLWRALVTTVGADPPHVRHDKTIARLRDGPADLPARLSLFGHTRLA
FT                   CTDVQLLDALAVHHDLHLWLPHPSDELWRALAGFQGADGLLPRRQDTSRRAAQHPLLET
FT                   LGRDVRELQRALPAARATDEFLGATTKPDTLLGWLQADIAGNAPRPAGRSLSDADRSVQ
FT                   VHACHGPARQIDVLREVLLGLLEDDPTLQPRDIVVMCPDIDTYAPLIVAGFGLGEVAGD
FT                   CHPAHRLRVRLADRALTQTNPLLSVAAELLTIAETRATASQLLNLAQAAPVRAKFGFAD
FT                   DDLDTITTWVRESNIRWGFDPTHRRRYGLDTVVHNTWRFGLDRILTGVAMSEDSQAWLD
FT                   TALPLDDVGSNRVELAGRLAEFVERLHHVVGGLSGARPLVAWLDALATGIDLLTACNDG
FT                   WQRAQVQREFADVLARAGSRAAPLLRLPDVRALLDAQLAGRPTRANFRTGTLTVCTMVP
FT                   MRSVPHRVVCLVGLDDGVFPRLSHPDGDDVLAREPMTGERDIRSEDRQLLLDAIGAATQ
FT                   TLVITYTGADERTGQPRPPAVPLAELLDALDQTTSAPVRERILVTHPLQPFDRKNVTPG
FT                   ALLGAKPFTFDPAALAAAQAAAGKRCPPTAFISGRLPAPPAADVTLADLLDFFKDPVKG
FT                   FFRALDYTLPWDVDTVEDSIPVQVDALAEWTVGERMLRDMLRGLHPDDAAHSEWRRGTL
FT                   PPGRLGVRRAKEIRNRARDLAAAALAHRDGHGQAHDVDVDLGDGRRLSGTVTPVFGGRT
FT                   VSVTYSKLAPKHVLPAWIGLVTLAAQEPGREWSALCIGRSKTRNHIARRLFVPPPDPVA
FT                   VLRELVLLYDAGRREPLPLPLKTSCAWAQARRDGQDPYPPARECWQTNRFRPGDDDAPA
FT                   HVRAWGPRAPFEVLLGKPRAGEEVAGEETRLGALAARLWLPLLAAEGSV"
FT   gene            complement(729893..730588)
FT                   /gene="echA3"
FT                   /locus_tag="MRA_0641"
FT   CDS_pept        complement(729893..730588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="echA3"
FT                   /locus_tag="MRA_0641"
FT                   /product="enoyl-CoA hydratase EchA3"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72365"
FT                   /db_xref="GOA:A5U015"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A5U015"
FT                   /protein_id="ABQ72365.1"
FT                   /translation="MSDPVSYTRKDSIAVISMDDGKVNALGPAMQQALNAAIDNADRDD
FT                   VGALVITGNGRVFSGGFDLKILTSGEVQPAIDMLRGGFELAYRLLSYPKPVVMACTGHA
FT                   IAMGAFLLSCGDHRVAAHAYNIQANEVAIGMTIPYAALEIMKLRLTRSAYQQATGLAKT
FT                   FFGETALAAGFIDEIALPEVVVSRAEEAAREFAGLNQHAHAATKLRSRADALTAIRAGI
FT                   DGIAAEFGL"
FT   gene            complement(730637..731476)
FT                   /locus_tag="MRA_0642"
FT   CDS_pept        complement(730637..731476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0642"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72366"
FT                   /db_xref="GOA:A5U016"
FT                   /db_xref="UniProtKB/TrEMBL:A5U016"
FT                   /protein_id="ABQ72366.1"
FT                   /translation="MVDSMGWVLSSWHEVTGVDSGTWLAWAAWAALGLGVVALVVTKRQ
FT                   IQRNRRLAAEQTRPYVAMFMEPHVADWHVIELVVRNFGRTAAYDVRFSFPNPPTVAQYE
FT                   NAANGYADVVELRLPQELPMLAPGQEWRMVWDSALDRAEIGRGIESRFPGTVTYYDRPE
FT                   QPRRWRFWRRGRRPLETKVVLDWDALPPVARIELMTTHDLAKREKQKLELLRSLLTYFH
FT                   YASKETRPDVFRSEIDRINRAAAETQDRWRARQVEVPTEVSQRSEGQGPQPTRIPAG"
FT   gene            complement(731630..732343)
FT                   /locus_tag="MRA_0643"
FT   CDS_pept        complement(731630..732343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0643"
FT                   /product="putative glyoxalase II"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72367"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A5U017"
FT                   /protein_id="ABQ72367.1"
FT                   /translation="MSKDRLYFRQLLSGRDFAVGDMFATQMRNFAYLIGDRTTGDCVVV
FT                   DPAYAAGDLLDALESDDMQLSGVLVTHHHPDHVGGSMMGFQLPGLAELLERASVPVHVN
FT                   THEALWVSRVTGIPVGDLITHEHGDKVSVGDIDIELLHTPGHTPGSQCFLLDGRLVAGD
FT                   TLFLEGCGRTDFPGGDSDEMYRSLRQLAELPGDPTVFPGHWYSAEPSASLSEVKRSNYV
FT                   YRPASLDQWRMLMGG"
FT   gene            732423..732674
FT                   /locus_tag="MRA_0644"
FT   CDS_pept        732423..732674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0644"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72368"
FT                   /db_xref="InterPro:IPR019239"
FT                   /db_xref="UniProtKB/TrEMBL:A5U018"
FT                   /protein_id="ABQ72368.1"
FT                   /translation="MGSDCGCGGYLWSMLKRVEIEVDDDLIQKVIRRYRVKGAREAVNL
FT                   ALRTLLGEADTAEHGHDDEYDEFSDPNAWVPRRSRDTG"
FT   gene            732804..732876
FT                   /locus_tag="MRA_t06"
FT   tRNA            732804..732876
FT                   /locus_tag="MRA_t06"
FT                   /product="tRNA-Thr"
FT   gene            732913..732986
FT                   /locus_tag="MRA_t07"
FT   tRNA            732913..732986
FT                   /locus_tag="MRA_t07"
FT                   /product="tRNA-Met"
FT   gene            733022..733189
FT                   /gene="rpmG2"
FT                   /locus_tag="MRA_0645"
FT   CDS_pept        733022..733189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG2"
FT                   /locus_tag="MRA_0645"
FT                   /product="50S ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72369"
FT                   /db_xref="GOA:A5U019"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5U019"
FT                   /protein_id="ABQ72369.1"
FT                   /translation="MASSTDVRPKITLACEVCKHRNYITKKNRRNDPDRLELKKFCPNC
FT                   GKHQAHRETR"
FT   gene            733240..733698
FT                   /locus_tag="MRA_0646"
FT   CDS_pept        733240..733698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0646"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72370"
FT                   /db_xref="InterPro:IPR016709"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:A5U020"
FT                   /protein_id="ABQ72370.1"
FT                   /translation="MALSADIVGMHYRYPDHYEVEREKIREYAVAVQNDDAWYFEEDGA
FT                   AELGYKGLLAPLTFICVFGYKAQAAFFKHANIATAEAQIVQVDQVLKFEKPIVAGDKLY
FT                   CDVYVDSVREAHGTQIIVTKNIVTNEEGDLVQETYTTLAGRRGWRGIF"
FT   gene            733698..734126
FT                   /locus_tag="MRA_0647"
FT   CDS_pept        733698..734126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0647"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72371"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A5U021"
FT                   /protein_id="ABQ72371.1"
FT                   /translation="MALREFSSVKVGDQLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDE
FT                   IAKVVGLDTAIAHGMLTMGIGGGYVTSWVGDPGAVTEYNVRFTAVVPVPNDGKGAELVF
FT                   NGRVKSVDPESKSVTIALTATTGGKKIFGRAIASAKLA"
FT   gene            734212..734631
FT                   /locus_tag="MRA_0648"
FT   CDS_pept        734212..734631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0648"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72372"
FT                   /db_xref="InterPro:IPR016709"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:A5U022"
FT                   /protein_id="ABQ72372.1"
FT                   /translation="MPRAVKCDHPAFFSEEAAADLGYDALVAPLTFVTILAKYVQLDFF
FT                   RHVDVGMETMQIVQVDQRFVFHKPVLAGDKLWARMDIHSVDERFGADIVVTRNLCTNDD
FT                   GELVMEAYTTLMGQQGDGSARLKWDKESGQVIRTA"
FT   gene            734830..734902
FT                   /locus_tag="MRA_t08"
FT   tRNA            734830..734902
FT                   /locus_tag="MRA_t08"
FT                   /product="tRNA-Trp"
FT   gene            735043..735528
FT                   /gene="secE1"
FT                   /locus_tag="MRA_0649"
FT   CDS_pept        735043..735528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE1"
FT                   /locus_tag="MRA_0649"
FT                   /product="translocase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72373"
FT                   /db_xref="GOA:A5U023"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A5U023"
FT                   /protein_id="ABQ72373.1"
FT                   /translation="MSDEGDVADEAVADGAENADSRGSGGRTALVTKPVVRPQRPTGKR
FT                   SRSRAAGADADVDVEEPSTAASEATGVAKDDSTTKAVSKAARAKKASKPKARSVNPIAF
FT                   VYNYLKQVVAEMRKVIWPNRKQMLTYTSVVLAFLAFMVALVAGADLGLTKLVMLVFG"
FT   gene            735560..736276
FT                   /gene="nusG"
FT                   /locus_tag="MRA_0650"
FT   CDS_pept        735560..736276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="MRA_0650"
FT                   /product="transcription antitermination protein NusG"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72374"
FT                   /db_xref="GOA:A5U024"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A5U024"
FT                   /protein_id="ABQ72374.1"
FT                   /translation="MTTFDGDTSAGEAVDLTEANAFQDAAAPAEEVDPAAALKAELRSK
FT                   PGDWYVVHSYAGYENKVKANLETRVQNLDVGDYIFQVEVPTEEVTEIKNGQRKQVNRKV
FT                   LPGYILVRMDLTDDSWAAVRNTPGVTGFVGATSRPSALALDDVVKFLLPRGSTRKAAKG
FT                   AASTAAAAEAGGLERPVVEVDYEVGESVTVMDGPFATLPATISEVNAEQQKLKVLVSIF
FT                   GRETPVELTFGQVSKI"
FT   gene            736328..736756
FT                   /gene="rplK"
FT                   /locus_tag="MRA_0651"
FT   CDS_pept        736328..736756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="MRA_0651"
FT                   /product="50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72375"
FT                   /db_xref="GOA:A5U025"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5U025"
FT                   /protein_id="ABQ72375.1"
FT                   /translation="MAPKKKVAGLIKLQIVAGQANPAPPVGPALGQHGVNIMEFCKAYN
FT                   AATENQRGNVIPVEITVYEDRSFTFTLKTPPAAKLLLKAAGVAKGSAEPHKTKVAKVTW
FT                   DQVREIAETKKTDLNANDVDAAAKIIAGTARSMGITVE"
FT   gene            736823..737530
FT                   /gene="rplA"
FT                   /locus_tag="MRA_0652"
FT   CDS_pept        736823..737530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="MRA_0652"
FT                   /product="50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72376"
FT                   /db_xref="GOA:A5U026"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5U026"
FT                   /protein_id="ABQ72376.1"
FT                   /translation="MSKTSKAYRAAAAKVDRTNLYTPLQAAKLAKETSSTKQDATVEVA
FT                   IRLGVDPRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADAAVAAGADVVGSDDLIERI
FT                   QGGWLEFDAAIATPDQMAKVGRIARVLGPRGLMPNPKTGTVTADVAKAVADIKGGKINF
FT                   RVDKQANLHFVIGKASFDEKLLAENYGAAIDEVLRLKPSSSKGRYLKKITVSTTTGPGI
FT                   PVDPSITRNFAGE"
FT   gene            complement(737604..738509)
FT                   /gene="mmaA4"
FT                   /locus_tag="MRA_0653"
FT   CDS_pept        complement(737604..738509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmaA4"
FT                   /locus_tag="MRA_0653"
FT                   /product="methoxy mycolic acid synthase 4"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72377"
FT                   /db_xref="GOA:A5U027"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5U027"
FT                   /protein_id="ABQ72377.1"
FT                   /translation="MTRMAEKPISPTKTRTRFEDIQAHYDVSDDFFALFQDPTRTYSCA
FT                   YFEPPELTLEEAQYAKVDLNLDKLDLKPGMTLLDIGCGWGTTMRRAVERFDVNVIGLTL
FT                   SKNQHARCEQVLASIDTNRSRQVLLQGWEDFAEPVDRIVSIEAFEHFGHENYDDFFKRC
FT                   FNIMPADGRMTVQSSVSYHPYEMAARGKKLSFETARFIKFIVTEIFPGGRLPSTEMMVE
FT                   HGEKAGFTVPEPLSLRPHYIKTLRIWGDTLQSNKDKAIEVTSEEVYNRYMKYLRGCEHY
FT                   FTDEMLDCSLVTYLKPGAAA"
FT   gene            complement(738574..739455)
FT                   /gene="mmaA3"
FT                   /locus_tag="MRA_0654"
FT   CDS_pept        complement(738574..739455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmaA3"
FT                   /locus_tag="MRA_0654"
FT                   /product="methoxy mycolic acid synthase 3"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72378"
FT                   /db_xref="GOA:A5U028"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5U028"
FT                   /protein_id="ABQ72378.1"
FT                   /translation="MSDNSTGTTKSRSNVDDVQAHYDLSDAFFALFQDPTRTYSCAYFE
FT                   RDDMTLHEAQVAKLDLTLGKLGLEPGMTLLDVGCGWGSVMKRAVERYDVNVVGLTLSKN
FT                   QHAYCQQVLDKVDTNRSHRVLLSDWANFSEPVDRIVTIEAIEHFGFERYDDFFKFAYNA
FT                   MPADGVMLLHSITGLHVKQVIERGIPLTMEMAKFIRFIVTDIFPGGRLPTIETIEEHVT
FT                   KAGFTITDIQSLQPHFARTLDLWAEALQAHKDEAIEIQSAEVYERYMKYLTGCAKAFRM
FT                   GYIDCNQFTLAK"
FT   gene            complement(739603..740466)
FT                   /gene="mmaA2"
FT                   /locus_tag="MRA_0655"
FT   CDS_pept        complement(739603..740466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmaA2"
FT                   /locus_tag="MRA_0655"
FT                   /product="methoxy mycolic acid synthase 2"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72379"
FT                   /db_xref="GOA:A5U029"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5U029"
FT                   /protein_id="ABQ72379.1"
FT                   /translation="MVNDLTPHFEDVQAHYDLSDDFFRLFLDPTQTYSCAHFEREDMTL
FT                   EEAQIAKIDLALGKLGLQPGMTLLDIGCGWGATMRRAIAQYDVNVVGLTLSKNQAAHVQ
FT                   KSFDEMDTPRDRRVLLAGWEQFNEPVDRIVSIGAFEHFGHDRHADFFARAHKILPPDGV
FT                   LLLHTITGLTRQQMVDHGLPLTLWLARFLKFIATEIFPGGQPPTIEMVEEQSAKTGFTL
FT                   TRRQSLQPHYARTLDLWAEALQEHKSEAIAIQSEEVYERYMKYLTGCAKLFRVGYIDVN
FT                   QFTLAK"
FT   gene            complement(740633..741493)
FT                   /gene="mmaA1"
FT                   /locus_tag="MRA_0656"
FT   CDS_pept        complement(740633..741493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmaA1"
FT                   /locus_tag="MRA_0656"
FT                   /product="methoxy mycolic acid synthase 1"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72380"
FT                   /db_xref="GOA:A5U030"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5U030"
FT                   /protein_id="ABQ72380.1"
FT                   /translation="MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLE
FT                   EAQLAKVDLALDKLNLEPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHYERSKD
FT                   RLAAIGTQRRAEARLQGWEEFEENVDRIVSFEAFDAFKKERYLTFFERSYDILPDDGRM
FT                   LLHSLFTYDRRWLHEQGIALTMSDLRFLKFLRESIFPGGELPSEPDIVDNAQAAGFTIE
FT                   HVQLLQQHYARTLDAWAANLQAARERAIAVQSEEVYNNFMHYLTGCAERFRRGLINVAQ
FT                   FTMTK"
FT   gene            complement(741540..742445)
FT                   /gene="lipG"
FT                   /locus_tag="MRA_0657"
FT   CDS_pept        complement(741540..742445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipG"
FT                   /locus_tag="MRA_0657"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72381"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5U031"
FT                   /protein_id="ABQ72381.1"
FT                   /translation="MDIRSGTAVSGDVKLYYEDMGDLDHPPVLLIMGLGAQMLLWRTDF
FT                   CARLVAKGLRVIRYDNRDVGLSTKTERHRPGQPLATRLVRSWLGLPSQAAYTLEDMAAD
FT                   AAALLDHLDVKHAHVVGASMGGMIAQIFAARFAQRTKTLAVIFSSNNHRFLPPPAPRAL
FT                   LALLTGPPPDSPRDVIVDNAVRVSKIIGSPAYPIPEDQVRAEAAESYDRNFHPWGIAQQ
FT                   FSAILGSGSLLRYDRRIVAPTVVIHGRADKLMRPFGGRAVARAINGARLVLIDGMGHDL
FT                   PRQLWDRVIGELTRNFSEAG"
FT   gene            complement(742457..743923)
FT                   /locus_tag="MRA_0658"
FT   CDS_pept        complement(742457..743923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0658"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72382"
FT                   /db_xref="GOA:A5U032"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A5U032"
FT                   /protein_id="ABQ72382.1"
FT                   /translation="MRAEIGPDFRPHYTFGDAYPASERAHVNWELSAPVWHTAQMGSTT
FT                   HREVAKLDRVPLPVEAARVAATGWQVTRTAVRFIGRLPRKGPWQQKVIKELPQTFADLG
FT                   PTYVKFGQIIASSPGAFGESLSREFRGLLDRVPPAKTDEVHKLFVEELGDEPARLFASF
FT                   EEEPFASASIAQVHYATLRSGEEVVVKIQRPGIRRRVAADLQILKRFAQTVELAKLGRR
FT                   LSAQDVVADFADNLAEELDFRLEAQSMEAWVSHLHASPLGKNIRVPQVHWDFTTERVLT
FT                   MERVHGIRIDNAAAIRKAGFDGVELVKALLFSVFEGGLRHGLFHGDLHAGNLYVDEAGR
FT                   IVFFDFGIMGRIDPRTRWLLRELVYALLVKKDHAAAGKIVVLMGAVGTMKPETQAAKDL
FT                   ERFATPLTMQSLGDMSYADIGRQLSALADAYDVKLPRELVLIGKQFLYVERYMKLLAPR
FT                   WQMMSDPQLTGYFANFMVEVSREHQSDIEV"
FT   gene            744025..747672
FT                   /locus_tag="MRA_0659"
FT   CDS_pept        744025..747672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0659"
FT                   /product="alpha-mannosidase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72383"
FT                   /db_xref="GOA:A5U033"
FT                   /db_xref="InterPro:IPR000602"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR011682"
FT                   /db_xref="InterPro:IPR015341"
FT                   /db_xref="InterPro:IPR018905"
FT                   /db_xref="InterPro:IPR027291"
FT                   /db_xref="InterPro:IPR028995"
FT                   /db_xref="InterPro:IPR037094"
FT                   /db_xref="UniProtKB/TrEMBL:A5U033"
FT                   /protein_id="ABQ72383.1"
FT                   /translation="MMGGTYNEPNTNLTSPETTIRNLVHGIGFQRDVLGAEPATAWQLD
FT                   VFGHDPQFPGLAADAGLTSSSWARGPHHQWGPAQGGVDRMQFCSEFEWIAPSGRGLLTH
FT                   YMPAHYSAGWSMDSSTSLADAEAATYALFDQLKKVALTRNVLLPVGTDYTPPNKWVTAI
FT                   HRDWGARYTWPRFVCALPKEFFAAVRAELAKRGWVPSPQTRDMNPIYTGKDVSYIDTKQ
FT                   ANRAAENAVLEAERFAVFAALLTGAEYPQAALAKAWVQLAYGAHHDAITGSESDQVYLD
FT                   LLTGWRDAWELGRAARDNSLRLLSGAVAASHDRVVVWNPLTQRRTDIVTARVDPPLQAG
FT                   VRVFDPDGAEVAALVEHDGRSVTWLACDVPSLGWRVYRLVPADEAPGWELVPGTDIANE
FT                   HYRLAVDPERGGALSSLVQDGRQLIAAGRVANELALYEEYPSHPTQGEGPWHLLPTGPV
FT                   VCSSACPAQVQAYRGPLGQRLVVRGRIGTLLRYTQTLTLWDGVDRVDCRTSIDEFTGED
FT                   RLLRLRWPCPVPGAMPISEVGDAVVGRGFALLHEGPESVDTAQHPWTLDNPAYGWFGLS
FT                   SAVRVRAGDGVRAVSVAEVVSPTETVSGPMARDLMVALVRAGVTATCSGADKPRYGHLD
FT                   VDSNLPDARIALGGPDRNTFTKAVLAEAAPAYTAELQRQLAKTGTARVWVPAANPLARA
FT                   WLPGADLRAPCALPVLVIDGRDEKHLRAAVASLADDLADAEIVVHQRAAPQMEPFEDRT
FT                   VALLNRGVPSFAVDSEGTLHTALMRSCTGWPSGVWIDQPRRTAPDGSNFQLQHWTHHFD
FT                   YALVCGGGDWRRAGIPARSAQFSHPLLAVAPRRPQGELPAVGSLLHVEPADSVQLGALK
FT                   AAGNPLAAGSARPVQPAAVALRLVQTTGADTPVTIGCELGKVGALRPADLLETPLAMAR
FT                   ARKSSIDLHGYQVATVLARLDVAADMANVLAADDVALAPHAETAQPQYARYWLHNRGPA
FT                   PLGGLPAVAHLHPRRVRGQPGDDVVLRLTAASDCTDSVLGGVVDVVCPLGWPATPARLP
FT                   FTLGAGAHLQADIALSIPAGAPPGPYPVRAQLRVVDTAVPAAWRQVVEDVCVVTVGADS
FT                   DLEELVYLVDGPADIELAAGDRARLAVTIGSRAHAELALDAHSISPWGTWEWIGPPALG
FT                   AVLPARGMAKLAFDVTPPAWLEPGQWWALVRVGCAGQLVYSPAVKVSVT"
FT   gene            747669..748343
FT                   /gene="fabD2"
FT                   /locus_tag="MRA_0660"
FT   CDS_pept        747669..748343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabD2"
FT                   /locus_tag="MRA_0660"
FT                   /product="putative malonyl CoA acyl carrier protein
FT                   transacylase FabD2"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72384"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A5U034"
FT                   /protein_id="ABQ72384.1"
FT                   /translation="MSGRSRLPGSSSRRDAARIVAERVVATVAGVAVAVDEVDAAEARL
FT                   RDGPRAAALPASGTSEGRQLRRWLTQLIVTERVVAAEAAARGLTAAGAPAEADLLPDAT
FT                   ARLEIGSVAAAVLADPLARALFAAVTARVAVTDDAVADYHARNPLRFAAPCPGQHGWRA
FT                   PAAAAPPLDQVRRAITEHLLGAARRRAFRVWLDARRNALVVLAPGYEHPGDPRQPDNTR
FT                   RH"
FT   gene            748343..749251
FT                   /locus_tag="MRA_0661"
FT   CDS_pept        748343..749251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0661"
FT                   /product="putative glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72385"
FT                   /db_xref="GOA:A5U035"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A5U035"
FT                   /protein_id="ABQ72385.1"
FT                   /translation="MLTLCLDIGGTKIAAGLADPAGTLVHTAQRPTPAYGGAEQVWAAV
FT                   AEMIADALGVAGGAVGGVGIASAGPIDLHSGRVSPINIGSWGGFPLRDRVAAAVPGVPV
FT                   RLGGDGVCMALGEHWLGAGRGARFLLGLVVSTGVGGGLVLDGAPCLGRTGNAGHVGHVV
FT                   VDPDGSPCPCGGRGCVETIASGPSLARWARANGWSAPPGAGAKELAEAAGAGDPVALRA
FT                   FRRGAAALAAMIASVGAVCDLDLAVIGGGVAKSGRLLFEPLRAALADHARLDFLAGLRV
FT                   VPAELGGAAGLVGAARLAAIA"
FT   gene            749582..750118
FT                   /gene="rplJ"
FT                   /locus_tag="MRA_0662"
FT   CDS_pept        749582..750118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="MRA_0662"
FT                   /product="50S ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72386"
FT                   /db_xref="GOA:A5U036"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5U036"
FT                   /protein_id="ABQ72386.1"
FT                   /translation="MARADKATAVADIAAQFKESTATLITEYRGLTVANLAELRRSLTG
FT                   SATYAVAKNTLIKRAASEAGIEGLDELFVGPTAIAFVTGEPVDAAKAIKTFAKEHKALV
FT                   IKGGYMDGHPLTVAEVERIADLESREVLLAKLAGAMKGNLAKAAGLFNAPASQLARLAA
FT                   ALQEKKACPGPDSAE"
FT   gene            750155..750547
FT                   /gene="rplL"
FT                   /locus_tag="MRA_0663"
FT   CDS_pept        750155..750547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="MRA_0663"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72387"
FT                   /db_xref="GOA:A5U037"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:A5U037"
FT                   /protein_id="ABQ72387.1"
FT                   /translation="MAKLSTDELLDAFKEMTLLELSDFVKKFEETFEVTAAAPVAVAAA
FT                   GAAPAGAAVEAAEEQSEFDVILEAAGDKKIGVIKVVREIVSGLGLKEAKDLVDGAPKPL
FT                   LEKVAKEAADEAKAKLEAAGATVTVK"
FT   gene            complement(750540..751235)
FT                   /locus_tag="MRA_0664"
FT   CDS_pept        complement(750540..751235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0664"
FT                   /product="putative transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72388"
FT                   /db_xref="GOA:A5U038"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A5U038"
FT                   /protein_id="ABQ72388.1"
FT                   /translation="MTSQTGVRDELLHAGVRLLDDHGPDALQTRKVAAAAGTSTMAVYT
FT                   HFGGMRGLIAAIAEEGLRQFDVALTVPQTADPVADLLAIGTAYRRYAIERPHMYRLMFG
FT                   STSAHGINVPARDVLTLKVAEIEHQHPSFAHVVRAVHRCLLAGRFATALGADDDTAIVA
FT                   TAAQFWSQIHGFVMLELAGFYGDRGAAVEPVLAAMTVNLLVALGDSPERAQCSLRAEQT
FT                   QKNTLGRAT"
FT   gene            751306..752811
FT                   /locus_tag="MRA_0665"
FT   CDS_pept        751306..752811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MRA_0665"
FT                   /product="putative dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72389"
FT                   /db_xref="GOA:A5U039"
FT                   /db_xref="InterPro:IPR004294"
FT                   /db_xref="UniProtKB/TrEMBL:A5U039"
FT                   /protein_id="ABQ72389.1"
FT                   /translation="MTTAQAAESQNPYLEGFLAPVSTEVTATDLPVTGRIPEHLDGRYL
FT                   RNGPNPVAEVDPATYHWFTGDAMVHGVALRDGKARWYRNRWVRTPAVCAALGEPISARP
FT                   HPRTGIIEGGPNTNVLTHAGRTLALVEAGVVNYELTDELDTVGPCDFDGTLHGGYTAHP
FT                   QRDPHTGELHAVSYSFARGHRVQYSVIGTDGHARRTVDIEVAGSPMMHSFSLTDNYVVI
FT                   YDLPVTFDPMQVVPASVPRWLQRPARLVIQSVLGRVRIPDPIAALGNRMQGHSDRLPYA
FT                   WNPSYPARVGVMPREGGNEDVRWFDIEPCYVYHPLNAYSECRNGAEVLVLDVVRYSRMF
FT                   DRDRRGPGGDSRPSLDRWTINLATGAVTAECRDDRAQEFPRINETLVGGPHRFAYTVGI
FT                   EGGFLVGAGAALSTPLYKQDCVTGSSTVASLDPDLLIGEMVFVPNPSARAEDDGILMGY
FT                   GWHRGRDEGQLLLLDAQTLESIATVHLPQRVPMGFHGNWAPTT"
FT   gene            752823..753902
FT                   /gene="mkl"
FT                   /locus_tag="MRA_0666"
FT   CDS_pept        752823..753902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mkl"
FT                   /locus_tag="MRA_0666"
FT                   /product="ribonucleotide ABC transporter ATP-binding
FT                   protein Mkl"
FT                   /db_xref="EnsemblGenomes-Gn:MRA_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ72390"
FT                   /db_xref="GOA:A5U040"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030296"
FT                   /db_xref="UniProtKB/TrEMBL:A5U040"
FT                   /protein_id="ABQ72390.1"
FT                   /translation="MRYSDSYHTTGRWQPRASTEGFPMGVSIEVNGLTKSFGSSRIWED
FT                   VTLTIPAGEVSVLLGPSGTGKSVFLKSLIGLLRPERGSIIIDGTDIIECSAKELYEIRT
FT                   LFGVLFQDGALFGSMNLYDNTAFPLREHTKKKESEIRDIVMEKLALVGLGGDEKKFPGE
FT                   ISGGMRKRAGLARALVLDPQIILCDEPDSGLDPVRTAYLSQLIMDINAQIDATILIVTH
FT                   NINIARTVPDNMGMLFRKHLVMFGPREVLLTSDEPVVRQFLNGRRIGPIGMSEEKDEAT
FT                   MAEEQALLDAGHHAGGVEEIEGVPPQISATPGMPERKAVARRQARVREMLHTLPKKAQA
FT                   AILDDLEGTHKYAVHEIGQ"
FT   gene            complement(754290..754673)
FT                   /locus_tag="MRA_0