(data stored in ACNUC7421 zone)

EMBL: CP000613

ID   CP000613; SV 2; circular; genomic DNA; STD; PRO; 4355543 BP.
XX
AC   CP000613;
XX
PR   Project:PRJNA18307;
XX
DT   26-OCT-2008 (Rel. 97, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 10)
XX
DE   Rhodospirillum centenum SW, complete genome.
XX
KW   .
XX
OS   Rhodospirillum centenum SW
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales;
OC   Rhodospirillaceae; Rhodospirillum.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-4355543
RX   DOI; 10.1186/1471-2164-11-325.
RX   PUBMED; 20500872.
RA   Lu Y.K., Marden J., Han M., Swingley W.D., Mastrian S.D., Chowdhury S.R.,
RA   Hao J., Helmy T., Kim S., Kurdoglu A.A., Matthies H.J., Rollo D.,
RA   Stothard P., Blankenship R.E., Bauer C.E., Touchman J.W.;
RT   "Metabolic flexibility revealed in the genome of the cyst-forming alpha-1
RT   proteobacterium Rhodospirillum centenum";
RL   BMC Genomics 11:325-325(2010).
XX
RN   [2]
RP   1-4355543
RA   Touchman J.W.;
RT   ;
RL   Submitted (05-MAR-2007) to the INSDC.
RL   Pathogen Genomics, Translational Genomics Research Institute, 445 N. Fifth
RL   Street, Phoenix, AZ 85004, USA
XX
RN   [3]
RC   Sequence update by submitter
RP   1-4355543
RA   Touchman J.W.;
RT   ;
RL   Submitted (17-FEB-2010) to the INSDC.
RL   Pathogen Genomics, Translational Genomics Research Institute, 445 N. Fifth
RL   Street, Phoenix, AZ 85004, USA
XX
DR   MD5; eef9d3caf987d2da135545fba0609b74.
DR   BioSample; SAMN02603908.
DR   EnsemblGenomes-Gn; EBG00001245219.
DR   EnsemblGenomes-Gn; EBG00001245220.
DR   EnsemblGenomes-Gn; EBG00001245221.
DR   EnsemblGenomes-Gn; EBG00001245222.
DR   EnsemblGenomes-Gn; EBG00001245223.
DR   EnsemblGenomes-Gn; EBG00001245224.
DR   EnsemblGenomes-Gn; EBG00001245225.
DR   EnsemblGenomes-Gn; EBG00001245226.
DR   EnsemblGenomes-Gn; EBG00001245227.
DR   EnsemblGenomes-Gn; EBG00001245228.
DR   EnsemblGenomes-Gn; EBG00001245229.
DR   EnsemblGenomes-Gn; EBG00001245230.
DR   EnsemblGenomes-Gn; EBG00001245231.
DR   EnsemblGenomes-Gn; EBG00001245232.
DR   EnsemblGenomes-Gn; EBG00001245233.
DR   EnsemblGenomes-Gn; EBG00001245234.
DR   EnsemblGenomes-Gn; EBG00001245235.
DR   EnsemblGenomes-Gn; EBG00001245236.
DR   EnsemblGenomes-Gn; EBG00001245237.
DR   EnsemblGenomes-Gn; EBG00001245238.
DR   EnsemblGenomes-Gn; EBG00001245239.
DR   EnsemblGenomes-Gn; EBG00001245240.
DR   EnsemblGenomes-Gn; EBG00001245241.
DR   EnsemblGenomes-Gn; EBG00001245242.
DR   EnsemblGenomes-Gn; EBG00001245243.
DR   EnsemblGenomes-Gn; EBG00001245244.
DR   EnsemblGenomes-Gn; EBG00001245245.
DR   EnsemblGenomes-Gn; EBG00001245246.
DR   EnsemblGenomes-Gn; EBG00001245247.
DR   EnsemblGenomes-Gn; EBG00001245248.
DR   EnsemblGenomes-Gn; EBG00001245249.
DR   EnsemblGenomes-Gn; EBG00001245250.
DR   EnsemblGenomes-Gn; EBG00001245251.
DR   EnsemblGenomes-Gn; EBG00001245252.
DR   EnsemblGenomes-Gn; EBG00001245253.
DR   EnsemblGenomes-Gn; EBG00001245254.
DR   EnsemblGenomes-Gn; EBG00001245255.
DR   EnsemblGenomes-Gn; EBG00001245256.
DR   EnsemblGenomes-Gn; EBG00001245257.
DR   EnsemblGenomes-Gn; EBG00001245258.
DR   EnsemblGenomes-Gn; EBG00001245259.
DR   EnsemblGenomes-Gn; EBG00001245260.
DR   EnsemblGenomes-Gn; EBG00001245261.
DR   EnsemblGenomes-Gn; EBG00001245262.
DR   EnsemblGenomes-Gn; EBG00001245263.
DR   EnsemblGenomes-Gn; EBG00001245264.
DR   EnsemblGenomes-Gn; EBG00001245265.
DR   EnsemblGenomes-Gn; EBG00001245266.
DR   EnsemblGenomes-Gn; EBG00001245267.
DR   EnsemblGenomes-Gn; EBG00001245268.
DR   EnsemblGenomes-Gn; EBG00001245269.
DR   EnsemblGenomes-Gn; EBG00001245270.
DR   EnsemblGenomes-Gn; EBG00001245271.
DR   EnsemblGenomes-Gn; EBG00001245272.
DR   EnsemblGenomes-Gn; EBG00001245273.
DR   EnsemblGenomes-Gn; EBG00001245274.
DR   EnsemblGenomes-Gn; EBG00001245275.
DR   EnsemblGenomes-Gn; EBG00001245276.
DR   EnsemblGenomes-Gn; EBG00001245277.
DR   EnsemblGenomes-Gn; EBG00001245278.
DR   EnsemblGenomes-Gn; EBG00001245279.
DR   EnsemblGenomes-Gn; EBG00001245280.
DR   EnsemblGenomes-Gn; EBG00001245281.
DR   EnsemblGenomes-Gn; EBG00001245282.
DR   EnsemblGenomes-Gn; EBG00001245283.
DR   EnsemblGenomes-Gn; EBG00001245284.
DR   EnsemblGenomes-Gn; EBG00001245285.
DR   EnsemblGenomes-Gn; EBG00001245286.
DR   EnsemblGenomes-Gn; EBG00001245287.
DR   EnsemblGenomes-Gn; EBG00001245288.
DR   EnsemblGenomes-Gn; EBG00001245289.
DR   EnsemblGenomes-Gn; EBG00001245290.
DR   EnsemblGenomes-Gn; EBG00001245291.
DR   EnsemblGenomes-Gn; EBG00001245292.
DR   EnsemblGenomes-Gn; EBG00001245293.
DR   EnsemblGenomes-Gn; EBG00001245294.
DR   EnsemblGenomes-Gn; EBG00001245295.
DR   EnsemblGenomes-Gn; EBG00001245296.
DR   EnsemblGenomes-Gn; EBG00001245297.
DR   EnsemblGenomes-Gn; EBG00001245298.
DR   EnsemblGenomes-Gn; EBG00001245299.
DR   EnsemblGenomes-Gn; EBG00001245300.
DR   EnsemblGenomes-Gn; EBG00001245301.
DR   EnsemblGenomes-Gn; EBG00001245302.
DR   EnsemblGenomes-Gn; EBG00001245303.
DR   EnsemblGenomes-Gn; EBG00001245304.
DR   EnsemblGenomes-Gn; EBG00001245305.
DR   EnsemblGenomes-Gn; EBG00001245306.
DR   EnsemblGenomes-Gn; EBG00001245307.
DR   EnsemblGenomes-Gn; EBG00001245308.
DR   EnsemblGenomes-Gn; EBG00001245309.
DR   EnsemblGenomes-Gn; EBG00001245310.
DR   EnsemblGenomes-Gn; EBG00001245311.
DR   EnsemblGenomes-Gn; EBG00001245312.
DR   EnsemblGenomes-Gn; EBG00001245313.
DR   EnsemblGenomes-Gn; EBG00001245314.
DR   EnsemblGenomes-Gn; EBG00001245315.
DR   EnsemblGenomes-Gn; EBG00001245316.
DR   EnsemblGenomes-Gn; EBG00001245317.
DR   EnsemblGenomes-Gn; EBG00001245318.
DR   EnsemblGenomes-Gn; EBG00001245319.
DR   EnsemblGenomes-Gn; EBG00001245320.
DR   EnsemblGenomes-Gn; EBG00001245321.
DR   EnsemblGenomes-Gn; EBG00001245322.
DR   EnsemblGenomes-Gn; EBG00001245323.
DR   EnsemblGenomes-Gn; RC1_0031.
DR   EnsemblGenomes-Gn; RC1_0062.
DR   EnsemblGenomes-Gn; RC1_0318.
DR   EnsemblGenomes-Gn; RC1_0346.
DR   EnsemblGenomes-Gn; RC1_0371.
DR   EnsemblGenomes-Gn; RC1_0372.
DR   EnsemblGenomes-Gn; RC1_0373.
DR   EnsemblGenomes-Gn; RC1_0374.
DR   EnsemblGenomes-Gn; RC1_0406.
DR   EnsemblGenomes-Gn; RC1_0461.
DR   EnsemblGenomes-Gn; RC1_0554.
DR   EnsemblGenomes-Gn; RC1_0606.
DR   EnsemblGenomes-Gn; RC1_0687.
DR   EnsemblGenomes-Gn; RC1_0691.
DR   EnsemblGenomes-Gn; RC1_0692.
DR   EnsemblGenomes-Gn; RC1_0694.
DR   EnsemblGenomes-Gn; RC1_0836.
DR   EnsemblGenomes-Gn; RC1_0911.
DR   EnsemblGenomes-Gn; RC1_0939.
DR   EnsemblGenomes-Gn; RC1_0959.
DR   EnsemblGenomes-Gn; RC1_1015.
DR   EnsemblGenomes-Gn; RC1_1061.
DR   EnsemblGenomes-Gn; RC1_1070.
DR   EnsemblGenomes-Gn; RC1_1083.
DR   EnsemblGenomes-Gn; RC1_1085.
DR   EnsemblGenomes-Gn; RC1_1097.
DR   EnsemblGenomes-Gn; RC1_1155.
DR   EnsemblGenomes-Gn; RC1_1157.
DR   EnsemblGenomes-Gn; RC1_1212.
DR   EnsemblGenomes-Gn; RC1_1213.
DR   EnsemblGenomes-Gn; RC1_1241.
DR   EnsemblGenomes-Gn; RC1_1243.
DR   EnsemblGenomes-Gn; RC1_1250.
DR   EnsemblGenomes-Gn; RC1_1256.
DR   EnsemblGenomes-Gn; RC1_1286.
DR   EnsemblGenomes-Gn; RC1_1302.
DR   EnsemblGenomes-Gn; RC1_1323.
DR   EnsemblGenomes-Gn; RC1_1538.
DR   EnsemblGenomes-Gn; RC1_1597.
DR   EnsemblGenomes-Gn; RC1_1643.
DR   EnsemblGenomes-Gn; RC1_1657.
DR   EnsemblGenomes-Gn; RC1_1677.
DR   EnsemblGenomes-Gn; RC1_1728.
DR   EnsemblGenomes-Gn; RC1_1810.
DR   EnsemblGenomes-Gn; RC1_1962.
DR   EnsemblGenomes-Gn; RC1_1963.
DR   EnsemblGenomes-Gn; RC1_2003.
DR   EnsemblGenomes-Gn; RC1_2040.
DR   EnsemblGenomes-Gn; RC1_2043.
DR   EnsemblGenomes-Gn; RC1_2063.
DR   EnsemblGenomes-Gn; RC1_2089.
DR   EnsemblGenomes-Gn; RC1_2334.
DR   EnsemblGenomes-Gn; RC1_2377.
DR   EnsemblGenomes-Gn; RC1_2423.
DR   EnsemblGenomes-Gn; RC1_2434.
DR   EnsemblGenomes-Gn; RC1_2494.
DR   EnsemblGenomes-Gn; RC1_2497.
DR   EnsemblGenomes-Gn; RC1_2546.
DR   EnsemblGenomes-Gn; RC1_2625.
DR   EnsemblGenomes-Gn; RC1_2626.
DR   EnsemblGenomes-Gn; RC1_2627.
DR   EnsemblGenomes-Gn; RC1_2628.
DR   EnsemblGenomes-Gn; RC1_2629.
DR   EnsemblGenomes-Gn; RC1_2630.
DR   EnsemblGenomes-Gn; RC1_2735.
DR   EnsemblGenomes-Gn; RC1_2736.
DR   EnsemblGenomes-Gn; RC1_2791.
DR   EnsemblGenomes-Gn; RC1_2854.
DR   EnsemblGenomes-Gn; RC1_2872.
DR   EnsemblGenomes-Gn; RC1_3019.
DR   EnsemblGenomes-Gn; RC1_3031.
DR   EnsemblGenomes-Gn; RC1_3087.
DR   EnsemblGenomes-Gn; RC1_3153.
DR   EnsemblGenomes-Gn; RC1_3191.
DR   EnsemblGenomes-Gn; RC1_3198.
DR   EnsemblGenomes-Gn; RC1_3310.
DR   EnsemblGenomes-Gn; RC1_3341.
DR   EnsemblGenomes-Gn; RC1_3412.
DR   EnsemblGenomes-Gn; RC1_3413.
DR   EnsemblGenomes-Gn; RC1_3518.
DR   EnsemblGenomes-Gn; RC1_3538.
DR   EnsemblGenomes-Gn; RC1_3539.
DR   EnsemblGenomes-Gn; RC1_3540.
DR   EnsemblGenomes-Gn; RC1_3541.
DR   EnsemblGenomes-Gn; RC1_3577.
DR   EnsemblGenomes-Gn; RC1_3587.
DR   EnsemblGenomes-Gn; RC1_3603.
DR   EnsemblGenomes-Gn; RC1_3702.
DR   EnsemblGenomes-Gn; RC1_3703.
DR   EnsemblGenomes-Gn; RC1_3704.
DR   EnsemblGenomes-Gn; RC1_3705.
DR   EnsemblGenomes-Gn; RC1_3706.
DR   EnsemblGenomes-Gn; RC1_3707.
DR   EnsemblGenomes-Gn; RC1_3905.
DR   EnsemblGenomes-Gn; RC1_3968.
DR   EnsemblGenomes-Gn; RC1_4037.
DR   EnsemblGenomes-Gn; RC1_4122.
DR   EnsemblGenomes-Gn; RC1_4126.
DR   EnsemblGenomes-Gn; RC1_4127.
DR   EnsemblGenomes-Tr; EBT00001590608.
DR   EnsemblGenomes-Tr; EBT00001590609.
DR   EnsemblGenomes-Tr; EBT00001590610.
DR   EnsemblGenomes-Tr; EBT00001590611.
DR   EnsemblGenomes-Tr; EBT00001590612.
DR   EnsemblGenomes-Tr; EBT00001590613.
DR   EnsemblGenomes-Tr; EBT00001590614.
DR   EnsemblGenomes-Tr; EBT00001590615.
DR   EnsemblGenomes-Tr; EBT00001590616.
DR   EnsemblGenomes-Tr; EBT00001590617.
DR   EnsemblGenomes-Tr; EBT00001590618.
DR   EnsemblGenomes-Tr; EBT00001590619.
DR   EnsemblGenomes-Tr; EBT00001590620.
DR   EnsemblGenomes-Tr; EBT00001590621.
DR   EnsemblGenomes-Tr; EBT00001590622.
DR   EnsemblGenomes-Tr; EBT00001590623.
DR   EnsemblGenomes-Tr; EBT00001590624.
DR   EnsemblGenomes-Tr; EBT00001590625.
DR   EnsemblGenomes-Tr; EBT00001590626.
DR   EnsemblGenomes-Tr; EBT00001590627.
DR   EnsemblGenomes-Tr; EBT00001590628.
DR   EnsemblGenomes-Tr; EBT00001590629.
DR   EnsemblGenomes-Tr; EBT00001590630.
DR   EnsemblGenomes-Tr; EBT00001590631.
DR   EnsemblGenomes-Tr; EBT00001590632.
DR   EnsemblGenomes-Tr; EBT00001590633.
DR   EnsemblGenomes-Tr; EBT00001590634.
DR   EnsemblGenomes-Tr; EBT00001590635.
DR   EnsemblGenomes-Tr; EBT00001590636.
DR   EnsemblGenomes-Tr; EBT00001590637.
DR   EnsemblGenomes-Tr; EBT00001590638.
DR   EnsemblGenomes-Tr; EBT00001590639.
DR   EnsemblGenomes-Tr; EBT00001590640.
DR   EnsemblGenomes-Tr; EBT00001590641.
DR   EnsemblGenomes-Tr; EBT00001590642.
DR   EnsemblGenomes-Tr; EBT00001590643.
DR   EnsemblGenomes-Tr; EBT00001590644.
DR   EnsemblGenomes-Tr; EBT00001590645.
DR   EnsemblGenomes-Tr; EBT00001590646.
DR   EnsemblGenomes-Tr; EBT00001590647.
DR   EnsemblGenomes-Tr; EBT00001590648.
DR   EnsemblGenomes-Tr; EBT00001590649.
DR   EnsemblGenomes-Tr; EBT00001590650.
DR   EnsemblGenomes-Tr; EBT00001590651.
DR   EnsemblGenomes-Tr; EBT00001590652.
DR   EnsemblGenomes-Tr; EBT00001590653.
DR   EnsemblGenomes-Tr; EBT00001590654.
DR   EnsemblGenomes-Tr; EBT00001590655.
DR   EnsemblGenomes-Tr; EBT00001590656.
DR   EnsemblGenomes-Tr; EBT00001590657.
DR   EnsemblGenomes-Tr; EBT00001590658.
DR   EnsemblGenomes-Tr; EBT00001590659.
DR   EnsemblGenomes-Tr; EBT00001590660.
DR   EnsemblGenomes-Tr; EBT00001590661.
DR   EnsemblGenomes-Tr; EBT00001590662.
DR   EnsemblGenomes-Tr; EBT00001590663.
DR   EnsemblGenomes-Tr; EBT00001590664.
DR   EnsemblGenomes-Tr; EBT00001590665.
DR   EnsemblGenomes-Tr; EBT00001590666.
DR   EnsemblGenomes-Tr; EBT00001590667.
DR   EnsemblGenomes-Tr; EBT00001590668.
DR   EnsemblGenomes-Tr; EBT00001590669.
DR   EnsemblGenomes-Tr; EBT00001590670.
DR   EnsemblGenomes-Tr; EBT00001590671.
DR   EnsemblGenomes-Tr; EBT00001590672.
DR   EnsemblGenomes-Tr; EBT00001590673.
DR   EnsemblGenomes-Tr; EBT00001590674.
DR   EnsemblGenomes-Tr; EBT00001590675.
DR   EnsemblGenomes-Tr; EBT00001590676.
DR   EnsemblGenomes-Tr; EBT00001590677.
DR   EnsemblGenomes-Tr; EBT00001590678.
DR   EnsemblGenomes-Tr; EBT00001590679.
DR   EnsemblGenomes-Tr; EBT00001590680.
DR   EnsemblGenomes-Tr; EBT00001590681.
DR   EnsemblGenomes-Tr; EBT00001590682.
DR   EnsemblGenomes-Tr; EBT00001590683.
DR   EnsemblGenomes-Tr; EBT00001590684.
DR   EnsemblGenomes-Tr; EBT00001590685.
DR   EnsemblGenomes-Tr; EBT00001590686.
DR   EnsemblGenomes-Tr; EBT00001590687.
DR   EnsemblGenomes-Tr; EBT00001590688.
DR   EnsemblGenomes-Tr; EBT00001590689.
DR   EnsemblGenomes-Tr; EBT00001590690.
DR   EnsemblGenomes-Tr; EBT00001590691.
DR   EnsemblGenomes-Tr; EBT00001590692.
DR   EnsemblGenomes-Tr; EBT00001590693.
DR   EnsemblGenomes-Tr; EBT00001590694.
DR   EnsemblGenomes-Tr; EBT00001590695.
DR   EnsemblGenomes-Tr; EBT00001590696.
DR   EnsemblGenomes-Tr; EBT00001590697.
DR   EnsemblGenomes-Tr; EBT00001590698.
DR   EnsemblGenomes-Tr; EBT00001590699.
DR   EnsemblGenomes-Tr; EBT00001590700.
DR   EnsemblGenomes-Tr; EBT00001590701.
DR   EnsemblGenomes-Tr; EBT00001590702.
DR   EnsemblGenomes-Tr; EBT00001590703.
DR   EnsemblGenomes-Tr; EBT00001590704.
DR   EnsemblGenomes-Tr; EBT00001590705.
DR   EnsemblGenomes-Tr; EBT00001590706.
DR   EnsemblGenomes-Tr; EBT00001590707.
DR   EnsemblGenomes-Tr; EBT00001590708.
DR   EnsemblGenomes-Tr; EBT00001590709.
DR   EnsemblGenomes-Tr; EBT00001590710.
DR   EnsemblGenomes-Tr; EBT00001590711.
DR   EnsemblGenomes-Tr; EBT00001590712.
DR   EnsemblGenomes-Tr; RC1_0031-1.
DR   EnsemblGenomes-Tr; RC1_0062.
DR   EnsemblGenomes-Tr; RC1_0318.
DR   EnsemblGenomes-Tr; RC1_0346.
DR   EnsemblGenomes-Tr; RC1_0371-1.
DR   EnsemblGenomes-Tr; RC1_0372-1.
DR   EnsemblGenomes-Tr; RC1_0373-1.
DR   EnsemblGenomes-Tr; RC1_0374-1.
DR   EnsemblGenomes-Tr; RC1_0406-1.
DR   EnsemblGenomes-Tr; RC1_0461.
DR   EnsemblGenomes-Tr; RC1_0554.
DR   EnsemblGenomes-Tr; RC1_0606.
DR   EnsemblGenomes-Tr; RC1_0687-1.
DR   EnsemblGenomes-Tr; RC1_0691-1.
DR   EnsemblGenomes-Tr; RC1_0692-1.
DR   EnsemblGenomes-Tr; RC1_0694-1.
DR   EnsemblGenomes-Tr; RC1_0836.
DR   EnsemblGenomes-Tr; RC1_0911.
DR   EnsemblGenomes-Tr; RC1_0939-1.
DR   EnsemblGenomes-Tr; RC1_0959.
DR   EnsemblGenomes-Tr; RC1_1015-1.
DR   EnsemblGenomes-Tr; RC1_1061-1.
DR   EnsemblGenomes-Tr; RC1_1070.
DR   EnsemblGenomes-Tr; RC1_1083-1.
DR   EnsemblGenomes-Tr; RC1_1085-1.
DR   EnsemblGenomes-Tr; RC1_1097.
DR   EnsemblGenomes-Tr; RC1_1155-1.
DR   EnsemblGenomes-Tr; RC1_1157-1.
DR   EnsemblGenomes-Tr; RC1_1212.
DR   EnsemblGenomes-Tr; RC1_1213.
DR   EnsemblGenomes-Tr; RC1_1241-1.
DR   EnsemblGenomes-Tr; RC1_1243-1.
DR   EnsemblGenomes-Tr; RC1_1250-1.
DR   EnsemblGenomes-Tr; RC1_1256-1.
DR   EnsemblGenomes-Tr; RC1_1286.
DR   EnsemblGenomes-Tr; RC1_1302-1.
DR   EnsemblGenomes-Tr; RC1_1323-1.
DR   EnsemblGenomes-Tr; RC1_1538-1.
DR   EnsemblGenomes-Tr; RC1_1597-1.
DR   EnsemblGenomes-Tr; RC1_1643-1.
DR   EnsemblGenomes-Tr; RC1_1657-1.
DR   EnsemblGenomes-Tr; RC1_1677-1.
DR   EnsemblGenomes-Tr; RC1_1728-1.
DR   EnsemblGenomes-Tr; RC1_1810.
DR   EnsemblGenomes-Tr; RC1_1962-1.
DR   EnsemblGenomes-Tr; RC1_1963-1.
DR   EnsemblGenomes-Tr; RC1_2003-1.
DR   EnsemblGenomes-Tr; RC1_2040.
DR   EnsemblGenomes-Tr; RC1_2043.
DR   EnsemblGenomes-Tr; RC1_2063-1.
DR   EnsemblGenomes-Tr; RC1_2089.
DR   EnsemblGenomes-Tr; RC1_2334.
DR   EnsemblGenomes-Tr; RC1_2377-1.
DR   EnsemblGenomes-Tr; RC1_2423.
DR   EnsemblGenomes-Tr; RC1_2434-1.
DR   EnsemblGenomes-Tr; RC1_2494-1.
DR   EnsemblGenomes-Tr; RC1_2497-1.
DR   EnsemblGenomes-Tr; RC1_2546-1.
DR   EnsemblGenomes-Tr; RC1_2625-1.
DR   EnsemblGenomes-Tr; RC1_2626-1.
DR   EnsemblGenomes-Tr; RC1_2627-1.
DR   EnsemblGenomes-Tr; RC1_2628-1.
DR   EnsemblGenomes-Tr; RC1_2629-1.
DR   EnsemblGenomes-Tr; RC1_2630-1.
DR   EnsemblGenomes-Tr; RC1_2735-1.
DR   EnsemblGenomes-Tr; RC1_2736-1.
DR   EnsemblGenomes-Tr; RC1_2791.
DR   EnsemblGenomes-Tr; RC1_2854.
DR   EnsemblGenomes-Tr; RC1_2872-1.
DR   EnsemblGenomes-Tr; RC1_3019.
DR   EnsemblGenomes-Tr; RC1_3031-1.
DR   EnsemblGenomes-Tr; RC1_3087.
DR   EnsemblGenomes-Tr; RC1_3153.
DR   EnsemblGenomes-Tr; RC1_3191-1.
DR   EnsemblGenomes-Tr; RC1_3198-1.
DR   EnsemblGenomes-Tr; RC1_3310.
DR   EnsemblGenomes-Tr; RC1_3341-1.
DR   EnsemblGenomes-Tr; RC1_3412.
DR   EnsemblGenomes-Tr; RC1_3413.
DR   EnsemblGenomes-Tr; RC1_3518-1.
DR   EnsemblGenomes-Tr; RC1_3538-1.
DR   EnsemblGenomes-Tr; RC1_3539-1.
DR   EnsemblGenomes-Tr; RC1_3540-1.
DR   EnsemblGenomes-Tr; RC1_3541-1.
DR   EnsemblGenomes-Tr; RC1_3577.
DR   EnsemblGenomes-Tr; RC1_3587.
DR   EnsemblGenomes-Tr; RC1_3603.
DR   EnsemblGenomes-Tr; RC1_3702-1.
DR   EnsemblGenomes-Tr; RC1_3703-1.
DR   EnsemblGenomes-Tr; RC1_3704-1.
DR   EnsemblGenomes-Tr; RC1_3705-1.
DR   EnsemblGenomes-Tr; RC1_3706-1.
DR   EnsemblGenomes-Tr; RC1_3707-1.
DR   EnsemblGenomes-Tr; RC1_3905.
DR   EnsemblGenomes-Tr; RC1_3968-1.
DR   EnsemblGenomes-Tr; RC1_4037.
DR   EnsemblGenomes-Tr; RC1_4122-1.
DR   EnsemblGenomes-Tr; RC1_4126.
DR   EnsemblGenomes-Tr; RC1_4127.
DR   EuropePMC; PMC2890560; 20500872.
DR   EuropePMC; PMC4032944; 24904540.
DR   EuropePMC; PMC5772239; 29150498.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00517; serC.
DR   RFAM; RF00519; suhB.
DR   RFAM; RF00521; SAM_alpha.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000613.
DR   SILVA-SSU; CP000613.
DR   StrainInfo; 355473; 0.
XX
CC   On Feb 17, 2010 this sequence version replaced gi:209956825.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4355543
FT                   /organism="Rhodospirillum centenum SW"
FT                   /strain="SW; ATCC 51521"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:414684"
FT                   /culture_collection="ATCC:51521"
FT   gene            11..3343
FT                   /locus_tag="RC1_0011"
FT   CDS_pept        11..3343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0011"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains a type I secretion target ggxgxdxxx repeat
FT                   (2 copies) domain; Contains a Cadherin domain; identified
FT                   by match to protein family HMM PF02789"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97462"
FT                   /db_xref="GOA:B6IPS6"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPS6"
FT                   /protein_id="ACI97462.1"
FT                   /translation="MIGAVTGSAGSNDTLVLAGSGYVTLTAQGLVLSGIETVSFDNDAL
FT                   SRTVVIDQALNLAFGLSGTNSVSTAVAALDLSGKSLTGVDALVSTSDTGTAFRLAESQI
FT                   GSGKVTSVSGGSGASDSLRVDGDAVDFSSLTLSGIETLSNQQAGGGIGVTDTVLAGLTA
FT                   ISGEDGWISSNASYDVSKISLSGIFELRSSASDGTVTITVGGDQIGSGKVERITAQAGA
FT                   DVTLVTSSASFDASELTVTNIDTITTTRAGGTAITDSGESTRIIGGSGADTLAGSFGDD
FT                   TLDGGAGDDIFLYGGGNTDNGRDLIQNLATGDIIRVSNADFSATTITAGNGTSVGLNEI
FT                   QIATANGRTTLHIGTDAQADAADLVIDLDGLYTADNFKLSGSDITVNLNASPVITAPGT
FT                   AAVAENATGVTLGTISLADGDNDAQTVTLSVGSGSFGLDTAGLSVVSDDTTAGRTLVVS
FT                   GSVGALNTALAGLTYTPVANTSGSVDLVVSTKDGKGGTDSGTVKITVSDVNPVLAPQSF
FT                   TVAENSAAGTVVGTAVASGDTNGLIWSISGGTGAGLFTIDAASGQIKVAQGAVLDFETT
FT                   ASYTLTVAVDDEDADTTADATTTVTVTLSDVDETPVTPPPVVVIPPSPPAPPLPPAPPG
FT                   PPAAPPPPPVVPTTVTATEDGVSVGRGSGSDSLTGRPVEQVVVAPVPSSRQDAGGTPTA
FT                   NADIRLGGSSSVPVLVATLPVGVGLQASGATTLTLAELSAAAGVEAGRIQAAGTVSTGT
FT                   VDLAGLSTLLPGSTPVTLRTVTPTLTAGSTTPPGQPILLSVPTSTDTSGMVTAVVIDGR
FT                   SLPSGTNIELRDVDYAVVTGSVFVTGGTGSNVVIGDDARQYIRLGPDDDTLRGGGGDDT
FT                   VGSGEGRDLLYGDEGNDSVFGGEGYDRLSGGAGDDTIDGGSGVDVVRIEAARSAVTLEA
FT                   AGPWGVRLSGAATGTDVASGVELIRFDDQVVYVTLPVRFEAVQPDGGGAFDEAFYLARW
FT                   ADVRAAVNAGQVMSGLEHYLAFGQAEGRDPTPLFDEEAYLARWADVRVAVEAGQFHSGY
FT                   EHYLAFGWREDRDPSAWFDLSAYLQRNPDVADAGIDPLRHWLVWGIGENRIATAADTGL
FT                   WFA"
FT   gene            complement(3443..4321)
FT                   /locus_tag="RC1_0012"
FT   CDS_pept        complement(3443..4321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0012"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00028
FT                   match to protein family HMM PF00353"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97463"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPS7"
FT                   /protein_id="ACI97463.1"
FT                   /translation="MDIDRNDHLSDEAGAISARTLILDLMDTGSPPDFSTRDLVLAGAA
FT                   FGLEATGIRTALTRLRQEGRVRTLDRGRHAIGAKAEPLQHRILGWREVQGRQRPWDGGW
FT                   LLAVAGPQERANRTLWRHTVRALDLEGFAEAETNVWVRPDNLEGGLEGGLEGGLEGGLE
FT                   GGLEGGATAMRRRLLALDAAPSLLLVRATALDDEREARFRTLWPVAGLAASHAGLVRRL
FT                   AESAARLPDLPLVEAAAECLLTGRQAIRAILRDPLLPEALCPPDALTDLIAAMDAYDRL
FT                   GKDIWRRYLGT"
FT   gene            4450..6072
FT                   /locus_tag="RC1_0013"
FT   CDS_pept        4450..6072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0013"
FT                   /product="Acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.-"
FT                   /note="identified by match to protein family HMM PF07848"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97464"
FT                   /db_xref="GOA:B6IPS8"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR041504"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPS8"
FT                   /protein_id="ACI97464.1"
FT                   /translation="MSSIRPLTQLETHEVFNQPPPLEGLNLFSGDTALVEAVRKAGGGV
FT                   HEARLAALGARAGTAEVIDWGVEANRRIPELDSFDRYGRRIDEVRFHPAYHELMRFGLD
FT                   SGFAAIAWDGSPAGHVGHAAILYLSGQADSGTICPMTMTYAAVPALRVEPAVAAEWVPR
FT                   ILAGRYDPAVRPAGEKAGVTIGMAMTEKQGGSDVRANTTRAVPTGQEGWYSLTGHKWFC
FT                   SAPMCDAFLTLAYAEGGLTCFLVPRWLPDGERNPGFRVMRLKDKLGDRSNASSEIEYHG
FT                   ALARRVGPEGRGVATIIQMVQHTRLDCVVGSAQIMRGAVAQALWHTANRSAFQRRLVDQ
FT                   PAMAAVLADLAVETEAATALGFRLARAFDAEDPVARLLTPVAKYWVCKRTPGVVYEAME
FT                   CLGGAGYIETGPMGRLFRQSPLNAIWEGSGNVIALDVLRAMAREPESAAALKDYLTAQA
FT                   GRNPDYDDWIAGIDLRRVTEATARMLVERLALAAQAAVLLEWDNPLADTFCSLRLRARG
FT                   AMYGAFDATIDTRAIIDRAMPAM"
FT   gene            complement(6093..6971)
FT                   /locus_tag="RC1_0014"
FT   CDS_pept        complement(6093..6971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0014"
FT                   /product="transcriptional regulator, LysR family protein"
FT                   /note="identified by match to protein family HMM PF00441
FT                   match to protein family HMM PF02770 match to protein family
FT                   HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97465"
FT                   /db_xref="GOA:B6IPS9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPS9"
FT                   /protein_id="ACI97465.1"
FT                   /translation="MTLDQLRIFVAVAEREHVTRAAQALNLAQSAVSHAIAALEAQHQV
FT                   RLFERRGRGIVLTEAGIVLLTEARTLLAQVGMIELALSDFSALKRGTLSLHASQTIASY
FT                   WLPRHLAAFHAAHPQVRIRLEIGNSAAVVAAVQAGTAELGFVEGDGETGGLARRPVARD
FT                   RLLVVVGPGHPWADGRRLAPADLAGSDWVLREPGSGTRAMFEDALIRAGVAPSALRIAL
FT                   ELPSNEAVRGVVEAGLGATCLSASVAAAGLEAGLLRQAGVDLPDRRFHLLHHPGRPRSR
FT                   AALAFAAQVEP"
FT   gene            7105..8280
FT                   /locus_tag="RC1_0015"
FT   CDS_pept        7105..8280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0015"
FT                   /product="C4-dicarboxylate transporter"
FT                   /note="identified by match to protein family HMM PF00126
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97466"
FT                   /db_xref="GOA:B6IPT0"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="InterPro:IPR038665"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPT0"
FT                   /protein_id="ACI97466.1"
FT                   /translation="MTSTDSVPAARLPAVLAPSVLPRAIRHFTPNWFTASMGTGILALA
FT                   LNQFPLPVPGLHGLARALWLLNIGLFGLFCLLYGARWLCCFDEARRIFRHPVMSMFLGA
FT                   IPMALATILNGCLVFGPELIGAAAVPLAHVLWEVDAVLAVACGILVPYCMVTRQDHALE
FT                   RMTAVWLLPVVACEVAAASGGLLVAHLPAAHGYPVLLLSYVLWALSVPAALGILVILLL
FT                   RLVLHKLPGRDMAASGWLALGPIGTGALALLLLGQEAQRLGGSAGPAGLGDAAFGIGIV
FT                   GGLILWGYGLWWLALAVLKTAHYLRRGMPFNLGWWGFTFPLGVYSLATLALGRLTGFVP
FT                   FSGIGAGLVVCLALFWTVVAARTLRGALSGRLFHAPCLAAPAPVGLAGDGI"
FT   gene            complement(8374..8511)
FT                   /locus_tag="RC1_0016"
FT   CDS_pept        complement(8374..8511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0016"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97467"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPT1"
FT                   /protein_id="ACI97467.1"
FT                   /translation="MPAALPIREDLSASELRTLARRESKGRVAARMSAIAHALDGVSLP
FT                   "
FT   gene            complement(8757..10019)
FT                   /locus_tag="RC1_0017"
FT   CDS_pept        complement(8757..10019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0017"
FT                   /product="RNA polymerase sigma-70 factor, ECF family
FT                   protein"
FT                   /note="Contains Sigma-70 region 2 and Sigma-70 region 4,
FT                   see PF04542"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97468"
FT                   /db_xref="GOA:B6IPT2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPT2"
FT                   /protein_id="ACI97468.1"
FT                   /translation="MTTGETHRAIEAVFRIERARLVAGLARLVRDVGLAEELAQDAFAT
FT                   ALAAWEAGGVPENPGAWLMAAAKRRAIDGLRRSRMLDRRHAELARELEEKRDRGVEEVE
FT                   AAMDDDVGDELLGLIFAACHPVLSPEARIALTLRLIAGLSTQEIARAFLVSEAAVAQRI
FT                   VRAKRTLGRAGLGFEVPRGREREARLGSVLEVVYLIFNEGYAATAGDDLIRPALCAEAR
FT                   RLGRILAALAPDEPEVSGLLALMEIQSSRLPARAAADGSLVPLPDQDRSRWDRLLIRRG
FT                   LAALERAVALGGGNRPYTLQAALAACHARARSAAETDWPRIAGLYDALRTVMPSPVVEL
FT                   NRAVAHSMAFGPEAGLALLDGIGDALDGYAPLSAARGDFLLRAGRRAEARVQFERAAAL
FT                   SRNGRERAFLLARAASCDSGA"
FT   gene            complement(10048..10470)
FT                   /locus_tag="RC1_0018"
FT   CDS_pept        complement(10048..10470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0018"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04542
FT                   match to protein family HMM PF04545 match to protein family
FT                   HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97469"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPT3"
FT                   /protein_id="ACI97469.1"
FT                   /translation="MRVMVLVKATVDSEAGIMPTSELLEAMGRYNEALANAGIMLTGEG
FT                   LQPSSKGKRVAFDGADRRVIDGPFAETRELVAGYWLWEVKDMAEAIEWAKRCPNPMPGP
FT                   SEIEIRPIYEMSDFGDVLTPEIAALHERVGAKTAAR"
FT   gene            10577..11014
FT                   /locus_tag="RC1_0019"
FT   CDS_pept        10577..11014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0019"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04946"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97470"
FT                   /db_xref="InterPro:IPR018723"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPT4"
FT                   /protein_id="ACI97470.1"
FT                   /translation="MAPQRGRERDPDDTDPALAPRLPAALRDAFVLGAERTQAEDIGFG
FT                   IRQLVEMCLRALSPGINDVFTAVAVTDSLSAALGHIYARETEPVLLYDGSVRIIRSVSD
FT                   HTGMTAAAFDQIRQAGQGKPAVLIRLLEALRRASAAAGRPG"
FT   gene            complement(11027..11179)
FT                   /locus_tag="RC1_0020"
FT   CDS_pept        complement(11027..11179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0020"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97471"
FT                   /db_xref="GOA:B6IPT5"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPT5"
FT                   /protein_id="ACI97471.1"
FT                   /translation="MNSRLAVPGKDGSALQREGGHAMLRILGWVIGIIFLIGLLVVFGV
FT                   LDLIF"
FT   gene            complement(11192..11731)
FT                   /locus_tag="RC1_0021"
FT   CDS_pept        complement(11192..11731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0021"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97472"
FT                   /db_xref="GOA:B6IPT6"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPT6"
FT                   /protein_id="ACI97472.1"
FT                   /translation="MLFDSWSGLGRVLLVGTLAYLALVLLLRVSGKRTLTKMNAFDLVV
FT                   TVALGSTLATVLLSKSVALAEGILALALLIFLQFAITWAQVRSSGVQALIKAEPTLVLH
FT                   RGRFLEGALRAQRLTREEVLAAMRGSGVAMPEQAYAVVLETDGSVSVIRSRPETAGEGG
FT                   TLPGVAVPDGAGRLAG"
FT   gene            11941..12627
FT                   /locus_tag="RC1_0022"
FT   CDS_pept        11941..12627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0022"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97473"
FT                   /db_xref="GOA:B6IPT7"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPT7"
FT                   /protein_id="ACI97473.1"
FT                   /translation="MEDDLMDGRTDWLIAGAATGLWLLCLGSDAMAAWLLVEDGPVETL
FT                   SAVLYLAAAVVALAGTGGRPWLRRGVAGLALLCFLSEISFGARLFGYAMPAMQGGGELD
FT                   GGQDLAMLLWRQARPWLSAHKAAVLTATALGAGLLLWRLWPLLLAVARPLADRPAERRA
FT                   VIAVVLLALAVLIDLDIRPYLVLRRLEEVVELAAAGFLLAAALAHGCQPAFRFRRPAVA
FT                   RGLRRP"
FT   gene            complement(12634..12759)
FT                   /locus_tag="RC1_0023"
FT   CDS_pept        complement(12634..12759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0023"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97474"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPT8"
FT                   /protein_id="ACI97474.1"
FT                   /translation="MEPDLPGEVLLGLAFVEEARPWRDCWPSLSVAGEVPRAGWG"
FT   gene            13233..15074
FT                   /locus_tag="RC1_0024"
FT   CDS_pept        13233..15074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0024"
FT                   /product="ABC transporter, ATP-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97475"
FT                   /db_xref="GOA:B6IPT9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPT9"
FT                   /protein_id="ACI97475.1"
FT                   /translation="MRAVRIDSLEDQDRAFSWEDAESVRPLERRPFRFIWSLMREKFAG
FT                   RFALMVAAVVAGQAIEAFEPYALKGLIDGLTAASAGQPVEGIGIVGWFVLLLGIWFFGI
FT                   GMYRVYQVVDIYTSPSIRALAQKRMFGWLMGHSHTYFQDNFAGKLGQKIKQGANAILGI
FT                   IEIMMFDMIRTAVLLAVAVVLLWTAAPAFSAFLMAWAVLYIAVSGWLARHCFRLSEQMS
FT                   EAVSTSSGRIIDAITNADLIRGFARIAFERSFLGHWINAERFRSRRLRWYLVVMRLFQM
FT                   ASIIVLLGVLVWVALDRTLAGTMTVGEFTLVFTLGFQISNTVWHLSDRLLSFFEELGTL
FT                   SEALDLVSAPHGIVDAPGATPLVVTEGRIEVRDLRFSFPDGTKVFDGLSLTIRPGEKIG
FT                   LVGRSGAGKSTLVKLIRRQYEPQGGAVLIDGQDIATVTQESLNAAIAEVPQQPGVFHRT
FT                   IGENIAYGRLGATQAEVEEAARQAHAHEFIARRPTGYDTVVGEQGVKLSGGERQRVAIA
FT                   RALLKDARILVLDEATSALDSESEHLIQGALWTLMQGRTVIAIAHRLSTITGMDRILYV
FT                   EGGRIVEQGSHADLLALGGRYAALWQRQSGGFLEAAE"
FT   gene            15169..15636
FT                   /locus_tag="RC1_0025"
FT   CDS_pept        15169..15636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0025"
FT                   /product="acetyltransferase, gnat family"
FT                   /note="identified by match to protein family HMM PF00005
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97476"
FT                   /db_xref="GOA:B6IPU0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPU0"
FT                   /protein_id="ACI97476.1"
FT                   /translation="MHYRWSTFDDLSAARLYELLGFRQSVFIVEQASAFQDLDGRDPFC
FT                   WHLAVRDRPGGELLGYARCCGPRDGAPAFIGRFVVAPAARGLGLGRRLVAESLRQVTLH
FT                   HPHVDVMLSAQVHLQPFYAGFGFRTEGESYDDGGIEHVTMRLRTVPAEAAA"
FT   gene            complement(15740..16894)
FT                   /locus_tag="RC1_0026"
FT   CDS_pept        complement(15740..16894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0026"
FT                   /product="phosphodiesterase"
FT                   /EC_number="3.1.3.1"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97477"
FT                   /db_xref="GOA:B6IPU1"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPU1"
FT                   /protein_id="ACI97477.1"
FT                   /translation="MSDTDPDRRRLLTGMAAAPLALATGLRADGTQAEGAAAGPAPYPA
FT                   ADEGRTIRRIAFGSCAKSEKEQPIWDAIVAAEPDLFIFLGDNVYLDTRDPEVMRRKYAA
FT                   LAAKPGFQKLRARTPVIAIWDDHDYGENDAGADYPMKEESRRQFCDFFGVPADSPRRTR
FT                   DGIYTSVTFGPPGRRLQVLLPDLRWNRTPIRTLDLGGTPYDTWADEQARAGRPVPGPYA
FT                   RNPEDPATMLGERQWQWLEQQLARPADVRILASSLQVVADFPGWEAWINYARDHQRLIQ
FT                   AIREKRADGLFCISGDTHYAEISRLDVNVPYPLWDFTSSGLTEVWPVLPPNARRRGEAY
FT                   RAENFGLIEIDWRDGNTIVTVQIRDIVGAVRLEQRLRVADLAVP"
FT   gene            complement(16957..19248)
FT                   /locus_tag="RC1_0027"
FT   CDS_pept        complement(16957..19248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0027"
FT                   /product="TonB-dependent receptor, putative"
FT                   /note="identified by match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97478"
FT                   /db_xref="GOA:B6IPU2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPU2"
FT                   /protein_id="ACI97478.1"
FT                   /translation="MHRHRFLGRVLAGTALSSLGIGLPAQAQTQVAETPALEEIVIYGR
FT                   GETRQVQSVTAATLQLTAPGTSPLKAIEKLPGVSFQSADPFGAYEWSARISIRGFNQNQ
FT                   LGFTLDEVPLGDMSYGAHNGLHVSRAVISENLDRVVVAQGAGAIGTASTSNLGGTLQFV
FT                   SRDPSEEAGISTALTAGGDSTRRAYVRLETGALATGTRAYASYAGQWSDKWKGDGIQKQ
FT                   QQMNAKIVQPVGEGTITGWINWSDRRENDYQDLSRSMIGRLGYDWDNFAKNWNLALQVA
FT                   DIGNNRGDSGAPVSNPAAGTVYPAPVRTLDDAYYDAAGLRKDTLGAVTLDYPLGSILSV
FT                   SATGYGHRNEGQGVWFTPYVPTPGGGPISIRTTEYDIERYGVIGRLTADLGDHRIEAGG
FT                   WYEDNDFSQARRFYGLDRAAPQRSSTQFQSSPFYTQWDYDFTTTTRQLYIADTWAVTDM
FT                   LTLNGGFKAVKVENEADTVTGPQRSGTIEAKDSFLPQVSARLALTEDQELFASYTENIR
FT                   AFVSAATSGPFSTTPEGFAAIRDSLEPETSQTVELGWRFRIDTLQGSVTGYYVKFDDRL
FT                   LTLSLGAGIVGNPTALQNVGSVTTKGVEAAATWEFVENWSVFGSLTYNDSTYDDNVLDA
FT                   NGVITAATKDKKATDTPEFMAKGELAYDDGDLFGTVGVSHTGKRYYTYLNNGSVPSYTL
FT                   VDLSLGYRFSGSGWLDGLEVQANVTNLFDKEYVSTIGSNGFTNADPDGTFQTLLAGAPQ
FT                   QFFVTLRKSF"
FT   gene            19580..20725
FT                   /locus_tag="RC1_0028"
FT   CDS_pept        19580..20725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0028"
FT                   /product="glucose/sorbosone dehydrogenase, putative"
FT                   /note="identified by match to protein family HMM PF00593
FT                   match to protein family HMM PF07715"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97479"
FT                   /db_xref="GOA:B6IPU3"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPU3"
FT                   /protein_id="ACI97479.1"
FT                   /translation="MAVGLAAVGPVLGVPVSAGALAAPREFNAWPAPAARQAVKVTTVV
FT                   DGLDHPWSVAFLPDGRLLVTERTGRLRTVQEGRLLPEPVAGLPPIEEVGQGGLLEVALH
FT                   PDHARNRLVYISYAEPDPSGRGHRTAIARFRDGNGTAEGFEVLYRGTSDRTRHHFGSRI
FT                   VFGTDGKLYFSIGDRGTDKRAQDPADSSGSILRLNDDGSIPGDNPFVGRPGHLPELYSM
FT                   GNRNPQGLAVQPGTGLIWESEHGPQGGDEINIIRAGANYGWPVITYGRTYGLGLPIGEG
FT                   TEKPGMVQPELYFVPSLALAGMTFYTGDALPAWKGDLIVALLGGGLVRLDVEDDRVVAA
FT                   ERLLEEELGRTRHVAQGPDGALYALVDEPAPGGRLVRIDPQ"
FT   gene            20871..22325
FT                   /gene="gatB"
FT                   /locus_tag="RC1_0029"
FT   CDS_pept        20871..22325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="RC1_0029"
FT                   /product="aspartyl/glutamyl-tRNA (Asn/Gln) amidotransferase
FT                   subunit B, GatB putative"
FT                   /EC_number="6.3.5.-"
FT                   /note="TIGR00133 With a good score above the trusted cutoff
FT                   and uncharacterized homologs; identified by match to
FT                   protein family HMM PF07995"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97480"
FT                   /db_xref="GOA:B6IPU4"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6IPU4"
FT                   /protein_id="ACI97480.1"
FT                   /translation="MAYLIQGETGEWEIVIGLEVHAQVISNAKLFSGAATAFGAAPNSQ
FT                   VSFVDAAFPGMLPVINEVCVEQAVKTGLGLKAQINLRSVFDRKNYFYADLPAGYQISQF
FT                   QQPVVGNGTIVLDLADGSTREVGIERLHLEIDAGKSLHDQHPSKTYVDLNRAGVALMEI
FT                   VSKPDMRSPEEAAAYLRKLRTILRYLGTCDGNMEEGSMRCDVNVSVRKVGQPYGTRTET
FT                   KNVNSIRYVQQAIEYEAQRQVELIEGGGTVVQETRLWDPNKGETRSMRSKEEAHDYRYF
FT                   PDPDLLPLEIEQSWVDRIKETLPELPDDKKARFMADYGLSAYDAGILVAERARADFYET
FT                   VAKGRDPKLAANYVIGDLLGALNKTGRDITESPIAADDLGGLIDLVTDGTISGRIAKDV
FT                   FAEMLETGEKPSLIVEKKGLRQVTDTGAIDKAIDEVMAANADKVAEFRSGKEKLFGFFV
FT                   GQVMRATQGKANPALVNEILATKLKG"
FT   gene            complement(22431..23126)
FT                   /locus_tag="RC1_0030"
FT   CDS_pept        complement(22431..23126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0030"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97481"
FT                   /db_xref="InterPro:IPR021747"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPU5"
FT                   /protein_id="ACI97481.1"
FT                   /translation="MQDTAVQAPAFFRPAAVRFAAVVLVALAVAAPAVAKVASQDVRGA
FT                   PPVPELPLQGLEQRPLSGMDIFSVRPGTDLSRYDRVLIDPIGLSVTRRHEDLALTERDA
FT                   EHARSYFREKLEQEFGARALAAQPGPGVLRLSLLITEFVPNSPVFPERQDGRGGIIHRT
FT                   YGVGEAAFQAVLTDAMTGEVVAVFADSDTGQPLGQNLHATTQYGDADRFIRRWAAQIAS
FT                   AVTGGSGQG"
FT   gene            23442..23533
FT                   /locus_tag="RC1_0031"
FT   tRNA            23442..23533
FT                   /locus_tag="RC1_0031"
FT                   /product="tRNA-Ser"
FT   gene            complement(23904..24107)
FT                   /locus_tag="RC1_0032"
FT   CDS_pept        complement(23904..24107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0032"
FT                   /product="phage-related hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97482"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPU6"
FT                   /protein_id="ACI97482.1"
FT                   /translation="MATLRDIADAEAVTVPFVSRFLRLAYLSPEVLEHLLIHRRPCALS
FT                   LERLAAKALAPWVEQPGMVFEE"
FT   gene            24541..25305
FT                   /locus_tag="RC1_0033"
FT   CDS_pept        24541..25305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0033"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97483"
FT                   /db_xref="InterPro:IPR021150"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPU7"
FT                   /protein_id="ACI97483.1"
FT                   /translation="MPIGDNEFETVAKGDLPALLASSSDDDLDFLVSYILNASTESLSS
FT                   KDEYKRHRPKHSRYTDLIAAEIREFGGNTFANLFRGEGPFYAEVVVDVCEQLKVKPGGD
FT                   VVENEKKILMKIVEDSWEKLSPEKREEFLDEIRKAGHKGASLSAAMPLSVIMAQLSVRL
FT                   AGFMAYRMAMVAANAVARQVLGRGLALAVNAGLARAIGAFAGPIGWIVTGLWTAIDLAG
FT                   PAYRVTIPCVIHVAYLRQKLLFEALAASADFE"
FT   gene            25315..26238
FT                   /locus_tag="RC1_0034"
FT   CDS_pept        25315..26238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0034"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97484"
FT                   /db_xref="GOA:B6IPU8"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPU8"
FT                   /protein_id="ACI97484.1"
FT                   /translation="MAMLEILFDLPEEIIRGLADGTLKRKGGVIYNSDGGVVMWLKETG
FT                   TAMQSQAASTPLPPELASQLQSLQGLMGLQIGLQALTLGVTVAGFVILAKKMDAIGRKL
FT                   DQIAAAIDDLTDEVQWQRTVRDVERSADLLGALEHAQWAELNGELGELKGLRKEFSQSH
FT                   VKYAMLMRSMDAERRAHLHPDVYLSFYRHSAMAGMAKIRCDWLLTGAETALASHHELAS
FT                   MLSSAKEEFLAPMRTFDASRLINISPAAMAPLKEMARSLAEEGHRVVSHRSEIEWCRDK
FT                   GLPLAEWELLGRDVQDRAVVFIRPTA"
FT   gene            complement(26400..26789)
FT                   /locus_tag="RC1_0035"
FT   CDS_pept        complement(26400..26789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0035"
FT                   /product="phage-related conserved hypothetical protein,
FT                   probable resolvase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97485"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPU9"
FT                   /protein_id="ACI97485.1"
FT                   /translation="MSSAPETIRVVIPLAVKRRNGRPRILPPANIEAASEGATPDPRLL
FT                   RAIARAWDWRRRLDRGEAATLKDVAVAEGVTVPFISRFLRLAYLSPEVLEHLLIHRCPC
FT                   VLSLDRLAAAALAPWVEQRDTVFDE"
FT   gene            complement(26786..28126)
FT                   /gene="gin"
FT                   /locus_tag="RC1_0036"
FT   CDS_pept        complement(26786..28126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gin"
FT                   /locus_tag="RC1_0036"
FT                   /product="Gin (G segment invertase), phage site-specific
FT                   recombinase, resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97486"
FT                   /db_xref="GOA:B6IPV0"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPV0"
FT                   /protein_id="ACI97486.1"
FT                   /translation="MRRTSTPATPVQRRLRCAIYTRKSSEEGLDMEFNSLDAQREACES
FT                   FIASQKAEGWVALRDRFDDGGFSGGTLERPALQRLLADIEAGLVDVVVVYKIDRLSRAL
FT                   MDFARLVEVFDRHGVTFVSVTQSFNTTTSMGRLTLNILLSFAQFEREVIGERIRDKFAA
FT                   SRARGMWMGGYVPTGYDVKDRKLVVNEAESATIRMIFERFVQLGSATTLVAQLAAEGVV
FT                   TKRGKPVDKGFLYKLLNNRVYLGEAVHKGTSYPGEHAAIIDQDLWNRVHGILQESPRSR
FT                   AAATRTQTPALLKGLIFGPTGTAMTPTATKKGSRLYRYYASMDVIRGRMSGTESTAPQR
FT                   LPAEMVENAVVREVRRLVRTPEIVAQTVAAARRDDAGVTEHDVVTALDRFDEVWSALFP
FT                   AEQARLVRLLVDRVTVTADGIAVDLRTAGLGSVVREMLTPRTPEAVA"
FT   gene            complement(28123..28632)
FT                   /locus_tag="RC1_0037"
FT   CDS_pept        complement(28123..28632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0037"
FT                   /product="putative bacteriophage-related protein"
FT                   /note="identified by match to protein family HMM PF00239
FT                   match to protein family HMM PF07508"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97487"
FT                   /db_xref="InterPro:IPR021322"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPV1"
FT                   /protein_id="ACI97487.1"
FT                   /translation="MRAEALKQAGGPPRPGADKDRDATVLARLAALKEMTVNEMKAEWR
FT                   RLFGADAPNNSRPFLEMRLAWRIQELSYGGPSRETVRLLDALADELHGKPGRKALIADP
FT                   RKPVAGTRLVREWDGVEHTVTVLRDGFEFEGRKYKSLSAIARAITGTRWNGWRFFGLRE
FT                   IGRDKP"
FT   gene            complement(28632..28823)
FT                   /locus_tag="RC1_0038"
FT   CDS_pept        complement(28632..28823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0038"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97488"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPV2"
FT                   /protein_id="ACI97488.1"
FT                   /translation="MDKPLSGPNALAPDRMTAEERLAEVGRLLAAGLLRIRGGDIRLDF
FT                   PPTQRGGGREPRSQAGGR"
FT   gene            29140..29463
FT                   /locus_tag="RC1_0039"
FT   CDS_pept        29140..29463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0039"
FT                   /product="putative transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97489"
FT                   /db_xref="GOA:B6IPV3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPV3"
FT                   /protein_id="ACI97489.1"
FT                   /translation="MTQTPTTFGQAIAQARKAKGLSQKELAARIVKDEGGNISPQYLND
FT                   IEHDRRSPSSDHLIRQFAAELGMDDNILFILAGKIPDETRRNVKDLMKAADAFMNFRRD
FT                   ASN"
FT   gene            29565..30194
FT                   /locus_tag="RC1_0040"
FT   CDS_pept        29565..30194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0040"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97490"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPV4"
FT                   /protein_id="ACI97490.1"
FT                   /translation="MTRLLRGRRSESLYPITTDELTILIEQNNAGLDAYADLSDFGADV
FT                   EGVTIFHPDRDPEILISDRLANDERRENRLRTTLAHEFGHLHFHRHLWADKLAARRLFD
FT                   RLSRDNKAICKRDTILNARDVDWMEWQAGYVSGAILMPLTAVRRLVSDYCGPRNLHAAV
FT                   SVASEHGRQIVAHVMETFQVSEDAARVRLLKLGQLTASDRQPSLFG"
FT   gene            30308..31474
FT                   /locus_tag="RC1_0041"
FT   CDS_pept        30308..31474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0041"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06114"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97491"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPV5"
FT                   /protein_id="ACI97491.1"
FT                   /translation="MPSVTTIVRKTPASNLRQYFDARGIVLPPAVNWDGPEGEIVRPLL
FT                   RAVDELDPETRARIANDVERVGEMADEAGDAALYSVAPDTGYLDALPNAHARALWMFVN
FT                   EAELFRRAEEVRYTDDRRRGRMWDGFVGAPNLEVRRDAAALEVFKDAVRQRFESPNVQV
FT                   DVFDRHRPTFDGDDRNVVQGTVYREGRPDDFLEFVDGALDRRPRRPVFEAALTYEPETG
FT                   VIEVVARDRESRPDLVRLFARDLLATEFHEERLPLRRFDLSVLTCPCTFDSDPEDEIAA
FT                   VRVNHLRLMPFDTNGERITLECMRGADTNIWEMAARRLGDADPLQGGWTVTQAKLTIRF
FT                   HPEPGSNRGKTLPLTITMPHGCDLKDRTERERLIGEKYLRRWGIVRDV"
FT   gene            31782..32414
FT                   /locus_tag="RC1_0042"
FT   CDS_pept        31782..32414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0042"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97492"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPV6"
FT                   /protein_id="ACI97492.1"
FT                   /translation="MFMAQLLASLDRRSAGTVPLIPELLWEVGDVRLGRRPQRVPLWFA
FT                   RRLHDQAVWRQVKGVAQARPAPGLRVLLTSTAFRRVPDEGVAGHEIISVPDVIDHNAGV
FT                   ALHPEILAARVGGRDHRSDGPLAHTADFTVVTVHGKDYPFRGAKQRDLVRQLVDAFQRG
FT                   APRCLTAKVLEEANYNSSVNTIAKAFSGRDDWREFIAEDGGSCWIFT"
FT   gene            32554..32739
FT                   /locus_tag="RC1_0043"
FT   CDS_pept        32554..32739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0043"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97493"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPV7"
FT                   /protein_id="ACI97493.1"
FT                   /translation="MAVSHLTQTDLARRWRISPRTLERWRWLGQGPKYLKIGGRVVYRL
FT                   EDIEAFEAEKQREAVA"
FT   gene            32871..33176
FT                   /locus_tag="RC1_0044"
FT   CDS_pept        32871..33176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0044"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97494"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPV8"
FT                   /protein_id="ACI97494.1"
FT                   /translation="MQTPDPTRTLVADETALLDWLRTAQPGDRFLYHIGHLAADRVRGS
FT                   AGLTDPQREALCRLADRVLALVTEDALTAAQRRRADGHMAYLAIKTSGRKAGRRFP"
FT   gene            33173..33670
FT                   /locus_tag="RC1_0045"
FT   CDS_pept        33173..33670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0045"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97495"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPV9"
FT                   /protein_id="ACI97495.1"
FT                   /translation="MTATPTPTNRVTLDALTAMPVGEIANLPVDQLALLLDDLAEEKAR
FT                   LKRLDDRLNGALALRYGERAQTLRRDQGKLAGIVRIEEADGFVAVCDVPKKPEYDQEKL
FT                   RAAIETIRSWGSNPDDYVTTEIKVSETKYGAWPPEIRRLFEPARTVRLGKPSFRIERPT
FT                   PR"
FT   gene            33787..34638
FT                   /locus_tag="RC1_0046"
FT   CDS_pept        33787..34638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0046"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97496"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPW0"
FT                   /protein_id="ACI97496.1"
FT                   /translation="MAIRIITADERLSAASTKISFAIFGPPGVGKTSLLKTLPPDRTLC
FT                   LDLEAGLKSVQDWRGASIPIRSYLDFRDLVVLISGPDPAVHPTATYGEAHYQHVRATHA
FT                   DTGLEAFLASKPILFVDSITDLSRQVMTFARQQPEAFSDRTGKPDVRGAYGLLGREVIH
FT                   ALKLLQHAPGKTVVFVGVLERVTDDFNAVTWQPQMEGAKIGRELPGIVDQVMTMHFFDR
FT                   AADGTFAFNEKGEHRRLVCRAGNPWGLPAKDRSGRLDPTEPPDLSALFAKINAPGPAAT
FT                   AA"
FT   gene            34650..35405
FT                   /locus_tag="RC1_0047"
FT   CDS_pept        34650..35405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0047"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97497"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPW1"
FT                   /protein_id="ACI97497.1"
FT                   /translation="MYDLNDAQPQMAPAGDLIPDGTFARVRMTIRPGGVNGSSPLDAGL
FT                   LTASKSSDAKMLDCEFTVVEGAFARRKFWQNFTVAGGKLDDKGVSKGWNIAKAAFRAMV
FT                   DSALGLDPKDMSDAAKAKRTLRGLKDLDGITFVARIMVEPASSPQYKDANKLAHVVTPD
FT                   EPQHSAVLRGEAVPPEPVNAKPRKAAEPAAQGGPAWATTPPAANPNAGAAWNTSPAAPA
FT                   TAPAWAGQTTAPASPPPAAPPAGPAWLNG"
FT   gene            35390..35683
FT                   /locus_tag="RC1_0048"
FT   CDS_pept        35390..35683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0048"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97498"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPW2"
FT                   /protein_id="ACI97498.1"
FT                   /translation="MAQRLTGERGRADDDAGPAPTTMTDDDWQAQVTREAAKAIGQWLE
FT                   GRGRLHQPIAVLTLPELEAMAANAIARFVVLASERIRDRPDDNRDLTRLLLG"
FT   gene            35680..36045
FT                   /locus_tag="RC1_0049"
FT   CDS_pept        35680..36045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0049"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97499"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPW3"
FT                   /protein_id="ACI97499.1"
FT                   /translation="MRLCSVCDREGRGFLYSHPGHPDRLHRFCSMGCLDAGARLAKENN
FT                   GMIDKTAREVQALKDARRPFAEALTELGLMDPFFHRTAAEIDRLIEAAVTGYVDSMQRR
FT                   AGVRERTGTALDDPLPF"
FT   gene            36060..36275
FT                   /locus_tag="RC1_0050"
FT   CDS_pept        36060..36275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0050"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97500"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPW4"
FT                   /protein_id="ACI97500.1"
FT                   /translation="MMDLNDDGPAGEWLQLLEAADANAETDFEIAFCESLREKFETYGS
FT                   RARLTDAQDRKLRCIAQGGGFWERGA"
FT   gene            36272..37069
FT                   /locus_tag="RC1_0051"
FT   CDS_pept        36272..37069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0051"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97501"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPW5"
FT                   /protein_id="ACI97501.1"
FT                   /translation="MIDLNHGSGCQYEGPARPPDLAAAVNTAIDAILVARNRAQPPRRY
FT                   VSTSGIGRECLRQIQYDYLAVPKDAGADFTGATLRIFDAGHRGEDVVADWLRAAGFDLR
FT                   THRRDGRQFGFAALGGRFKGHIDGCLVAGPAAMAYPALWENKCLGAAPWKEVVKRGVVL
FT                   ARPVYAAQIALYQAYMDLAEPALFTALNRDSWELHAELVPFDAPLAQRMSDRAVEVVQA
FT                   SAVQELLPRAAAHRTSALCRGGWTGGEWHAPCPWQDRCWGPAP"
FT   gene            37066..38388
FT                   /locus_tag="RC1_0052"
FT   CDS_pept        37066..38388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0052"
FT                   /product="exodeoxyribonuclease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97502"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPW6"
FT                   /protein_id="ACI97502.1"
FT                   /translation="MTGIIPSATQARAIAAIHDWFENRTHEQPVFRLFGYAGTGKSTVL
FT                   KFALDDLGIDPHRSGKDGGAMVPGVVTATFTGKAALVLRRKGTPARTIHSLIYRVIEAT
FT                   EEEIEAARRKIADAEQKARALSGFERVTAEAAIEAMRQGLKDMRKPRFDLNPDSDAAHC
FT                   RLIVLDEVSMVGAEMARDLLSFGKPILVLGDPGQLPPIKGEGAFTQQAPDIMLTEIHRQ
FT                   AAESAVIRLATWAREGRPIPMGRHDDHVWKLAKTAVTPDQCLRGGQVICGLNATRLQLN
FT                   NALRRAAGLNGGWFPTGPAEKVVCLKNRNDLGLINGMFLTLDDIVDEGGLYFSAAVTDE
FT                   DGNAIGAVGPDGRHNRLRLYKGHFEDHHALDKDRNDRDWKEKKYLIEATYGWAITGHKA
FT                   QGSQWENVIVWDDGLGRTAEDRARWLYTAITRAEKGLVILA"
FT   gene            38385..40913
FT                   /locus_tag="RC1_0053"
FT   CDS_pept        38385..40913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0053"
FT                   /product="virulence-associated protein E, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97503"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR007936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPW7"
FT                   /protein_id="ACI97503.1"
FT                   /translation="MIDLNDVWQPPPRFDLRQVRDRLAASAPDWLPPLFPRGRLSADRR
FT                   TLRCADLSGRPPRNEGSCVLHLVGSHAGWGFDFATGESAGPIDLIHYATGLEDGPLFEE
FT                   AVRLARMDLPVSAPRPASGRPDHSLEVARILDGCRPLAGTVAETYLRSRGLADPGSPDL
FT                   LYHDDLADRDTARGWPGLVAVVRDGAGQPTGGIHRTFLLDDGSCKAPPGKKMLGPIANG
FT                   HVRLAPLGADGHLGVAEGIETALAATAIFGIPTWAGLSADGVRRFQWPEGTSQITIFAD
FT                   AGDAGRQAAAALADRLNRADILNSIVVPLHGDDFNDDLRQGKSAADYSLEPAAQPARTL
FT                   NTLAEMEAAALALTCPPDMTDLARLLGAIATARLDPVPIRHLLTTIKATTRIPVSVLEK
FT                   QLRDLRRRLNGGGGDAPAIRSPWAAMLRIGDDGTPERNEANVITALSNDPAFAGALVFD
FT                   EFRQEILAARPLPWESAPFPAARPWNATDDVRCAEWLQRREINVTPLVVSRSVGAVAND
FT                   IRVHPVRDYLDHLRWDGTARLETWAIRYLGAKDTPLSHAFGARWLISAVARILRPGAKV
FT                   DHMLILEGPQGTGKSTALKVLAGEDWFTDELAEIGSRDCAQQMRGVWIIEIAELDAIGR
FT                   AEVERIKAFLTRTTDRYRPPYERYVIDVPRQCVFAGSVNPDTYLRDETGNRRFWPLRCG
FT                   RIDLDALRQDRDQLWAEAVARFRDGAIWWLDDPDLIAAARIEQEARYQGDAWDARIDRW
FT                   LTHERRRINRGYAGYDDWRDEEVERDRPVCDVSVGEILEGALGIETGKWSRGDQMRVAA
FT                   YLKARQWERYKAGAGGRREWRYRRPTWLAD"
FT   gene            complement(40915..41577)
FT                   /locus_tag="RC1_0054"
FT   CDS_pept        complement(40915..41577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0054"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97504"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPW8"
FT                   /protein_id="ACI97504.1"
FT                   /translation="MEGRSDVLFLKLAAKLYREERGIDVFNDFGVLAAGDGDDGGVDGV
FT                   NRRLSAARQLAEYDLTPAGAKRYRFIGLFDNDEAGRRALKRACNFDPRVVRYEDVFLLH
FT                   PVMPIAGGSPGSVVEKRAETLNYDFRRLDWEVEDLFSPDFLRAFVADYPNAVVHETTIG
FT                   GRTHRDLSRDGKTALREFAEKYATLDDVIDLIRLICSLRDYLHLQHNHILPTQGDSG"
FT   gene            complement(41647..45231)
FT                   /locus_tag="RC1_0055"
FT   CDS_pept        complement(41647..45231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0055"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97505"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPW9"
FT                   /protein_id="ACI97505.1"
FT                   /translation="MLVSAVPTPIKRLGPVGTIGEGKSVVTTAGLVPTSADVGSRMGVV
FT                   RAGVFPEQAASDRRSLDLVNYPSRCPPFFTTLPCKLLFLILNCARKKRTIPTSEVACRH
FT                   GPVRSPLGPRCPRATVGPYARSHSLRNTFMSDGVHHQAEAPASLFAELDSRDVAVWLQE
FT                   PFAAAAGPEKAAKVLGLPWAFVFSESSDQALITALEATESVESPLVRRRGIIHIVDTNP
FT                   SDVPLPPRSLPVFLLNGRGGTRNSGLAALTRRLTMLEELQRRSIKHLVVLGGPTFALPQ
FT                   ELTGLWAEGFRSFTTVVSDASDATDKAAAWRAETGARTISLVTTAAGAFVDDLVRRYME
FT                   GRDERQILRLRDATETLHRLDVTGLDDPEHPLLGRYELLTEEHLIPLLPDDLRVEDVEG
FT                   FFKDPRSSWRPFAAGMPWPREPDALNILKRALRKLDREAGESNPLFYVSAESGAGATTF
FT                   IRNLAWETASEGYPTLLAAAAPFTPSSVEVTSYMSRCMETATKTGIGADTRLYQAPWLI
FT                   VFDRTALNGHEDDLIHFSRELEKSGRRACIVFVTDSVLPIAIYEGSRFKRLAVLTHQVS
FT                   KPDAVELGRHLNRYLLKHGTVRSEAEWNNFLQRSIVGPGNGYAAFWIALSFWLRRLFDM
FT                   EETIQSWLYYQFHEKVTDPVLRHAIIDIAAMSTVHRPLPEVLLPASHDWPTADKLCDIQ
FT                   SGLGALGIVRGIDSTQRYWALIHDLLGRFLLTALFYDRPALEAAGFGEATNPEHLRLLV
FT                   LKRIARLPGLAHRGLREVAEAFATSIFKIDPSHGHALFAPYWREALVALDEMPRAFRTT
FT                   SRAFLHHAAISRRRIAKDKSAFDISDDERAELLSRAISDIETALSITGDADGESDMNLL
FT                   NSLAHAYHDLAEVEVQRRAKQERIQDLQTKARDATRRAYRLSPDNSFVVETYARDLLTG
FT                   ARSDPTATAGNAIEVLGLVYAAMQRGAAEARRFALGRLAEAALDVLLEVAGEFDERSNP
FT                   QTESDAIIVALKSLAEGVRRFEGMELNDYPATNRIRAAEHLANPILRSNAQAVRLQYLL
FT                   CCMDRPQDFAQQLEFLESLKGSSSTFTPQMDLELAVLLHQRDRHHEAARKFHELRQRWQ
FT                   REEHFVEVPERLKWLRVRDRDDRRQVRARISQTGDGRHRARVSEMQGVEVTFRPQEFGR
FT                   EKLRPGMVINGYISFGHNGPFLRPLTAN"
FT   gene            45531..46070
FT                   /locus_tag="RC1_0056"
FT   CDS_pept        45531..46070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0056"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97506"
FT                   /db_xref="GOA:B6IPX0"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPX0"
FT                   /protein_id="ACI97506.1"
FT                   /translation="MTTLFPVPALPGSGPAALAVLPATLVVLALDLGSTMGWALRSADG
FT                   AIVSGTEAFRQDRWSGGGMRYLRFRRWLGEVATMTGGLGLVVYEEVRRHVGTDAAHVYG
FT                   GFLATLTAWCEDRGIAYEGVPVGTIKRFATGKGNAGKDAVIAAVRARGFQPADDNEADA
FT                   LALLLWAIQRRAGGAP"
FT   gene            46067..46378
FT                   /locus_tag="RC1_0057"
FT   CDS_pept        46067..46378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0057"
FT                   /product="ribonucleotide reductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97507"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPX1"
FT                   /protein_id="ACI97507.1"
FT                   /translation="MSRIRRPDRRPAETAEIAFDGQRFTVTIGFYPDGRPGEVFADGAR
FT                   IGSDLDALLDDACVALSLLLQHGVDPRRLAGSMGRLGDQRPASLIGAVADLLAGEVRP"
FT   gene            46375..46572
FT                   /locus_tag="RC1_0058"
FT   CDS_pept        46375..46572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0058"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97508"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPX2"
FT                   /protein_id="ACI97508.1"
FT                   /translation="MRMTPRGFGGDRTPPEAIKRDGWQAQGILVVSENDQRLTWPDREL
FT                   VRQLGRKLYGDRPAKEARHG"
FT   gene            46565..47017
FT                   /locus_tag="RC1_0059"
FT   CDS_pept        46565..47017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0059"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97509"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPX3"
FT                   /protein_id="ACI97509.1"
FT                   /translation="MADPRWTPLMVEERLTEAADVLKRLPERRIGGYFNTWPQIVPEFC
FT                   DLVGREPPQLRPPLPTAAAITRMEETLGWTIGLDPVDARIVWLRAGGERWKEVCWKVGL
FT                   ARAAAHQHWLYALCVIAWRLNGRRVPGKRSRQQVIAMVRAACGSAG"
FT   gene            47407..48792
FT                   /locus_tag="RC1_0060"
FT   CDS_pept        47407..48792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0060"
FT                   /product="DNA methylase, putative"
FT                   /note="identified by match to protein family HMM PF01555
FT                   match to protein family HMM PF02195"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97510"
FT                   /db_xref="GOA:B6IPX4"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR015840"
FT                   /db_xref="InterPro:IPR017985"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPX4"
FT                   /protein_id="ACI97510.1"
FT                   /translation="MEIINLPIERVIPYARNPRHNAEAVAKVAASIAEYGWRQPIVVDR
FT                   DMVVVAGHTRLEAARRLGLVTVPVHVATDLTPAQARAYRLMDNRSHQEARWNDELLALE
FT                   LKDLRLDAVDLALTGFDADEIDQILAALDDAADQDAEAADAADPDAAPEPPSDPVTRAG
FT                   DLWLLGQHRLLCGDSTDPAAVAQVLGGDSAALCFTSPPYGQQRDYTTGGIARWDSLMQR
FT                   VFALLPMAPEGQVLVNLGLIHRDGEWLPYWSDWLDWMRTQGWRRFGLYVWDQGPGLPGD
FT                   WGGRLAPSFEFVFHFNRQGRKPNKIVPCKYAGLDTHLRADGHSTAMRKADGTVGAWTHA
FT                   GQPTQTHRIPDSVIRIGRHKARGIEVEHPAVFPVALPELILNAYADAGDVVYEPFSGSG
FT                   TTLIAGERTGRRVCAVDLAPAYVDVAVRRWNEQFPASPARLEGGGTFAETAAARGVTLA
FT                   FAA"
FT   gene            48797..50035
FT                   /locus_tag="RC1_0061"
FT   CDS_pept        48797..50035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0061"
FT                   /product="DNA methylase, putative"
FT                   /note="identified by match to protein family HMM PF01555
FT                   match to protein family HMM PF02195"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97511"
FT                   /db_xref="GOA:B6IPX5"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR015840"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPX5"
FT                   /protein_id="ACI97511.1"
FT                   /translation="MLNDIRIERWPLDRLLPYAANARTHSEAQVAEIAGSIREFGFNNP
FT                   VLVDDRGVLIAGHGRLLAARRLGLAEVPVIRLGHLTETQARAFRLADNRIALNGGWDDA
FT                   LLSAELARLVEEGTALDGLGFDAGELNRLLNLDDPAPGLVDEDATPEPPAEPVTRPGDL
FT                   WILGSHRLLCGDATGASDVERLLAGARPHLMVTDPPYGVEYDPSWRNAAGVAKTKRTGK
FT                   VANDDRADWRDAWALFPGDVAYVWHAAIHATTVAESLIACGFDIRAQIVWSKSRFALGR
FT                   GDYHWQHEPCWYGVRKGAKSHWQGARDQSTLWSIAPAGGEDAATPHGTQKPVEVMRRPI
FT                   VNNSARGDVLYEPFCGSGTTLIAAETVGRVCYALELDPTYCDVIVRRWEGFTGQRATRA
FT                   DGTPFSDGTDAGA"
FT   gene            50028..51011
FT                   /pseudo
FT                   /locus_tag="RC1_0062"
FT   CDS_pept        50028..51011
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0062"
FT                   /note="site-specific DNA methylase, pseudogene;Disrupted
FT                   reading frame; identified by match to protein family HMM
FT                   PF00145"
FT   gene            complement(51064..51594)
FT                   /locus_tag="RC1_0063"
FT   CDS_pept        complement(51064..51594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0063"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97512"
FT                   /db_xref="InterPro:IPR021880"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPX6"
FT                   /protein_id="ACI97512.1"
FT                   /translation="MTTLSDLTLTQLATAYGALSGTETGPKTFNSKARAISRLEALLAE
FT                   RGLTIADALRAAGIAADVAFDDSGCDPEPAGASGGDDRPGADLEAAVTAIEETLAAEPP
FT                   RTKRSRADSKQAQMIALLRRPEGTTIAEIAAATGWQAHTVRGFFAGALKKKLGLTVTSE
FT                   KVEERGRVYRIAP"
FT   gene            complement(51695..51946)
FT                   /locus_tag="RC1_0064"
FT   CDS_pept        complement(51695..51946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0064"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97513"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPX7"
FT                   /protein_id="ACI97513.1"
FT                   /translation="MTVRTTMEDAMPTPRDNTQALDAFLARKAEIDTMLARLAALSADH
FT                   FNVAPDDIHWGHVGTLATYAELLKRITDAAFREGEHAD"
FT   gene            52023..52613
FT                   /gene="nu1"
FT                   /locus_tag="RC1_0065"
FT   CDS_pept        52023..52613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nu1"
FT                   /locus_tag="RC1_0065"
FT                   /product="probable terminase small subunit, Nu1"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97514"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPX8"
FT                   /protein_id="ACI97514.1"
FT                   /translation="MAGNGQPLAVIAKLLDLSERRVQQLSREGVIPKAERGAYDLVGAV
FT                   RGYVRYLRDLAQRAQGGVADLPTERTRLVKAKADLAELDAQQRRGDLVPVAETALAWAA
FT                   VTARLRARLITLPDKLAPLVHDAANPAAVRVLLRSAIVEALAELAATPVAVAPAPDRAS
FT                   GAGEAGDDGVADADAAAGPDGEPMGGRQPPAEF"
FT   gene            52465..54471
FT                   /locus_tag="RC1_0066"
FT   CDS_pept        52465..54471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0066"
FT                   /product="phage terminase large subunit (GpA)"
FT                   /note="identified by match to protein family HMM PF05876"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97515"
FT                   /db_xref="InterPro:IPR008866"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPX9"
FT                   /protein_id="ACI97515.1"
FT                   /translation="MRRRRSPSPLRLTGHPGLAKLVTTALQMLTPPPDLTVSQWADANR
FT                   RLSSEASAEPGRWSTARAEYQRGIMDAVSDPDIETVVVMSSAQVGKTEVLNNTVGYHID
FT                   QDPSPIMVVMPTERDAETWSKDRFAPMARDTPCLIGRIADPKSRDGSNKILHKRFAGGH
FT                   LTIVGANAPSGLASRPIRILLCDEVDRYPASAGAEGDPVKLARKRTVTFWNRKILLVST
FT                   PTLKGASRIETAFEESDRRRFWVPCPDCGQHQVLSWGQVRWDSDPEPRPDSARYVCVHC
FT                   DAVWGDARRWQAISRGQWRAEAPFTGIAGFHLNEIYSTWVRLADMVRTFLSAKAAGDEA
FT                   MKTFVNTSLGETWQESGEAPDWQRLYERRGGYRFGAVPTGGLFLTAGADVQKDRIEVSV
FT                   WAWGRGLTSWLVDHVVIEGGPERAEAWAALTALLGRTWPHTHGSRLGLARLAIDTGYEA
FT                   PAVYAWARSVGFAQVAPVKGVEGFNRAAPVAGPSYVDATENGRKVRRGARLWTVAVATF
FT                   KSETYRFLRLARPTDEDLAAGITVPPGSLHLPQGVEAEWVKQLVAEQLVTVKTKRGFTK
FT                   LDWQKLRERNEALDCRVYARAAAWIAGIDRWTEAKWRDLEDQVGPAPDAAGTPTPVVPA
FT                   AEVPTAGHLKRPTAPGEKRRGGWLGGRNQGWLG"
FT   gene            54459..54677
FT                   /locus_tag="RC1_0067"
FT   CDS_pept        54459..54677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0067"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97516"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPY0"
FT                   /protein_id="ACI97516.1"
FT                   /translation="MVGMTWTQGELDALRRAYAAGTLRVSYDGRSVEYGSAADLLSRIR
FT                   TIEREMAGNTSSKLPMAGFAGFRRGER"
FT   gene            54677..56164
FT                   /locus_tag="RC1_0068"
FT   CDS_pept        54677..56164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0068"
FT                   /product="phage portal protein, lambda family"
FT                   /note="identified by match to protein family HMM PF05136
FT                   match to protein family HMM TIGR01539"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97517"
FT                   /db_xref="GOA:B6IPY1"
FT                   /db_xref="InterPro:IPR006429"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPY1"
FT                   /protein_id="ACI97517.1"
FT                   /translation="MAGLWLDRALGLVAPQAALRRVLARQSLDRLTRGYDGAAKGRRTD
FT                   GWRAPGSSADAEIAVAGALLRDRMRDLVRNNPHAAKAVSVLVNNIVGSGIMPRAASGDD
FT                   RLDKATDALWQDWSARCDADGQLDFYGLQTLACRQMVEAGEVLLRRRPRRAGDGLPVPL
FT                   QIQLVEADLLDAGRNGDLADGGRIVQGIEFDPLGRRRAYWLNAQHPGDAVVSLRRRLDS
FT                   AAVPAAEVAHIYEKQRAQVRGVPWGTPVMRALRDLDDWTQAELVRKKTEACVVGIVLGA
FT                   DEGEQGIAPSVVDADGHRVEQFEPGLIAYARGGKDIRFNQPATTAGVAEWLRAQLHIIA
FT                   AGFRMPYELLTGDLSQVNYSSIRAGLVEFRRLIEAAQWQLVIPMLCQPAWDWFTTQAWA
FT                   AGRLPRPDIPVEWSPPRFEAVDPLKDAMADLLAMRSGTMTLAQAISRQGHNPEAVLTEI
FT                   AAMNARLDALGLVLDSDPRRVTKTGVIQAGETAANQD"
FT   gene            56171..58138
FT                   /gene="u35"
FT                   /locus_tag="RC1_0069"
FT   CDS_pept        56171..58138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="u35"
FT                   /locus_tag="RC1_0069"
FT                   /product="U35 peptidase, phage protease prohead HK97"
FT                   /EC_number="3.4.-.-"
FT                   /note="identified by match to protein family HMM PF04586"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97518"
FT                   /db_xref="GOA:B6IPY2"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPY2"
FT                   /protein_id="ACI97518.1"
FT                   /translation="MHGTLDLPALRRAADLVLASFDEADRSVELVWSTGARVRRQPLFG
FT                   EPFDEELSLDPAHVRLERLNGGAPLLKVHDMGTLDAVIGSVVPGTARIENGRGLARVRF
FT                   SDRAEVEPILADIRAGHLRAVSIGYQVHRFEISRPASGPELWRAVDWTPFEISAVPVGA
FT                   DLAAGFRSAEPLSPCVVVRPGAPSPATRTSMDETQTKPATPDVATAPAPDVARATATPP
FT                   TPDTDALVARAQAAERERVGTIHDLAGRLGLERGFAEDLVRRGTGLDEARRLILDKVAD
FT                   ASDRTRIFPQVTVPLGGRDERLLRREAVSTALLHRYSPTLFPLTDQAREYRGLSLLELA
FT                   REFLTQAGVAVRGLSRDEIATRALHSTSDFPEVLSAVTAKTLRQAYEVYPRTFTPFCRQ
FT                   VLATDFKAMHRVQIGEAPQLLKVNEGGEFQRGTIGESKESYRIETYGRVVAITRQVLIN
FT                   DDLDAFTRIPAMYGTAIATLESDVVWGILTANAAMADGKALFHADHKNLAGTAAPPTVT
FT                   AIGDARAAMAKQTGLDRKTVLNIRPSFLIVPAALELTAEQLVAQNLTPAKTSDIVPASI
FT                   RTLTPIAEPRLDAASATAWYLAANPAQIDTLEYAYLEGQQGAYIETRNGFDVDGVEIKC
FT                   RLDFGAKAIDWRGLYKNAGA"
FT   gene            58142..58636
FT                   /gene="amiB"
FT                   /locus_tag="RC1_0070"
FT   CDS_pept        58142..58636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amiB"
FT                   /locus_tag="RC1_0070"
FT                   /product="N-acetylmuramoyl-L-alanine amidase, phage related
FT                   protein"
FT                   /EC_number="3.5.1.28"
FT                   /note="identified by match to protein family HMM PF01510"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97519"
FT                   /db_xref="GOA:B6IPY3"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR015510"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPY3"
FT                   /protein_id="ACI97519.1"
FT                   /translation="MTDPFPILSMPGQNVPFAVPKRPVHVVFIHCSASDQAAHDDAAVI
FT                   DQWHRRRGWRGIGYHVFIRGDGTIQRGRPLEDVPAAQAGHNSGSIALCLHGFHQFSPVQ
FT                   FDSLRRLADAMDAAYAAQGKRLRWRGHREVAAKLCPNFDYRVVLGLDAGGFRRPAVPAL
FT                   S"
FT   gene            58649..58822
FT                   /locus_tag="RC1_0071"
FT   CDS_pept        58649..58822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0071"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97520"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPY4"
FT                   /protein_id="ACI97520.1"
FT                   /translation="MRYLIERLRERSTWLGATALLSAFGVSLDPALVDQIALVGGAAAG
FT                   LILMLTPDRPAR"
FT   gene            58859..59197
FT                   /locus_tag="RC1_0072"
FT   CDS_pept        58859..59197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0072"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97521"
FT                   /db_xref="InterPro:IPR011231"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPY5"
FT                   /protein_id="ACI97521.1"
FT                   /translation="MKNHIQPGTTLTLAAPYAVASGEGVLVGALFGIAVASAAGGEPVE
FT                   VCLVGVFDLTKTGSQAWSAGDKIYWDNTAREATKTATGNTLIGAAVTAVDNSAGETVGR
FT                   VRLNGTVT"
FT   gene            complement(59248..60963)
FT                   /locus_tag="RC1_0073"
FT   CDS_pept        complement(59248..60963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0073"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97522"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPY6"
FT                   /protein_id="ACI97522.1"
FT                   /translation="MQKSPKLNVRRYLPSKDFVSNLREIRAFRGAYYGNNLLESLEMAG
FT                   LLRPKLRLRWPDPVARRMWLEGHSDVGSMQEAVEPDGPRWGAAVRLENSLFRTTHPGVY
FT                   GDIPHPFDEPDPAFVEFLQRPAQQVYQSHQDRRVSVANEKYPELFADCNVRDFYSGWQV
FT                   LVAAEFADIGIHFRLNMADAEAARRARHAVFDGRRPADTWREITAPTRALNGFQSHEAA
FT                   LDAVVWSEEEADHALGRILRDHGGGRFWLTEDQAKAYHQAQIEAARKAQEHYGVQSPAI
FT                   LELCKFLAERWSDWEFEGRTLIAHAYKVYLAAAIRMLRMAAGMAFDDIKESVGCQSGHR
FT                   EFTLDAVWPDWVRDQKDRLIRTLQPAVQRECPGAMTDDEIIAFADFIDQERQDAVFLRL
FT                   ESFERHAFGDVDARLAGMSSDLQGLTVAVEHVARAMGGSGDHLHEMFRNLWTGTEIEKL
FT                   LKRNQNDVRRSIFSPSMNIEEKAEAYSSFKVMIEGWRSSCVAKAIAADLVTASKLRGAV
FT                   HYAFPERDHLEMEKLFVAVLRAAALTHAHVRRSQQIKISGQAGLLPTEPASKEC"
FT   gene            complement(61028..61651)
FT                   /locus_tag="RC1_0074"
FT   CDS_pept        complement(61028..61651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0074"
FT                   /product="plasmid pRiA4b ORF-3 family protein"
FT                   /note="identified by match to protein family HMM PF07929"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97523"
FT                   /db_xref="InterPro:IPR012912"
FT                   /db_xref="InterPro:IPR024047"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPY7"
FT                   /protein_id="ACI97523.1"
FT                   /translation="MPTSAPSADVLQIKVTLLDTVPPVWRRLLVPAELNFARLHECIQV
FT                   SMGWTFSHLHEFRVGDRRYGVPDPEFADPAFPVYRDSTLKLSAVLARGIRRFHYTYDFG
FT                   DSWEHEIAIERTLPADPGMEYPRFVDGQRRCPPEDCGGVPGFEMFLDAMADPNHPEHAS
FT                   MRDWYGDDYDPDDIETYIIDIQLDRIAAARRGGIKGRGRPKKSK"
FT   gene            complement(61687..62013)
FT                   /locus_tag="RC1_0075"
FT   CDS_pept        complement(61687..62013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0075"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97524"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPY8"
FT                   /protein_id="ACI97524.1"
FT                   /translation="MRRPSIAADRGALHLEQVVADQQAVPRPGADAGGGQVGGAHLEQG
FT                   SIADHLSTAEAGDDVLAPGDNPHRDRHPADAEISGGRAEDGEHRIDGGLEGIGHGFPSK
FT                   VRPG"
FT   gene            62018..62629
FT                   /locus_tag="RC1_0076"
FT   CDS_pept        62018..62629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0076"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97525"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPY9"
FT                   /protein_id="ACI97525.1"
FT                   /translation="MLAADLAAAERAVTAGLREASDGLKAELRGQIAGAGLGTRLARTW
FT                   RSEIYPKGGRSLRAAGLVWSKAPGIVGLHADGAIIRSRQGLFLAIPTPAAGRYGDGGKK
FT                   ITPGGWERRTGLPLRFVYRRRGLSLLVADNARLSKRGLATANRGRRGEAGFIRLAGRTT
FT                   VPVFILVPQVRVKKRLDVAGAGRAWQGRLPGLILRHWKEP"
FT   gene            62633..63082
FT                   /locus_tag="RC1_0077"
FT   CDS_pept        62633..63082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0077"
FT                   /product="acyl-CoA transferases/carnitine dehydratase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97526"
FT                   /db_xref="GOA:B6IPZ0"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPZ0"
FT                   /protein_id="ACI97526.1"
FT                   /translation="MPSIREAALSALLARLAAVPDAMDGREVAVPERIPPGGLLILRDG
FT                   EPGVPEVTLSPLLHHYDHVAEIEVLVQAADPPLGRTGPGRARALDELLRALAASLAADR
FT                   TLGGTVDWMAWGAPETEDIAVAGGAAIKAARVPVTLTYSTPDLLT"
FT   gene            63131..64036
FT                   /locus_tag="RC1_0078"
FT   CDS_pept        63131..64036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0078"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97527"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPZ1"
FT                   /protein_id="ACI97527.1"
FT                   /translation="MLGAFETAYGTAPGGNFHTLPFVSCDLGSQQPLEASDVLGLGRDP
FT                   APPSRDVITAEGQITVPVDLRSIGFWLKGLFGPPVTTGTGPYSHVYTSRADTLPSLALE
FT                   VGHPQVPRYFLNLGCLVNSLNLGWAPSGKANATLAVIAQVETDAATSSGGTPTTQGLQR
FT                   FHQFQGRIAKDGAALANITAAELTYANNLDPVRVIRDDGKIEGADLGVAACTGNLAARF
FT                   ADMVLLDAATDGTAMALEFAWVIDADRSLTVALPSVFLPKPRIPISGPAGIEARFDWQA
FT                   AKPDSGAFATVTLKNDVASY"
FT   gene            64051..64410
FT                   /locus_tag="RC1_0079"
FT   CDS_pept        64051..64410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0079"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97528"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPZ2"
FT                   /protein_id="ACI97528.1"
FT                   /translation="MIRLDLLREPFWLDLGMGVRLHLRPCTTALVLAARQAVRDTDMTD
FT                   EPPDLVPGTRTATFLKAMGRLSILGWEGVGDADGAPVEPTPDGIDALLDLHPVADAFSL
FT                   RYLGPVALLEQEKNV"
FT   gene            64620..64760
FT                   /locus_tag="RC1_0080"
FT   CDS_pept        64620..64760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0080"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97529"
FT                   /db_xref="GOA:B6IPZ3"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPZ3"
FT                   /protein_id="ACI97529.1"
FT                   /translation="MLGFDHAAVLDMAAAQGMPIAAMTILLPAVEVALVDAANAERKQS
FT                   A"
FT   gene            complement(64767..65141)
FT                   /locus_tag="RC1_0081"
FT   CDS_pept        complement(64767..65141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0081"
FT                   /product="plasmid stabilization system protein, RelE"
FT                   /note="identified by match to protein family HMM PF05016"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97530"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPZ4"
FT                   /protein_id="ACI97530.1"
FT                   /translation="MTSGGPTWTVRLSAAAERDFQEILRWTADRFGLRQANTYARVLSA
FT                   ALEALVSGPTIIGVRQRNEIAPGLLTLHVARTGNKGRHFVLFRITPNTDERTIDVLRLL
FT                   HDSMDISRHLPAVENEMGEP"
FT   gene            complement(65138..65440)
FT                   /locus_tag="RC1_0082"
FT   CDS_pept        complement(65138..65440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0082"
FT                   /product="transcriptional regulators (CopG/Arc/MetJ
FT                   DNA-binding domain), putative"
FT                   /note="identified by match to protein family HMM PF03693
FT                   match to protein family HMM TIGR02606"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97531"
FT                   /db_xref="GOA:B6IPZ5"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR022789"
FT                   /db_xref="InterPro:IPR038296"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPZ5"
FT                   /protein_id="ACI97531.1"
FT                   /translation="MPTRNVVLTDHQADLIERLVSSGRYQNASEVLREGLRLVEDREAE
FT                   ERARLDALREAARLGIADIEDGRFRSFTTADALGRHLTGLAETVLGDQAGLRDRS"
FT   gene            complement(65537..65719)
FT                   /locus_tag="RC1_0083"
FT   CDS_pept        complement(65537..65719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0083"
FT                   /product="putative prevent-host-death protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97532"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPZ6"
FT                   /protein_id="ACI97532.1"
FT                   /translation="MIVTKYGRPSVVILSAGEYERLKRLDRQVLAVTDLSDDDIAGIEA
FT                   ARIPDAHRYHSDDLP"
FT   gene            65901..68573
FT                   /locus_tag="RC1_0084"
FT   CDS_pept        65901..68573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0084"
FT                   /product="phage tail tape measure protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97533"
FT                   /db_xref="InterPro:IPR006431"
FT                   /db_xref="InterPro:IPR009628"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPZ7"
FT                   /protein_id="ACI97533.1"
FT                   /translation="MTDRTIAVRLAAIGGDRVRAELREVGTTGERALQRIEQASRPASR
FT                   ALQAVDAAAGEVRGGAEALAGRLGPAGAALAALGPVGLAAAAAMGVLSLGITEGLRAAG
FT                   EAEQSYRRLEAVLKATGQSAGLTADQIAAFADGQEAATLASAEAVQDAAAVLATFRSVA
FT                   GDTFTRALTLAGDMAAVFGGDLSSAAMQLGKALEDPVEGLSALRRVGVSFTGSQAEVIR
FT                   SLVETGQVAEAQRLILDALEQQVGGAAAAEAGGVTGAANRLSDAWGKLLEAIGKTPAVA
FT                   WPAEAVLDLLARAADGLAGLFEDTPIEQRIVALNRRLVEAQDRAAEIQGIVDAAGGRFG
FT                   QRRLADARADVARLETDLEALIAEARRQADAVDADQRQADGGRARAEAERRAEIIADWR
FT                   RRLDDGLAQPANDPAERIARVNAELDRTRQALEALRSPDGGNADAVDAALAKAEELARR
FT                   RIAQIEQPDRDRAAREQEAETKRRQAALDAIDGQIAALSRERDAVALSARERAIQTELL
FT                   RAEETARRGGIALTEAQREAIHAEAGANYDAAAATAERNRLLEEGSRLTESLLDPTERY
FT                   QAELARLQTLLEAGVLSWETYQRAVERAAQADPETQKRNRLLEQGAWLTERLLSPTEQY
FT                   AATIAKLNDLQAAGAITAESRARAEEQAADLVLAASRRWQDGAIRGLKDYADEAGNAAL
FT                   QVERVMMRAFGRLEDALVDLVMRQKLNFADLLNAIAEDFARMMIRMSITAPLAQAASGA
FT                   IAGIFHEGGTAGGAAPGRAVPAAAFLAAPRLHTGTVPWLAPDEIPAILQRGEIVLNRAQ
FT                   SAAVASAGARTEAGTSGPVYVIQVDARGADDPDAVAMRVEAAVDQALAARLPGVVKAAA
FT                   GVARSQVADEWSRRGGRFG"
FT   gene            68570..69166
FT                   /locus_tag="RC1_0085"
FT   CDS_pept        68570..69166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0085"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97534"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPZ8"
FT                   /protein_id="ACI97534.1"
FT                   /translation="MSDLVWPLDLRPGSQEFYIQTLSVVWASPYTGQTQVLERDGARWV
FT                   CRLTFRRGDPLARQVDALIASLRGPAGTVLVPDWRTLAARGTLAGTPQLVGGSGRSLTV
FT                   AGFAPGATGVLLPGDLIQTSPGRAHLVTSTVTAGLDGDALVSVEPRLREPVTIGPLVTS
FT                   ACRVRMRLSSDDAGRNPTRPPRRSEWALELFEVLP"
FT   gene            69163..69846
FT                   /locus_tag="RC1_0086"
FT   CDS_pept        69163..69846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0086"
FT                   /product="extracellular solute-binding protein family 3,
FT                   putative"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97535"
FT                   /db_xref="UniProtKB/TrEMBL:B6IPZ9"
FT                   /protein_id="ACI97535.1"
FT                   /translation="MTPDWPGDIHPVAVAFWFEPVTAQTVSPLTRQTLALERDGARWVA
FT                   EVTVELSGTQAARFGAWLAGCRGPVAAFRVPLWLHEGAAGSLQSMDAYAAAIGVTRFSD
FT                   GTDFDDGAGFIEGAGQPHITGGVAARLAVAGFAPWTDSVLKTGGAVAVPPGSVHLLVEA
FT                   GRTDIDGRMIVTVRPKLRTPVGRAPLPTEGLALRMRLAGDDAGRGLTRPPVRTRWTLNL
FT                   VEDLP"
FT   gene            69843..70412
FT                   /locus_tag="RC1_0087"
FT   CDS_pept        69843..70412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0087"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97536"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ00"
FT                   /protein_id="ACI97536.1"
FT                   /translation="MTQRLSAPLAAETGRPVVRPVLLALFDFAGGEVRVWSGVGDLVWE
FT                   GRTWIGVGSFGTVGPIEETTEVRATGARFQLSGVPSGLLNEVVGLNVQGRRARLWLAFM
FT                   AEDWGGFVDAPVPLFDGRMDMVEVTDGGRIATIALAAENRLRDLERPRLRRYTSQDQQS
FT                   EFPGDLGFDFVPELQELEIRWGAPAA"
FT   gene            70448..70828
FT                   /locus_tag="RC1_0088"
FT   CDS_pept        70448..70828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0088"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97537"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ01"
FT                   /protein_id="ACI97537.1"
FT                   /translation="MVEAARHSTFAWGRVDCCLFAADAVAAVTGVDPAAPWRGTYADVR
FT                   TAARLLARMGGLEATAAGMARHHGWPETPPAFLGRGDVALVRLDDGRQALAVCLGAALV
FT                   LPAARGLATLERDRVLTGWRIG"
FT   gene            70828..72258
FT                   /locus_tag="RC1_0089"
FT   CDS_pept        70828..72258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0089"
FT                   /product="phage tail protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97538"
FT                   /db_xref="InterPro:IPR032876"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ02"
FT                   /protein_id="ACI97538.1"
FT                   /translation="MPPAVIAVGASIAGSAAAAAVGGGVIGAIVGATVTVGVSYLGNRI
FT                   VGPPKAPAVDLGQSMLDARSGRTQMLVQPVTSHRVVYGEVRVGGPLVFAHTRTEGGGSK
FT                   LDMLHLVVVHAAHEVESLGAVWFGDTAIMLDGGGAATAAPWAGKVQVWSHAGLPDQGAD
FT                   AVLVAEGGGRWTHNHRLRGRAYTHLRLRYDPEAFAGGIPNLSRLVRGRKLWDPRDGATR
FT                   WSANAALCILDYLMAPWGLAAGPDEIDLAGWIAQANICDEPVATLTGAEPRYTCNGVLD
FT                   LAGRPLDNLESLLTSCAGRLSFTGGKWRLAVGAWQPPTVILGENELRAPVTYRPWRSRR
FT                   DLVNTVRGAFTSPAHNWQPTDYPPVADAPSIATDDGEAALTLDLPFTTSHTMAQRIARI
FT                   ALRQNRRQKSLDWPANLAGLRLAAGYPVAVSLGRLGLAGTPFRVETWRLTEEMGVDLAL
FT                   AEDAAEVYAHDPSWLKAM"
FT   gene            72263..73531
FT                   /locus_tag="RC1_0090"
FT   CDS_pept        72263..73531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0090"
FT                   /product="putative phage tail fiber repeat family protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97539"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ03"
FT                   /protein_id="ACI97539.1"
FT                   /translation="MRDARFILPGVRAALEAKAPADHGHVLDDVAGLSATLAGKAPAAH
FT                   THALSDLPVATAGESHAARLVRADDPRLSDSRAPLAHGHALADLPVAGPGESSAAKLVR
FT                   ADDPRLSGGGEAGGPAALRNLVVNGCARVSHRPAAPLASTWQPGEVDLWRVRADGNPSA
FT                   GTVKRATGVFTLSPSGSACLVQGATLGSGGAFHWRLRLEGADALRLRHGPAVLSARAYH
FT                   DCGRDVGWTLTLARAGAPDGFASVSTIATTTVTVPHDSNTDLVLAVPDMGACETGLQIT
FT                   FTAACGAVSGRWFYLGAVQLEAGSTATEFDLRPIALETALVHRQLRPIATAVGRANSGT
FT                   NVQLSVSHSGLRAPPEYQTTAPLTITDMVTANFTQASLGLGTIHERTADGGRFDVGTFS
FT                   GLTSGTPVVLTSLGGRILASAEL"
FT   gene            73535..74962
FT                   /locus_tag="RC1_0091"
FT   CDS_pept        73535..74962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0091"
FT                   /product="phage-related pre-neck appendage protein,
FT                   putative"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97540"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR024535"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ04"
FT                   /protein_id="ACI97540.1"
FT                   /translation="MASAIDDVLIPGQPVDKQRLRDYLRGREIAVPQSYGGIPDGVSDC
FT                   SDAIEAALAASSTVLLVPGTYRVSRPVVLGYGQTLMGVGEGSVLQARPDPFDGAAPIYS
FT                   QTGWNAVEVVDGYASLRDLRIVGGAAGIKLVGRDGACVKTVIENVSIWDAVIGIVLDGY
FT                   DNPDRPCYWNHIARTLVARPQLHGVLLTVDSAGDTPNANKFHDVRVYSLAAPMAGCGFF
FT                   ISAGRFNNSFVDCEANLHPNAESCFRLGFSTDQNLIVNFYAESLGPVPGIRIDGGSQNT
FT                   AILNLFSATGGAPIWDTTGARRYTAFNAGHPVKNHLKRTELTEARIGRLELETAFTEGV
FT                   ATVTLDPARAVHLISAWTGPVTAELPDPHPLNGVVLVVKKSDSGPHAVTVTQAGGGGPD
FT                   ADPVRLGRRGDHVVVVSNSAAWHIIAARYDRPAAAWPNPSGTAFTRSLNADASTLADVR
FT                   AVLRALILDLKTAGILS"
FT   gene            74989..75261
FT                   /locus_tag="RC1_0092"
FT   CDS_pept        74989..75261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0092"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97541"
FT                   /db_xref="GOA:B6IQ05"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ05"
FT                   /protein_id="ACI97541.1"
FT                   /translation="MTTAEWALLVAIVAHGAAIMAALLKLVAWGTTKVAVIEGRIGTLE
FT                   RAVDNDITGRRVVAQIVNDVAVIKSEIAEVRQALRHAEHQSDKQS"
FT   gene            75547..76293
FT                   /locus_tag="RC1_0093"
FT   CDS_pept        75547..76293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0093"
FT                   /product="phage protein Gp37"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97542"
FT                   /db_xref="InterPro:IPR011101"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ06"
FT                   /protein_id="ACI97542.1"
FT                   /translation="MSTSSKIEWTEQTWNPTTGCTKISPGCKHCYAEVMARRLHAMGAA
FT                   GYENGFKLALHPERLAQPLARRKPTVYFVNSMSDLFHRDIPDTFLDDVFAVIGRTPQHT
FT                   YQILTKRAERLTEYFASRRCPPNVWLGVSVEDREYGVPRIDYLRRVEAQVRFLSIEPLL
FT                   EDLGAFDLSGIHWVIVGGESGHKARPMEEVWVENIKRQADSASVAFFFKQWGGWGADGV
FT                   KRHKKANGRVFKGRTWNAYPEINTAY"
FT   gene            complement(76299..77120)
FT                   /locus_tag="RC1_0094"
FT   CDS_pept        complement(76299..77120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0094"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07505"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97543"
FT                   /db_xref="InterPro:IPR031009"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ07"
FT                   /protein_id="ACI97543.1"
FT                   /translation="MGALINGDDGLPAEEVGTWAKEKHDRLRRYLDISRAARNKFLTGA
FT                   ARSATFIDLFCGPGRAQVKETGEWIDGSAVAAWKISQNGGAPFSDIYVADIDDDRRKAT
FT                   VERLNRLKAPVRELSGSAADAAAELAGVINRYGLHFAFIDPFSLGALDFRIIQSLATLK
FT                   RIDMLIHVSAMDLQRNLGINLGQDGSAFDSFAPGWREKVDLARPQQAIRQQVVEYWRDL
FT                   VAGLGKKPSTRMELITGNTGQRLYWLLLAAENELAHKFWSVATDNGQRSLF"
FT   gene            complement(77143..79824)
FT                   /locus_tag="RC1_0095"
FT   CDS_pept        complement(77143..79824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0095"
FT                   /product="type III restriction enzyme, res subunit,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97544"
FT                   /db_xref="GOA:B6IQ08"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ08"
FT                   /protein_id="ACI97544.1"
FT                   /translation="MNRHVNAIAGRLSLRPPQRQSLEILDRITEVIPPRKVADAVAALE
FT                   AIKAEFPTVTDFERDFPSLCFALATGVGKTRLMGAFITYLHLAHGINNFFVLAPNLTIY
FT                   NKLIADFTPNTPKYVFKGIAEFSVETPEVITGDNYESRGALLNELLRCKINIFNISKIN
FT                   SEVRGGKSPRIKRLSEYIGESYFDYLAGLPDLVLLMDESHRYRASAGVRAINELKPVLG
FT                   LELTATPFVETSRGAVPFKNVILDYPLGRAMADGFVKEPAVVTRKDFNPAGMSIEEIER
FT                   LKLEDGVRLHEGVKVELETYARQTGNAIVKPFVLVIARDTTHAGQLMQFIQSDRFFGGR
FT                   YAHKVIQVDSSKTGAEEDEMIERLLKVEHTEEPTEIVIHVNMLKEGWDVTNLYTIVPLR
FT                   AANARTLIEQSIGRGLRLPYGKRTGVISVDRLNIVAHDKFQEIVEEANRPNSTIRLQQV
FT                   IIAPEQFQQKTATVVSQSRLAAKLGFQPEQMTASTSVASGGEAPAFATPEEQKVARITY
FT                   EVIRRLENQPGKLPSVTYLQNPEVRETVLREVAAQYRPQQLEMEGVSKPDLAAVVAKTT
FT                   ELVVQQTIDIPRILVVPKGEVRSGFKPFTLDLSKINYQAPSEELWVQHLRTNHLEIIGL
FT                   GHGGIEESRLEDYIVGGLIDFDDIAYDDHADLLYDLAGQMTSHLLGYLSSDDARRVLRF
FT                   HQREIARFVHAQMQAHYWEEAVDYEVVVSKGFTELKTSAFTASATEPPLDFRTSPTDKS
FT                   NMAKYLFSGFQKCLYPVQKFQSDSERKMSVILERESLKWFKPAKGQFQIFYKRGADHAE
FT                   YQPDFVAEAADTIYMLEPKAANQMTDEEVLAKRDAAVKWCRHASGHAGTYGGKPWKYLL
FT                   IPHDAIAENMTLTGLERQFVTR"
FT   gene            complement(79821..80849)
FT                   /locus_tag="RC1_0096"
FT   CDS_pept        complement(79821..80849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0096"
FT                   /product="DNA-binding protein, putative"
FT                   /note="identified by match to protein family HMM PF04851"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97545"
FT                   /db_xref="GOA:B6IQ09"
FT                   /db_xref="InterPro:IPR011204"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ09"
FT                   /protein_id="ACI97545.1"
FT                   /translation="MSTGEVILYTTEDGRTEIQLRSSGGTVWLTQEQMAILFDRERSVI
FT                   TKHIGNLFADGELGEESNVQNMHVAHSDKPVRLYSLDVVLAVGYRVRSERGVQFRRWAT
FT                   TVLKEYLVKGFVMNDERLKDPKFDYFDELLERIRDIRASEARFYQKVRDILALSVDYTA
FT                   KADTVPTFYATIQNKMLHAVTHHTAAELIAARADENAPNMGLTSWKGGRVRKADVTTAK
FT                   NYLGETEVRELNLIVGMFLDTAELRSTRRQQIHLAEWETILDGFLKANELPLLHNAGSV
FT                   SAKQAEKIAHDRYALFDTQRKEAERRASEEADELDELKRIAEQAATARNPRPAPAKKGT
FT                   KR"
FT   gene            complement(80846..82510)
FT                   /locus_tag="RC1_0097"
FT   CDS_pept        complement(80846..82510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0097"
FT                   /product="type III restriction-modification system
FT                   methyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97546"
FT                   /db_xref="GOA:B6IQ10"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002295"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ10"
FT                   /protein_id="ACI97546.1"
FT                   /translation="MSRKTKLELTWIGKEDRPRLEPRILLEDPEKSHHADARVTDEDIF
FT                   DNRLIFGDNLLALKALEQEFAGKVKCVFIDPPYNTGSAFEHYEDGVEHSLWLSLMRDRL
FT                   EIIRRMLSDDGSLWITIDDNEAHYLKILLDEVFGRSSFIANIVWQKRTSRENRAAIGSA
FT                   HDHILIYAPSGPQRWKDVRNRLGDEGSYSNPDNDTKGPWRSIPFSAQGYRANQMYDIET
FT                   PSGEIVKPPAGRCWGATEPVFKKHLADGRVYFPNGGTGRPRIKQYKGEEVGLAPMTWWD
FT                   AAFAGDNQAAKKEILGLFDDDIFGTPKPEKLLMNVIHIATNPGDLVLDSFAGSGTTGAV
FT                   AHKMGRRWIMVELGEHCHTHIIPRLKKVIDGEDKGGVTEAVGWQGGGGFRYFRLAPSLL
FT                   EKDKWGREVIAKEYNAAMLAEAVCKLEGFVYAPSDAVYWQHGHSTERDFIYVTTQTLGP
FT                   DQLQQLSDEVGPDRSLLVLCAAFRGAVDGWPNLTVKKIPNHIKNRCEWGHDDYSLKVEN
FT                   LPKATPKPVTPLPAAKSGRRTTTPVPDLFSGTREDDE"
FT   gene            complement(82507..84171)
FT                   /locus_tag="RC1_0098"
FT   CDS_pept        complement(82507..84171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0098"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01555"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97547"
FT                   /db_xref="InterPro:IPR018891"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ11"
FT                   /protein_id="ACI97547.1"
FT                   /translation="MLVGLCGIDDTMAVGAITDGKNDGGIDALFFDRTGSRLVFVQAKF
FT                   KRGGAAPSQEEMLKTINGIRALLERRFGDFNQAIQGRLDEIEEALDTAGVRIEVVPAFL
FT                   GDTLGPHATADLNALQADMNRFAPRMAWEAAGLSKVHNWLIAEQMPVTVNAQVTLENWS
FT                   CITAPRNAVYGQISAAELAQLVEDHGKALFERNIRHYLGSVGVNLAIERTVRGRPGDFF
FT                   YLNNGLTAVADRITPAAGTNARCVFGFKNLSIVNGAQTAGSIANAAIAGTISPDAKLLI
FT                   TIIEIGPGAGDFGLEITRARNHQNVVRGVDFAALDPNQERLRQELALAGITYHYRPSAE
FT                   ARARREDAFTLEEAAVALACLSFPVVHSRDAHAAPRRAHPNAVDLVVTAKKEIGRLWEQ
FT                   DGAHYGQIFTPSLSGLKTCRAVRIFGFIDQILADSERSETAYHRRMFFRHGRYFVMAFV
FT                   AHRLPDLIRRSDLALSEADRTTLSRKVNELSELIYAVSHPWLTSKGYLSIFRNLTDAQP
FT                   LANAVLDRLAEQDAAARLAASSTPASTSSPSSGTHNP"
FT   gene            complement(84332..87208)
FT                   /locus_tag="RC1_0099"
FT   CDS_pept        complement(84332..87208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0099"
FT                   /product="helicase, SNF2 family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97548"
FT                   /db_xref="GOA:B6IQ12"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ12"
FT                   /protein_id="ACI97548.1"
FT                   /translation="MLRRMNLTAYHSKYLAHELTRRFPSDSDEKLAGAVARAQVDLNPH
FT                   QVDAALFAFRSPLSKGAVLADEVGLGKTIEAGLVISQKWAERKRRILVIAPSNLRKQWH
FT                   QELKEKFFLPCAILEAGSYKEAMKAGNVHPFEIKDTIVICSYQFARNKAADVQAAPWDL
FT                   VVIDEAHRLRNVYKTSNVIANTLKGALGHTQKLLLTATPLQNSLLELYGLVSFIDEHTF
FT                   GDLKSFREQFANLGQDRAFQVLKERLKPICHRTLRRQVTAYVPYTKRLPLIEEFTPSDS
FT                   EDRLYQLVSEYLRRDNLQALPASQRSLMTLVLRKLLASSTFAIAGALTTLSTRLKEKLR
FT                   KPEPSQSLEEELDQDYEALDTTAEEWSEDEAAESLSEVDRRAIEAEIADLDEFTRIATS
FT                   IEHNEKGKALLKALTVAFAKARELDAAEKAIIFTESRRTQDYLLRTLADSPFADRIVLF
FT                   NGTNTDERSKEIYTAWKARHEGSDRVTGSRTADMRSALVDYFREQGRIMIATEAGAEGI
FT                   NLQFCSLVVNYDLPWNPQRIEQRIGRCHRYGQKHDVVVVNFLNRKNEADQRVFRLLSEK
FT                   FQLFEGVFGASDEVLGAIESGVDFEKRIATIYQKCRQPDEIKTAFDQLQLELSLEIDQA
FT                   MTRTRQQLLENFDDEVREKLKVRDEASKAYLDRFERLLMRLTRYELDDNAEFPDDSSFR
FT                   LKSSPFPAWVGDIPLGLYELPRRTGEAHLYRLNHPLAEAILVRAKGRDLPVAEVCFDYD
FT                   SHEGKVSILEHLRGQSGWLSLSLFTVEALDQIEDHLLLTGVADSGSPLSDDTLRRLLTI
FT                   PGKVGAALDIPADVRRALDELIHRRQNGIQRGISERNATFFAAEAEKLDSWADDLKLGL
FT                   EREIREIDRQIKEARRAATTALTLEEKLAGQKQVKALESLRNQKRRSLFDAQDQVDKQR
FT                   EELIAQIEAKLMQSASLQALFTIRWTLA"
FT   gene            complement(87213..87662)
FT                   /locus_tag="RC1_0100"
FT   CDS_pept        complement(87213..87662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0100"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00176
FT                   match to protein family HMM PF00271"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97549"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ13"
FT                   /protein_id="ACI97549.1"
FT                   /translation="MLYFDTSFLVPLLLPEPISDKITEFVRGLPADQLTVSHWTRVEFS
FT                   SLIAREVRMGGLDAQAAAQINARFETMVDESFAVVLPNADDFDLAKEFLRNFKTGLRAE
FT                   DALHLAIARNHHAMTFYSLDKALLKAGLFLGLPVTAGVSLPEYGQ"
FT   gene            complement(88616..89818)
FT                   /gene="moeA"
FT                   /locus_tag="RC1_0101"
FT   CDS_pept        complement(88616..89818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moeA"
FT                   /locus_tag="RC1_0101"
FT                   /product="molybdopterin biosynthesis protein MoeA"
FT                   /note="identified by match to protein family HMM PF01850"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97550"
FT                   /db_xref="GOA:B6IQ14"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ14"
FT                   /protein_id="ACI97550.1"
FT                   /translation="MIPVAEARGRILDGVAPLPAEVVGIGQALGRVLAADVAARLTQPP
FT                   ADVSAMDGWAVRAADLDPLPASLRRIGEAPAGHPFPGTVGPGEAVRIFTGAVMPAGADT
FT                   VVLQEDCDEAGGAVTVREGGGRGRWVRPAGLDFRTGEVGLVAGRRLTVRDVALAAAMNV
FT                   PWLTVRRRPRVAILATGDEVVMPGDPVGPGCIVSSNGLALAALVEREGGLPVTLGIAPD
FT                   DPAALAGHLAAAAGCDLLVTTGGASVGEHDLMRQALAAPGTRLDFWKVAMRPGKPLLSG
FT                   RVGDVPVLGLPGNPVSTLVCALVFLRPLLRLLQGLPPDDGPAPLARLAAPLAANDRRQD
FT                   YLRAGLERAADGSLLAGAFPKQDSSMLSALAAADCLIVRPPLAPAAPAGTEVEIIPLDG
FT                   F"
FT   gene            complement(89815..90324)
FT                   /gene="moaC"
FT                   /locus_tag="RC1_0102"
FT   CDS_pept        complement(89815..90324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaC"
FT                   /locus_tag="RC1_0102"
FT                   /product="molybdenum cofactor biosynthesis protein C"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97551"
FT                   /db_xref="GOA:B6IQ15"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6IQ15"
FT                   /protein_id="ACI97551.1"
FT                   /translation="MGTGDPGGAPRLTHFDEHGNAAMVDVSAKAETERVATAEALVSMR
FT                   PETFALIESGGIAKGDVLGVARIAGIMAAKRTADLIPLCHPLALSRVAVDFALLPDRPA
FT                   VRIEATVTLKGRTGVEMEALTAVSVAALTLYDMCKAVDRGMTIGGIRLLHKSGGKSGTY
FT                   RAGDEA"
FT   gene            complement(90329..91141)
FT                   /gene="trpC"
FT                   /locus_tag="RC1_0103"
FT   CDS_pept        complement(90329..91141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpC"
FT                   /locus_tag="RC1_0103"
FT                   /product="indole-3-glycerol phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97552"
FT                   /db_xref="GOA:B6IQ16"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ16"
FT                   /protein_id="ACI97552.1"
FT                   /translation="MSADVLARICADKREHVARCRRDRPLAAVEAAARAAPAPRGFARA
FT                   LDAAVAAGRHGLIAEIKKASPSKGLIRPDFDPPALARAYLVGGATCLSVLTDIPYFQGD
FT                   DRYLEAARAAVPLPALRKDFMLEPYQIVESRALGADCILLIMAALDDGQAAELYAAAIH
FT                   YGMDVLVEVHDEAEMERALALPGGLLGVNNRNLKTLAVDLATTEGLAAMVPPGRALVAE
FT                   SGIYGPADIARLAAVGARRFLVGESLMRQADVTAATRALLTPAPATAA"
FT   gene            complement(91138..92163)
FT                   /gene="trpD"
FT                   /locus_tag="RC1_0104"
FT   CDS_pept        complement(91138..92163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpD"
FT                   /locus_tag="RC1_0104"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.18"
FT                   /note="identified by match to protein family HMM PF00994
FT                   match to protein family HMM PF03453 match to protein family
FT                   HMM PF03454 match to protein family HMM TIGR00177"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97553"
FT                   /db_xref="GOA:B6IQ17"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ17"
FT                   /protein_id="ACI97553.1"
FT                   /translation="MPDFKSLLAKVATGAALSETEAETAFDIIMAGNATPAQMGGFLMA
FT                   LRVRGETVDEITGAARIIRSRLVPVEGPEGLIDTCGTGGDAAGTYNISTAVALVVAGCG
FT                   VPVAKHGNRAISSRSGAADVLAALGVNVEAEFDLVHKALWEAGIAFMMAPRHHTAMRNV
FT                   GPTRVELGTRTIFNLMGPLSNPAHARRQLLGVYARTWVEPIAQVLLRLGSESAWVVHGS
FT                   DGLDEITTTGPTYVAELRDGRIRTFEVTPEEAGLPRASLHDLHGGDPETNAAALRSVLG
FT                   GAHGPYRDIVLLNAAGALVVAGAVPDLRSGVRHAAGCIDEGRAMATLDRLVAITNGSTA
FT                   A"
FT   gene            complement(92202..92816)
FT                   /gene="trpG"
FT                   /locus_tag="RC1_0105"
FT   CDS_pept        complement(92202..92816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpG"
FT                   /locus_tag="RC1_0105"
FT                   /product="anthranilate synthase component II, putative"
FT                   /EC_number="4.1.3.27"
FT                   /note="Strong similarity With PabA from E; coli, which Has
FT                   a different enzymatic function; identified by match to
FT                   protein family HMM PF01967 match to protein family HMM
FT                   TIGR00581"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97554"
FT                   /db_xref="GOA:B6IQ18"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ18"
FT                   /protein_id="ACI97554.1"
FT                   /translation="MLLLIDNYDSFTWNLVHYLGELGAEVEVRRNDALTAEEALAMRPE
FT                   AVVLSPGPCDPDKAGICLPMIHLAAQARLPLLGVCLGHQAIGQAFGGKVVRAPEPMHGK
FT                   MGSVRHAGAGLMRGLPSPFQATRYHSLIVERESLPDCLEVTAELEDGMIMALSHRDLPI
FT                   HGVQFHPESIASEHGHRILDNFLDIARGGRNVPSRVPGEAA"
FT   gene            92922..93323
FT                   /gene="hmrR"
FT                   /locus_tag="RC1_0106"
FT   CDS_pept        92922..93323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmrR"
FT                   /locus_tag="RC1_0106"
FT                   /product="HTH-type transcriptional regulator HmrR"
FT                   /note="Alternate namesAlso matched to TIGR02044:
FT                   Cu(I)-responsive transcriptional regulator and PF00376:
FT                   transcriptional regulator, MerR family; identified by match
FT                   to protein family HMM PF00218"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97555"
FT                   /db_xref="GOA:B6IQ19"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ19"
FT                   /protein_id="ACI97555.1"
FT                   /translation="MRIGDAAARSGVPARTIRYYESVGLIDAAGRGENGYRDYDDTDVR
FT                   TLLFISRARALGFSMKEVAGLLELWRDRARASADVRALAQQHMAEIDARIADLQSLRRT
FT                   LGDLVERCQGDGRPDCPILDTLSGSRCHG"
FT   gene            93812..94534
FT                   /locus_tag="RC1_0107"
FT   CDS_pept        93812..94534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0107"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00591
FT                   match to protein family HMM PF02885 match to protein family
FT                   HMM TIGR01245"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97556"
FT                   /db_xref="GOA:B6IQ20"
FT                   /db_xref="InterPro:IPR006837"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ20"
FT                   /protein_id="ACI97556.1"
FT                   /translation="MPAWQRNAVPTPPAEGRPRIVIVIDDMGLDHRRSGRVVALPGPLT
FT                   LAWLPYARDLPIQTRQAHQRGHELIVHMPMEPAGSGDPGPNALLVRQSPEEIRSRLRTN
FT                   LDAFSGYVGINNHMGSRFTADAAASAVVVEELARRGLLVLDSRTTADSRLRDEAVRRHV
FT                   PSASRDVFLDHVQTPAAVSAALEKVEATARRQGLAIAIGHPHDVTTEALARWLPTLAGK
FT                   GFQLVPLSAVVRTGPSES"
FT   gene            94603..94806
FT                   /locus_tag="RC1_0108"
FT   CDS_pept        94603..94806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0108"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF00117
FT                   match to protein family HMM TIGR00566"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97557"
FT                   /db_xref="GOA:B6IQ21"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ21"
FT                   /protein_id="ACI97557.1"
FT                   /translation="MAAIYRVEGMTCQGCANSVSRAIETQTGATRALVDLTAGTVSVEG
FT                   QVSEAEVRSAIEAAGFDFKGTV"
FT   gene            complement(94876..96405)
FT                   /gene="trpE"
FT                   /locus_tag="RC1_0109"
FT   CDS_pept        complement(94876..96405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpE"
FT                   /locus_tag="RC1_0109"
FT                   /product="anthranilate synthase component I"
FT                   /EC_number="4.1.3.27"
FT                   /note="identified by match to protein family HMM PF00376
FT                   match to protein family HMM TIGR02044"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97558"
FT                   /db_xref="GOA:B6IQ22"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ22"
FT                   /protein_id="ACI97558.1"
FT                   /translation="MRVFPEADAFAETYRQGTSQVVWTRLVSDLDTPVSAMMKLSQGRP
FT                   NAFLLESVTGGSVRGRYSLIGLKPDLMWRSKGDRAEVNRRFAEAPEAFEPCPEPPLKAL
FT                   AALLEESRIALPASLPPMSAGLFGYLGYDMVRLMERLPDANPDELGLDDAILIRPTVMA
FT                   IFDGIENVITVVTPVRKEPGIDADVAYRRATERLAEAVADLEGPVPAALGTDLDLQPLP
FT                   EPASNTSRAEYHALVERAKEYIRAGDIFQVVPSQRFSVPFSLPPFALYRALRRLNPSPF
FT                   LFFLDFGHVSVVGSSPEILVRLRDNTVTIRPIAGTRRRGKDAAEDKELAADLLSDPKEL
FT                   AEHLMLLDLGRNDVGRVAQVGTVKVTERFTIEYYSHVMHIVSNVEGQVAPTFTAIDALI
FT                   AGFPAGTVSGAPKIRAMEIIDELEKTRRGIYGGCIGYFAANGTMDTCIALRTAVIKDGM
FT                   MYVQAGGGVVADSDPEAEYQETVNKSKALFKAAEEAMRFAAERRQAAAADL"
FT   gene            complement(96412..98280)
FT                   /locus_tag="RC1_0110"
FT   CDS_pept        complement(96412..98280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0110"
FT                   /product="peptidyl-prolyl cis-trans isomerse, putative"
FT                   /note="identified by match to protein family HMM PF04748"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97559"
FT                   /db_xref="GOA:B6IQ23"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ23"
FT                   /protein_id="ACI97559.1"
FT                   /translation="MLQAIRSTAGSWIAKILFILLIASFAVWGIGDFTRGLGRHVAEVG
FT                   DVQITPQELDQEFRDEVTRLRRVMGADLTAEQARAFGLLERTLQQMVQRTLVSLAGQDK
FT                   GLMPSDAMVADEIRRVPVFHNQLGQFDPDLMRALLRQNGMTEQGLVEQVRADMARGQLL
FT                   GSVSIGAILPTTLAETLFRFRNEKRVADLITVPATAMPEPAAPDASVLAQYHQDRAVRY
FT                   TAPEYRSLTVAKLTAEAIAGDITVSDADIEQAYSARASEFVAPERRAVVQAVLPDEAAA
FT                   KSVADAVAGGASLEQAAKAAAAEAIDLGEVTRDQLLPELVEPVFGLSQGAISAPVESTL
FT                   GWHVLTVRGITPGHERPLAEVRDQVVADLRKERALDRLYEVANQMDDDLAGGATLEEAA
FT                   QRAGAEIVRIEAVDSRGTTPAGTPVQDVPALPQVLETAFALPSGETGHMTETDAQGYFA
FT                   VRVDGVQPAALKPLETIRERVLADWTAEQRAAAARTKADELAAKLREGADPARLAATVP
FT                   GATHARSEPFTRRPEAAALPASLVEELFGAQPGGVAVADGREGPVAARLVEIIPAVPDA
FT                   AGVKVIRDTTEATLADDLVTQYVGGLQRQFPVSVNRGLIDSLYRPE"
FT   gene            98290..98541
FT                   /locus_tag="RC1_0111"
FT   CDS_pept        98290..98541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0111"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00403"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97560"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ24"
FT                   /protein_id="ACI97560.1"
FT                   /translation="MRSREGPSSGRGNAATLGSPKAAHHRSRSPARQARQPPHSRGWKS
FT                   VSAAVKRDGATCRSGSQPAERRLKCASQEKRPCPTAAR"
FT   gene            98520..99275
FT                   /gene="tpiA"
FT                   /locus_tag="RC1_0112"
FT   CDS_pept        98520..99275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpiA"
FT                   /locus_tag="RC1_0112"
FT                   /product="triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="identified by match to protein family HMM PF00425
FT                   match to protein family HMM PF04715 match to protein family
FT                   HMM TIGR00564"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97561"
FT                   /db_xref="GOA:B6IQ25"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ25"
FT                   /protein_id="ACI97561.1"
FT                   /translation="MPDRRPLIAGNWKMNGLRADGTALARDLAGRLAAAGSAGFDLLVC
FT                   PPATLLHAVGEALAGSGIALGGQDCHAAEKGAHTGDVSAWMLADIGCSHVIVGHSERRH
FT                   DHGEDDAAVRAKAAAAHKAGLTAIICVGETEAERDAGEAEAVVARQLEGSIPQGADAVD
FT                   TVIAYEPVWAIGTGRTPTVADIAAMHGMIRRRLHGLVASPDSVRILYGGSMKPGNAAEI
FT                   MAVADVDGGLVGGASLKADDFWQIALSVR"
FT   gene            99397..99750
FT                   /gene="secG"
FT                   /locus_tag="RC1_0113"
FT   CDS_pept        99397..99750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /locus_tag="RC1_0113"
FT                   /product="preprotein translocase, SecG subunit, putative"
FT                   /note="identified by match to protein family HMM PF00639"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97562"
FT                   /db_xref="GOA:B6IQ26"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ26"
FT                   /protein_id="ACI97562.1"
FT                   /translation="MEKVVLVVHLLIAVSLVGVVLIQKSEGGGLGIGGGTMGGLMTTRG
FT                   SANLLTRTTAILAACFFTTSLVLAAMTGATGPAESIFDRTAPGVQQEAPAVPAPAPEQP
FT                   PAQPAQPTVPVGQ"
FT   gene            99870..101498
FT                   /gene="pyrG"
FT                   /locus_tag="RC1_0114"
FT   CDS_pept        99870..101498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="RC1_0114"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97563"
FT                   /db_xref="GOA:B6IQ27"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6IQ27"
FT                   /protein_id="ACI97563.1"
FT                   /translation="MTRFIFITGGVVSSLGKGLASAALGALLQARGFKVRLRKLDPYLN
FT                   VDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFTGVPTRQSDNITTGRIYSNVIAKERR
FT                   GDYLGATVQVIPHITDAIKEFVQADLTDEDFCLVEVGGTVGDIESLPFLEAIRQLGNEL
FT                   GPDRALFTHVTLLPYIPAAGELKTKPTQHSVKELLSVGIQPQILLCRADRPIPDNERRK
FT                   IALFCNIKQEAVIAALDVDTIYQVPISYHEQGFDTQVLKFFGMPVGGEPDLSRWQEIVS
FT                   RVRHPEGEVTIAVVGKYTSLLDAYKSLGEALTHGGIANNVKVKLDWIDAEIFETDGAIH
FT                   RLEGVHGILVPGGFGERGTEGKIKAAQFARERGIPYFGICFGMQMAVIEATRHLAGLEN
FT                   AGSSEFGHPDPAVVGLMTEWSRGNQLEKRAAGGDLGGTMRLGSYDCHLLPGTKVRDIYG
FT                   ADFIQERHRHRYEVNINFRDKLEAVGLTFSGLSPDGVLPEIVELPTHPWYIGVQFHPEL
FT                   KSKPFEPHPLFTSFIRAAIEQSRLV"
FT   gene            101573..102415
FT                   /gene="kdsA"
FT                   /locus_tag="RC1_0115"
FT   CDS_pept        101573..102415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdsA"
FT                   /locus_tag="RC1_0115"
FT                   /product="2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /EC_number="2.5.1.55"
FT                   /note="Also called Phospho-2-dehydro-3-deoxyoctonate
FT                   aldolase or3-deoxy-D-manno-octulosonic acid 8-phosphate
FT                   synthetase; identified by match to protein family HMM
FT                   PF00121 match to protein family HMM TIGR00419"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97564"
FT                   /db_xref="GOA:B6IQ28"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ28"
FT                   /protein_id="ACI97564.1"
FT                   /translation="MVAPRTVAVRDLTVANDRPFTLIAGPCQLESRQHALEMSGALVEI
FT                   TRRLGIGLIYKTSFDKANRTSVSTARGLGMEKSLPILAEVRETFGIPVLTDVHAPEQCA
FT                   AVAEVVDVLQIPAFLCRQTDLLLAAGETGRPVNVKKGQFLAPWDMKNVAAKIASTGNDN
FT                   ILLCERGASFGYNTLVSDMRSLPIMAATGYPVVFDATHSVQQPGGQGTSSGGQREFVPV
FT                   LARAAVAIGVAAVFMETHQDPDHAPSDGPNMVPVSELESILEVMVALDRIAKAAPVRF"
FT   gene            102460..103083
FT                   /locus_tag="RC1_0116"
FT   CDS_pept        102460..103083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0116"
FT                   /product="acyltransferase, putative"
FT                   /note="identified by match to protein family HMM PF03840
FT                   match to protein family HMM TIGR00810"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97565"
FT                   /db_xref="GOA:B6IQ29"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ29"
FT                   /protein_id="ACI97565.1"
FT                   /translation="MQIPSIGSAVPRRGTPFSRWLGRTAMRLGGWQFEGEVPDAPKFII
FT                   IGAPHTSNWDFLVVMSAALALAIDVKIMAKHTLMRGPLAPIMRWCGVFGIDRRRAGGVV
FT                   GQMAEKFRQADKLTMAIAPDGSRTASEHWKNGFWRIARAADIPVLPCALDYGRRRVRFG
FT                   PLMRMSSDIAADLAALTDFYLGTRGARRTIDRPISFKDIGAEPA"
FT   gene            103255..104535
FT                   /gene="eno"
FT                   /locus_tag="RC1_0117"
FT   CDS_pept        103255..104535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eno"
FT                   /locus_tag="RC1_0117"
FT                   /product="phosphopyruvate hydratase, putative"
FT                   /EC_number="4.2.1.11"
FT                   /note="identified by match to protein family HMM PF00117
FT                   match to protein family HMM PF06418 match to protein family
FT                   HMM TIGR00337"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97566"
FT                   /db_xref="GOA:B6IQ30"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6IQ30"
FT                   /protein_id="ACI97566.1"
FT                   /translation="MSAIIDIHAREILDSRGNPTVEVEVRLESGAFGRAAVPSGASTGA
FT                   HEAVELRDGDKARYGGKGVLRAVESVNGEIFDTLSGLEATEQVAIDSIMIELDGTPNKN
FT                   RLGANAILGVSLAVAKAAADELDQPLYRYVGGTNARTLPVPMMNIINGGAHADNPIDIQ
FT                   EFMVMPVGAETCADSIRMGAEIFHALKKKLKDAGHNTAVGDEGGFAPNLKSTDEALGFI
FT                   MKAVEAAGYRPGEDVLLALDAASTEFYRNGRYELAGEGKSLDAAGMVAYWQDLVGRYPI
FT                   VSVEDGMAEDDWDGWKALTDAIGGSVQLVGDDLFVTNPTRLSEGISRGIANSILVKVNQ
FT                   IGSLTETLEAVRIAQSNGYTAVMSHRSGETEDSTIADLAVATNCGQIKTGSLSRSDRIA
FT                   KYNQLIRIEEGLGRARIFPGRAALKRG"
FT   gene            104726..105088
FT                   /locus_tag="RC1_0118"
FT   CDS_pept        104726..105088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0118"
FT                   /product="septum formation initiator, putative"
FT                   /note="identified by match to protein family HMM PF00793
FT                   match to protein family HMM TIGR01362"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97567"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ31"
FT                   /protein_id="ACI97567.1"
FT                   /translation="MHALGSAFNRAFRQIIGPVLGASVVAYFAYHTVQGDRGLVALTHL
FT                   QGEVEEASRVLAEVRHEREQLEHRARLLRPDNLDPDMLEERARLLLNKTHPDDLVILLP
FT                   GRPAPQSPQDTQPGSR"
FT   gene            105260..106273
FT                   /gene="pdhA"
FT                   /locus_tag="RC1_0119"
FT   CDS_pept        105260..106273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhA"
FT                   /locus_tag="RC1_0119"
FT                   /product="pyruvate dehydrogenase E1 component, alpha
FT                   subunit"
FT                   /EC_number="1.2.4.1"
FT                   /note="identified by match to protein family HMM PF01553"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97568"
FT                   /db_xref="GOA:B6IQ32"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017597"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ32"
FT                   /protein_id="ACI97568.1"
FT                   /translation="MAMSKRRAKGAAPEAATLPGPEELLKYYREMLLIRRFEEKAGQMY
FT                   GMGLIGGFCHLYIGQEAVVVGIQNALRPGDSIITSYRDHGHMLACQMDPKGVMAELTGR
FT                   RGGYSKGKGGSMHMFSREKKFFGGHGIVGAQVPIGTGLAFAHKYAKDDGIAVCYMGDGA
FT                   VNQGQVYESFNMAALWHLPVLYVIENNKYAMGTAQTRSSAGELYMRGSAYGIPGRQVNG
FT                   MDVLEVRGAADEAVAHVRGGQGPMILEMKTYRYRGHSMSDPAKYRTKEEVNKMRSESDP
FT                   IDHLKTKLLEKSYADEDALKVIDREVKQVVTEAAEFATQSPEPDPSELWTDVLVDA"
FT   gene            106301..107695
FT                   /gene="pdhB"
FT                   /locus_tag="RC1_0120"
FT   CDS_pept        106301..107695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhB"
FT                   /locus_tag="RC1_0120"
FT                   /product="pyruvate dehydrogenase E1 component, beta
FT                   subunit"
FT                   /EC_number="1.2.4.1"
FT                   /note="identified by match to protein family HMM PF00113
FT                   match to protein family HMM PF03952 match to protein family
FT                   HMM TIGR01060"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97569"
FT                   /db_xref="GOA:B6IQ33"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR027110"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ33"
FT                   /protein_id="ACI97569.1"
FT                   /translation="MPVQVLMPALSPTMTEGKLAKWVKKEGDEVKAGDVLAEIETDKAT
FT                   MEVEAVDEGTLASILVQEGTEGVAVNTPIAVITQEGESAEQAQARTEESTPKSAAAQHV
FT                   KGETGTAPSLPAAPPPSSPAAPPASDEDRFFKDAPVITVREALRDAMAEEMRRDPTVFL
FT                   MGEEVAEYQGAYKVSQGLLQEFGAERVIDTPITEHGFAGLGVGAAFGGLRPVIEFMTFN
FT                   FSMQAIDQIINSAAKTLYMSGGQMGCPIVFRGPNGAAARVAAQHSQDFASWYGHIPGLK
FT                   VVAPYTAADAKGLLKAAIRDPNPVIVLENEILYGHSFPCPTDPDFIVPIGRAKVVRQGT
FT                   DVTVTAYSLMVAHALAAAERLAEEGISVEVIDLRTIRPLDVETVVASVKKTNRLVSVEE
FT                   GWAFAGIGSELAALMMEHAFDHLDAPVVRVHAKDVPLPYAANLEKLALPQPDDVVQAVK
FT                   AVTYRR"
FT   gene            107723..109129
FT                   /gene="pdhC"
FT                   /locus_tag="RC1_0121"
FT   CDS_pept        107723..109129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhC"
FT                   /locus_tag="RC1_0121"
FT                   /product="pyruvate dehydrogenase complex dihydrolipoamide
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.12"
FT                   /note="E2 component of pyruvate dehydrogenase complex"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97570"
FT                   /db_xref="GOA:B6IQ34"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006257"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ34"
FT                   /protein_id="ACI97570.1"
FT                   /translation="MPIEILMPALSPTMTEGKLARWLKKEGDEVKAGDVLAEIETDKAT
FT                   MEVEAVDEGRLARILIGDGTEGVAVNTPIGLIAEEGEDMSAAADGGKAPPPAAPAPREG
FT                   ATGPADAAVAPKPGQTATGPVGGASPSLPESREPAAPARHGGGEQDGHDRVFASPLARR
FT                   MAQQAGLDLASLSGSGPQGRIVKADIEAALARGPQQKEAARSATKPSPAPAAPSAAPQP
FT                   AAAGAAPRGIDARDYADRLGMPYTVLPNSGMRKTIARRLTEAWQTIPHFALTVDLEIDR
FT                   LLALRAELNERSGEKVSVNDFVVKAAALALRKVPAANVSWHEDGILQYENVDVSVAVAT
FT                   EGGLITPIVRNADRKGLSTISAEVKALAQKARDGKLKPEEFQGGTFSVSNLGMFGIRTF
FT                   TSIINPPQSCILSVGAGEKRAVVKGDALAIATVMSCTLSVDHRSVDGAVGAEFLKVFRQ
FT                   LIEDPITMML"
FT   gene            109239..110645
FT                   /gene="pdhD"
FT                   /locus_tag="RC1_0122"
FT   CDS_pept        109239..110645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhD"
FT                   /locus_tag="RC1_0122"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="E3 component of pyruvate and 2-oxoglutarate
FT                   dehydrogenases complexes identified by match to protein
FT                   family HMM PF04977"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97571"
FT                   /db_xref="GOA:B6IQ35"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ35"
FT                   /protein_id="ACI97571.1"
FT                   /translation="MADTQFDLIVLGAGPGGYVAAIRAAQLGMKTAVVEREHLGGICLN
FT                   WGCIPTKALLRTAEVAHLIQHAKDYGITVEGPVRFDLAPIIKRSRQVAAQLSAGVKGLL
FT                   KKNKVTVIDGSGRLLGKGRLAVEKDGKPAGEYAAKHIIIATGARARVLPGLEPDGRLVW
FT                   TYKEAMVPERMPKSILVVGSGAIGVEFACFYRQMGVEVTLVEVLDRILPVEDEEISAIA
FT                   AKQFTKQGIRIHTGTKVTKLEKAADSVTATLDLGGGRTETVTVDRVIAAVGIVGNVEDI
FT                   GLEATRVKVERNHIVTDAWMRTDEPGVYAIGDVCGAPWLAHKASHEGVLCVEKIAGVQG
FT                   VHPMDVRNIPGCTYSLPQVASVGLTERKAREAGHEVRVGRFPFIGNGKAIALGEPEGLV
FT                   KTVFDARTGELLGAHMVGTEVTELIQGYTIAKTMETTEAELMHTIFPHPTLSEMMHESV
FT                   LAAYGRAIHY"
FT   gene            110856..111833
FT                   /gene="lipA"
FT                   /locus_tag="RC1_0123"
FT   CDS_pept        110856..111833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipA"
FT                   /locus_tag="RC1_0123"
FT                   /product="lipoic acid synthetase"
FT                   /EC_number="2.8.1.-"
FT                   /note="[Synonyms] Lipoyl synt Hase Lipoate synt Hase
FT                   Lipoyl-acyl-carrier protein synt Hase identified by match
FT                   to protein family HMM PF00676"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97572"
FT                   /db_xref="GOA:B6IQ36"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6IQ36"
FT                   /protein_id="ACI97572.1"
FT                   /translation="MPIAPDRVRHPEKANRPDNPIQRKPEWLRVKAPTSPEYGETRSLM
FT                   RGLRLNTVCEEAACPNIGECWKKKHATFMILGAVCTRACAFCNVATGRPDQLDPHEPEK
FT                   VAEAVAHLKLEHIVVTSVDRDDLEDGGAGHFARTIRAIRAAAPGTTIEVLTPDFMKKKG
FT                   AVETVVEARPDVFNHNLETAPRLYPTIRPGARYFTSLQLLARVKEIDPSMFTKSGIMVG
FT                   LGETKEEVFQVMDDLRAADVDFMTIGQYLAPTPKHAKVDRFVTPDEFAGYVTVGRGKGF
FT                   LMVASSPLTRSSYHAGADFERLRAAREAKLAGRPVAAPEATSAE"
FT   gene            111854..112321
FT                   /locus_tag="RC1_0124"
FT   CDS_pept        111854..112321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0124"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00364
FT                   match to protein family HMM PF02779 match to protein family
FT                   HMM PF02780"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97573"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ37"
FT                   /protein_id="ACI97573.1"
FT                   /translation="MPRHTEQKVFPYSPDQLFALVSDVERYPEFLPWAVAARIRRRDGN
FT                   VFWADLVIGFKMVRERYTSRVVLSPDKRRIDVEYAEGPFEHLENHWVFHPHPDGCVVDF
FT                   YVDFEFRNKVLQKIIGALFHEAVRRMVAAFETRAHQLYGAPTVRPAARPVL"
FT   gene            complement(112352..112837)
FT                   /gene="cinA"
FT                   /locus_tag="RC1_0125"
FT   CDS_pept        complement(112352..112837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cinA"
FT                   /locus_tag="RC1_0125"
FT                   /product="competence/damage-inducible protein CinA,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF00198
FT                   match to protein family HMM PF00364 match to protein family
FT                   HMM PF02817 match to protein family HMM TIGR01349"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97574"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ38"
FT                   /protein_id="ACI97574.1"
FT                   /translation="MFPDDLTALAERVRDAFVARGLWLATAESCTGGLIAGCLTSVSGS
FT                   SALVDRGFVTYTNAAKTEMLGVPAALIAAHGAVSEPVATAMACGVLAHSRADVALSVTG
FT                   IAGPTGGTASKPVGLVWLGAARRDGPVRVERHVFPGDRTAVRLASVRRSLELALDLL"
FT   gene            complement(112842..114020)
FT                   /gene="ispDF"
FT                   /locus_tag="RC1_0126"
FT   CDS_pept        complement(112842..114020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispDF"
FT                   /locus_tag="RC1_0126"
FT                   /product="IspD"
FT                   /EC_number="2.7.7.60"
FT                   /EC_number="4.6.1.12"
FT                   /note="[includes] 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase, 2-C-methyl-D-erythritol
FT                   2,4-cyclodiphosphate synt Hase [pathway] Isoprenoid
FT                   biosynthesis identified by match to protein family HMM
FT                   PF00070 match to protein family HMM PF01134 match to
FT                   protein family HMM PF02852 match to protein family HMM
FT                   PF07992 match to protein family HMM TIGR01350"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97575"
FT                   /db_xref="GOA:B6IQ39"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR026596"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ39"
FT                   /protein_id="ACI97575.1"
FT                   /translation="MPACIALIVAAGRGERFGSDIPKQYLPLAGKTVLRHSVEAFLRHP
FT                   GVTGVRVVINPEHRDLYDAAVAGLGLPEPIRGGASRQQSVLNGLEALAEEKPDLVLVHD
FT                   GARPLVDAGTIDRVIAALAEQPAAVAATRLADTLKRERDGRVCTTVDRTGLWRARTPQG
FT                   FRYHDILGAHREAVGLDLTDDAAVAERAGLAVALVPSNPDNLKVTHADDLARAERLIYA
FT                   GLSDIRTGSGYDVHKFHPGDHVTLCGVSVPHDQALEGHSDADVGLHALTDALLGALAAG
FT                   DIGQHFPPTDPRWKGADSAVFLRHAAEMVRERGGVIAHVDVTLICERPKVGPHRPAMQA
FT                   RMAELLGIAADRVSVKATTTEGLGFTGRREGIAALATATVRLPMPGLPTAGK"
FT   gene            114254..115270
FT                   /locus_tag="RC1_0127"
FT   CDS_pept        114254..115270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0127"
FT                   /product="tRNA-dihydrouridine synthase B, putative"
FT                   /note="PF01207 With a good score above the trusted cutoff
FT                   and uncharacterized homologs; identified by match to
FT                   protein family HMM PF04055 match to protein family HMM
FT                   TIGR00510"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97576"
FT                   /db_xref="GOA:B6IQ40"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ40"
FT                   /protein_id="ACI97576.1"
FT                   /translation="MGKRLAPLRIGPVTIDDPVILAPMSGVSDMPFRRLVKRTGAGLVV
FT                   SEMIASQAMIRASRESMLKTEWSPEEAPISMQLAGCDPEAMAEAARLNEDRGAHIIDIN
FT                   FGCPVKKVVNGYAGSALMKDEPLAGRIMEQTVKAVSVPVTMKMRKGWDAGNLNAPRLAR
FT                   IAEECGIRMVTVHGRTRCQMYNGTADWKFIRTVKEAVSIPVIANGDINTLADVVRCLEE
FT                   SGADGVMIGRGTYGRPWFLAQVMHYLRTGEARPDPSLAEQLTIVLEHYEAILEHYGAEA
FT                   GLRIARKHVAWYSKGLPGSADYRNAIMTMDQPARVKQAIVDFYRALMDRGITERVAA"
FT   gene            115270..116397
FT                   /gene="ntrB"
FT                   /locus_tag="RC1_0128"
FT   CDS_pept        115270..116397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrB"
FT                   /locus_tag="RC1_0128"
FT                   /product="Nitrogen regulation protein NtrB"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF03364"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97577"
FT                   /db_xref="GOA:B6IQ41"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ41"
FT                   /protein_id="ACI97577.1"
FT                   /translation="MPKPATLARRRPQEEIDPAVVLNALPDPVLVVDRAGAVQFVNLEA
FT                   EEFFDVSSARVVGTPLTDLIPADSPILGLIEQARETHGSVSEYGVTLETPRIGAHFMTV
FT                   QAAPASDPPDLVVLTLHQRSIARKIDNQLSHRGAARSVIAMAAMLAHEVKNPLSGIRGA
FT                   AQLLEESVVEEDRLLTRLICDETDRIVALVDRMEVFADRRPVQKAAINIHSVLEHVRRI
FT                   AQNGFARHIRFVERYDPSLPPVLGNRDQLIQVLLNLVKNAAEACPEQGGEIVLSTAYQH
FT                   GVRLAVAGSDSRVHLPLLVSVQDNGDGIPEDIQANLFDPFVTTKLNGTGLGLALVAKIV
FT                   GDHGGVIEFESVPRRTVFKVSLPMAADSGALVEGA"
FT   gene            116399..117847
FT                   /gene="ntrC"
FT                   /locus_tag="RC1_0129"
FT   CDS_pept        116399..117847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrC"
FT                   /locus_tag="RC1_0129"
FT                   /product="Nitrogen assimilation regulatory protein NtrC"
FT                   /note="contains Sigma-54 interaction domain identified by
FT                   match to protein family HMM PF02464 match to protein family
FT                   HMM TIGR00199"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97578"
FT                   /db_xref="GOA:B6IQ42"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ42"
FT                   /protein_id="ACI97578.1"
FT                   /translation="MGATILVADDDRAIRTVLTQALARLGHEVRSAGNAATLWRWVSEG
FT                   QGDLVITDVVMPDENGLDLIPRIKRTRPDLRIIVMSAQNTLLTAVKAAERGAFDYLPKP
FT                   FDLKELVAMVQKALSSPRPPVEPVPLPPVEAEEETLPLIGRSPAMQEIYRVLARLMGTD
FT                   LTVMVTGESGTGKELVARALHDYGKRREGPFVAINMAAIPRELIESELFGHEKGAFTGA
FT                   TMRSTGRFEQAQGGTLFLDEIGDMPLEAQTRLLRVLQEGEYTTVGGRTPIKTDVRIVAA
FT                   THRDLRTLIRQGLFREDLFYRLNVVPIRIPPLRERTEDIQALVRHFFHLATHQGLPLKS
FT                   MDNAAMERMKRHRWPGNVRELENMVRRLAALYAQEVIGLDVIEQELAEAAPASQPAEEP
FT                   VNEGLGAAVERHLKEYFAAHKDGVPAAGLYDRVLREVERPLLSLSLLATKGNQIKAAHL
FT                   LGLNRNTLRKKIRELDIQVVRGLK"
FT   gene            118078..120372
FT                   /gene="ntrY"
FT                   /locus_tag="RC1_0130"
FT   CDS_pept        118078..120372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrY"
FT                   /locus_tag="RC1_0130"
FT                   /product="Nitrogen regulation protein NtrY"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF01128
FT                   match to protein family HMM PF02542 match to protein family
FT                   HMM TIGR00151 match to protein family HMM TIGR00453"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97579"
FT                   /db_xref="GOA:B6IQ43"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017232"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ43"
FT                   /protein_id="ACI97579.1"
FT                   /translation="MTAVADAAARPPWWRRLVRWASGRGLGNKLAIALAIAAVLAGSAT
FT                   YAALTETPPFGKDPNTVSLLLTLDLALLLLLSSIMARRIVTLWLERRRGLAGARLHARL
FT                   VAVFSLLAVLPAIIMAAFSALFFYVGVQSWFSDRVRTAVNESLAVAEAYLAEHQQAIRA
FT                   DALTTSYELQRAGGAFFLWQPAMMQQILRNQAYARSITQAVIFDSQGRIYARAGLAFDF
FT                   DVSDVPRSAMDEARRGDVVVVGGRVDRVSALVHIDPDFDVFLFVGRPVEARVLAHVEAT
FT                   QSAVQEYTRLEVERFGLQTRLALIFVVVAMLLLLAAIWAGLNFATYLVQPMSALIAAAE
FT                   RVRAGDLTARVPEMETEAEDELTSLSRAFNRMTSQIEGQRGALVEANRLLDLRRRFTEA
FT                   VLAGVSAGVLGLDQEERINLPNLSAAELLGVEDPQSLVGERLDDVVPEMAELLATIRRR
FT                   PGKLVEGQVQIRRGTQIRTLLVRIGAEVVAGTIRGYVVTFDDVSELLSAQRKAAWADVA
FT                   RRIAHEIKNPLTPIQLSAERLRRKYLKEIQSDPETFRTMTDTIVRHVDDIGRMVDEFSA
FT                   FARMPSPVMKPTNLQELCRQAMLLHATAHPAIHFEADLPSEPLVVICDGRQIGQALTNL
FT                   LKNAGEAVEGREETAGGKTLPAGRVMVQLRADEERVTLLVEDNGKGLPTDQRDRLTEPY
FT                   VTTRAKGTGLGLAIVKKIMEDHGGALTLEDRPGGGARVGLVLPRVQPAAVADPGAADRA
FT                   EGTAVAAGAKG"
FT   gene            120377..121783
FT                   /gene="ntrX"
FT                   /locus_tag="RC1_0131"
FT   CDS_pept        120377..121783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrX"
FT                   /locus_tag="RC1_0131"
FT                   /product="Nitrogen assimilation regulatory protein NtrX"
FT                   /note="contains Sigma-54 interaction domain identified by
FT                   match to protein family HMM PF01207 match to protein family
FT                   HMM TIGR00737"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97580"
FT                   /db_xref="GOA:B6IQ44"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ44"
FT                   /protein_id="ACI97580.1"
FT                   /translation="MAHDILIVDDESDIRMLIAGILNDEGMKTREAADADQALAAVAAR
FT                   RPSLVILDIWLQGSRLDGLQILDELKRDHPDVPIVMISGHGTIETAVAAIKKGAYDFIE
FT                   KPFKADRLLLLVERAIEAARLRRENRELKLRAGAETDLVGKSLPVNQLRHGVEKVAPTG
FT                   SRVLISGPPGSGKEVVARMIHARSRRADGPFVALNCATMRPDRLEIELFGTEHALDGGG
FT                   RKVGTFEQAHGGTLFLDEVADMPLETQGKIVRVLQEQTFERVGGSARVEVDVRVIASTN
FT                   RDLTLEIELGRFRQDLYYRLAVVPLKVPPLRERREDIPLLARHFMQRTAESAGLPQRSF
FT                   GEDAMAALQAYDWPGNVRQLRNVVEWLLIMVAGDPHEPVRADMLPPEIGAITPTVLKWE
FT                   KGGEIMGLPLREAREVFEREYLLAQVTRFGGNISRTAAFVGMERSALHRKLKSLGVHGT
FT                   EKNGTRLTVE"
FT   gene            121853..123229
FT                   /gene="trkA"
FT                   /locus_tag="RC1_0132"
FT   CDS_pept        121853..123229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkA"
FT                   /locus_tag="RC1_0132"
FT                   /product="K+ transport systems, NAD-binding component"
FT                   /note="identified by match to protein family HMM PF00512
FT                   match to protein family HMM PF00989 match to protein family
FT                   HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97581"
FT                   /db_xref="GOA:B6IQ45"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ45"
FT                   /protein_id="ACI97581.1"
FT                   /translation="MKVIVCGAGQVGSNIARYLASEGNNVTVIDQSSELIQKISDTLEV
FT                   QAMVGFASHPHVLEAAGAADADMIVAVTLADEVNMVACQVAHSLFNVPTKIARVRHQSY
FT                   LAPIWADLFSRDHLPIDVIISPEIEVARAVARRLQVPGAFDMIPMADGKVKVIGVICGD
FT                   NCPIIHTPLRQLTGLFPDLNIEIVAIVRNDRPIIPSGDDQMLPGDEVYFVADTKHVSRA
FT                   MAAFGHEEPEARRVIIIGGGNIGLCLAEEIEAKHQGVSARIVEIDRKRAQMVAQRLSRT
FT                   MVLHGDGLDPDILEEANVRASETVVAVTNNDEGNILASLLAKRYGCERAITLINKSTYQ
FT                   PLVQPLGIDAVVSPRSITVSSILQHVRRGRIKAVHSLREGFAEVIEAEALETSSLINTP
FT                   LREIRLPDGVIVGAIVRGGDVIIPRPSTVIKPNDRVIILAEVGQVKKVEKMFAVRLEFF
FT                   "
FT   gene            123281..124150
FT                   /locus_tag="RC1_0133"
FT   CDS_pept        123281..124150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0133"
FT                   /product="D-alanine aminotransferase, putative"
FT                   /EC_number="2.6.1.21"
FT                   /note="identified by match to protein family HMM PF00072
FT                   match to protein family HMM PF00158 match to protein family
FT                   HMM PF02954 match to protein family HMM TIGR01818"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97582"
FT                   /db_xref="GOA:B6IQ46"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ46"
FT                   /protein_id="ACI97582.1"
FT                   /translation="MPRFAYVNGRYLPHDDAAVHIEDRGFQFADGVYEVVTIVGGRFAD
FT                   LEGHLARLDRSLRELRMPWPVKPTSLRLIMRELAARNGVRDGMVYVQVTRGVAPRDFRF
FT                   PADTAPTLVLTCRRSRFQTARQLAEGVSVITIPDIRWLRRDIKTVGLLAQSLGKQKAAE
FT                   AGAYEAWQVDPDGTVTEGCSSNAWIVTAEGTLVTRPASNLILNGITRLSLLRIARDLGI
FT                   PVEERPFTVAEAHAAREALMSSAGSFALPVTRIDGKPVGEGRPGPLTLRLRAAYLADVG
FT                   APDPVGRV"
FT   gene            124155..124889
FT                   /locus_tag="RC1_0134"
FT   CDS_pept        124155..124889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0134"
FT                   /product="HAD-superfamily hydrolase, subfamily IA"
FT                   /note="identified by match to protein family HMM PF00512
FT                   match to protein family HMM PF00672 match to protein family
FT                   HMM PF00989 match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97583"
FT                   /db_xref="GOA:B6IQ47"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ47"
FT                   /protein_id="ACI97583.1"
FT                   /translation="MNDAIADATVSAPLPPQRLPRAVLFDWDNTLVTNWRCVHAAINAA
FT                   LERFGHRPWTLEESYGRVRHSLRDSFPAIFGDDWMAARDVFYAHFQEHHLDYLEPLPGA
FT                   AELLEQLSGTGIYLGVVSNKTGSFLRAEADSLGWTRHFGKLVGATDAAADKPSVAPVEM
FT                   ALEPGGIVAGPDVWFVGDADIDMECAHRSGCLPILVGCTPDVAAGLGRFPPAVRLDGCS
FT                   AISALVQQMRDTISLDGAPRMS"
FT   gene            124968..125216
FT                   /gene="hfq"
FT                   /locus_tag="RC1_0135"
FT   CDS_pept        124968..125216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hfq"
FT                   /locus_tag="RC1_0135"
FT                   /product="protein hfq"
FT                   /note="Also called RNA chaperone Hfq; identified by match
FT                   to protein family HMM PF00072 match to protein family HMM
FT                   PF00158 match to protein family HMM PF02954"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97584"
FT                   /db_xref="GOA:B6IQ48"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ48"
FT                   /protein_id="ACI97584.1"
FT                   /translation="MSEKSQNVQDVFLNHVRKNKTPVTVFLVNGVKLQGIITWFDNFSV
FT                   LLRRDAHSQLVYKHAISTVMPAHPIQLFEPAKETEHD"
FT   gene            125290..126582
FT                   /gene="hflX"
FT                   /locus_tag="RC1_0136"
FT   CDS_pept        125290..126582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflX"
FT                   /locus_tag="RC1_0136"
FT                   /product="GTP-binding protein hflX, putative"
FT                   /note="identified by match to protein family HMM PF02080
FT                   match to protein family HMM PF02254"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97585"
FT                   /db_xref="GOA:B6IQ49"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ49"
FT                   /protein_id="ACI97585.1"
FT                   /translation="MASRSPEAQLEEAVGLARAIELEVVGARSIRVMRPRPAALLGQGA
FT                   VEELAAAIEAETATLVVVDHALTPVQQRNLEKAWKAKVIDRTGLILEIFGARARTREGQ
FT                   LQVELAALTYQRSRLVRSWTHLERQRGGFGFLGGPGESQLEIDRRLIGERIARLKAELE
FT                   EVRRTRGLHRRAREKVPYPVVALVGYTNAGKSTLFNRMAGADVFAKDLLFATLDPTMRA
FT                   ITLPSNRKIILSDTVGFISDLPHGLVEAFRATLEEVQAADIVLHVRDVSHPDTEAQKAD
FT                   VETVLRELGIEVDSDARVVEVLNKIDLVPEGERDALLRQARRTGDTVAISALTGEGLGG
FT                   LFDLIDRRMVADRDVVSVAVDLADGAALAWLYQRGEVLERQDDDARALVRVGLETADVG
FT                   RFRERFGYLPVPAAPVGTAAPDAGPWEARRA"
FT   gene            complement(126606..127451)
FT                   /gene="purU"
FT                   /locus_tag="RC1_0137"
FT   CDS_pept        complement(126606..127451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purU"
FT                   /locus_tag="RC1_0137"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /EC_number="3.5.1.10"
FT                   /note="identified by match to protein family HMM PF01063"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97586"
FT                   /db_xref="GOA:B6IQ50"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ50"
FT                   /protein_id="ACI97586.1"
FT                   /translation="MQSYVLTLSCPDAVGIVATLSGLLAGHDANILDSAQFGDRISGRF
FT                   FLRISFEVEDGRVDTLRRALAEVAERFRMDLHLHDAGRRPRVMILVSRFGHCLNDLLYR
FT                   YRIGALAMDIPAIVSNHRDFYQLAAWHDVPFHHLPVNGGNKERQEERLLEIIEGERIDL
FT                   VVLARYMQVLSPTLCERLPGRCINIHHSFLPSFKGAKPYHQAFARGVKLIGATAHYVTT
FT                   DLDEGPIIEQAVERVDHTLGPDDLVAVGRDIECMVLARAVKYHLERRVLLNGSKTVVFR
FT                   "
FT   gene            127685..128485
FT                   /gene="suhB"
FT                   /locus_tag="RC1_0138"
FT   CDS_pept        127685..128485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="suhB"
FT                   /locus_tag="RC1_0138"
FT                   /product="inositol-1-monophosphatase, putative"
FT                   /EC_number="3.1.3.25"
FT                   /note="[Synonyms] IMPase Inositol-1-phosphatase identified
FT                   by match to protein family HMM PF00702 match to protein
FT                   family HMM TIGR01549"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97587"
FT                   /db_xref="GOA:B6IQ51"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ51"
FT                   /protein_id="ACI97587.1"
FT                   /translation="MVPDIARVADIVREVAASEIMPRFRHLEDRDVREKGPGDLVTIAD
FT                   VAAERQLSVRLTELLPGSVAIGEEAATADERVLERIQGDDPVWIIDPVDGTANFVAGRP
FT                   VFAVMVALARRGETLAGWIHDPCGGSMAVATRGGGAWLDGVRLCVAPPVPLETMTGAVG
FT                   TRYFERRVREHLESRMPRLAGTFTLQCAGHEYLRLLRGESHFSLYRRIMPWDHAAGALM
FT                   HAEAGGYAAKLDGIGYTPMELAGGLLLAPDRPSWNALRTLLFGD"
FT   gene            complement(128513..129286)
FT                   /gene="ydfG"
FT                   /locus_tag="RC1_0139"
FT   CDS_pept        complement(128513..129286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfG"
FT                   /locus_tag="RC1_0139"
FT                   /product="NADP-dependent L-serine"
FT                   /EC_number="1.1.1.-"
FT                   /note="identified by match to protein family HMM PF01423
FT                   match to protein family HMM TIGR02383"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97588"
FT                   /db_xref="GOA:B6IQ52"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ52"
FT                   /protein_id="ACI97588.1"
FT                   /translation="MSQSYRPETVLITGATGGFGTAFAHRFAGLGCRLVLVGRDAAKLR
FT                   ALASGLTVPVHTVQVDVRDRPAVEAALAALPTDFAAIDLLINNAGLALGADPAFRSNLD
FT                   DWEVMIDTNDKALAVMTGLVLPGMVARGRGHIINISSTAGSYPYPGGHVYCASKAFVTQ
FT                   FSLALRADLIGTGVRVTSIEPGMVETDFSLVRFKGDAEKAARVYADTTPLTADDVAEAV
FT                   VWAGTLPPHFNINRIELMPTTQGPGALGVHRSPKG"
FT   gene            complement(129357..130166)
FT                   /locus_tag="RC1_0140"
FT   CDS_pept        complement(129357..130166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0140"
FT                   /product="MazG family protein"
FT                   /note="identified by match to protein family HMM PF01926
FT                   match to protein family HMM TIGR00231"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97589"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ53"
FT                   /protein_id="ACI97589.1"
FT                   /translation="MSDSMKRLVDLMAKLRDPEGGCPWDLEQDFRSIAPHTIEEAYEVA
FT                   DAIEKGDMAALKDELGDLLFQVVFYARMAEERGDWDFDAVAAHITAKMVRRHPHVFGET
FT                   VVDTAADQTQRWEDLKARERAEKAAAEGRRPSALDGVIGGLPALTRAVKLQKRAARVGF
FT                   DWTRAEEILDKIEEEIGELRHELRAATPHPDRIRDETGDLLFALVNLARRLEVDPESAL
FT                   RGTNAKFERRFRHIEDRLAAQGRTPGDATLEEMEALWQQAKRLEPRD"
FT   gene            complement(130346..130780)
FT                   /gene="cueR"
FT                   /locus_tag="RC1_0141"
FT   CDS_pept        complement(130346..130780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cueR"
FT                   /locus_tag="RC1_0141"
FT                   /product="HTH-type transcriptional regulator cueR"
FT                   /note="Alternate namesMatched to PF00376: transcriptional
FT                   regulator, MerR family; identified by match to protein
FT                   family HMM PF00551 match to protein family HMM PF01842
FT                   match to protein family HMM TIGR00655"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97590"
FT                   /db_xref="GOA:B6IQ54"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ54"
FT                   /protein_id="ACI97590.1"
FT                   /translation="MNIGRLGSLTETNVETIRYYERIGLLPPPPRTQSNYRDYDDGHVR
FT                   RLSFIRRARALGFHLDTIRALLDVSDRPDQSCAGVDALTRRQIAEVEAKIADLTRLRDE
FT                   LVRLAGQCRGDRIRDCRIIEALSPPVLPEPLPEMPAQGRP"
FT   gene            130866..131516
FT                   /locus_tag="RC1_0142"
FT   CDS_pept        130866..131516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0142"
FT                   /product="Cation efflux protein , putative"
FT                   /note="identified by match to protein family HMM PF00459"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97591"
FT                   /db_xref="GOA:B6IQ55"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ55"
FT                   /protein_id="ACI97591.1"
FT                   /translation="MGASCCAGPCASEKPPADSAYRRVLWVALLVNGAMFGVEIVAGAA
FT                   ADSVSLKADALDFLSDAANYAISLFVLGAALTVRARAALVKGLSLGAVGLVVAGNTFYN
FT                   ALAQAVPGAEVMGAVGLLALAANVGVAALLYAWRDGDSNRRSVWICSRNDAIGNVAVVL
FT                   AAAGVFGTGTGWPDIVVAAVMAGLAVSGAVQITRQALGELRDTNRPAAGALPL"
FT   gene            131649..132863
FT                   /gene="gcdH"
FT                   /locus_tag="RC1_0143"
FT   CDS_pept        131649..132863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcdH"
FT                   /locus_tag="RC1_0143"
FT                   /product="glutaryl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.6"
FT                   /note="identified by match to protein family HMM PF00106
FT                   match to protein family HMM PF01370"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97592"
FT                   /db_xref="GOA:B6IQ56"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ56"
FT                   /protein_id="ACI97592.1"
FT                   /translation="MADVPETGLPQKTPKGSPFRWEDPLRLDDQLSEEERMVRDSARAY
FT                   CQDRLMGRVLEAFRHEHFHREIMAEMGELGLLGVTIDGYGCAGLNHVCYGLVAREVERV
FT                   DSGYRSAMSVQSSLVMHPIHAYGSEEQRQRWLPGLASGTLVGCFGLTEPDAGSDPGSMK
FT                   TRARKVAGGWTLSGSKTWITNSPIADIFVVWAKDEAGDIRGWVLEKGMAGLSAPKIEGK
FT                   FSLRASVTGMIMMDEVFVPEENLLPGAKGLSGPFGCLNKARYGIAWGAMGAAEFCWHAA
FT                   RQYTLDRQMFGRPLAATQLIQKKLADMQTEIALGLQGALALGRMLDAGTWAPEAISLMK
FT                   RNNCGKALDIARVARDMHGGNGIADEYHVIRHVLNLEAVNTYEGTHDVHALILGRAQTG
FT                   LQAFG"
FT   gene            133013..134284
FT                   /gene="frhB"
FT                   /locus_tag="RC1_0144"
FT   CDS_pept        133013..134284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frhB"
FT                   /locus_tag="RC1_0144"
FT                   /product="coenzyme F420 hydrogenase"
FT                   /EC_number="1.12.98.1"
FT                   /note="[synonyms] 8-hydroxy-5-deazaflavin-reducing
FT                   hydrogenase subunit beta identified by match to protein
FT                   family HMM PF03819 match to protein family HMM TIGR00444"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97593"
FT                   /db_xref="GOA:B6IQ57"
FT                   /db_xref="InterPro:IPR007516"
FT                   /db_xref="InterPro:IPR007525"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ57"
FT                   /protein_id="ACI97593.1"
FT                   /translation="MGISMDGNGPIWAPAVGDAVPRTLCTDCGISRTTTPGRCGHACQF
FT                   IRPDYAGMETQVHGRSRDPSRPGELHFGPFRRMVRAAMATPRPGAQWTGITTRIAERLL
FT                   ETGAVDAVLTMAPDPDDKWRPVPVLVTKPEGMARCRGMRMGYAPLLALLEPARERGYRR
FT                   LAVVGIPCQVHALRRLEAELGFERLYVIGIPCSDNTTTERFHQFLNLLSDRPETITYLE
FT                   FRADFYVELRFDDGRVKEIPFLLLPISKLPTDFFPLTCRTCVDYTNVLADITVGYMGGQ
FT                   GEQWLLVRNERGEELLSLLGDEVRLSEPGSAGKRQGPVKGFIENTKRAAGGLPLRQMPD
FT                   WLRPLVGWLMPKVGPKGLEFARARVEMKASETVLHLRREQPRRMKHMVPPHVWELVRPY
FT                   GLEAEPGERHDTAEPETADPETRA"
FT   gene            134406..134978
FT                   /locus_tag="RC1_0145"
FT   CDS_pept        134406..134978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0145"
FT                   /product="transcriptional regulator, MarR family protein"
FT                   /note="identified by match to protein family HMM PF00376"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97594"
FT                   /db_xref="GOA:B6IQ58"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ58"
FT                   /protein_id="ACI97594.1"
FT                   /translation="MKCAPTTLYAATASGTSPPVLRRSGGPDPRIRSPLVVPEFLPFRF
FT                   GSIFSKMVFDSTRAPEIYEGLSLRAWRVLALLASYPDITNAEMSALFGMDTATVTRAVA
FT                   ELKSKGLITTNRDPSDRRRVQNRLTDAGAALHDRIAPARIARGRRYEACFTPEELTQLH
FT                   RLLDKLSRHVDAIFIEEWREERRRAAV"
FT   gene            135041..135364
FT                   /locus_tag="RC1_0146"
FT   CDS_pept        135041..135364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0146"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97595"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ59"
FT                   /protein_id="ACI97595.1"
FT                   /translation="MIVSTTGSVPGQDGYQILGVVGGEAVLGTNFLRDMFAGIRDIFGG
FT                   RSGGYQKAMREAKEHAIDDMVDQAKRMGADAIIGVTLIPYAIASDKDKMLAISASGTAV
FT                   RFR"
FT   gene            135389..136102
FT                   /locus_tag="RC1_0147"
FT   CDS_pept        135389..136102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0147"
FT                   /product="fumarylacetoacetate (FAA) hydrolase, putative"
FT                   /EC_number="3.7.1.5"
FT                   /note="identified by match to protein family HMM PF00441
FT                   match to protein family HMM PF02770 match to protein family
FT                   HMM PF02771 match to protein family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97596"
FT                   /db_xref="GOA:B6IQ60"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ60"
FT                   /protein_id="ACI97596.1"
FT                   /translation="MQSLAIQPLFDPGPRPTLAIVGRPERFPVRRIYCVGRNYAAHARE
FT                   MGGDPDREPPFFFQKPADAVVADGADVPYPPRTDDLQHEVELVVALGRGGRNIPVAEAG
FT                   ALVFAQAVGIDLTRRDLQAAARKAGKPWDTAKAFDHSAPVGILHPVGPAGPLTRGRIWL
FT                   AVNGDRRQQADLADMTWSVAEVIAELSTLFDLAPGDLIFTGTPSGVGSLLPGDRIDAGI
FT                   DGLEPLVTRIVPPVA"
FT   gene            complement(136320..136487)
FT                   /locus_tag="RC1_0148"
FT   CDS_pept        complement(136320..136487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0148"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04422
FT                   match to protein family HMM PF04432"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97597"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ61"
FT                   /protein_id="ACI97597.1"
FT                   /translation="MEPDPSIESLQRQHAALEAQIMAETGHAYYDSVAVRQMKLEKLRL
FT                   KEELDRLRRH"
FT   gene            complement(136604..137887)
FT                   /locus_tag="RC1_0149"
FT   CDS_pept        complement(136604..137887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0149"
FT                   /product="AMP-dependent synthetase and ligase, putative"
FT                   /note="PF00501 With a good score above the trusted cutoff
FT                   and uncharacterized homologs; identified by match to
FT                   protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97598"
FT                   /db_xref="GOA:B6IQ62"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ62"
FT                   /protein_id="ACI97598.1"
FT                   /translation="MPASGRLTDLLEAGASINPAAPALVEDGRVLSHMDLLVHVDALAS
FT                   LLQRWLGPGDRAPTGRIGPRVGVCALNSIRHVTAFLAILRAGAVWVPINPHDGREVNRT
FT                   LVRQADLDLLLVEADCAECVGTGSVSALLIDEGGELDRHLNRTLGDRPGTVPEGAEDIV
FT                   CIRFVGTQGGRSRGVLLPARSFLSVQRTLERLFAPVAADISLLAAPLSEDAAHFILPVL
FT                   GAGGTHRLLRHAGPAGILDALRQEVTLAYLPPAYLPLLLGERDFAPSDFPALRHLACGT
FT                   EGLLPDLTALALERFGPRLAVLFGLPEAPLTISTLGAAEMEEAGLRATVGPACEDSRIA
FT                   LLGPDGVLRQEPGAAGEVLVTGDLVMAGYLDAPVETEAAFHEGWLRTGEVGTLDDRGHL
FT                   TLGTMDVSPSAGRQDGWPVDRPRHTVKA"
FT   gene            complement(138273..139151)
FT                   /locus_tag="RC1_0150"
FT   CDS_pept        complement(138273..139151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0150"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01906"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97599"
FT                   /db_xref="GOA:B6IQ63"
FT                   /db_xref="InterPro:IPR006879"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ63"
FT                   /protein_id="ACI97599.1"
FT                   /translation="MTDASGKGYPILLCADDYGLSPGVSCAILRLALDGRISALSCMTV
FT                   GPSWPEDAAALEPAYGRVDVGLHLCLTALPPLGTMPVLAPEGRLPGLGALIRAALLRRL
FT                   PLGEIAAELERQFDAFVAATGRLPDFLDGHQHVHQLPGIRGLVLDLFRRRLDPARHYVR
FT                   NCYEPPGAILRRGVAPARTLVLSALAAGFPTDAARTGVPCNDGFRGVHAFDPADDPASR
FT                   FDRLLSGVRGRVLVNCHPGLVDDLLRAVDPVHAPREAEYRFLSGGAFPRLLAARGLRLA
FT                   RFADLMRESSD"
FT   gene            139120..140310
FT                   /locus_tag="RC1_0152"
FT   CDS_pept        139120..140310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0152"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /EC_number="2.4.1.-"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97600"
FT                   /db_xref="GOA:B6IQ64"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ64"
FT                   /protein_id="ACI97600.1"
FT                   /translation="MGYPFPLASVTVPSLIEASRNNRIRPSGTSAMPTAPDTVSPSSPT
FT                   GKRPLLSAILPMYNEAGNLARLFERLEGVLGRLRMDYEIICIDDGSRDGTFEALLFHRL
FT                   RNPRIKPVRLSRNFGKEAAMAAGLERAAGAAVVLLDSDLQHPPELIEAMVAHWRDGAEM
FT                   VYARRTSRDTDGWLRRTLTRAYYRLYRALSEVDLPPGAGDFRLLDRRVVDAIIAMPERR
FT                   RFLKGMMAWVGFRQVAIPYEPEARHAGSSTWNFWRLFTLAFDGLASFTTLPLRIWSVIG
FT                   LFVALVAMAYGGVIAVRTLVYGVDVPGYASLMVATLFLGGVQLICLGVLGDYLGRVFEE
FT                   VKRRPVYLVAEAAGFGEAEQTAAKASPPVLADPAVPEPARERSSDTASLTLASQRS"
FT   gene            complement(140266..141669)
FT                   /locus_tag="RC1_0151"
FT   CDS_pept        complement(140266..141669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0151"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97601"
FT                   /db_xref="GOA:B6IQ65"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ65"
FT                   /protein_id="ACI97601.1"
FT                   /translation="MDGWKDSLRTVLLVGLGALPLLGPALWNGYPLFFFDSFEYVPLPF
FT                   TGELPVYRTAGYGLFAWIGRLTGSLWPIIVVQCLLVAFVLLAFARAVAGVGRSGAAYAV
FT                   LLAAAAAGGLPWYTGQVMADGLTGAVILGLLTLLLFRDRLPLSWATLVAAVVAVGIASH
FT                   TSHVGIAGGLLLLGFAAAALGRLRPGWLPPVRTGLPAVTLAAGLMLAVGANWTATGRLF
FT                   LVQPSTVQTLALFVENGLAARYLDAVCPGREPPPHALCAHRGALPHSANEFLWGHSPFR
FT                   ALGGWDGLRPEAEAIVDGVRSRYPGALLWQSARFTGRQFAMMRLGDGLVPMQFLMRGPV
FT                   AEHYPAELAAFEAARQQQGEITFPFWNPLLSVLWWGGLGGLVLLVAGRWRAGCRRQSIL
FT                   ALGVLAALAGNAFICGALSNPNQRYQGRLAWMPVALVGLLLTAGDGRGAVAPAVSGALR
FT                   GEGERRRIG"
FT   gene            142057..143181
FT                   /locus_tag="RC1_0153"
FT   CDS_pept        142057..143181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0153"
FT                   /product="phosphatase, Ppx"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97602"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ66"
FT                   /protein_id="ACI97602.1"
FT                   /translation="MESDQGQSYHAQDGHVQAGQAAAARFDAAGWDAVGREGDGTAAIG
FT                   PEPAGAMVPRPGPVFAALDVGTNNCRLLIARPARGGFRVVDAFSRIVRLGEGLSRTDRL
FT                   SDEAMGRTLSALKVCRSKIRRRGVTALRAVGTEACRRADNGAEFLERVESETGIHVEII
FT                   SAGEEARLALAGCAPLLDPALARAAVFDIGGGSTELMWLELRRGRPHLIDQISVPLGVV
FT                   GLTERFGGDRVSPDSYRGMVEEMREALRPFARRNALAREVARGRVQMLGTSGTVTTLAG
FT                   IRMGLPRYDRSRVDGTWLSRVDATAIAGDLRALDFQGRASHACIGRDRADLVIAGCAIL
FT                   DGIWETLPVPRLRIADRGVREGILAELAAAARQR"
FT   gene            143344..144027
FT                   /gene="rrmJ"
FT                   /locus_tag="RC1_0154"
FT   CDS_pept        143344..144027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rrmJ"
FT                   /locus_tag="RC1_0154"
FT                   /product="ribosomal RNA large subunit methyltransferase
FT                   J,RrmJ"
FT                   /EC_number="2.1.1.-"
FT                   /note="PF01728TIGR00438; ribosomal RNA large subunit
FT                   methyltransferase J; With a good score above the trusted
FT                   cutoff and characterized homologs"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97603"
FT                   /db_xref="GOA:B6IQ67"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR010311"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ67"
FT                   /protein_id="ACI97603.1"
FT                   /translation="MRVKTAHRRSLSSTRWLERQLNDPYVAEARKRGYRSRAAFKLLQL
FT                   DEKFHFLRRGQRIVDLGAAPGGWTQVAVAVVKPGEGSTGKVVGLDLLEVEPVPGATIIQ
FT                   LDFLDASAPDRLKELLGGQADIVLSDMAANTTGHPATDHLRIIGLAEAAYDFAADVLAP
FT                   GGAFVCKLFQGGATKGLLDLLKRDFATVRHAKPPASRADSSETYVVATGFRGSSSADDR
FT                   GGAEV"
FT   gene            144243..145733
FT                   /gene="guaB"
FT                   /locus_tag="RC1_0155"
FT   CDS_pept        144243..145733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="RC1_0155"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97604"
FT                   /db_xref="GOA:B6IQ68"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ68"
FT                   /protein_id="ACI97604.1"
FT                   /translation="MTSIGGRVTSGDRFREALTFDDVLLVPAESSVMPAEVSTRTRLTR
FT                   SIELGIPLLSAAMDTVTESALAIAMAQAGGIGVVHRNLDIARQAEEVRKVKRFESGMVV
FT                   NPITIHPEATLADALDLMARHRISGIPVTDAAGRLVGILTNRDVRFATNPQQPISELMT
FT                   KDRLVTVKEGVDRAEAKRLLHQYRIEKLLVVDEAYRCVGLITVKDIEKAQLHPNACKDE
FT                   KGRLRVAAATGTGPDGFKRAEALFDAEVDVLVVDTAHGHSTKVAAAVTAARKLSNYTQI
FT                   VAGNVATAEGARSLIDAGADAIKVGIGPGSICTTRIVAGVGVPQLTAIMDVVEECHRQG
FT                   IPVIADGGIKYSGDLAKAIAGGADVAMLGSLFAGTDESPGEVILFQGRSYKSYRGMGSV
FT                   GAMARGSADRYFQAEVSNTLKLVPEGVEGRVPYKGPIGAVIHQLVGGLRAAMGYTGCAT
FT                   IQEMQTKTRFVRITNAGLRESHVHDITITNEAPNYRPG"
FT   gene            145882..147252
FT                   /locus_tag="RC1_0156"
FT   CDS_pept        145882..147252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0156"
FT                   /product="tRNA and rRNA cytosine-C5-methylase, putative"
FT                   /note="Has few homologs With this identity non of which is
FT                   characterized; identified by match to protein family HMM
FT                   PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97605"
FT                   /db_xref="GOA:B6IQ69"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ69"
FT                   /protein_id="ACI97605.1"
FT                   /translation="MTPAARIQAAIDLLSEIEATPRPADALVSQFFRNRRYIGAKDRQG
FT                   VAGLVYSVLRHRGRLGWWLDRCNVMPTPRALLLAEAVLVQGRRADSVSGLFNGAKFGPE
FT                   PLNDSERRLLKAVDTHTIDHPKQPEALALEVPEWAEAPLRAAFGDRFHAEMAAMLGEAP
FT                   LDLRANPLKAAREQVQAALAEAGVTAAPTGLSPLGLRVQGRAPVSALPAFREGLFEIQD
FT                   EGSQLVALLADPRPGMQVVDFCAGAGGKTLAIAAMMDNKGRVVASDVLEGRLTRAKERF
FT                   RRAGLHNIETRALSSERDPWVKRHKGKFDRVVVDAPCSGTGTWRRNPDSRWRPLGPGLA
FT                   ELLPLQAAILDSAARLVRPGGRLVYATCSLLPEENERQVEAFLANHPAFRLLPVAEAWP
FT                   ENLGAAPVTGDTLRLTPARHDTDGFFAAVMVREEAAEATEAATSDAAGTEPPPAADV"
FT   gene            147392..148135
FT                   /locus_tag="RC1_0157"
FT   CDS_pept        147392..148135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0157"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02541"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97606"
FT                   /db_xref="GOA:B6IQ70"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ70"
FT                   /protein_id="ACI97606.1"
FT                   /translation="MPLLTRLLAPLALLLVVGVILLPRPAGAFRLVPIEMEFEPAGRGA
FT                   TQIFQLQNDNADPVAVEITIKARAMDRDGQDVLTDAGDDWVIFPEQIILQPGESQSVRV
FT                   QWIGPATPDRELAFRLIAEQLPIDIGRPPARGGQVRLLVNYIASLYVMPAGVRADVGVV
FT                   SAQEIATPDGRRLELVLRNGGTTRKPLNEPTLTLKAGGTTVTLTPDRLGGLNGENMLAG
FT                   ATRRFLLPWPEKLPVGAVTASLSLP"
FT   gene            148135..150660
FT                   /locus_tag="RC1_0158"
FT   CDS_pept        148135..150660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0158"
FT                   /product="fimbrial usher protein, putative"
FT                   /note="identified by match to protein family HMM PF01728"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97607"
FT                   /db_xref="GOA:B6IQ71"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ71"
FT                   /protein_id="ACI97607.1"
FT                   /translation="MHRRPGRSTGRLLLAAVCIAVALLPPAALAADEPPPPVPAAAGKD
FT                   ALFDKVFGQRARATKLRQIDLPVRFDGQELGVVPARLSGDPRTAQVDIPRLAELLRDVA
FT                   QDAALDELRRLAGPDGFAVPAPPAPGRIEVAINAADLSVQVTVPPDIRRLVRIDVQGRS
FT                   DAARGYLVRPPADLSAYVNARAAIGYLSLPGGGVQDEGRGPLTVSLEGAVNLKGWVVET
FT                   DSYYREDGERRWSRGPTRLVRDFPDSGVRVQAGDLTYPVSGQQVGRPLSGLSVARNFSL
FT                   QPYRSVQPAGQRDFILETPSLVEVFVNGRPTRTLRLSPGPYNLANFPGASGTNDIQIRI
FT                   TDQFGREQTIEFPFFFDNQLLAGGIHEFGYTIGYPYTTDGDNLAYDRDRPTFSGFHRIG
FT                   LSDRLTLGAGLQADRQQQVAGAEMLLATPIGTLGVEPSVSFGAATGYAATLGYRDYRTG
FT                   DSFWQQRTTTAQISWRDSAYGSFGTLDPDNDIALDAAFRFSQPLAPDLTATLGGRWREN
FT                   REPERVDGYAMDLTLRRRLGRTASWDLTFSHDRDTDGERETGAYVSLRVSLDEGRHTAG
FT                   ASFDTVRREKRLDWRYQSLEPVDQLSLSLDATGASGSDRLQGSAGYVHQRFSAGVRHDV
FT                   VERTTGGTENRTQANFATALAYADGHVALSRPISNSFALVVPHPRLAGRTVGVDPVNGS
FT                   YLARTDGLGPPVVPNISAYLVRPLLLDVPEVPLGYDIGEDRPAVRPGYRTGTVVPVGTD
FT                   ATVSLDGSLTGPDGQPVALASGVLRPVGGPERQEIQFFSNRRGRFRVESVRPGRWELVL
FT                   VGVEARPVPVEVPADAEGVLPLGEVRLQP"
FT   gene            150754..151842
FT                   /locus_tag="RC1_0159"
FT   CDS_pept        150754..151842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0159"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97608"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ72"
FT                   /protein_id="ACI97608.1"
FT                   /translation="MPLRTLAELAHQVGAVIPFADTKLKFTRVRRGQDGLEALLPSLVG
FT                   GRETYVVQLIDLPRLFPLPLYDRMLLEEIVAEAALAPSSLRRAALTLDADGARGAVARQ
FT                   EAQARLAMDRTQEISAYFAALERLRDLLVPSLPPWEVETYDLRERGTNLRVNTLVEAAA
FT                   QRFGQDKRAVVALLERMARVLSPLMDFQVTQGHLASALYAVRSFVSDLARMRLGGSADG
FT                   QEVLSFVRMAGRETDRLVTPLLRQGQGMLQAVDAFLQRPDDMEAALSELVQTVEWSLDG
FT                   WTSLIDHWQTVDERTQLAAATLDQIAPNVPFLPLQVFATGSRDRGTALERGRARLTGLT
FT                   RTVAAGEVDTLSLDLLRRRRAG"
FT   gene            151853..152710
FT                   /locus_tag="RC1_0160"
FT   CDS_pept        151853..152710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0160"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97609"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ73"
FT                   /protein_id="ACI97609.1"
FT                   /translation="MSEPIRFFEDLDPPARQRLLRRLEKAGPDGLVPVENLLIRQHLRP
FT                   GLRRLRPERQRQPARVLLLPAEPFLVDAPVSGRLPLIPRAVLSPLIRRLAGAGLRLDGG
FT                   RSDGERPLDWSQPLSAADEPAARRVLAAHVARERDALATVAATGLGGDMAGARRAVAAL
FT                   ATCLCHADRIAGWCADVPAGPILWIDDPLADLLAAQFAQAERAEDGLGTLLLLLVARRM
FT                   QNPALLPAAFAAQARASAALAAASSAVVGEIAPVLAADALAFLDRPTVPEALAGIDFFR
FT                   VRHC"
FT   gene            complement(153096..154481)
FT                   /locus_tag="RC1_0161"
FT   CDS_pept        complement(153096..154481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0161"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase subunit A,
FT                   putative"
FT                   /note="PF01425"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97610"
FT                   /db_xref="GOA:B6IQ74"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ74"
FT                   /protein_id="ACI97610.1"
FT                   /translation="MPDKGQGRQGRMTDRVEGIPPVLRLEEQLSRIGRLDRELRAFALV
FT                   LPELAREAAWRLERGPGTGPLAGRTLAVKDLFDLRGVPTAAGARTPVVDEAPATATALD
FT                   HLLRAGMIPLGKAATVELAFGTWGINRATGTPRNPWDMTVARVPGGSSSGSAVAVAAGL
FT                   ADMALGSDTGGSIRIPCALNGISGIKTTVGRVSRAGVVPLSPTLDTVGPMAWSVAEAAA
FT                   LLEAMAGPDPADPATLERPGFGAAAALARSVRGCRLAVLGDADLASVADPVGAAYLEAL
FT                   SVLERQGARLQEVRPAVAPGACVEPTGRLIGAEGWRRWSDRVERFAPEMDPGTLARLQA
FT                   AASSTEADHARLLAARAADQGRFHAWMQDFDALLTPTVPVTAPPLDTADETTLPFSSFT
FT                   RMANWLDLPAVALPCGQSGEGLPVSLQVLALPWGEEAAVAVAHAFQQVTDWHRRRPPGL
FT                   PEE"
FT   gene            154598..155527
FT                   /locus_tag="RC1_0162"
FT   CDS_pept        154598..155527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0162"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97611"
FT                   /db_xref="InterPro:IPR007893"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ75"
FT                   /protein_id="ACI97611.1"
FT                   /translation="MFCSRLLHVTLLALLIAAVTPAAPAGAKTSNCKLKLRDLTRIEPQ
FT                   SGSYDPFAGTPPPQYHRFEVQHLNGPGCAFVIGVDAGSNGSRQMEEDGYRLSYGLYIDG
FT                   ALSQPLADAYGSPSGLLSGYVEDTKGRDAVELQFFSIIPAGQMVPADTYRDEVRFTLYE
FT                   WEDGTPGRILDSRDVQVRAKVREVFQASVRVGGISRPLAGVAGTLDLGELSNGAATTFD
FT                   LEVSGNAGYDVSLESENRGYLVSHDGGGSIPYGLTLDGRSVSLQRSVTLGFGGSGTAQH
FT                   GLTVTVPAASNALAGTYRDNLVLTVSAR"
FT   gene            155745..156146
FT                   /locus_tag="RC1_0163"
FT   CDS_pept        155745..156146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0163"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97612"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ76"
FT                   /protein_id="ACI97612.1"
FT                   /translation="MAGAAERGQITLRGTVPAVCTVALSASSATLEVVRGQSATPVATV
FT                   EERCNAAAGYTVSVTSRNGGQLRQEGAASGVSYAVSYDQVSSNSGALVAVRTPTGAARV
FT                   GTLAVEVPASPEAAAGDYVDVLTVSISAR"
FT   gene            complement(156375..156854)
FT                   /locus_tag="RC1_0164"
FT   CDS_pept        complement(156375..156854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0164"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97613"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ77"
FT                   /protein_id="ACI97613.1"
FT                   /translation="METIMQTLTRIAFATLVATAATASVAAAAQSGSTIQLRGTVAVNC
FT                   SVSVTDLNQALNISGGETNKQVGTVTETCNRGNGYKITVGSANAGKLVSGAAGTSPIMY
FT                   TTIYDGQSGNAGSLEILRSQAQFNKVSSVNVTIPASAQYIAGDYADTLTITIAAR"
FT   gene            157098..158738
FT                   /gene="zraR"
FT                   /locus_tag="RC1_0165"
FT   CDS_pept        157098..158738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zraR"
FT                   /locus_tag="RC1_0165"
FT                   /product="transcriptional regulatory protein ZraR"
FT                   /note="Member of the two-component regulatory system zraS"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97614"
FT                   /db_xref="GOA:B6IQ78"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ78"
FT                   /protein_id="ACI97614.1"
FT                   /translation="MARDPHRILIVEPSAALAQAFVTALRRDGHALDQADSIAAALDRL
FT                   AAAPADLVLLNLQVTDRPGLDGLKALCDRAARIIALTAQGSVQAAVEIMRAGAVDVLLL
FT                   PVGTEKLRGAVTAALEAGPPRLQGSVGPLQSAPPSPLPGPAAPAAAPAGEPLGYLGFIG
FT                   LSPQMQAVYRMIDAAAPSKATVFITGESGTGKEVCAESIHRRSPRTGGPFVAINCAAIP
FT                   KDLMESEIFGHVKGAFTGATADHAGAALQAHGGTLFLDEICEMDLALQAKLLRFLQTGM
FT                   VKKVGSEKLEPVDVRIVCATNRDPYAEVQAGRFREDLFYRLQVISIELPPLRDRGDDVL
FT                   LIARQFLIRFNQEERKRFRGFSLEAERILRDYAWPGNVRQLHNVVRNVVVLNEGEEIQP
FT                   FMLPPPLNKPTMIVPPMLSDPRWAAVAGPLAFQFGGGPKPPGLPTMPGLPGFPPAPAPA
FT                   DPVPQPDRETAAVPAPPDPVPAPAPQSLAAAFPPEAPERRIRPLWQVEQDAIDEAIRLC
FT                   GGNITRAAALLEINPCTIYRRRQRKRAAL"
FT   gene            158759..159079
FT                   /locus_tag="RC1_0166"
FT   CDS_pept        158759..159079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0166"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97615"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ79"
FT                   /protein_id="ACI97615.1"
FT                   /translation="MITEIRHIIFSNDELKLVFQTVPLDGFDPARRITRIEVMEGPPPS
FT                   VRIRSEAPGGPPSELDVEAYQLARLIVSYCRDKRIPLPKDALKTLHAQGEQLCFSIMST
FT                   LG"
FT   gene            complement(159081..159395)
FT                   /locus_tag="RC1_0167"
FT   CDS_pept        complement(159081..159395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0167"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97616"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ80"
FT                   /protein_id="ACI97616.1"
FT                   /translation="MAKRPALGAALKAAAGSKAVPKAAEAKRPDPAALAAAANPPEERR
FT                   YVPPPSRNGTAPVTVHLSPEGRKLLRQLALDEDTSVQALMVEAVNMLLAQRGKPEIAAP
FT                   "
FT   gene            complement(159525..160154)
FT                   /locus_tag="RC1_0168"
FT   CDS_pept        complement(159525..160154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0168"
FT                   /product="cobyrinic acid a,c-diamide synthase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97617"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ81"
FT                   /protein_id="ACI97617.1"
FT                   /translation="MTKVLSLISTKGGTGKTTIALNLAVAFREARKTVVVLDLDPQATA
FT                   TAWSDQREDEDELSVLSCQHGRLQAVLQAARDNRADIVIIDTAPHSEAAALAAAKAADL
FT                   ILMPLRPEIFDLRAMANTVEMIGVAKKQPTAVLNAVPVRGPKVQEARTALEELGLETAP
FT                   VTIGNRAAFGYAAIASQGVTEFEPEGTAATEVKALRKWVAKRLGAA"
FT   gene            160404..161471
FT                   /locus_tag="RC1_0169"
FT   CDS_pept        160404..161471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0169"
FT                   /product="glycosyl transferase family protein"
FT                   /note="identified by match to protein family HMM PF00072
FT                   match to protein family HMM PF00158 match to protein family
FT                   HMM PF02954"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97618"
FT                   /db_xref="GOA:B6IQ82"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ82"
FT                   /protein_id="ACI97618.1"
FT                   /translation="MRILALPRYDRLGASSRLRFLDFLPGLAATGIALRVSPFFDDAYL
FT                   RRQYAGLRPDRRAVAGHYARRFTALAGRRGHDLLWIEKEALPFLPLAVERAALSGVPYV
FT                   LDFDDAWHERYEGHPNPAVRRLLGGKLARLAGAAAAVLVGNGHLEDWAWRAGARRVVRL
FT                   PTPVDLARYPDRPPPTDGFRLGWIGTPSSAVHLALLAEPLRRLAAEGPLTLVTIGVAPV
FT                   ALPGVPEEFHPWTSETEGALLATIHAGIMPLADTPFTRGKSGYKLIQYMAAGRAAIGSP
FT                   VGENALIVRPEETGLLPGTEGEWLDALRRLRADPGFAARLGRAGRVEAATRFGLAVLVP
FT                   RLAETLRCAAEGERG"
FT   gene            complement(161475..161882)
FT                   /locus_tag="RC1_0170"
FT   CDS_pept        complement(161475..161882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0170"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97619"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ83"
FT                   /protein_id="ACI97619.1"
FT                   /translation="MMHRLAAALVVALAAGSVPTTLPALAQTEKASGFEGTFRVSGSTG
FT                   NGRDYRGEAKVVRTGDTYTIAWRIGTEHHFGTGIVSGGQLSAVFASGPHAPPGVAIYRP
FT                   TPDGRVIGVYTILGGTSTALETWEREATPAP"
FT   gene            complement(161970..163214)
FT                   /gene="expC"
FT                   /locus_tag="RC1_0171"
FT   CDS_pept        complement(161970..163214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="expC"
FT                   /locus_tag="RC1_0171"
FT                   /product="glycosyl transferase family protein"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97620"
FT                   /db_xref="GOA:B6IQ84"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR022623"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ84"
FT                   /protein_id="ACI97620.1"
FT                   /translation="MRILFIHQNFPAQYLHLAPALAARGHQCVALGMRDPVKLPGVQAF
FT                   RYKVGRGSSTAIHPWVSEFETKVIRGEGVLRACEAMKKNGFVPDVVCVHPGWGEALFLR
FT                   EVFPTARVLAYHEFYYAAEGQDVGFDPEFPMAGVDALARLHLKNTHLLLSLHLADAILS
FT                   PTEWQGSTLPPEFRPKLRVVHDGVNTDAIRPDPGVTVRLSDGTVLTTADPVVTFVARNL
FT                   EPMRGFHSFARSLPALQKARPDAQILVIGGDEVSYGAKPQDGVSYKERFMREVAGRIDP
FT                   SRIHFLGRVPYGQFIGLLQLSSAHVYLTYPFVLSWSLLESMAAGALVVGSATPPVQEVV
FT                   EHGRNSLLVDFFDPDAIAATVAEALDRREELRPLRAAARDTVVRRFDLNRVCLPRHIAL
FT                   VEALGTGQPLPTWAG"
FT   gene            complement(163278..164759)
FT                   /gene="manC"
FT                   /locus_tag="RC1_0172"
FT   CDS_pept        complement(163278..164759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manC"
FT                   /locus_tag="RC1_0172"
FT                   /product="mannose-1-phosphate guanylyltransferase"
FT                   /EC_number="2.7.7.22"
FT                   /note="Also called mannose-6-phosphate isomerase.Gene
FT                   symbol synonyms rfbM rfbM1 identified by match to protein
FT                   family HMM PF01656"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97621"
FT                   /db_xref="GOA:B6IQ85"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ85"
FT                   /protein_id="ACI97621.1"
FT                   /translation="MPNSIDAAVAEVMDGMSDAGRKQIQPVLLSGGTGSRLWPMSRERF
FT                   PKQLLALSGKRTMIQETALRVGDARAFRSPIVVCNQEHRFSVGEQLQSVGIEPAAIVLE
FT                   PVGRNTAAAAAIAARLAARDDPDALLLLLPADHVVQDRAAFGRAVEQAARAAAAGFLVT
FT                   FGVRPTSPETGYGYIKAGAALDGIAGVQRVERFTEKPSLAVAEAFVADGAHLWNSGMFL
FT                   FRAGTFLEELERHAPAVLAAADAALAAATRDLDFLRLDPEAFGRSPNLSIDYAVMEKTD
FT                   RAAVVPADLGWTDVGSWSALWEIGEKDADGNVVQGDVMLVDAHDNYIRSDGMLTAVLGI
FT                   DDAVLVVTGDAILLARRDRVQDVKGIVERLKQSGRTEPLEHRKVHRPWGSYESITSGER
FT                   FQVKCLTVKPGRKLSLQKHFHRAEHWVVVNGTALVTRDGEEMLVRENESVYLPLGCVHR
FT                   LENPGKVPLNLIEVQSGAYLGEDDIVRFEDTYGRV"
FT   gene            165362..165886
FT                   /gene="expG"
FT                   /locus_tag="RC1_0173"
FT   CDS_pept        165362..165886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="expG"
FT                   /locus_tag="RC1_0173"
FT                   /product="exopolysaccharide II synthesis transcriptional
FT                   activator ExpG"
FT                   /note="Gene symbol synonym Contains PF01047:
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97622"
FT                   /db_xref="GOA:B6IQ86"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ86"
FT                   /protein_id="ACI97622.1"
FT                   /translation="MMTKPNSPVAAVVNRQDPVTSVSVYTDIARVVERMQRRFHDVVRV
FT                   ELGRIGVDDISPMQVVMLMNIGNDELSVRDLMERGYYLGSNASYNLKHLVEQGYVDRGA
FT                   SQRDRRAARLRLSEKGQWLCNELRRLEGHQAGVLIREPRDAEDLETTYRTLRRLERLWG
FT                   DIIRYDGRNLD"
FT   gene            165959..167074
FT                   /locus_tag="RC1_0174"
FT   CDS_pept        165959..167074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0174"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97623"
FT                   /db_xref="InterPro:IPR019285"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ87"
FT                   /protein_id="ACI97623.1"
FT                   /translation="MDRLLREPGPHSRIETMAKLVADLEAGLLTQAEHRLALEVLGAFA
FT                   ADAEAEVRSAVAWQIHNSPLLTTDLADRLARDVARVAFPILRHVEMLTDELLLEIVAER
FT                   DPHKQLAIAGRRRVSAEVASALVETGNLVTVVHLLRNRGAHVAAATLERAVERFGQIRT
FT                   VADAVAARPELPLALVERLIAFVSEDIRRRLVDEHGLEPQLATRLAQRGREAATLRLLK
FT                   PLLLRAEDAELMARHLNWQGRLTPHFLFRALCGGDLPLFVAGMAERSGIAIGSAEMLVW
FT                   DDGALGLRTLFDAARIPAALYAPFRTAIRTAKESGFVGGLCEREAFQAEVLARLFEECG
FT                   DIEEREVDELLLQVCDQPGASPPDMLLPLRA"
FT   gene            167186..167620
FT                   /locus_tag="RC1_0175"
FT   CDS_pept        167186..167620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0175"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97624"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ88"
FT                   /protein_id="ACI97624.1"
FT                   /translation="MNHRSILDPALRDLPIRQAAYIAKLADQLDIRDDLEERRHLLYPV
FT                   VAAAAKDIEPVLEPAECAALAAAFLDVHAEGVARTLYSPAFLTEGTAAMKPWADRLLAA
FT                   IAGAILDRLKQGDMSIAPRKVWRFRADGSDPDFPYRDDGD"
FT   gene            167726..168328
FT                   /locus_tag="RC1_0176"
FT   CDS_pept        167726..168328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0176"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97625"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ89"
FT                   /protein_id="ACI97625.1"
FT                   /translation="MSRTSFFEKRRQIREPVQAGGALVDGIPCRVLNWSLNGLLLDGLD
FT                   RPMQPGRRFSADLDFVASSGERFSFPIEARVVRWQSEGRVAATYVCLDAQVARRILTHF
FT                   QPVPGPRLHGMEAEWRREAPPRPPPAAEPESAAMDDSVRLADTVLALKEISAIKSAFAR
FT                   RFHPDTAPRDAGYDLRVQLFKEFWEVLDGAEKRLKGR"
FT   gene            complement(168366..168608)
FT                   /locus_tag="RC1_0177"
FT   CDS_pept        complement(168366..168608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0177"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97626"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ90"
FT                   /protein_id="ACI97626.1"
FT                   /translation="MPHTAPISLTTELHLLLDQAAELADETGLARLREILLYLSEGAEI
FT                   KDYSVEVPQGLDHNPLFQRQLMLQHLLTTVAAGRC"
FT   gene            complement(168739..170259)
FT                   /locus_tag="RC1_0178"
FT   CDS_pept        complement(168739..170259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0178"
FT                   /product="PPE-repeat proteins (cell mobility)"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97627"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ91"
FT                   /protein_id="ACI97627.1"
FT                   /translation="MAEQGGYGPGGVAPVGNVGPVQRPVQTHPAVQAPHALVAARPAEL
FT                   PAGTVTVTGVLGAAGTDGLLPLTTSFGTLLLRPVPGAWPPELPAGSNLTVSLGSRGGVV
FT                   ITASTPATSPAMLQVERASALPTRVAGAEGSLASRAVGASEAALRGLLALSAAPAATQP
FT                   ASTPAVPPAALPGAVPTAAPGSPHAPAATPALLSVAGSIRGPTVAPTPVAALPSLPRGV
FT                   TAPASPVSIPALGRSLGGGTDDLLRQGAAVAARGAVTGQAAALGTGLTPEGRELLADLA
FT                   GGVEPEAAPRPDLLLAAALANPAVAARLGPLLPRPDRLGGLALLLYLFGARGGGLRAWT
FT                   GLEGLERSGKVGASLKRIEEAMTPTPRPTADGSVWSALLAPLLDPDGDGLSILLLASRQ
FT                   GPPEPLDGEEDEAGSPRPRVGRPVDFAVGAELSELGPVQILGRAGGLDLRLEISVGGLP
FT                   EPGLRQDFEAALAEALPAVSRLRVAWGTPPAKPELMPGGTLPRLDARL"
FT   gene            complement(170279..171304)
FT                   /gene="fliG"
FT                   /locus_tag="RC1_0179"
FT   CDS_pept        complement(170279..171304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliG"
FT                   /locus_tag="RC1_0179"
FT                   /product="flagellar motor switch protein FliG"
FT                   /note="Part of the C ring in the flagellar basal body of
FT                   many bacteria along With fliM and fliN.Rotor"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97628"
FT                   /db_xref="GOA:B6IQ92"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ92"
FT                   /protein_id="ACI97628.1"
FT                   /translation="MLPKIRSDYKSLTGLEKTAVILLALGEERGARLMERLEDDEIRDV
FT                   SYAMAGLGTVSGKVVERLIRDFSERFAGTGEILGGFDSTERFLARFLPSDRVQEILSEL
FT                   RGPAGRTMWEKLSNVNEQVLANYLRNEHPQTIAVVLTRIRPEHAAKVLGLLPGNLVQMI
FT                   VSRIIKMEAVPRDVLEDVEKTLRSEFMANYVRAHGHDSHAIMAEILNRTDKELFEQIMD
FT                   PLEKRMPESATRIKQLMFTFEDLARLDPQAIQTVIRNTDSERLAYALKGLDDPIQQVFL
FT                   ENMSERAAALLREEMDLLGAVRARDVEEARDAILRTTKLLAEEGQIVINRGSDSAAYLV
FT                   Y"
FT   gene            complement(171321..171650)
FT                   /gene="flhB"
FT                   /locus_tag="RC1_0180"
FT   CDS_pept        complement(171321..171650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhB"
FT                   /locus_tag="RC1_0180"
FT                   /product="flagellar biosynthetic protein FlhB, putative"
FT                   /note="Part of the flhB operon"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97629"
FT                   /db_xref="GOA:B6IQ93"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ93"
FT                   /protein_id="ACI97629.1"
FT                   /translation="MTHSRPPRQEARAAALTYEQGSDALPRVVASGRGAVAERIVDLAF
FT                   LHGVPVREDADLARVLAAIDPGTEIPPDAIMAVAEVLAHLYRLNRSLASDRSGPALTEP
FT                   KTDPA"
FT   gene            complement(171647..172450)
FT                   /gene="fliP"
FT                   /locus_tag="RC1_0181"
FT   CDS_pept        complement(171647..172450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliP"
FT                   /locus_tag="RC1_0181"
FT                   /product="flagellar biosynthesis protein FliP"
FT                   /note="Gene name synonym flaR.Part of the fliL operon; Type
FT                   III secrestion system; Export component integral to plasma
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97630"
FT                   /db_xref="GOA:B6IQ94"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ94"
FT                   /protein_id="ACI97630.1"
FT                   /translation="MKARATLLAAGAALLTTLLAAAPALAQSFSMDMGGTGDASFAGRM
FT                   VQVVALVTILSVAPGLLVMVTSFTRIVVVLSLLRSALGLQQTPPNMVLLGLALLLTAYV
FT                   MGPTLDRSWREGVQPMVDGQITEEQAFERIVEPFRDFMQAHVRPKDLELFRSFEAGTKS
FT                   GAAPAAGSAGPAPSTEEAASAPGLRTLIAAFVISELRRAFEIGFLLFLPFLVIDMIIAA
FT                   VLMAMGMMMLPPVIISLPFKIIFFVMVDGWLLVAGALVRSYGGVG"
FT   gene            complement(172447..172806)
FT                   /gene="fliN"
FT                   /locus_tag="RC1_0182"
FT   CDS_pept        complement(172447..172806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliN"
FT                   /locus_tag="RC1_0182"
FT                   /product="flagellar motor switch protein FliN"
FT                   /note="Part of the C ring in the flagellar basal body of
FT                   many bacteria along With fliG and fliM.Orgainization of
FT                   fliN in the C ring, see J Bacteriol; 2006
FT                   Apr188(7):2502-11; Rotor"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97631"
FT                   /db_xref="GOA:B6IQ95"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR012826"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ95"
FT                   /protein_id="ACI97631.1"
FT                   /translation="MTTQPASYTDTIAKPAGADAAATARPAAPEEPGQDRDELRAIFNV
FT                   PVNVQVVLGRTTMPVSQLLKLGRGAVVELNRKVGEAVDVFVNDRLIARGEVVIVDDGRL
FT                   GVTMTEIVKAELSLL"
FT   gene            complement(172855..173538)
FT                   /gene="fliH"
FT                   /locus_tag="RC1_0183"
FT   CDS_pept        complement(172855..173538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliH"
FT                   /locus_tag="RC1_0183"
FT                   /product="flagellar assembly protein FliH, putative"
FT                   /note="identified by match to protein family HMM PF01706
FT                   match to protein family HMM TIGR00207"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97632"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ96"
FT                   /protein_id="ACI97632.1"
FT                   /translation="MPRPFRFGTEFPPDLPPGSADVPPEPLRSTTTVGGFTEEDLESVR
FT                   DRAFRQGLEVGERNGFERGQQSARQAAEAQMAEALAGIEAALRRADETVGPFREQIERD
FT                   AVRVVSSLVTRLAPPLLDTVAEAELDTLVLDCLHAAVGTPRLELRLPPGSVERMREQVE
FT                   KMQAAAGFRGTVALIPDPSLPPGAATADWGTGGAVRDPKVVERRLSDAVAIAISRLTLR
FT                   GGPRA"
FT   gene            complement(173538..175259)
FT                   /gene="fliF"
FT                   /locus_tag="RC1_0184"
FT   CDS_pept        complement(173538..175259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliF"
FT                   /locus_tag="RC1_0184"
FT                   /product="flagellar M-ring protein FliF"
FT                   /note="Gene symbol synonym flaO.MS-ring protein mounting
FT                   flange for rotor"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97633"
FT                   /db_xref="GOA:B6IQ97"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ97"
FT                   /protein_id="ACI97633.1"
FT                   /translation="MPFGCGRTISATGLQKRKRFGAVVANLLQNLRALGQRRLMLLAAA
FT                   GAGVLLAVALVAFGLSRAPMGLLYAGLDDAEAGRILTQLQSMKVPYQVSGTGGAILLPQ
FT                   DQIARTRMLLAQQGLPSAGGAGYELFDEQGALGLTSFMQRLNKARALEGELARTIQTLN
FT                   GVKSARVHLSMPDGEAFAPGAAPAGASVVVRTVTGGLDRSQALAIRHLVAAAVPRLQPG
FT                   AVTVMDASGVVLAADGGATDGLALLHAEELRSATETRLARAIEEMLVPRFGPGNIRVRV
FT                   AAEIDLGRETLREQTFDPNSRVLRSTQTVEERESSLDRDTDQPTTVEQNLPLEAADAQA
FT                   PQGSRSESAREEETANYEISSILRERAQDAGEIRRLAVAVVVNGSYVPGADGKSVYQPR
FT                   SDEELSRIEHLVRTAIGFDDRRGDMVAVENLQFLAGPEEPVAAPATEPGLVGNDMVRLL
FT                   QWVVLGVVAVLVILLVLRPLVLRSKEVPAPAAAQAAAPPQLADATTPVAGQLTHEGSDL
FT                   VPAGEEGSQEMDDIVDLRSVEGGVSAAALRRLAGIVDEHPEESITVLRTWIYEGAS"
FT   gene            175370..175855
FT                   /gene="fliL"
FT                   /locus_tag="RC1_0185"
FT   CDS_pept        175370..175855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliL"
FT                   /locus_tag="RC1_0185"
FT                   /product="flagellar basal body-associated protein FliL"
FT                   /note="Gene symbol synonym flbO; identified by match to
FT                   protein family HMM PF00813 match to protein family HMM
FT                   TIGR01103"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97634"
FT                   /db_xref="GOA:B6IQ98"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ98"
FT                   /protein_id="ACI97634.1"
FT                   /translation="MSESTFERLTKKADEAQASRRRRLLLGAGAVVGAGVLGLLASVGS
FT                   REIGLWTDEAPPPAQAGWSAFVKLPDLTVNLRPTSKVKLLKIGVTLRTAPDKAAELATL
FT                   EPVLIDGMQDYLRQLDEHDLEGNAGLARLREGLLRRSRLLAAPVPVEDVLLRTMILQ"
FT   gene            175863..176921
FT                   /gene="fliM"
FT                   /locus_tag="RC1_0186"
FT   CDS_pept        175863..176921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliM"
FT                   /locus_tag="RC1_0186"
FT                   /product="flagellar motor switch protein FliM"
FT                   /note="Gene symbol synonym flbO.Part of the C ring in the
FT                   flagellar basal body of many bacteria along With fliG and
FT                   fliN; C ring target for Che Y-P binding peripheral;
FT                   identified by match to protein family HMM PF01052 match to
FT                   protein family HMM TIGR02480"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97635"
FT                   /db_xref="GOA:B6IQ99"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR001689"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQ99"
FT                   /protein_id="ACI97635.1"
FT                   /translation="MIDQPDETAPADEDEALVAWEAMVAGSEKTLSQTEIDRLLDVDDS
FT                   KSVRTRSVIDQIVNSSFVNYDRLPMLDVVFDRLVRLLNTSFRNLTSGTVEVTVQQIASV
FT                   RFGDYLSGIPLPSLIAVVRAEEWDNHCLLTVDSELIYSIVDILLGGRRSDPAPIDGRPY
FT                   TVIERALAERLIRTVLKDLGTAFSPLSAVGFACERVETTPQFAVITRSNNACISARFQV
FT                   ALDGRGGCVSLLIPYATLEPIRDLLLQMFMGEKFGRDSMWETHLKNELRRTSVDLSAVL
FT                   GQAQVSLTDLLAWKEGTQLVLDMRPDAQALLTCGHVPMFVGEMGQRNGNVAIRIDADLG
FT                   AQDEVIHGLLQR"
FT   gene            176902..177474
FT                   /locus_tag="RC1_0187"
FT   CDS_pept        176902..177474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0187"
FT                   /product="probable ATPase involved in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97636"
FT                   /db_xref="GOA:B6IQA0"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQA0"
FT                   /protein_id="ACI97636.1"
FT                   /translation="MASFNAELLQHGLNLGLALLFVGALVHLARLNQRLTALRGAQSEL
FT                   HGLLRSCSDNVDTAEKSIARLRTATQEMAVGLGRSLDEAERLKADIDATCAAARRLLAR
FT                   LEEGPAPAPFIAAVPEPRPVPPVAPVAAPAEPVVEADPAPKPAVATGAAEPRWVIRRQR
FT                   PAAPPAPEPKTGERAALRFFRETFRGL"
FT   gene            177508..178296
FT                   /gene="flaA"
FT                   /locus_tag="RC1_0188"
FT   CDS_pept        177508..178296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flaA"
FT                   /locus_tag="RC1_0188"
FT                   /product="flagellin protein FlaA"
FT                   /note="identified by match to protein family HMM PF01514
FT                   match to protein family HMM TIGR00206"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97637"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQA1"
FT                   /protein_id="ACI97637.1"
FT                   /translation="MSRPRLLPVMIAACALAAPLYAGGVADTLAALAQSAAAPPAQPPS
FT                   RQPEMAGEPGYADLLAPQGPSASVPDAQAGASAPLPAPVATAGACSPAVLDMVAQERAA
FT                   LDARARDLDNRAQTLEALERRAREQFERLQAARAELAGLLETRTSLSKADLQRLVGIYG
FT                   AMKPKDAARLLNETETPILVDLVDAMEERRSAPILAEMDAAKVNELTRTLALRRTPEAD
FT                   RPPVPKPARQPAPRTAARPATPVAAAAPVEASRPVPGPGM"
FT   gene            complement(178441..179562)
FT                   /gene="flhB"
FT                   /locus_tag="RC1_0189"
FT   CDS_pept        complement(178441..179562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhB"
FT                   /locus_tag="RC1_0189"
FT                   /product="flagellar biosynthetic protein FlhB"
FT                   /note="Export component integral to plasma membrane
FT                   substrate specificity switch Has a large cytoplasmic domain
FT                   thought to be the target for the docking of soluble export
FT                   components FliI, FliH, and FliJ; identified by match to
FT                   protein family HMM PF03748"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97638"
FT                   /db_xref="GOA:B6IQA2"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQA2"
FT                   /protein_id="ACI97638.1"
FT                   /translation="MSERPEDSQKTEEPTQRKLDEARRKGDVPVSREVSSMMLVLAGVI
FT                   LVGGLGSWMGGHLTDDLLPLVENPGDFPLQAPADAFRLLAWLAGEIGLVLLPAAAILLA
FT                   AVLLAAVGQNGIVFTTERLKPKLERISPIAGLRRLVSLRTLVEFLKGLAKVAAVGAALL
FT                   VVLEPELHRMEALALTDVAALPELLTSVLTRLLVATLIASIAIALLDLVWQQFSWRRQQ
FT                   RMTLQELKEEFRQAEGDPHVKARISQLRRERARQRMFSDIPRATVVITNPTHFAVALRY
FT                   DLSEAPAPVCLAKGMDLVARRIREAAMGHKVPIVENPPLARALHKSVEIGEEVQPEHYM
FT                   AVAEVISYVVGLQARSQGAAPTPPGQPGVPPAR"
FT   gene            complement(179581..180336)
FT                   /gene="fliR"
FT                   /locus_tag="RC1_0190"
FT   CDS_pept        complement(179581..180336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliR"
FT                   /locus_tag="RC1_0190"
FT                   /product="flagellar biosynthesis protein FliR"
FT                   /note="Part of the fliQR operon.Type III secretion system;
FT                   Export component integral to plasma membrane; identified by
FT                   match to protein family HMM PF01052 match to protein family
FT                   HMM PF02154 match to protein family HMM TIGR01397"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97639"
FT                   /db_xref="GOA:B6IQA3"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006303"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQA3"
FT                   /protein_id="ACI97639.1"
FT                   /translation="MTLQATLSGEIYGVLLVLVRVGAALSMLPGFGEMAVPMRTRMAAA
FT                   LALALALAAAVPGLPAVPPAGPGELLRHIVGEAMAGAVIGIGARILFAALQIAGQIIAQ
FT                   SASLSNIFALPGTGFEGGSVLGAYLMMGGLVLVFVTDLHHAMIRALLDSYQLMPAATIP
FT                   DPRSLGKLTAETVNLSFRLAVQFSAPFLLLGLAYNVGLGLVNRAMPHFAVFFVGLPVSI
FT                   LGGFIVLALVAAAILGGFLDAFGGWLGRF"
FT   gene            complement(180345..182414)
FT                   /gene="flhA"
FT                   /locus_tag="RC1_0191"
FT   CDS_pept        complement(180345..182414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhA"
FT                   /locus_tag="RC1_0191"
FT                   /product="flagellar biosynthesis protein FlhA"
FT                   /note="gene symbol synonym flbF.Part of the flhB operon;
FT                   Export component integral to plasma membrane Has a large
FT                   cytoplasmic domain thought to be the target for the docking
FT                   of soluble export components FliI, FliH, and FliJ"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97640"
FT                   /db_xref="GOA:B6IQA4"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006301"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQA4"
FT                   /protein_id="ACI97640.1"
FT                   /translation="MTTASAAIPLGLKHRDVLFALGLVFILTVLILPVPSWMLDVGLAL
FT                   SMAVAVLILMVALWINRPLDFSSFPTVLLIATLLRLALNLASTRLILSEGHTGTDAAGH
FT                   VIMGFANFVMGGNFVIGLIVFAILVVVNFIVITKGASRIAEVGARFALDAMPGKQMAID
FT                   ADLSAGLIEETEARRRRQELEQESSFFGAMDGASKFVRGDAVAGLIITGINVLGGMVIG
FT                   VAQQDMAFGDAARTYTILTVGDGLVTQIPALIVSLAAGILVSKGGNRGSVDEALLGQLG
FT                   AYPKALAVAGGLMGLLSLTPGLPMPPFLLLAALAGGLAWFLPRYAAKQEESKRHEEMLA
FT                   AKAPTAEEPVADMLRVDDIKVELGNGLVTLILDPAQGLSAKVRRLRKRFATEFGFLLPS
FT                   VRLRDSASLPLNAYEISIQGVVVAKGEVMPRKMLAIDPRGQGIDVPGADTREPTFGLPA
FT                   RWIDAAQTEEAELKGFTVVDADSVITTHLSEVIKEHMPGLLGYAATRKLLDEMDRENQR
FT                   LVADLIPGQVSLSVVQRVLQALLAERVSIRNLPIILEGISEAAAWTRNVTLITEHVRSR
FT                   LSLQICQSLMNAEGYIPVIVVNPDWEQAFLENIVEEGEDRRFVMPPSQVQDFLLAARAK
FT                   IQAHAGSDHWPAVLVAPAARPFVRSLLERVSPSTPVICHNELHRKAPVTTIDQI"
FT   gene            182373..182534
FT                   /locus_tag="RC1_0193"
FT   CDS_pept        182373..182534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0193"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97641"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQA5"
FT                   /protein_id="ACI97641.1"
FT                   /translation="MLEAEGDGGGGCGHRARRSGGGRSGRSLGPPGKTGVQARGPGPPT
FT                   TPSADARR"
FT   gene            complement(182503..183243)
FT                   /locus_tag="RC1_0192"
FT   CDS_pept        complement(182503..183243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0192"
FT                   /product="lytic murein transglycosylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97642"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQA6"
FT                   /protein_id="ACI97642.1"
FT                   /translation="MRALGEVGATRRIFVKRSRRRLRRLLLLAALLGLGLVAPGWALSE
FT                   PAILPATAPERLCLDAIRKAERAHRLPSRLLLALGVTESGRTVDGRLTVWPWTVNAEGQ
FT                   GRFFKSREEALTHVRALRARGVRSIDVGCLQVNLHWHPDAFPDLETALDPAANVGYAAA
FT                   LLKNLHGDLRNWTRSVKHYHSRTPERGEAYFDRVSENMRLVAQRRRDLADAPPTRQRTT
FT                   PTPGGTVVRPVTDSLSAWRLPKAW"
FT   gene            complement(183240..183506)
FT                   /gene="fliQ"
FT                   /locus_tag="RC1_0194"
FT   CDS_pept        complement(183240..183506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliQ"
FT                   /locus_tag="RC1_0194"
FT                   /product="flagellar biosynthesis protein FliQ"
FT                   /note="Part of the FliQR operon.Type III secretion system;
FT                   Export component integral to plasma membrane; identified by
FT                   match to protein family HMM PF01311"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97643"
FT                   /db_xref="GOA:B6IQA7"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006305"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQA7"
FT                   /protein_id="ACI97643.1"
FT                   /translation="MNEADVFELVRAGIWAAVWAAGPVLAVALLVGFGISLLQALTQLQ
FT                   EATLSFVPKIVAMLVTIVLALPFMYGVLATFTEQVVARIGGAP"
FT   gene            complement(183516..183830)
FT                   /gene="fliE"
FT                   /locus_tag="RC1_0195"
FT   CDS_pept        complement(183516..183830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliE"
FT                   /locus_tag="RC1_0195"
FT                   /product="flagellar hook-basal body complex protein FliE,
FT                   putative"
FT                   /note="Part of the proximal rod With flgB and flgC.MS-ring
FT                   rod junction protein export gate periplasmic space;
FT                   identified by match to protein family HMM PF00771 match to
FT                   protein family HMM TIGR01398"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97644"
FT                   /db_xref="GOA:B6IQA8"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQA8"
FT                   /protein_id="ACI97644.1"
FT                   /translation="MIVPAAGVAKAYAAGKVAGIAGPALDTATAPERGSFAGFVETAVK
FT                   SAIKTVRTGEEMSAAGLQGKASAQEVVQAVMSAEMTVQAVVTVRDKLVSAYLDIMRMGI
FT                   "
FT   gene            complement(183850..184263)
FT                   /gene="flgC"
FT                   /locus_tag="RC1_0196"
FT   CDS_pept        complement(183850..184263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /locus_tag="RC1_0196"
FT                   /product="flagellar basal-body rod protein FlgC, putative"
FT                   /note="Part of the proximal rod With fliE and flgB"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97645"
FT                   /db_xref="GOA:B6IQA9"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQA9"
FT                   /protein_id="ACI97645.1"
FT                   /translation="MDPLASSFGIAASGMKAQATRLRVVAENMANASSTGETPGADPYR
FT                   RKTIVFDSVLDRALRADTVRVKTIGRDSSDFRLSYEPGHPAADAKGYVKLPNVNTLVEM
FT                   MDMREAGRSYEANLNVLQQARGMLGRTIDMLRG"
FT   gene            complement(184293..184688)
FT                   /gene="flgB"
FT                   /locus_tag="RC1_0197"
FT   CDS_pept        complement(184293..184688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgB"
FT                   /locus_tag="RC1_0197"
FT                   /product="flagellar basal-body rod protein FlgB, putative"
FT                   /note="Part of the proximal rod with fliE and flgC
FT                   transmission shaft periplasmic space"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97646"
FT                   /db_xref="GOA:B6IQB0"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQB0"
FT                   /protein_id="ACI97646.1"
FT                   /translation="MDLAAIGLFHLASRRMDYLGARHQVIAENVANANSPGYRAKDLKG
FT                   FDFQSAMQSAAVRPSLTDPAHLAGLREARDFKEDRQAAAYEMAPDGNGVVLEEQMMKAA
FT                   EVRQAYDLAAGLFQKHVGMLRQAFTGR"
FT   gene            184881..186266
FT                   /gene="fliI"
FT                   /locus_tag="RC1_0198"
FT   CDS_pept        184881..186266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliI"
FT                   /locus_tag="RC1_0198"
FT                   /product="H+-transporting two-sector ATPase FliI"
FT                   /EC_number="3.6.3.14"
FT                   /note="Part of the type III secretion system; identified by
FT                   match to protein family HMM PF01313 match to protein family
FT                   HMM TIGR01402"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97647"
FT                   /db_xref="GOA:B6IQB1"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR022426"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQB1"
FT                   /protein_id="ACI97647.1"
FT                   /translation="MTVLAGLAADVQHLPGPVFHGKVSSCSGMTVEVEGLERRLAVGDA
FT                   CRVFARDGRALACEVIGFSVGRAVLMPFGPLDGLGLGCRVETGGEPASFRPALSWLGRV
FT                   VDGFGRPVDGRGPLSRGDENRVLRAAPPHAYERRRIGPRLETGLRVVDTFVPLCRGQRL
FT                   GVFAGSGVGKSTLLAMLARSSAADVNVIGLIGERGREVQEFIQDDLGPEGLARSVVVVA
FT                   TSDEPALMRRQAAWLTLGLAEYFRDQGRDVLCMMDSVTRFAMAQREIGLSAGEPPTTKG
FT                   YPPTVFAELPRLLERAGPGREGTGDITGIFTVLVEGGDHDEPVADAVRGILDGHLVLTR
FT                   SIAERGRYPAADVLKSVSRALPGCHSEEENLTMGRARALLARYESMEELVRLGAYKAGS
FT                   DPELDLAIKANEPLENFLRQGKTETTASADAFARLQGILDGLVPEAPLPEAPMQKRLPR
FT                   LAG"
FT   gene            186790..188337
FT                   /locus_tag="RC1_0199"
FT   CDS_pept        186790..188337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0199"
FT                   /product="phosphate transporter family protein"
FT                   /note="identified by match to protein family HMM PF02049"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97648"
FT                   /db_xref="GOA:B6IQB2"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQB2"
FT                   /protein_id="ACI97648.1"
FT                   /translation="MQDIMGEMPSQLRKQALDKDLKKISALETVGHEGRLRLLPLGFSL
FT                   IFLVLVWLLATNQVLPGSGAGLVIAAAVIGGYMALNIGANDVANNMAPAVGARALTMTG
FT                   ALVVAAIFEAAGALIAGADVVETISRGIINPAAVSGNATFVALMMAALLGAALWLNLAT
FT                   WIGAPVSTTHSIVGGVLGAGITAAGFDVANWPVMGAIAASWVISPLLGGLIAAGFLAIL
FT                   NALILQADDRIAAARRWVPLIVGGTASAFTVYLVQKGLSKVWHPGTGTLVLLSVAILLA
FT                   GAQFARMAIARRAPFLDNSEKAVGTLFTVPLIVAAALLSFAHGANDVANAIGPLAAIAA
FT                   AVGGESGTKVTVPSWIMLIGAIGISVGLALFGPRLIRVVGEKITKLNPVRAFCVALSAA
FT                   ITVLVASALGLPVSSTHIAVGAVFGVGLAREYHVSRGGHIRRALRLRGGDGPAPAAPSE
FT                   PVVYPVPEETLRKVAKRRLVRRSHLLTIVAAWVITVPLTALISAALFLAIRSFVAGI"
FT   gene            complement(188355..188807)
FT                   /locus_tag="RC1_0200"
FT   CDS_pept        complement(188355..188807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0200"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97649"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQB3"
FT                   /protein_id="ACI97649.1"
FT                   /translation="MDKEMRARISRRERQRRWRQRNLEDRSGRRGTSVVAHLNDIEIAL
FT                   LDKLAIDDYRRRPCGRTDAADLSPPSRSRAIRLLIRRLLDLDLVDPADLGPLIPLKEEL
FT                   GEFWSREACWRRASRERRQGLDDDGRDAIEQPEPPWVPPDAAARRD"
FT   gene            complement(188885..190411)
FT                   /locus_tag="RC1_0201"
FT   CDS_pept        complement(188885..190411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0201"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97650"
FT                   /db_xref="InterPro:IPR010626"
FT                   /db_xref="InterPro:IPR023157"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQB4"
FT                   /protein_id="ACI97650.1"
FT                   /translation="MSVVGFGAATVSGGTGSSITQWRLLGRTADRQKTVMMSDPVNKAD
FT                   TQYARAKLASVGTVDELMSDRRLYSYVMRAFGLEDQINSQALVRKILTSDLSDPSSAAN
FT                   RIADPRFRELAAAFNFGADSKSKSKTSPSFINQIADLYVRERYEESVSSKNESLGMMLD
FT                   FTRNLPTKRSWAEVMADEGMAQVVRIIYDLPKPIGPVDAAEQAKSLEATIKFSVFTTVT
FT                   SVQSAFRDDFFDVWDANGNPRGSSIPSKVQWEMLARSYDREKAAFATRYDVKSDVAALT
FT                   KTIPTLDSVDDLLNDRKLLPIVLKAFDLEDKATDKTYLRKVLESDPNSATSFAAKAGPE
FT                   EKALALAFGMTNSGAKRRGSPAFVEDIVNRYTTQSFEVSAGNANEALRLGLYFQRKAGG
FT                   LTSWYQVLADQALAKVARLALNLPSQSAQIDLDRQVDMLSSKLDIKKLQDPAEVGKLIE
FT                   KFLLMWDVTGEDNGNSAAASPLVQLLSGNGGRTSLDPSTLLAAASLRRRW"
FT   gene            complement(190408..190734)
FT                   /locus_tag="RC1_0202"
FT   CDS_pept        complement(190408..190734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0202"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97651"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQB5"
FT                   /protein_id="ACI97651.1"
FT                   /translation="MSERKAVEGVSASEAATKMRLPERVVTEARTREAREEKPPEPPPP
FT                   PIEPSPSYRPYRVQLDPETSRLFTEVIDPRTGHVLLRIPPSYVPSDETSEAPEARVVRK
FT                   EIEL"
FT   gene            complement(190786..191223)
FT                   /gene="flbT"
FT                   /locus_tag="RC1_0203"
FT   CDS_pept        complement(190786..191223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flbT"
FT                   /locus_tag="RC1_0203"
FT                   /product="flagellum biosynthesis repressor protein FlbT,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF01384"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97652"
FT                   /db_xref="GOA:B6IQB6"
FT                   /db_xref="InterPro:IPR009967"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQB6"
FT                   /protein_id="ACI97652.1"
FT                   /translation="MGLKLKLKPFEKFIVNGVVIENGRHRNTVTVANHAQVMTGRSIMQ
FT                   LEEANSPARRTYFAIQCMLIDPPRMAEHRRTYEMLIGPLSEAVTDTEMARHLAEAAAHV
FT                   RDGDHYKALAALRPVIAYETGLLDDDRRPAGMTLPEAFAGG"
FT   gene            complement(191236..191610)
FT                   /gene="flaF"
FT                   /locus_tag="RC1_0204"
FT   CDS_pept        complement(191236..191610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flaF"
FT                   /locus_tag="RC1_0204"
FT                   /product="flagellar protein FlaF, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97653"
FT                   /db_xref="GOA:B6IQB7"
FT                   /db_xref="InterPro:IPR010845"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQB7"
FT                   /protein_id="ACI97653.1"
FT                   /translation="MRTETMSVAAYRQSMRDTVSPRQLEHRVFSQVTAELEVCTRQPDA
FT                   FATIRAVDRNRRLWGALVTDLAQPDNLLPDALKAGLISLGLWVNRYSSEVLTEGRPLNP
FT                   LIEVNRTVMQGLGSAPAGAA"
FT   gene            complement(191765..192631)
FT                   /gene="flaB"
FT                   /gene_synonym="lafA"
FT                   /locus_tag="RC1_0205"
FT   CDS_pept        complement(191765..192631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flaB"
FT                   /gene_synonym="lafA"
FT                   /locus_tag="RC1_0205"
FT                   /product="flagellin protein FlaB (LafA), putative"
FT                   /note="identified by match to protein family HMM PF06748"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97654"
FT                   /db_xref="GOA:B6IQB8"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQB8"
FT                   /protein_id="ACI97654.1"
FT                   /translation="MGASSILTNTGAMVALQTLNRTSKDLQTVQDRISTGMKVATAKDN
FT                   SSYWGIATTMKADVSALKALNENISINAATVQTARVGTENIQNLLSQVKSQLALATTAS
FT                   VDHSKITAELTSLQNQITNTINAASYNGENLLNNTTARTLVVSINRSATGISAVTDSVS
FT                   GVDLTAVATAVGGYVTAITGGADAAAKAAAANTALTDATTGVEAQITTVVNAASSFGNI
FT                   GKRLELQADFTSKLIDSLNEGIGTLVDANLNEESARLQALQVQQQLGIQALSIANGAPQ
FT                   NILSLFR"
FT   gene            complement(192862..193425)
FT                   /locus_tag="RC1_0206"
FT   CDS_pept        complement(192862..193425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0206"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97655"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQB9"
FT                   /protein_id="ACI97655.1"
FT                   /translation="MDVDTLPPDLRQRLRDAFDTLADLLDEETGRVARADAEELKLYTE
FT                   AKHALFEQLGILLKEANRPQQPVLPGPVVETGTAVLAMPETSAPGPGRAEETDVSAADG
FT                   AGEKSPPEPPVDDPAAVRAAASRLRGAVETNRRAIRAAQDAVSAVAGHIAAAVERSRSD
FT                   GVYGRSGQARRAVTPSFARVEREL"
FT   gene            complement(193430..193729)
FT                   /gene="cheL"
FT                   /locus_tag="RC1_0207"
FT   CDS_pept        complement(193430..193729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheL"
FT                   /locus_tag="RC1_0207"
FT                   /product="chemotactic signal-response protein CheL,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF07378"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97656"
FT                   /db_xref="InterPro:IPR019301"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQC0"
FT                   /protein_id="ACI97656.1"
FT                   /translation="MTHVSPLAATPAGVAARPNDPAWKTAKAFEGMMMSQMLEAMFAGL
FT                   STDGPFGGGFAEETYRGLLLENYGSAMAGGNGAGTGIAEAVYAQINAYRQAKES"
FT   gene            complement(193729..194862)
FT                   /gene="flgI"
FT                   /locus_tag="RC1_0208"
FT   CDS_pept        complement(193729..194862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgI"
FT                   /locus_tag="RC1_0208"
FT                   /product="flagellar P-ring protein FlgI"
FT                   /note="Gene symbol synonym flaP.P-ring protein part of
FT                   bushing internal disulfide bridge periplasmic space;
FT                   identified by match to protein family HMM PF07309"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97657"
FT                   /db_xref="GOA:B6IQC1"
FT                   /db_xref="InterPro:IPR001782"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQC1"
FT                   /protein_id="ACI97657.1"
FT                   /translation="MDARRSGQRALAVVLAFLLSVLPSAGPAFAQMRIKDLVEVEGVRS
FT                   NQLIGYGLVVGLDGTGDRLQNSPFTQQSLEGMLERMGVNITGLNVKTRNVAAVMVTAEL
FT                   PPFARQGSRLDVSISTMGDATSLLGGSLLATPLIGADGSVYAVAQGSVAVGGFSARGEA
FT                   ASVTKGVPTAGRIPNGGIVEREVEFALNDLARVRLTLRNPDFSTATRIAQAVNRQLGAY
FT                   SARATDPTTVELTVPGAYAGNVADLISRVETLPVTPDQPARVVIDEQSGTIVMGDSVRI
FT                   STVAIAQGNLTVRVTETPQVSQPGPFAQQGQTVVVPRTDIEVEDGSGNRLNIVQGSVSL
FT                   RELVDGLNRLGAGPRDIISILQAIKAAGALHADLEVL"
FT   gene            195152..195922
FT                   /gene="ctrA"
FT                   /locus_tag="RC1_0209"
FT   CDS_pept        195152..195922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctrA"
FT                   /locus_tag="RC1_0209"
FT                   /product="cell cycle transcriptional regulator (CheY-like
FT                   receiver domain) CtrA, putative"
FT                   /note="Three putative domains within the geneREC,
FT                   trans_reg_c, & OmpR; identified by match to protein family
FT                   HMM PF00669 match to protein family HMM PF00700"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97658"
FT                   /db_xref="GOA:B6IQC2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQC2"
FT                   /protein_id="ACI97658.1"
FT                   /translation="MRILLIENERLIAAALHREIGKAGLRCELSDEADAIRLMQEGDDS
FT                   FADYDAILVGTVSNGGGLVTQLRRCSGHTIIIGLLGHRCVTSTIAYLRSGADDVLVKPI
FT                   NALEFEARLHAVRRRTHGHSSSELRVGRLTVYLDGRDPAVDGQRLRLSHREHAIFSVLA
FT                   LNVGRVVSKEKIYETVYGLTGSDPLDKVIDVYICKLRKKLAEATGGDRYIETVYGRGYK
FT                   FEAPSEEEADIGPVAHIAPLSPALAADDGRHVSG"
FT   gene            complement(196199..197266)
FT                   /gene="flgL"
FT                   /locus_tag="RC1_0210"
FT   CDS_pept        complement(196199..197266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgL"
FT                   /locus_tag="RC1_0210"
FT                   /product="flagellar hook-associated protein 3 FlgL,
FT                   putative"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97659"
FT                   /db_xref="GOA:B6IQC3"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQC3"
FT                   /protein_id="ACI97659.1"
FT                   /translation="MSVSSISTMALARQTRNLVRTMQSDMHTLELEIGTGKKSDVAGSV
FT                   GSRAALLLDLRNARQTTAEYRQSIQTQSSRLTLMQEALDKVRGSATQVRDLALSVSGSG
FT                   VGAAAATIDEAALNAIQTLSSMFNSSQSGRYLFAGTRFDTRPMQPPTETAPSGIAPLDA
FT                   VKSVLSSLGPTSTAADVDAALNGPNGLSSIFSDTYGGGPAAPENFSKTFFLGSTTQVQG
FT                   RAGEDLPVTYACTAGDEPVRTLLKGLYLLAAVPSESVSTEAYQRIADQGWRLITQATDE
FT                   LIDTQGIIGLQEELLKRADERHEVEDGLLSKQITQMEMADPYETGLRLNTLETQLEATF
FT                   AMTSRISKLSLIDFL"
FT   gene            complement(197269..198756)
FT                   /gene="flgK"
FT                   /gene_synonym="flaS"
FT                   /gene_synonym="flaW"
FT                   /locus_tag="RC1_0211"
FT   CDS_pept        complement(197269..198756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgK"
FT                   /gene_synonym="flaS"
FT                   /gene_synonym="flaW"
FT                   /locus_tag="RC1_0211"
FT                   /product="flagellar hook-associated protein 1 FlgK,
FT                   putative"
FT                   /note="Part of the hook-filament junction; HAP1 first
FT                   hook-filament junction protein cell exterior"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97660"
FT                   /db_xref="GOA:B6IQC4"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQC4"
FT                   /protein_id="ACI97660.1"
FT                   /translation="MSIGLALQTALTGLQAQQQKSAILSRNVANATTPGYTRKEVTLAS
FT                   LTVGGEGRGVTVQDVRRNADAHLARETRTQSSDYAAKAARADALAVYTESIGQPQEERS
FT                   LSSAVTALETAFLALEELPDNPVQQRAVVDAAVSLANRLNAADDKIKQVRQQADSDIAA
FT                   SVADVNQALVQLEKLNREVKMRTGSGQDTTELEDQRDVLLDRIAGQIGIQYFTRSPNEL
FT                   VVMTDGGVTLLDGSARMLEFTPTAVIGSTTEYPSMLSGLKVEGADIAPGSGYPLPLKSG
FT                   RIAGLFEVRDSLMPQARRQIDEIASVLVDRFQAADASITGTGLSDTGLFTDAGVRHYRA
FT                   PPYSPASPGPAGLAGRIAVNDLVRVEAGGNPALLRTGIHAATTGDVGDTAQIRSFLGVF
FT                   QQTVSFDADAGLIPTGTLKGFASAAMGHQQMLRATAANDAKAQSVLLETVETARISKDG
FT                   VNIEEEMQELLLIEKAFAAAGQVMQAASRMLDTLMEI"
FT   gene            complement(198771..200075)
FT                   /gene="flgE"
FT                   /locus_tag="RC1_0212"
FT   CDS_pept        complement(198771..200075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgE"
FT                   /locus_tag="RC1_0212"
FT                   /product="flagellar hook protein FlgE"
FT                   /note="Gene symbol sysnonym flaK.Located on cell exterior;
FT                   identified by match to protein family HMM PF02119"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97661"
FT                   /db_xref="GOA:B6IQC5"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQC5"
FT                   /protein_id="ACI97661.1"
FT                   /translation="MSIYSAMYSGVSGLAAQSAKFAAISDNISNSSTVGYKRSGVQFST
FT                   LVTSASSPGSYSAGGVQADLHTEVSRGGIVQATNSATDMAISGRGFFVVSNRSAAVNGE
FT                   APSYMLTRSGAFRVDENGNLHNTAGYFLQGWKLGPDGKVVGGEPSRTSFTGLETVNLSS
FT                   ITGLAKATTQIDFAANLPASQTGKTPPAQPFSTSVDYYTPLGGTGRLTLEWAPQSAANE
FT                   WNLTIYDGTTSLGTANIVFNGNTATSGPPGSLNTMSEVGASPTLDVDAATGSIKLDVNG
FT                   QPIVVNLGRPNQTGGLTQWGDDYVPTKINKDGASYAPLERVEIGDDGVMTAIYKNGLRQ
FT                   AVYQIPVADVTNPDGLRRMDGNAFQVSRESGDYYLWDAGSGKAGAVDGAALEASNVDIA
FT                   EELTSIIETQRAYSSNAKIIQTADEMLDEVSRLMR"
FT   gene            complement(200189..201166)
FT                   /gene="motB"
FT                   /locus_tag="RC1_0213"
FT   CDS_pept        complement(200189..201166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motB"
FT                   /locus_tag="RC1_0213"
FT                   /product="chemotaxis MotB protein"
FT                   /note="Stator protein converts proton energy into torque
FT                   integral to plasma membrane; identified by match to protein
FT                   family HMM PF00072 match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97662"
FT                   /db_xref="GOA:B6IQC6"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQC6"
FT                   /protein_id="ACI97662.1"
FT                   /translation="MTGKPQKPQIVIKRRAQEESDELEGNGTWKIAYADFVTAMMAFFM
FT                   LLWLVNVTTPEQRHGIADYFNPIAVSDANSGANGQLAGQSVAREGALTSNAASAWETIP
FT                   TARVPTLSPPGPDRELDDGEGGGASAQENAESAPADGNGTPMTAALEQQLQQVAAEEQS
FT                   FDRIEQSVRDALMSAVDLADLSQNLVFERTADGLRIQITDRPHFSMFDSGATDLNGRAV
FT                   TLLGIVAEALSGVPNRIAISGHTDGRPFAANARYGNWELSADRANAARRVLLQKGIQPG
FT                   RVARVEGLADTLHLLPEDPGDPRNRRISIIVMRRVPLPGASVSQ"
FT   gene            complement(201170..202054)
FT                   /gene="motA"
FT                   /locus_tag="RC1_0214"
FT   CDS_pept        complement(201170..202054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motA"
FT                   /locus_tag="RC1_0214"
FT                   /product="chemotaxis MotA protein"
FT                   /note="Also called lateral flagellar motor protein
FT                   MotA.Stator protein exerts torque against rotor"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97663"
FT                   /db_xref="GOA:B6IQC7"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR022522"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQC7"
FT                   /protein_id="ACI97663.1"
FT                   /translation="MNLIIGSIIVIGSVLGGFAALGGNLGVLWQPFEVLIICGGAVGAF
FT                   VIANPSQVRRDTVLALRELFRGTRRKQGDYLDLLGALYTVLRMARTKGLLSLEKDIERP
FT                   EDSQIFQQFPSVLGHERAMRFLTDYLRLMSLGADRSHEMEALMEEELSTLQKELQRVSH
FT                   ALHVVAEGLPALGIVAAVLGMIKAMGSIAAPPEVLGHMIGGALVGTFMGVLLSYGFIGP
FT                   LAGAAHRMRDEELKYFQCMKAGLTAYLHGSAPAICVEHARKVLYSEVQPSFYDVEEVTT
FT                   AAAARLTERQKAA"
FT   gene            complement(202106..204121)
FT                   /locus_tag="RC1_0215"
FT   CDS_pept        complement(202106..204121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0215"
FT                   /product="tetratricopeptide TPR_2 (cell
FT                   wall/envelope/membrane biosynthesis)"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97664"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQC8"
FT                   /protein_id="ACI97664.1"
FT                   /translation="MPDRKPAPGTVAARSVASAASGGASGEPAAVGTSAGSAGGETVRT
FT                   QAAAATVAPAPAPVTEGQARHVRQAVADALEAVERDPDTRPGTPAADTGAAPRAAGNGE
FT                   PVPRPADPTASPPVGASPVATTPAPAAPPAPAPAQGPALFDLAAWRVEPFRARRSALRE
FT                   AAARPDAPEARRDFARFLLAWGLGPEAAAAARAAGDGPLLAAATLLEEPDATAADWLAG
FT                   PEALTHADGPLWAAVLLARRGRPAEALPLLPAADKALPGLPADLRGAFALDLLAVAAGA
FT                   GRDSVGRDLARIAEEAGLAEPDQARLHLLIGRLHEGTGRKDLALEQYDKAAVLPGEAGA
FT                   RARLAAADLRFTRGDLDAPGLRSVLEDIARDWRGGEVEFRALARQAGLSRAEGRPVEAL
FT                   DTLRLLVDRFPASEALAAETARAVGDFTAMLAAGPAPDLVAAFERNRALVPAGRAGLDI
FT                   RIGYARLLAAQGLTMAAARELAQVAQALPPTEAGPVRQELALLELTAGRPEAVATLVPE
FT                   DTPEARAVRARAAAVTGNADMALDLIGTPKDAAGLTARGDALWRSARWPEAARTYDLLV
FT                   QALTALPADDAGRAGLPDAVGRLGVASYLAGDAQAPRRLLAAHADLLAGGPWASQLAAL
FT                   AEERTPPAGAAGMDRLLAETDALLRLSAASRTENRP"
FT   gene            203924..204508
FT                   /locus_tag="RC1_0216"
FT   CDS_pept        203924..204508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0216"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97665"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQC9"
FT                   /protein_id="ACI97665.1"
FT                   /translation="MARLPFRDRGRGRGDGRRCRLRPHGLPPGASGRRADRCRLSGCTS
FT                   GRGGRDTPGCDRAGCRLPIRHRHRTHRQDQIAPPPLQLHPGPAGHADDQRLGTGHRQGE
FT                   NAPERPCRKAPDVHRSRHRQGRRTGVLDQRAARRCQSGQHQFRGAGPQPQLGGDRRVRL
FT                   GAAGNEESHEGGSGERRFHRQLLGNLNARLT"
FT   gene            204567..205313
FT                   /gene="flgF"
FT                   /locus_tag="RC1_0217"
FT   CDS_pept        204567..205313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgF"
FT                   /locus_tag="RC1_0217"
FT                   /product="flagellar basal-body rod protein FlgF"
FT                   /note="Gene symbol synonym flaC.Rod protein transmission
FT                   shaft periplasmic space; identified by match to protein
FT                   family HMM PF00691"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97666"
FT                   /db_xref="GOA:B6IQD0"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012836"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQD0"
FT                   /protein_id="ACI97666.1"
FT                   /translation="MENSLYVALSQQMAVRRMLDVTANNVANMNTAAFRAERPVFDAFV
FT                   EKAGKGQKVAFVIDRATYTDTRDGTVASTGNPLDVAVRGDAWLSVATPDGIRYTRDGRL
FT                   NRDPDGRLVTLDGYPVLDEGGGEITLPEDVGAIAITADGAIRAPAVDSENGEVEELGRL
FT                   GLARLPAAGDLERDGSGLVRYDGDPLPAEGATLIQGAVEGSNVQPITEMVRLVELTRAY
FT                   GQANRMVESEHERQKTAISKLGGPAT"
FT   gene            205348..206133
FT                   /gene="flgG"
FT                   /locus_tag="RC1_0218"
FT   CDS_pept        205348..206133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgG"
FT                   /locus_tag="RC1_0218"
FT                   /product="flagellar basal-body rod protein FlgG"
FT                   /note="Gene symbol synonym flaB.Distal rod protein
FT                   transmission shaft periplasmic space; identified by match
FT                   to protein family HMM PF01618"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97667"
FT                   /db_xref="GOA:B6IQD1"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQD1"
FT                   /protein_id="ACI97667.1"
FT                   /translation="MRTLNIAATGMMAQQLNVEVISNNIANLNTVGFKRSRAEFQDLMY
FT                   QAQVRPGSESSDQDTIVPAGIQLGLGVKPAAVSRMHGQGPLTPTENDYDVALDGRGYFV
FT                   ITLPNGDTAYTRAGNFQLSPEGTIVTVDGYTVSPNITVPDNTRKVAINRNGEVLAFIDG
FT                   QTEPENVGQFEVATFVNEAGLEAMGDNLFRETPASGIPILGIPGQLGYGGIRQGYVEAA
FT                   NVNIVQEITSLISAQRAYEMNSRVVEAGDQMLNTVTQMR"
FT   gene            206141..206788
FT                   /gene="flgA"
FT                   /locus_tag="RC1_0219"
FT   CDS_pept        206141..206788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgA"
FT                   /locus_tag="RC1_0219"
FT                   /product="flagella basal body P-ring formation protein
FT                   FlgA, putative"
FT                   /note="Chaperone for P-ring protein periplasmic space;
FT                   identified by match to protein family HMM PF07721"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97668"
FT                   /db_xref="GOA:B6IQD2"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="InterPro:IPR039246"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQD2"
FT                   /protein_id="ACI97668.1"
FT                   /translation="MRYLLPLLAILVLPAPALANAGEAVADEMVRRFGGSLPEGELRVR
FT                   LDQEGPADIIGVETLRYDPRSGRVAAILVAAEGRFAVEGSAWTEIEAAVPNRRLTPGEI
FT                   IQPGDLASLPVRADQVSARAVVAPTDLIGKQVRRALVPGRLVQSGSVGEPVVVERSKPV
FT                   TLEFRSGALLLTARGRALESGGVGDVVRVINLDSNRTITGVVSGPGVVSASP"
FT   gene            206820..207557
FT                   /gene="flgH"
FT                   /locus_tag="RC1_0220"
FT   CDS_pept        206820..207557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgH"
FT                   /locus_tag="RC1_0220"
FT                   /product="flagellar L-ring protein FlgH"
FT                   /note="Gene symbol synonym flbN.L-ring protein part of
FT                   bushing lipoprotein outer membrane; identified by match to
FT                   protein family HMM PF00460"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97669"
FT                   /db_xref="GOA:B6IQD3"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQD3"
FT                   /protein_id="ACI97669.1"
FT                   /translation="MPRIRPAAALLLLASLPGCAGQFDHLGRAPAMSPIEDPGMQTEAR
FT                   LVRMPMPVPSTEARQPASLWRTGSTGFLRDLRAKRVGDIVTVVIDMSEQAQIRNQTQRS
FT                   RASGEQMGTPNFLGLESRLGAVLPDAVDPERLVNLNSSSSSTGAGSVNRQEQIQLKVAA
FT                   VVTDVLPNGNLVIAGKQEVRVNFELRELRIAGVIRPEDISTRNIISYEKIAEARIAYGG
FT                   RGQITDVQQPRIGQQVLDVVLPF"
FT   gene            207577..208038
FT                   /locus_tag="RC1_0221"
FT   CDS_pept        207577..208038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0221"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97670"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQD4"
FT                   /protein_id="ACI97670.1"
FT                   /translation="MASSPRLFLAAVASSAVLGFALGRVVVQPVPATPPADPPPGAALG
FT                   SKDIEMLADLGQIIVPIWREGRIAGYVAAAISLRLAPGSAPSELMPILHDRMLATLIDA
FT                   GAEGRLDPGTADPAALSAALLEAARDAIGPDRVRSLDLSKLVRQENRAT"
FT   gene            208166..208777
FT                   /locus_tag="RC1_0222"
FT   CDS_pept        208166..208777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0222"
FT                   /product="DNA-binding protein (HTH domain), putative"
FT                   /note="identified by match to protein family HMM PF03240"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97671"
FT                   /db_xref="GOA:B6IQD5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQD5"
FT                   /protein_id="ACI97671.1"
FT                   /translation="MPPDVPVRDSSRLRSLRTARGMSLSALAAKVGLSKGELSKLETGV
FT                   RPLRPDHVAKLARAFEIAPSDLVGEASALRAMIAPEPATLPLYDGRDLARVGDAAEPIG
FT                   RVDAPAQLRSVPDAYAITINDLSNAPALMPGVVLHVHPGRAPALGDLVVNRVSWSPLAF
FT                   YLRQDDDGRFYGLTLSRRRVELSLEEVERLHKVAGIWFVG"
FT   gene            complement(208797..209456)
FT                   /gene="flgD"
FT                   /locus_tag="RC1_0223"
FT   CDS_pept        complement(208797..209456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgD"
FT                   /locus_tag="RC1_0223"
FT                   /product="basal-body rod modification protein FlgD,
FT                   putative"
FT                   /note="gene symbol synonyms fla FIV, flaV.Part of the
FT                   filament cap in flagella; Also called hook-capping protein;
FT                   Located on cell exterior; identified by match to protein
FT                   family HMM PF02107"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97672"
FT                   /db_xref="GOA:B6IQD6"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="InterPro:IPR025965"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQD6"
FT                   /protein_id="ACI97672.1"
FT                   /translation="MTTVAPPSAAGSQQTTADVASVRLAQDTQSFLKLLTAQLANQDPM
FT                   APIDATQFVTQLAQFSSVEQAVQSNTRLAEVLGELRSSSERLDLAYVGRTVEIESDALP
FT                   LIGGGAKASYTVPEDTEKTEIRILDQKGTIVRTLEGSSIPGSHLLTWDGLDDSGVKLAD
FT                   GIYQIDVAPRNPAGDRLGSTVQTADTVERVRRVDGETVFVMRSGLQVQRDQIVSAG"
FT   gene            complement(209467..210729)
FT                   /gene="fliK"
FT                   /locus_tag="RC1_0224"
FT   CDS_pept        complement(209467..210729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliK"
FT                   /locus_tag="RC1_0224"
FT                   /product="Flagellar hook-length control protein FliK,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97673"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQD7"
FT                   /protein_id="ACI97673.1"
FT                   /translation="MLPIPIQTAPSGTASAAAGQSGGAVQGSNGTASAGGAAASGATGI
FT                   AGFLAALALVQPQGDGEGAAVAGQPRRARPTEGEATGLEGQAPLVAPFPMIALAPVVPA
FT                   ESTSVSASGGVLLQAAPAVSSGTAPAPVVGMPAHRQGGQGIAGVPPDAGGTTLSGPSGS
FT                   VDAVPGTVPSTAPAPLQETASRAGQPAGRDGAERQTRADSAVQSLAAAVRPPVRAAATG
FT                   AEVVRPAASVDAAATLADGTATLLPDAVAPAAAAVAPTVVAGDAARAAAVHQAGRAGAP
FT                   GPAAQIHVQIERAVADGGPRSFTVHLEPEELGRVEVKLEFQDGRLHALVMADRPQTLDL
FT                   LQRDARLLERSMEQGGLRLQQDGLQFSLREGGGQNGGQGASQGGDPLHRGARLLAAVGE
FT                   TAGPADPVRSRAVDGLIDIQV"
FT   gene            210874..211110
FT                   /locus_tag="RC1_0225"
FT   CDS_pept        210874..211110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0225"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97674"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQD8"
FT                   /protein_id="ACI97674.1"
FT                   /translation="MTASRSAFAARRTRIVQSCTRAVASCDPATLVRLEQMLAAIADGA
FT                   RLERYCVSSPPDADLPADMAQLLTLLDPPVGRA"
FT   gene            211250..212800
FT                   /locus_tag="RC1_0226"
FT   CDS_pept        211250..212800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0226"
FT                   /product="biotin dependent acyl-CoA carboxylase, putative"
FT                   /note="identified by match to protein family HMM PF03963"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97675"
FT                   /db_xref="GOA:B6IQD9"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQD9"
FT                   /protein_id="ACI97675.1"
FT                   /translation="MVWEPEIEELRRRQELAQRMGGPEKVARQHANGRLTVRERIGKLL
FT                   DAGTFREIGSLAGQARYSGDGTLEEFTPANFLFGRGRLNGRPVVVGGDDFTVRGGAADA
FT                   GIFQKQIMAEQMANELRLPIVRLIDGTGGGGSVKSYEAMGFTYVPFNPGWDWVVANLAT
FT                   VPVVSLALGPVAGLGSARAVSSHYSLIVKGTAQMFIAGPAVVARIGPSLDKEDLGGASV
FT                   HTRAGAIDDEVASEEEAFERTRRFLSYLPSSVHEAPPRGARRDDPARRDDSLLSAIPRD
FT                   RRQVYKIRPVIETLVDQGSFFEMGRRHGRSLVTGFARLDGWPVALIATDPFVFGGAWDA
FT                   AAAQKLIRFVDLAETFHLPVVHLVDVPGFSVGPEAEKSATIRHGARALAAVYQASVPWC
FT                   SIILRRAFGVAGAGMMNHARLRYRYAWPSGDWGSLPMEGGIEVAYRAELEAAPDPAARM
FT                   AEIQARLERMRSPFRTAEHFSVEEIIDPRETRSLLCEFANLAAPLRTPGPRGPAGYRP"
FT   gene            complement(212868..213641)
FT                   /locus_tag="RC1_0227"
FT   CDS_pept        complement(212868..213641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0227"
FT                   /product="class II aldolase, putative"
FT                   /note="identified by match to protein family HMM PF02120"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97676"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQE0"
FT                   /protein_id="ACI97676.1"
FT                   /translation="MPDTLTKLPDVRAVVGEAEWKVREDLAACYRLVALFGWDDLVFTH
FT                   ISARVPGPEHHFLINPYGLLFEEITASSLVKIDLHANVVLDTGFPVNPAGFTIHSAVHE
FT                   VREDAQCVMHLHTPDGTAVATMKEGLLPLNQTAQLILGDLAYHDYEGVALDHDERPRLQ
FT                   ADLGDRSTMLLRNHGTLTLGATVAEAFTRMYFLERACQMQVRTLSQGRELYPTADAVIG
FT                   KNEAIGRMGLTQAANLLIWPALLRKLERTDPGYRQ"
FT   gene            complement(213719..213835)
FT                   /locus_tag="RC1_0228"
FT   CDS_pept        complement(213719..213835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0228"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97677"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQE1"
FT                   /protein_id="ACI97677.1"
FT                   /translation="MQGDPVFLVLLPAAVPTAVRTPAGRRDIFTAHRETQSL"
FT   gene            complement(214115..214318)
FT                   /locus_tag="RC1_0229"
FT   CDS_pept        complement(214115..214318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0229"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97678"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQE2"
FT                   /protein_id="ACI97678.1"
FT                   /translation="MTRFMQPDLEDAAFVQARLLDHFIALARDAAEQEGGFTRESIRDL
FT                   IEALREERRTVGQLARPRLIGH"
FT   gene            complement(214468..216672)
FT                   /gene="glgX"
FT                   /locus_tag="RC1_0230"
FT   CDS_pept        complement(214468..216672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgX"
FT                   /locus_tag="RC1_0230"
FT                   /product="glycogen debranching enzyme GlgX"
FT                   /EC_number="3.2.1.-"
FT                   /note="identified by match to protein family HMM PF00596"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97679"
FT                   /db_xref="GOA:B6IQE3"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQE3"
FT                   /protein_id="ACI97679.1"
FT                   /translation="MRDQPGTAEQHAPFRDIHLRTGSRIEEGSPFPLGATWDGLGVNFA
FT                   LFSANATKVELCLFDAEGRRELERIALPEYTDEVWHGYLPDARPGTVYAYRVHGAYEPL
FT                   AGHRFNPNKLLLDPYAKAHVGSLRWSDALFGYRVGSRQGDLGFDRRDSAPAMPKCRVVD
FT                   PAFTWGRDRPPAIPWTSTLFYETHVRGHTMRHPAVPESLRGTFAGMMQKEVIDYIRSLG
FT                   VTSVELLPIHAFVDDRYLIEKGLRNYWGYNSIGFFAPDPRYLAGPVISEFKEMVAHLHD
FT                   AGIEVILDVVYNHTAEGNEMGPTLSFKGIDNASYYRLLPDQPRYYINDTGTGNTLNLSH
FT                   PRVLQMVTDSLRYWVTEMHVDGFRFDLATILAREPYGFDEGGGFLDSCRQDPVLSRVKL
FT                   IAEPWDIGPGGYQVGGFPPGWAEWNDRFRDTVRAYWKGDEGRLPDLAARVTASGDVFNR
FT                   RGRKPWSSVNFVTAHDGFTLNDLVSYNDKHNMANGEENRDGHSHNLSWNHGAEGATADP
FT                   AILELRERQKRNMLATLFFSQGTPMLLAGDEFGRSQGGNNNAYCQDNEISWLDWQGIDD
FT                   RGQDLARFVRRLIRIRQMHPLLRRGRFLTGAYNGDLGVKDVTWLTPSGEEMTPEHWQDP
FT                   HARCLGMLMDGRAQPTGIPRTGNDATLLLVFNAHHEEVPFTLPEVAGGRAWATLVDTAR
FT                   PDLENGESLGPGEVFGVPGRALLLFELVRPRGHRVSPASE"
FT   gene            complement(216764..217885)
FT                   /locus_tag="RC1_0231"
FT   CDS_pept        complement(216764..217885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0231"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97680"
FT                   /db_xref="GOA:B6IQE4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQE4"
FT                   /protein_id="ACI97680.1"
FT                   /translation="MILIAWCALGLALLPLLLGLWNLVLFRAPPAARSAPVSGVSVLIP
FT                   ARNEEANIGDAVRSVLASRDIELEVVVLDDHSTDGTAAIVRDLAAADPRVRLEMAPPLP
FT                   AGWSGKQHACRVLADRARFDLLLFLDADVRLSPGAVGRIAAALGTRDVALTSGFPRELT
FT                   GSLPEHLVIPWIHVLLLGYLPMAFMRLLPTAVGFGTGCGQLMLARRQAYMAADGHAAIR
FT                   ASLHDGVKLPRAFRRAGFGTDLFDATDLATCRMYRGWKEVWPGFSKNATEGMATPVALP
FT                   VWTVLIGGGHILPWLLAPGGWVAGAGTVALLGLGGIAANLAWRALLAWRFRQSWTGVLL
FT                   HPVGAGVLLAIQWGALLRRGRPAEWRGRSYSAV"
FT   gene            complement(217882..218727)
FT                   /locus_tag="RC1_0232"
FT   CDS_pept        complement(217882..218727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0232"
FT                   /product="acyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97681"
FT                   /db_xref="GOA:B6IQE5"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQE5"
FT                   /protein_id="ACI97681.1"
FT                   /translation="MDGGLRLPTDLPDPDALRSPLLVRFFSRVMARHMASGFHAVRLMR
FT                   PGVPALPADRPVIVYCNHPSWWDPAFLILLASRAFPERRSFGPMDAAALVRYRFMARIG
FT                   LFPVEPDTAAGAVAFMKVGQSLLSRPDAMLWVTAEGRFTDPRARPVRLRGGIAHLACRL
FT                   ERVTLLPLALEYPFWEERTPEALARFGTPLLTEPGSGLTPARLQEMLEDRLEAAMDDLA
FT                   LAARSRDPDRFATLLRGRTGVGGVYDLWRRCKAWVRGERFDPAHGSAAAGTAGRKEPTS
FT                   "
FT   gene            complement(219046..220032)
FT                   /locus_tag="RC1_0233"
FT   CDS_pept        complement(219046..220032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0233"
FT                   /product="capsular polysaccharide biosynthesis protein I,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF00128
FT                   match to protein family HMM PF02922 match to protein family
FT                   HMM TIGR02100"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97682"
FT                   /db_xref="GOA:B6IQE6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQE6"
FT                   /protein_id="ACI97682.1"
FT                   /translation="MGMKVLVTGVAGFIGFHLAQALLDRGDTVVGVDNLNDYYSTALKQ
FT                   DRLALLRQREGFHFQHLNIADRDGMAALAAAHPDTAAIAHLAAQAGVRYSLTDPFAYVE
FT                   SNLMGHVVMLETARRFEGLRHLVYASSSSVYGLSEAHPFSLDDRADRPASLYGATKRAD
FT                   ELISHSYSHIHRIPQTGLRFFTVYGPWGRPDMALFLFTRAILAGEPIELFNHGRLQRDF
FT                   TYIDDIIAGVVRALDRPPPVVEGAVPHRVFNLGNNTPVELERFVAVLEDALGLKARRHL
FT                   APMQPGDVLSTHADIEESRRVLGFEPSTPIEAGIGRFVDWYRAYYRV"
FT   gene            220795..221544
FT                   /locus_tag="RC1_0234"
FT   CDS_pept        220795..221544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0234"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97683"
FT                   /db_xref="InterPro:IPR017031"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQE7"
FT                   /protein_id="ACI97683.1"
FT                   /translation="MDIPRIFNITESAHRIHNPITPGKLAILGAALRLEAGTRVLDLGS
FT                   GSGEMLCTWARDHGITGTGIDMSRLFTEQAKRRAVELGVADRVTFIHGDAAGHVAEEKV
FT                   GVAACVGATWIAGGVAGTVELLAQSLRAGGIILIGEPYWRQVPATEEIAKGCLATAISD
FT                   FLTLPDLLASFGHLGYDVVEMVLADQDGWDRYEAAKWLTMRRWLETNPDDGMAEEVRAR
FT                   LTSEPVRYAAYTREFLGWGVFALMPRY"
FT   gene            complement(222591..224324)
FT                   /gene="ilvB"
FT                   /locus_tag="RC1_0235"
FT   CDS_pept        complement(222591..224324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvB"
FT                   /locus_tag="RC1_0235"
FT                   /product="acetolactate synthase large subunit, putative"
FT                   /EC_number="2.2.1.6"
FT                   /note="identified by match to protein family HMM PF01553"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97684"
FT                   /db_xref="GOA:B6IQE8"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQE8"
FT                   /protein_id="ACI97684.1"
FT                   /translation="MKKTAAWLAVHAMEQLGIRFTFGIPGVHNTELYDELNSSETVTPV
FT                   LVTHEGGGAFMADAVSRAADDTVGALAIVPAAGITHAASGIGESFLGGIPMLIFSGGIR
FT                   TDTGRRFQLHEIDQLRLIEPLTKAAFRVERHEDVVPTIHEAYRIATGGQPGPVLVEIPV
FT                   NLQLFPGEVGELPRWTPPPPPASPDPEAVRRAADLLLAARRPGLFVGWGARGAQAEVAA
FT                   IAEFLQAPVSTTLQGLASFPADHPLHAGFGFSGSAVPAARNAFEGCDGMLAVGTRFGEI
FT                   PTGSFSAEVPAGLVHVDICADVIGANYPAAVGIVGDARTVLAALLEELRARGKPAPDTG
FT                   LADRLARDRRAWREEWYAHDSKGRVNPARFFDELRRQMPDDAVTVLDDGNHTFLTAELF
FT                   PIHRGGRVLTPTDFNAMGYAVPAAIGAKLAQPGKEVFAIVGDGCFLMTCMEIMTATARG
FT                   LGVIYFVFSDGELSQIAQAQEIPYNRKPCTVLAGADLEGVARATGAAHVAMQNGDRIAD
FT                   AIAEARRLAATGRPVIVDVAIDYSKRTAFTAGTAKSTFKRFPLSQRVRFAGRALLRRVT
FT                   G"
FT   gene            complement(224351..225973)
FT                   /locus_tag="RC1_0236"
FT   CDS_pept        complement(224351..225973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0236"
FT                   /product="conserved hypothetical protein"
FT                   /note="[contains] FAD binding domain identified by match to
FT                   protein family HMM PF01073 match to protein family HMM
FT                   PF01370 match to protein family HMM PF04321 match to
FT                   protein family HMM PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97685"
FT                   /db_xref="GOA:B6IQE9"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR014614"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQE9"
FT                   /protein_id="ACI97685.1"
FT                   /translation="MQQYRSDVLVIGGGLAGIVTALELLSAGRSVTLLDRDRKDAFGGQ
FT                   AKESFGGILLVGTPEQRRTGIRDTPDLALRDWLSFGAFGREAEAERWPRRWAEAYVHES
FT                   EGEIYRWLRARDIGFLPVPLWVERGEQGDGNSVPRWHVTWGTGHRLATRLAGLLREHPR
FT                   RDALTLRFDHRVEALTEAAGRVSGCIGVMTGETERPFTATADCVVVAAGGINGCLERVR
FT                   RHWHADWGRPPETILNGSHRFADGRLHDAVEAVGGVVSGLDRMWNYAAGIRHWRPRKPD
FT                   HGLSLVPPKSALWLNWRGERIGPAPLVGGFDTRELVTRICGQERAWSWQLLNQRIALKE
FT                   LAISGAEFNPSLRERSAAGFLRDTLLGNRWLVREVIENSPDTVTAATLPELVEKMNALQ
FT                   GDGAVDLAAVRAAAERYDAEIARGPALHNDRQLRRIAHLRRWRGDRMRTCAFQPILDPA
FT                   AGPLIAIREFIISRKSLGGIRTDLDSRVLDAGDQPVPGLYAVGEAAGFGGGGMNGLRSL
FT                   EGTFLGGCIYGARRAARSIAGRT"
FT   gene            complement(226239..227051)
FT                   /gene="butA"
FT                   /locus_tag="RC1_0237"
FT   CDS_pept        complement(226239..227051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="butA"
FT                   /locus_tag="RC1_0237"
FT                   /product="Aminoglycoside 3'-phosphotransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97686"
FT                   /db_xref="GOA:B6IQF0"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR024165"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQF0"
FT                   /protein_id="ACI97686.1"
FT                   /translation="MQAGNYGNPGAGGMPEPPAGWRERLEGYAWTRPSGGCSDAAVFRL
FT                   DAPGRPVLYVKTEPAEPLAELPGEIARLRWLAGQGIPCPAVLQATEEAGRHWLLMSALP
FT                   GHVLEEAPDLDTGRRVALYAGALRTLHALDIAACPFDQRIDGQIALAAARVAAGLVDEE
FT                   DFDEVRQGRSAADLLAELRARRPAREDLVVTHGDACPDNLMTDGGRFAGFIDCGRLGVA
FT                   DRHQDLALACRSIADCWGEAWIAPFLAHYGRPADPDRLDCYCLLDEFF"
FT   gene            complement(227075..228007)
FT                   /gene="cbbR2"
FT                   /locus_tag="RC1_0238"
FT   CDS_pept        complement(227075..228007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbbR2"
FT                   /locus_tag="RC1_0238"
FT                   /product="RuBisCO operon transcriptional regulator"
FT                   /note="Contains PF03466 identified by match to protein
FT                   family HMM PF00205 match to protein family HMM PF02775
FT                   match to protein family HMM PF02776"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97687"
FT                   /db_xref="GOA:B6IQF1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQF1"
FT                   /protein_id="ACI97687.1"
FT                   /translation="MHLTLQQLRLFEAVARHRSFTRAAEELHLTQPAVSIQIRRLEENA
FT                   GTPLIEHLGKRFFLTPAGEAMYATACDVLTRLRSLDDELDELADTLRGPLRLAVATTAK
FT                   YFTPHLLGRFVADHPAVVPRLVVTNRARLIQRLGENLDDFVIMGQVPDDLPLVAHPIIE
FT                   NRLVVVAHPHHPGADQAGLALPDLAGERWLMREPGSGTRTSFERELAGQGLTIEPYMEL
FT                   GSTEAIKQAVMAGLGLSVLPMHSIELELAAHRLVILDIAGFPLCRRWNAVHLQGKTLSR
FT                   AARSFLQFLKETAEAPSGTIPAALHPLPA"
FT   gene            228179..229597
FT                   /gene="cbbL2"
FT                   /locus_tag="RC1_0239"
FT   CDS_pept        228179..229597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbbL2"
FT                   /locus_tag="RC1_0239"
FT                   /product="ribulose-1,5-bisphosphate carboxylase/oxygenase
FT                   large subunit"
FT                   /EC_number="4.1.1.39"
FT                   /note="identified by match to protein family HMM PF00890
FT                   match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97688"
FT                   /db_xref="GOA:B6IQF2"
FT                   /db_xref="InterPro:IPR000685"
FT                   /db_xref="InterPro:IPR017443"
FT                   /db_xref="InterPro:IPR020878"
FT                   /db_xref="InterPro:IPR020888"
FT                   /db_xref="InterPro:IPR033966"
FT                   /db_xref="InterPro:IPR036376"
FT                   /db_xref="InterPro:IPR036422"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQF2"
FT                   /protein_id="ACI97688.1"
FT                   /translation="MGKTYQAGVKEYRETYWDPNYTPKDSDILACFKVVPQPGVPREEA
FT                   AAAVCAESSTATWTTVWTDLLTDLDYYKGRAYAIEDVPGDDEAFYAFVAYPMGLFEEGS
FT                   IVNVFTSLVGNVFGFKAVRSLRLEDVRFPLWFVTTCDGPPHGIQVERDKLDKYGRPLLG
FT                   CTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCQEAIEKAEA
FT                   ETGERKGHYLNVTAPNMEEIYRRAEYAKEIGSPIIMSDYLTIGWAAHSSLSRWCRNNGM
FT                   LLHVHRAMHGVIDRNPRHGINFRVLAKLLRLLGGDHLHSGTVVGKLEGDREATLGWVDL
FT                   MRERHVKEDRSRGLFFDQEWGHMAPVMPVASGGIHVWHMPALLSIFGDDAVFQFGGGTL
FT                   GHPWGNAAGACANRVALEACVEARNQGRDVEREGKDILTAAARHSPELKMAMETWKEVR
FT                   FEFDVVDKLDVVHR"
FT   gene            229629..229988
FT                   /gene="ccbS2"
FT                   /locus_tag="RC1_0240"
FT   CDS_pept        229629..229988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccbS2"
FT                   /locus_tag="RC1_0240"
FT                   /product="ribulose bisphosphate carboxylase, small subunit"
FT                   /EC_number="4.1.1.39"
FT                   /note="identified by match to protein family HMM PF01636"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97689"
FT                   /db_xref="GOA:B6IQF3"
FT                   /db_xref="InterPro:IPR000894"
FT                   /db_xref="InterPro:IPR036385"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQF3"
FT                   /protein_id="ACI97689.1"
FT                   /translation="MSVMQDYPSRLSDPGSRKLGTFSYLPPLDATQIRRQVEYIVAKGW
FT                   NPALEHTEPEHAASHYWYMWKLPLFGETDVDRVLAEIEACRQANPGHHIRLIGYDNIKQ
FT                   SQGTSMVVHRAPVAR"
FT   gene            230080..230889
FT                   /gene="cbbQ"
FT                   /locus_tag="RC1_0241"
FT   CDS_pept        230080..230889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbbQ"
FT                   /locus_tag="RC1_0241"
FT                   /product="CbbQ"
FT                   /note="identified by match to protein family HMM PF00126
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97690"
FT                   /db_xref="GOA:B6IQF4"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR013615"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQF4"
FT                   /protein_id="ACI97690.1"
FT                   /translation="MSEIDAAQYRVAAMPYYRPVGNETELYEAAYAARMPLILKGPTGC
FT                   GKSRFVEHMAWRLDRPLITVACNEDMTAADLVGRFLLDLNGTRWQDGPLTVAARIGAIC
FT                   YLDEVVETRQDTLVVIHSLTDHRRMLPLDKKGELVAAHPDFQMVISYNPGYQSLNKELK
FT                   PSTRQRFGAMAFDYPLPEIEAEIVAHESGVAPAQAAKLVQMAHRSRNLKGHGLDEGIST
FT                   RLLIYAGRLIVQGIPPAEACRMALVRPLTDDPDMQDTLDAAIDTLFG"
FT   gene            230922..233252
FT                   /gene="cbbO"
FT                   /locus_tag="RC1_0242"
FT   CDS_pept        230922..233252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbbO"
FT                   /locus_tag="RC1_0242"
FT                   /product="rubisco activation protein CbbO, putative"
FT                   /note="[contains] von Willebrand factor type A domain
FT                   identified by match to protein family HMM PF00016 match to
FT                   protein family HMM PF02788"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97691"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQF5"
FT                   /protein_id="ACI97691.1"
FT                   /translation="MSTDLEDIRRELVAAAPDLAGTLAVPLHEMSRLVSPAGRRDYLDG
FT                   ALALARLGRGSRLPAAYLAAMPQVARDCGEDAVADCRHAAMKLASMTSGEVLELVFASL
FT                   PTAAARLGDADLLAAYMQVLHRLAARAPRGLRPMLGVLDELLSRLTLSGLRRWVEFGAE
FT                   SHRGDVAAQVAYFGLTSPESRSVLQRERRGTQFVDSQRRLGAFLRALWGRDFRLRPAAS
FT                   DQPGFRPFVDAGALHLPDAVDAAGGLGGLDVLRAMAAHMAAHLLYRRRPLPVDGSAPAA
FT                   RFLIGLVEDARVEREALIRFPGLRRLWAPLLAANLPPFPGHPGMDLVEAAARALLDPAQ
FT                   RTGDAALDALVDRFHAGAGLPGAEETLAITLGHDLHDLLSARRLLPSLRILESHRLAYR
FT                   DDNHLLWTAEAFDDFGDPAGDGEAQGQVRRRVGLMEFINETDVENAGEDAQEIWVLGTE
FT                   LFPYEDDGISFNEREGRPPVSDPVRYPEWDDRGQHYRPDWVTLREHRPARGDPATIDAV
FT                   LERHRGVTAQVRRIVDRLRPQGVERRRRLDDGDELDIGPAVDAMVMLRAGLQPDSRITR
FT                   RSILHRRDLAVLVLLDLSASTNDPVRGSDTTILELTRDACTLLATAVSGIGDPFAIHGF
FT                   ASDGRQDVRYYRIKDFEQRFDGDARSRLAGLEGGLSTRLGTALRHAAHHLGRRPEAHRL
FT                   LLVVTDGEPADVDERDPQHLRQDARRAVEELRAQGIRPFCLTLDPLADRYVARIFGING
FT                   YTVIDHVRRLPERLPGLFAALTR"
FT   gene            complement(233302..234198)
FT                   /locus_tag="RC1_0243"
FT   CDS_pept        complement(233302..234198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0243"
FT                   /product="polysaccharide pyruvyl transferase superfamily"
FT                   /note="identified by match to protein family HMM PF00101"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97692"
FT                   /db_xref="GOA:B6IQF6"
FT                   /db_xref="InterPro:IPR007345"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQF6"
FT                   /protein_id="ACI97692.1"
FT                   /translation="MARLAAQVRTLARLFPPGGRVAYLDLPLHGNVGDLLIYLGTERFL
FT                   AEQQQRVVLRTTCAASPARIARRIGTGDLICLHGGGNFGDLYPAHQEFRRAVVERFPDN
FT                   RIVVMPQTVHFGDGSLWHLLEPFRRHRRLTVCVRDRTSARALAEAGIEDVVLVPDMAHL
FT                   LWRNRPDGGGGGRLHLLRRDQEAPATAGPEATAPAAVCDWGDLIHPVERRCFRLLQIAA
FT                   RRHLPVAPLWQPLARRLARRAERLLARHDHVVTDRLHGVILSALLSRRVTALDNSYGKV
FT                   SAYVDLWLDRSPLVARK"
FT   gene            complement(234258..234374)
FT                   /locus_tag="RC1_0244"
FT   CDS_pept        complement(234258..234374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0244"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97693"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQF7"
FT                   /protein_id="ACI97693.1"
FT                   /translation="MFIGRVDLPGADRCRFPPDGAAAPPPLLFLRLPFPPLA"
FT   gene            complement(234456..234659)
FT                   /locus_tag="RC1_0245"
FT   CDS_pept        complement(234456..234659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0245"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97694"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQF8"
FT                   /protein_id="ACI97694.1"
FT                   /translation="MLMDGRTPVLPLTGFALLAQAMGLAAAGRGETALDNPFVEEPGAS
FT                   AAWIDGWMRGQTGRSAPLPGRA"
FT   gene            complement(234760..236358)
FT                   /gene="phoD"
FT                   /locus_tag="RC1_0246"
FT   CDS_pept        complement(234760..236358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoD"
FT                   /locus_tag="RC1_0246"
FT                   /product="alkaline phosphatase D"
FT                   /EC_number="3.1.3.1"
FT                   /note="identified by match to protein family HMM PF04230"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97695"
FT                   /db_xref="GOA:B6IQF9"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="InterPro:IPR032093"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQF9"
FT                   /protein_id="ACI97695.1"
FT                   /translation="MPILDPFRLGRRQLLKTFGAAAVTALSLPPTLRQSLAQPVFVAPP
FT                   FQLGVAAGDPAPDGFVIWTRLAPQPLEPGYGMPAQPVEVDWQVAADDRFRTVVQKGTAV
FT                   ARPELGHAVHVEVAGLEPGRPYWYRFVAGTERSMVGRARTAPALGAPVERLRFAVGGCQ
FT                   AYEHGHYTAWRCISDESDLDFIYHYGDYIYEGGVRSFYFDRHQERTLPTPRPFDGRELY
FT                   SLDEYRRRYALYKLDPNLQMAHASAAFIPAWDDHEVDNNWVADRDQDGTPPEVFLLRRI
FT                   AAAQAYYENLPFRRSAWPLGPAMQIYRRLSFGSLLDLHVLDTRQFRTDQPCGDGFKAPC
FT                   AGMDADTASVLGAEQEKWLYDGLAASKARWTGLAQQVMLMDMDREPGEEDIRNMDSWDA
FT                   YRAARTRLLSFLHDRRISNTVVLTGDEHQNWIGDVKLRAGDPDSPTVATEFLATSISSG
FT                   ADGGEIRANGAGILAANPHLKLLNDQRGYHLHEVTPKAWTAHVKVLDKVSTPGGTLSTR
FT                   AVFTVDPRRPGPQAA"
FT   gene            complement(236393..238456)
FT                   /locus_tag="RC1_0247"
FT   CDS_pept        complement(236393..238456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0247"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97696"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008557"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQG0"
FT                   /protein_id="ACI97696.1"
FT                   /translation="MTAPFTHLSADEFEDRADLPSSPDTTPTFGEVLQRRFGRRELLRG
FT                   ALASTALAALPLSLLLPASRTAAAQDAARSVDAESRFPFEELARGVDETHHVAKGYQAK
FT                   VLLRWGDPLLPGAPEFDPYAQTAEKQLGQFGYNNDFVGYLPLPLGSRSSDHGLLWVNHE
FT                   YTNTEVMFPGLIPAGMDRIPQDRAAQLITREIAEVEMAAHGGSIVELKRGADGDWTYVK
FT                   GSPYNRRLSPLATEMAFTGPAAGHERMRTSADPTGTRVIGMMNNCAGGVTPWGTFLTCE
FT                   ENFDGYFIGTIDQSHPEQRNYDRYTVPGSRYLWGLHHPRFDVNKEPNEANRFGWVVEVD
FT                   PYDPTSTPRKHTALGRAKHEGAGVVVNKDGRVVVYMGDDQVFEHIYRFVSRNRFDPNDR
FT                   AKNMTLLEDGTLYAARYNADGTLTWLPLVQGQGPLTPENGFRTQADVSINTRHAATLVG
FT                   ATRMDRPEDIEVNHRTQKVYAMLTNNSDRRPVSPEHPSITHVDAANPRVGNLWGHIVEM
FT                   SAPEDDHTAETFRWTILLQAGNPADPKVKATFNPATTENGWFACPDNCVVDGQGRLWVA
FT                   TDQGNSWPTSSGSADGLWAVETEGPLRGTAKAFFRCPIGAEMCGPFFTPDDTALFLAVQ
FT                   HPGVDGVSQVVATGERATFEHPGTRWPDFDEKVPPRPSVVVITKDGGGPIGS"
FT   gene            238742..239743
FT                   /locus_tag="RC1_0248"
FT   CDS_pept        238742..239743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0248"
FT                   /product="basic membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97697"
FT                   /db_xref="GOA:B6IQG1"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQG1"
FT                   /protein_id="ACI97697.1"
FT                   /translation="MKTLLRAAFAAVLVLCAAMAGPAAAFEPAIVFDMGGRFDKSFNEG
FT                   ANDGAERFKAETGVNFRFFEVTNEAQREQFLRRLAQRGTDIVVAVGFSMAPAVEKIAKE
FT                   FPKARFTLIDNVVDLPNVQSIMFAEHEGSYLVGMLAAMASKTGTVGFVGGMDIPLIRRF
FT                   SCGYEQGVKAVNPQATLLVNMAGSTPAAWSDPTRGSELAKSQFDRGADVVFAAAGQTGM
FT                   GVLQAAADAGRLSIGVDSNQNHLFPGSVLTSMVKRVDVAAYNAFKTAQDGTWKPGLQYL
FT                   GLKDDGVIWAYDENNKDLITPEMKARVDAAAQEIKAGTRTVANYSDADGCKY"
FT   gene            239758..241344
FT                   /locus_tag="RC1_0249"
FT   CDS_pept        239758..241344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0249"
FT                   /product="sugar ABC transporter, ATP-binding protein,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF00245
FT                   match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97698"
FT                   /db_xref="GOA:B6IQG2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQG2"
FT                   /protein_id="ACI97698.1"
FT                   /translation="MTRPAPTPDATRSDSVPFAVELLGIDKRFGPVHANRDVTIRFAPG
FT                   SIHGLVGENGAGKSTLMSILYGFYQADGGEIRVGGKPARIATPQDAIRLGIGMVHQHFM
FT                   LVETFTVLENLLLGAEGGARLGPARERTRVEVEELESSFGLEVPLDARVSDLPVGVQQR
FT                   VEILKALHRGAEVLILDEPTAVLSPPEVAQLFRILERLREQGRTVVLITHKLKEIMAVT
FT                   DRVTVLRQGQVVAEFATAGTDEQQLADAMVGRRASLSLEKAPAAPGAPVLEVRDLSVVD
FT                   ALGVERLKSVGFDLRAGEIVGIAGVAGNGQSELLHALAGMTAPSKGSIRLKGTEIAGLT
FT                   PGEVRRRGVAHVPEDRLRLALVKPFPAYQNAILGYQDDAGLGRGPWLDWRRALERTAAL
FT                   MERFDVRPRQPGLRSSLFSGGNQQKLVMAREITRDPDVLLVGQPTRGVDIGAIAFIHRQ
FT                   LVDLRDRGKAILLVSAELDEIMALSDRILVMCDGRIVGGLAPSEASDGRIGRMMAGIAD
FT                   PLPASGAGATA"
FT   gene            241341..242462
FT                   /locus_tag="RC1_0250"
FT   CDS_pept        241341..242462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0250"
FT                   /product="sugar ABC transporter, permease protein,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF05787"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97699"
FT                   /db_xref="GOA:B6IQG3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQG3"
FT                   /protein_id="ACI97699.1"
FT                   /translation="MSAGMTAADGLPRWVSLALLPAINITVALLVSALVILAIGEDPAG
FT                   ALWTMLVGAFGSGTGLGYTLYYATSLIFTGLSVGVAFHAGLFNIGSEGQAYIGGLGVGL
FT                   VCLTLGGWPWWAALPLTVLAAMAFGGAWAFIPGYLQAYRGSHVVITTIMFNFLASALMV
FT                   YLLVNVLIRPGQMSPESREIDPSLFLPTLHDMLGALGLEIDVTPLNLSFFLALAACLLV
FT                   WLFIWHTRQGFALRTVGANEQAAHYAGIDPRRTVIVAMLISGALAGLLGINEIQGVQHR
FT                   LMLNFPAGMGFTGIAVALMGRAHPAGIIPAAILFGALYQGGAELAFEYQSISPELVVVI
FT                   QGVVILFAGALEHLFRPALVRLFARRGDRAAEA"
FT   gene            242464..243432
FT                   /locus_tag="RC1_0251"
FT   CDS_pept        242464..243432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0251"
FT                   /product="sugar ABC transporter, permease protein,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF02608"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97700"
FT                   /db_xref="GOA:B6IQG4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQG4"
FT                   /protein_id="ACI97700.1"
FT                   /translation="MDSVWLLSLLDSTVRLAAPLILAAMAGYFSERAGVVDLALEGKML
FT                   AGAFAAAAAAAATGSAWLGLGAAIAASVLLALLHGFACISQKGEQVVSGVAINTIALGL
FT                   TTVLASAWFGLGGRTPSLEAGARFQEITLPLAETLRPVPLLGPVYAELVSGHTLLAYVA
FT                   FAAVALAAWVSAQTRFGLRLRAVGENPAAVDTAGISVTGLRYQAVAIAGVLCGIAGAYL
FT                   STAQGAAFQENMTAGKGFLALAALILGKWRPVPAMAACLLFAAADAVQTRLQGVPLPGV
FT                   GQVPVQLIEALPYLLTVLLLAGFVGRAIPPKALGTPYVKDR"
FT   gene            243576..245561
FT                   /gene="cpdB"
FT                   /locus_tag="RC1_0252"
FT   CDS_pept        243576..245561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpdB"
FT                   /locus_tag="RC1_0252"
FT                   /product="2',3'-cyclic-nucleotide 2'-phosphodiesterase"
FT                   /EC_number="3.1.4.16"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97701"
FT                   /db_xref="GOA:B6IQG5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="InterPro:IPR041827"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQG5"
FT                   /protein_id="ACI97701.1"
FT                   /translation="MIRALGRRRPFAGLALLAALVLVPLLPARAEDRIELQVLTTTDLH
FT                   MALMDYDYYADRQDPSIGLVRVASLIRAARAANPNTLLLDNGDLIQGTPLGDWVVRERG
FT                   IGPGRPHPAMVALNHLGYDAAVLGNHEFNFGLDVLKQTYAAAAFPVLAGNVFVVDGDDD
FT                   PANDRPLYPGYTILERQLRDTAGAMHTVRIGVIGVLTPQIMVWDRDKLDGKVTTRDIVD
FT                   TARRLVPEVRAAGADIVIALSHAGLSGAPRVGGEEQASAYLTEIPGIDAVVTGHSHGVF
FT                   PGPDYAGLPGADLTKGTVNGVPLVMAGYSGNQLGVIELTLEQRDGRWTVADGRGSTRPL
FT                   TERRDGRNVPAAEPDAGLAALLATDHQGTLAYVRRAVGRTSGPIHSYCAFVGDTPGLEL
FT                   ISEAERFYMERALRGTPHAGLPILAAAAVFKSGGRFGPDFYADIPAGEIAIRNIADIYP
FT                   YPNMLVAVKVTGAQVREWLEMSARVFNRIDPADAKPQMLLDRRVPGYNFDVIDGVTYAV
FT                   DLTQPPRYDRDGKLAAPDAHRIRDLSFQGKPIDEAQEFIVVTNNYRANGGGSFPGLDGS
FT                   TVVFQAPETAQEAILDYIRTQGVVEPRTDSTFRFQPVTAPVTVLYDSSPRTRQHLAECP
FT                   TLTYHGPGENGFDLFRVDLSGKGTRP"
FT   gene            245558..246088
FT                   /locus_tag="RC1_0253"
FT   CDS_pept        245558..246088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0253"
FT                   /product="nucleoside 2-deoxyribosyltransferase, putative"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97702"
FT                   /db_xref="GOA:B6IQG6"
FT                   /db_xref="InterPro:IPR007710"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQG6"
FT                   /protein_id="ACI97702.1"
FT                   /translation="MSAAPRVYLAGPDVFLPDPMAAAETMRAACAAAGLEGVFPLDAAL
FT                   VRMHEEPLTAFAARIRAANLDLIRGCAGVIANVSPFRGPSADDGTAYEMGFATALGLPV
FT                   FTWSSDTRSLLARTRDLIDLFAHGADWRDAEGMLVEEFGLPVNLMLVDPATGPVHPHFE
FT                   AAVATAAARLLTD"
FT   gene            complement(246211..246399)
FT                   /locus_tag="RC1_0254"
FT   CDS_pept        complement(246211..246399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0254"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97703"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQG7"
FT                   /protein_id="ACI97703.1"
FT                   /translation="MEEVKLPRRRLLVHAVHSRPGHPPHVEFLVDGRSSDRLSLALEVV
FT                   NDPERFRRLGPTTQNAA"
FT   gene            246749..247348
FT                   /locus_tag="RC1_0255"
FT   CDS_pept        246749..247348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0255"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF00149
FT                   match to protein family HMM PF02872"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97704"
FT                   /db_xref="GOA:B6IQG8"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQG8"
FT                   /protein_id="ACI97704.1"
FT                   /translation="MFDWILDVITSAGYLGLVALMFLENLFPPIPSELIMPLAGFLAAR
FT                   GEMDPVLVVLTGTLGSVLGALPWYWVGRRFGRDRLDRLVERHGVWLTMEPCDVARAHDW
FT                   FRRRGWRAVLFGRLVPAVRTLISVPAGLARMRLLPFLALTTAGSLAWVTVLTGAGYLLQ
FT                   DQYQRVEAVVNPVSTAVVAGILLLYVWRVGTRLARG"
FT   gene            complement(247388..248227)
FT                   /gene="uspA"
FT                   /locus_tag="RC1_0256"
FT   CDS_pept        complement(247388..248227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uspA"
FT                   /locus_tag="RC1_0256"
FT                   /product="universal stress protein UspA, putative"
FT                   /note="identified by match to protein family HMM PF05014"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97705"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQG9"
FT                   /protein_id="ACI97705.1"
FT                   /translation="MGFKDILVHVRPHAVDGESVQVALRLAAWHGARLTGLLTLRDLAM
FT                   LKLLYPSSAAIVEQRVQEAARLATDAEERLRTLAGSGGVEFGFQVGEGDTAELLGLAGR
FT                   YHDLVVIGQTDPGTEELGVDVPEAALGTCGRPVLVVPRQGAFPVVGRHVLVAWNGSRES
FT                   ARAVQAALPFIALAERITVLLGRSKERYPSITRRPPVDIAVHLARHAGPGCAPVEAVPL
FT                   EVPEAEAGAGILRHAAAGGADLLVMGAYGRSWLREWALGGATRHVLRNAPLPVLMAH"
FT   gene            complement(248297..248968)
FT                   /gene="pac"
FT                   /locus_tag="RC1_0257"
FT   CDS_pept        complement(248297..248968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pac"
FT                   /locus_tag="RC1_0257"
FT                   /product="puromycin N-acetyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97706"
FT                   /db_xref="GOA:B6IQH0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQH0"
FT                   /protein_id="ACI97706.1"
FT                   /translation="MVSVPHEARAAAASPRVAGPKDRAPLARLLAAAFATDPVMDWWVR
FT                   DGAGRAEALYGFYDDQLAEVLPFGTSFMAGDASACAIWLPPDMAVRHYPFWRKLMMVPR
FT                   YLRFCGVARARRLIALGDMMERNHPPAPPHWYLYFLAVDPALKGRGLGSAILAATLARV
FT                   DADGLPAYLENSTPANLRLYERHGFRLVKQDRPLPGAPCQWTMWRGPAPVSTPVGSFGA
FT                   A"
FT   gene            complement(248970..249455)
FT                   /locus_tag="RC1_0258"
FT   CDS_pept        complement(248970..249455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0258"
FT                   /product="thioesterase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97707"
FT                   /db_xref="GOA:B6IQH1"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039298"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQH1"
FT                   /protein_id="ACI97707.1"
FT                   /translation="MARSAACATPFSGASEDGADTDLPLVTEGPFAGWRSWSGRDPWET
FT                   LTGPFYFRREGEVVRCAFRVEPKHLNGLGVIHGGCLMTFADFALFAIAHPLIGTGPAVT
FT                   VSLHGDFIAAGKEGELVEATGEVTRASRSLVFVRGLLTSGERTLFGFSGIIRRLSGP"
FT   gene            complement(249455..249940)
FT                   /locus_tag="RC1_0259"
FT   CDS_pept        complement(249455..249940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0259"
FT                   /product="MaoC-like dehydratase, putative"
FT                   /note="identified by match to protein family HMM PF00582"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97708"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQH2"
FT                   /protein_id="ACI97708.1"
FT                   /translation="MPAQPRYLEDIEPGQTVEFGDRLVTAEEIVAFARDYDPQPFHLDE
FT                   AAGARTHFGGLVASGWHTAAMVMRMLVDEYLHPETSLGSPGLDELRWHRPVRPGDRLRV
FT                   RVTTLEVRRSQSKPSIGIVRQRLEALNQDGEVVMSHVGMGMVRARTLPADMAAGGGA"
FT   gene            complement(250087..250857)
FT                   /locus_tag="RC1_0260"
FT   CDS_pept        complement(250087..250857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0260"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97709"
FT                   /db_xref="GOA:B6IQH3"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQH3"
FT                   /protein_id="ACI97709.1"
FT                   /translation="MTDQIDEIDEFDLHAYLDGQLEPRREAAVRAFIEANPATRERMRA
FT                   YAEQMLLLRMSQAEGEADGREAAALPVMRHLLARWQRSRPRERALRAAVGLLLFGAGWI
FT                   AAELSDRMPALVLPAYAQDALAVHEALGGADAKVIEAAGVRQEEVSRWLSARMGEPVKL
FT                   PELHMIGLRLVGATLEDGDQGMSGMLVYEDRTGRRVTLAMVPEESAGPDQLELSEVHGY
FT                   VVGCWRGKNFAYALVARTSETQVAQIAAAFGSSR"
FT   gene            complement(250854..251372)
FT                   /locus_tag="RC1_0261"
FT   CDS_pept        complement(250854..251372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0261"
FT                   /product="RNA polymerase sigma-70 factor; ECF family
FT                   protein"
FT                   /note="Contains Sigma-70 region 2 and Sigma-70 region 4,
FT                   see PF04542 identified by match to protein family HMM
FT                   PF03061 match to protein family HMM TIGR00369"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97710"
FT                   /db_xref="GOA:B6IQH4"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQH4"
FT                   /protein_id="ACI97710.1"
FT                   /translation="MPSNPFEDQLAEQIAALRRYALVLTRSRTEAEDLVQDCLAKALSC
FT                   ADQWQPGTDLRAWLFRILYTCHVSLLRKQQVRARAQQGEVPETSADPEQPRRLEVKRVL
FT                   SALDRLPAAQREAIVLVALEDMKYEDAARRLGIPVGTLMSRLARGREALRRLMDEGVRP
FT                   RLRLVGGKS"
FT   gene            251536..252315
FT                   /locus_tag="RC1_0262"
FT   CDS_pept        251536..252315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0262"
FT                   /product="RNA methyltransferase, TrmH family, putative"
FT                   /note="identified by match to protein family HMM PF01575"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97711"
FT                   /db_xref="GOA:B6IQH5"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQH5"
FT                   /protein_id="ACI97711.1"
FT                   /translation="MRRDRYRLIESPQNPGFKLWDSLLDRRGLRRHGRFLLAGRKTVPE
FT                   ALMRHPDRFGTVLAADPGQIDALPLPPGIEALLLAPALFERLDVTGTGFPLLVGSVPAM
FT                   PAIDLSAPPVGLELVCALGDPANLGALMRSAAAFGVRTLILLEEAAHPFHPKCLRAAAN
FT                   AQFELSLRTGPGWRGLAGIAGPVFGLDGGGHDLTDFDWPADVRLVLGEEGQGLPPDLPV
FT                   ERLAVPTTGAVESLNAMVAASIALYSHHASRRHRPDA"
FT   gene            252459..252800
FT                   /locus_tag="RC1_0263"
FT   CDS_pept        252459..252800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0263"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97712"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQH6"
FT                   /protein_id="ACI97712.1"
FT                   /translation="MATQETPLREAAAALRGDSDPAPGAEAPLVERLTRELMLARARID
FT                   ELQRRLETVQEQRLEEARELGEVRRHREGLLFKVDYLEEKLDIAKRAVRPRRRSLWQRL
FT                   TGSGSSAPD"
FT   gene            252904..254454
FT                   /gene="glpD"
FT                   /locus_tag="RC1_0265"
FT   CDS_pept        252904..254454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpD"
FT                   /locus_tag="RC1_0265"
FT                   /product="glycerol-3-phosphate dehydrogenase"
FT                   /EC_number="1.1.5.3"
FT                   /note="identified by match to protein family HMM PF00588"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97713"
FT                   /db_xref="GOA:B6IQH7"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQH7"
FT                   /protein_id="ACI97713.1"
FT                   /translation="MDGPVDLLVVGGGINGTGIARDAAGCGLSVVLCEQDDLAAATSSA
FT                   SSKLIHGGLRYLEHREFRLVRESLAEREVLLHSAPHIIRPLRFVLPHHDGLRPAWMLRA
FT                   GLFLYDHLGWRPGVRSHLPPTRTLHLRTDPAGVPLRPAFRLGFAYSDCWVEDSRLVVLT
FT                   ALDAAERGARILTRTRLAAARRAGDVWEAELEDAGTGRRTPLRARALVNAAGPWVASVQ
FT                   ALLGWPAGRRVRLVKGSHIVVPRLYEGEQAYTLQNADGRIVFVIPYEGAFSLIGTTDVP
FT                   VTGDPGTVTASAEETAYLCGVVADYFERPPTPADVVWSFAGVRPLHDDGSADASAVTRD
FT                   YALDLDGPADGQEDGPPLLTVHGGKLTTFRRLAEDALVKLMPRLGRQAAPWTEGATLPG
FT                   GDIPDGDVDRFEAETARRYPFLPPAMRHRLCRAYGTRIARVLGDARSLAALGRDFGGVT
FT                   EAELDHLRREEWARTGEDVLWRRSRLGLHLDADAMAGVGAWFAGERAPAPIPASARPG"
FT   gene            complement(254426..255961)
FT                   /locus_tag="RC1_0264"
FT   CDS_pept        complement(254426..255961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0264"
FT                   /product="Serine carboxypeptidase, putative"
FT                   /note="identified by match to protein family HMM PF04542
FT                   match to protein family HMM PF04545 match to protein family
FT                   HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97714"
FT                   /db_xref="GOA:B6IQH8"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQH8"
FT                   /protein_id="ACI97714.1"
FT                   /translation="MMRVGALLSAFLLALAVASPALSQDAKPPAGKEAEKATDLPEPRT
FT                   WKVERSGTFAGTKIDYAVVAHETRLKNDKGEPVADMFSIAYLRQGVKDPTRRPVTFLFN
FT                   GGPGSASLWLHMGVFGPRRIDVPSDGGNAGAPPYPIVDNAQTILDVTDLVFIDPVGTGY
FT                   SRVVGKGEEKDFLGVSEDARSVAKFIRQWLSDNKRWNSPKFLGGESYGAVRTAAVAKEL
FT                   SKGDSWVSLNGLLLISGAVDFATLDFGRGNDEAYWTFLPSYAANAWYHGKVPNKGNFEA
FT                   FIEEARRFALDRYAPALLKGNRLTPAERAAIVKELARFTGLSETFIDRANLRVSAARFQ
FT                   KELLRDQGKTIGRFDGRYTGDDFDDAGETFDNDPSYYGVAGAYTVAINDYMERDLGIDM
FT                   DREYKVLGSMWNRWNWSVGENSSRNGYIDVTPWIGQAMRENKDLRTLSASGYYDLATPF
FT                   FAKENTLNNNGVPTERVTFTYYQGGHMMYVNKPALDKLVDDVRKFIQAGLKQE"
FT   gene            256164..257183
FT                   /locus_tag="RC1_0266"
FT   CDS_pept        256164..257183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0266"
FT                   /product="Malate/L-lactate dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97715"
FT                   /db_xref="GOA:B6IQH9"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQH9"
FT                   /protein_id="ACI97715.1"
FT                   /translation="MMSGPIRMTLQEAEGLAMDALVACRTSPDTARATARALVQAEADG
FT                   QKGHGLSRVPCYAAQSRNGKVDGFARPSVRKLAPSVLRVDAAHGFAYPALDLAVAEIAP
FT                   LARSQGIALATIHRSHHFGQAGAVVERLADRGLVGLLLGNAPKAMAFWGGRQPMIGTNP
FT                   VAIAAPVPEGPPLVIDMALSQVARGKVMAAQQVGEPIPEGWALDPDGNPTTDAAAALKG
FT                   SMLPIGGAKGAALALMVEVLSAALTSSHFGWEASSLLDDVGPPPDLGQTLVAIDPAPSS
FT                   EGGFLSRMGDLIAAFAREPGVRPPGSRRLENRARAAREGITLPPTLHAEILSLLEAAA"
FT   gene            257254..258750
FT                   /gene="glpK"
FT                   /locus_tag="RC1_0267"
FT   CDS_pept        257254..258750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="RC1_0267"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /note="[synonyms] ATP:glycerol 3-phosphotransferase
FT                   Glycerokinase identified by match to protein family HMM
FT                   PF00450"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97716"
FT                   /db_xref="GOA:B6IQI0"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6IQI0"
FT                   /protein_id="ACI97716.1"
FT                   /translation="MGERPCILAIDQGTTSSRAIVFDAAASVLAVAQTEFPQHYPADGW
FT                   VEHDPEDIWRSTLEVSRQALQAAEAKGARVVAIGVTNQRETTLIWDRRTGRPIHNAIVW
FT                   QDRRTAADCAALAADGNETMVQARSGLLLDPYFSATKAAWLLDHVSGARMRAENGHLAF
FT                   GTVDSFLLWRLTGGRVHATDATNASRTNLFNIHTQDWDPELLRLFRVPAALLPEVKDSA
FT                   DSFGQTDPALFGRPLPVLGLVGDQQGATIGQCCFEPGTIKSTYGTGCFVVVNTGATPVP
FT                   SRHRLLTTIAYRIDGRTDYALEGSIFIAGAAVQWLRDGLGIVRTAAETEALAAGLPDNG
FT                   GVYMVPAFTGLGAPHWDAAARGTLTGLTRASGRAHLARAALEASCYQTCDLLAAMREDG
FT                   ATPAALRVDGGMVANGWMVQFLADLLDLPVDRPVVMETTALGAAYLAGRKAGLYGDFAE
FT                   FTRVWRRDRRFDPAMPTSTRTALLAGWQDAVRRTRSGAPD"
FT   gene            complement(258775..259299)
FT                   /locus_tag="RC1_0268"
FT   CDS_pept        complement(258775..259299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0268"
FT                   /product="conserved hypothetical protein"
FT                   /note="[contains] ACT domain identified by match to protein
FT                   family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97717"
FT                   /db_xref="GOA:B6IQI1"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR016867"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQI1"
FT                   /protein_id="ACI97717.1"
FT                   /translation="MHVSAILTVIGRDRPGLTQALADVVAETGGNWGDSQLARLGGHYV
FT                   GSVLVELPAGGLPALEQALRCLPDDLTVTLVEVTPEPHPPEGSRFSVSLVGQDRQGILR
FT                   EVTSVLAEMGVNIESLETGLEHEAWTGQKLFRADVQIFVPASLPLEVVADALEHISGEI
FT                   MVDINLSEALR"
FT   gene            259511..260623
FT                   /gene="adhC"
FT                   /locus_tag="RC1_0269"
FT   CDS_pept        259511..260623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adhC"
FT                   /locus_tag="RC1_0269"
FT                   /product="alcohol dehydrogenase class III"
FT                   /EC_number="1.1.1.1"
FT                   /note="Also called S-(hydroxymethyl)glutathione
FT                   dehydrogenase and Glutathione-dependent formaldehyde
FT                   dehydrogenase; identified by match to protein family HMM
FT                   PF02615"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97718"
FT                   /db_xref="GOA:B6IQI2"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQI2"
FT                   /protein_id="ACI97718.1"
FT                   /translation="MKTRAAVAVAAGKPLEIMEVDLAGPKVGEVLVEVMATGICHTDAY
FT                   TLSGQDSEGVFPSILGHEGAGIVREIGPGVTSVAVGDHVIPLYTPECRQCKTCLSRKSN
FT                   LCTAIRTTQGKGVMPDGTSRFSRNGEPLFHYMGCSTFSNFTVLPEIAVAKIRPDAPFDK
FT                   VCYIGCGVTTGIGAVIYTAKVEPGASVAVFGLGGIGLNVIQGARMVGADRIIGIDINPA
FT                   KRAMAEAFGMTHFVNPDEVGRDKVVQAVMDLTGGGADYSFDCTGNVQVMRQALECCHRG
FT                   WGQSIIIGVAPAGAEISTRPFQLVTGRVWKGSAFGGARGRTDVPKIVDWYMEGKINIDD
FT                   LITHTMPLEKINDGFELMHHGESIRSVVVY"
FT   gene            complement(261478..262746)
FT                   /locus_tag="RC1_0270"
FT   CDS_pept        complement(261478..262746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0270"
FT                   /product="C4-dicarboxylate transport sensor protein DctB,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF00370
FT                   match to protein family HMM PF02782 match to protein family
FT                   HMM TIGR01311"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97719"
FT                   /db_xref="GOA:B6IQI3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQI3"
FT                   /protein_id="ACI97719.1"
FT                   /translation="MDDFRQALYEGVLVAFGKAMARFDGFAQAEVMRDVGRELIEYLNR
FT                   KGLGFKETGSVSDLDVLIRLFVANGFAEGVEIVPADRGSTYVWRKLYGAPAYAELHRFS
FT                   DNPFLACPLNLCLYDLAERLGVRMLLHRKAFGPGCHVVESQYEIVPRPPEGEERDQLVV
FT                   HSATLVEQARQREAERSRFLAHASHDLRQPVQAVSIFTELLTQRLAGTEHEGTVDKLQQ
FT                   AVAATQNLLNALLDAAVLDSGQVQPHVSAFPLGPLLASLADQVRDEAAAKRLSLRVVPT
FT                   SAWVVSDPVLLERLLRNLLLNALRFTSSGGVLLGCRPRGRQLALCVVDTGIGIPADKLK
FT                   AVFEDFTRLGEGGDGSSRGFGLGLGVVRRMASVLNHGIEVRSTPGRGSTFAVLVPRSEP
FT                   VGAPAAVSPAPSDGPHASADGPP"
FT   gene            complement(263055..263738)
FT                   /locus_tag="RC1_0271"
FT   CDS_pept        complement(263055..263738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0271"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="identified by match to protein family HMM PF01842"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97720"
FT                   /db_xref="GOA:B6IQI4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQI4"
FT                   /protein_id="ACI97720.1"
FT                   /translation="MTEEAGPSGSERPGGRTQRLPAAERRAQILRVARDLFVQEGIERT
FT                   SLRRIADGAGITPTAIYDHFADKQDLLAAIAGDFLDGLIVAMQEEPADPADPLDRLRAL
FT                   GRGYVRYGAGHPHEYRLVFMTTLPAFSPVPGHRAPPDADPVCPPNKGMQSFGVLEAEIA
FT                   RLLELGLLVPGNRHAYADALWATMHGIVSLLITHAHFNWTPVDELVATATDMLLCGISV
FT                   PGRRI"
FT   gene            263845..264930
FT                   /locus_tag="RC1_0272"
FT   CDS_pept        263845..264930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0272"
FT                   /product="efflux transporter, RND family, MFP subunit,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF00107
FT                   match to protein family HMM TIGR02818"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97721"
FT                   /db_xref="GOA:B6IQI5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQI5"
FT                   /protein_id="ACI97721.1"
FT                   /translation="MVRAPLLPVPLALTALVLAVPLLTGCGRPEAGEAAVGPAPVVVTV
FT                   AEAVPAPGASLVRGTGTLAYKRELPLSFKVSGRIAAISVDVADSVRKGTRLALLDQAEV
FT                   SAQLREAEAAVTRARQDLDRLEPLLEKGFVELSRIETARTSLQAAKARRDAVAFNRSLS
FT                   EITAPADGVVLSRPVEPGEIVPAGAPVLILGDRGSGLIVRVGLADRDIGRIAPGNAAEV
FT                   LLDGRTLPATVDRIAAKSSPGTGVFDVELALDPAPERLSSGRIVGVRIAPVAGADAGLL
FT                   AIPSSAILEGFGMEATVYVLDPETGRVSRRMLTVAGLDGPFTLIAGGLAPGEQVVATGA
FT                   AYLRPGDPVTVAGPQTATIDR"
FT   gene            264938..268012
FT                   /locus_tag="RC1_0273"
FT   CDS_pept        264938..268012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0273"
FT                   /product="AcrB"
FT                   /note="identified by match to protein family HMM PF00512
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97722"
FT                   /db_xref="GOA:B6IQI6"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQI6"
FT                   /protein_id="ACI97722.1"
FT                   /translation="MSGIVGFAVRQWQFMLVLFAMLAAMGVGAFLSIPRAEDPDFPTPI
FT                   FNVIAVLPGADPLDMEEQVTDPLEDALDGLDDVIKITSRTRDGSTVIHVEFDWNSEPER
FT                   KYDQVVREVNALRPSLPDGLVRLEVKKVETSLTNFAQVALVSDRASDRELEERATDLKD
FT                   IIDRIPGIRETEVWGEARTEVRVAVDLGRLAALGIPVSALAEALKAEGAALPLGAVHSG
FT                   ERRFNVKATGDFRSLADIGETTVRAADGRVVKVHDVAAVSWAGDEPSHVTRFNGRRAVL
FT                   VTANMKPGQNIFDLTARLDAALGGFAATLPDTIRIERGFDQSVNVAHRLSRLFKDFGIA
FT                   LALVLVTLVPLGLRASLVVMLAIPLSLAIGLTLLQAAGFSLNQLTIAGFVLSLGLLVDD
FT                   SIVVTENIARHLRLGRPREQAAIEGTRQIAVAVLGCTATLMLAFLPLMFLPEGSGKFIK
FT                   SLPVAVLVTVAASLFVALSIIPFLAGRMLSRHGDPEGNRALRAVMAAIHTVYRPLLHRA
FT                   LERPGLTVLLAAGLFAASLLLVPRIGFSLFPPAGTPQFLVEVDLPDGASRAATQAAVDF
FT                   VEAELRATPEVAWFMGNVGHGNPRVYYNVQPREEDPTHGSVLVGLESWQGEAGVAVLDG
FT                   LRTRLARYPGAQIIVRAFENGPPIEAPVAIRVLGPELDVLKEIAGRVTAAMERTPGTRD
FT                   IVNPVRLNRTDLNLGVDLEKAGVLGVPAGAIDRAVRLALSGEQVALFRESDGDAFPVVL
FT                   RLPLGERHELETLGEIYVPAAGGATPLAAVTDPRFESGPARIDRYNRERAVTVTAYTAT
FT                   GHNTDQVTRAVMAAVAEIPLPPGYRITAGGEAEARARSFAGLSSAILIAVFGIVAVLIL
FT                   EFRSFSASAVVAGVIPLGIVGGLVALHVAGYTLSFTAMIGFVALIGIEIKNSILLVDFT
FT                   TQLRRAGVPLKQAIEQAGEVRFLPVLLTSATAIGGLLPLALEESGLYSPLAVVIIGGLV
FT                   SSTFLSRLVTPAMYLLLAPREVAAASPPAPATAAP"
FT   gene            complement(268046..268579)
FT                   /locus_tag="RC1_0274"
FT   CDS_pept        complement(268046..268579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0274"
FT                   /product="orphan protein, putative"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97723"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQI7"
FT                   /protein_id="ACI97723.1"
FT                   /translation="MLARRRLLSLALAGLGLAGVAGAPGPVLAHRAKAALTTIAWNPRS
FT                   GTLEVVHRLHAHDAEIALNRVEKVAAPDLADLKTRAILALYVEKNFALADAAGAPLALT
FT                   LVGAEVEMDHVYVYQELALPAPPAELAVRDTIMLDVFSDQLNQVNIDFSADGTGGVRTL
FT                   MFRGTDDWKTAKRG"
FT   gene            complement(268588..271170)
FT                   /locus_tag="RC1_0275"
FT   CDS_pept        complement(268588..271170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0275"
FT                   /product="Zn-dependent aminopeptidase, putative"
FT                   /note="No HMMs but some homologs With the same identity;
FT                   identified by match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97724"
FT                   /db_xref="GOA:B6IQI8"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQI8"
FT                   /protein_id="ACI97724.1"
FT                   /translation="MRGWSAWVSVAVGSGFLLLAAASASADAIQQTKGDWEDKFRQLEV
FT                   DLPTPNTYRTASGAPGHQYWQQRADYRIDVKLDAAGKRLTASETVRYTNNSPDTLSYLW
FT                   VQLDQNIYKDDSIARMTETVQTGGARRPATGGGDNGDRLTYNGLAREQIFKDIEFGVEI
FT                   RAVTDEAGHPLPYRVVDTMMRIDLPQPLSPGKATTFRIDWAYNIVDEERVGGRSGYEHF
FT                   KDTDTDLFFLAQWFPRMAAYTDYAGWQHKAFLGRGEFTLEFGDYDVSITVPADHIVAAT
FT                   GELQNPSDVLTPEQRRRLEQARTATSPVFIVTPDEAKENEKATETATRTWVFRAKNVRD
FT                   FAWSSSNKFIWDAMGFRQDSPQQPQVLAMSFYPNEAEPLWSKYSTQAVVHTMEVYSKFS
FT                   FPYPYPTAQSVNTWDRGGMEYPMITFNGSRPVKDKKTGKVTYSSQAKYGLIGVVIHEIG
FT                   HIYFPMTVNSDERQWSWMDEGLNTFLQNVAHLEWEENFGGQDRNPNLPDTITAYMVSEN
FT                   QVPVMTQSDSILQFGPNAYTKPATALTILRETVLGRDLFDHAFREYATRWKFKRPTPAD
FT                   FFRTMEDASGVDLDWFWRGWFYTTDHVDMAIDGVREYTISTRNPEVEKPLARTEQRQER
FT                   VEPLMQIHNREDGLKTRVERIPDLKDFYNENDQHTVTNKDRNDYADLIKGLEDWERAAL
FT                   ERAQKDGDFIYFADFTNKGGLVMPLPLKLTFADGSSEFVMIPVEIWRYNPKRVTKMLIR
FT                   PKRLVSIELDPRHEIADADRSDNSFPRRIEASRLELFKDRESTRNLMSDMLVELKSERT
FT                   GDTKGEADEGKAGEGKAGEGKTVPLGPAPKDAPRDGKPAPAAAPAPSK"
FT   gene            complement(271283..272227)
FT                   /locus_tag="RC1_0276"
FT   CDS_pept        complement(271283..272227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0276"
FT                   /product="hydrolase, alpha"
FT                   /note="identified by match to protein family HMM PF00873"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97725"
FT                   /db_xref="GOA:B6IQI9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQI9"
FT                   /protein_id="ACI97725.1"
FT                   /translation="MKLSLPFLVVLVASLFGLGVWLHTPDRPRDELEALYLRSPADYVQ
FT                   AAGMRLHVRDDGPRDAPAVVMLHGFGASLHTWEGWAQGLAGPFRVVRFDLPGFALTGPD
FT                   PTGDYGDERAMVVLEALLDRLGIARASLIGNSIGGRIAWKFAALHPDRVEKLVLVSPDG
FT                   FASPGFEYGRKAEVPGILNLMRFILPTAAVRANLQPAYGDPAVLTDQLTTRYRDLMLAP
FT                   GVRDAMFARLEQVMLEPPEPLLRRIQAPTLLLWGEKDAMIPVSNAADYARALHDSRTVT
FT                   FPDLGHVPQEEAPARSLEPVRKFLAEGYPGLDG"
FT   gene            272400..272645
FT                   /locus_tag="RC1_0277"
FT   CDS_pept        272400..272645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0277"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97726"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQJ0"
FT                   /protein_id="ACI97726.1"
FT                   /translation="MTENAAARYEAMRDRLAGLVEAELTAAALAQQTAALLSDTAMREQ
FT                   AGALLRDLRDLLDRASAEAETDLQTWRAERGIHPDD"
FT   gene            272837..275311
FT                   /locus_tag="RC1_0278"
FT   CDS_pept        272837..275311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0278"
FT                   /product="TonB-dependent receptor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97727"
FT                   /db_xref="GOA:B6IQJ1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQJ1"
FT                   /protein_id="ACI97727.1"
FT                   /translation="MPPSRRSRATKKTGGAFMPMVTTRGRLVRGTAVLALMAGAPPALA
FT                   QSAPPGGSPPPQGGFIEEILVTARKREETLQDVPFSINALGQAQLRARGAETLEDVSRN
FT                   VVGLTIENLGPGQSQVAVRGISAGQIVRDQPGVKEQVGVYLDESVISLSLFTPDLDLFD
FT                   LNRVEVLRGPQGTLYGSGSLSGTIRYITNRPTTEQVEGTAEAGIETLKDGGTGWSARGA
FT                   VNVPLAEKAAFRAVGYYTDYAGFVDAVRPDGSIDKNVNDGTRKGFRLSALVEPTEGLSV
FT                   VPRVIYQKIETNGFNREDVFNILANDLTPTTDPQRLYRFDERQQFTQLEEQFEDDFLLA
FT                   DLTLEWELDAVTLTSITTYTDRDLLVVRDASPLTGSITGQPGSFAPGGLPRSVYSIATP
FT                   LNDTTDLEVFTQEARVASNGDGPFQWVLGAFYSDIERTYAQRLDVPGFEALTGIPTAGP
FT                   LAPRDVLYYSLIPYDFKQLALFGEGSYDLTDQLSVTAGVRWFDFEEERVLNFDGLFADQ
FT                   SIGQAGKTSSDGFSPRVIVSYAATPDLTLNAQVSKGFRLGGINDPLNAPLCSAQDLVTF
FT                   GGRSSFDNETVWNYEVGAKLGFAEGRGQLNLAGFYADISNLQVTLDAGTCSSRIVFNAD
FT                   ARTMGGEAELSFQVTEALLLAVSTSYTDSEFTETVSSVGAGGAATVVGGIKDGNRLPTV
FT                   PRFQFNASANYEQEIADDLLGFVTATYQHVGSRYTQAVDQDPAAVGTVTRIPIGGQPAT
FT                   SFSFDPKLPAYDIVNLRLGVRRDTWEIAGYVNNLFDENARLSLDRERGFRARVGYQVIK
FT                   PRTIGLNVLTRF"
FT   gene            complement(275377..275994)
FT                   /locus_tag="RC1_0279"
FT   CDS_pept        complement(275377..275994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0279"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97728"
FT                   /db_xref="GOA:B6IQJ2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQJ2"
FT                   /protein_id="ACI97728.1"
FT                   /translation="MAGRTAPARRGGSKAEQSATTRAALLAEAQRHFAVKGFAATTAED
FT                   ILQPLGLTRGALYHQFSGMRDLFRTVCRDMMDSCGNEVLSETGAATGDPVEQLRAGCIA
FT                   FLRRAAEPDFARIVLTDGPAVLGWEAMAELDQGTWYPRFMETVRGAIAAGASLPADTDA
FT                   AIRIVDGAVGKLAEWVATATDDREEVLRRAIAAVEALIRDPA"
FT   gene            276246..277382
FT                   /locus_tag="RC1_0280"
FT   CDS_pept        276246..277382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0280"
FT                   /product="HlyD family secretion protein"
FT                   /note="Contains TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97729"
FT                   /db_xref="GOA:B6IQJ3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQJ3"
FT                   /protein_id="ACI97729.1"
FT                   /translation="MRIRSWVIAVLAMLAILAGLGGYKTIEITRAIAAAESYPEQRETV
FT                   QGARAEPGTFTTSARTVGTVIALRHVELRNELAGRVIDVAFDSGDVVEEGQVLVRFDTA
FT                   QEEADLAALKAEADLARLTLERQQRLVKTQATAEATLDQARSQLAALRARMQGMEVQIA
FT                   KKTLRAPFRARVGLRDLHPGAYLSEGTLITGLQGVSDDAFVDFAFPQDIAPLLAGSGTV
FT                   ALSGAQLPGGTAVARIVARDAAVDDGARSLRLRAVVPGLGDALTPGAFVDVVAETGAPR
FT                   PALFVPLTAVRRAPHGDHVFVLAQEDGQTRARQRFVRLGPVRGAEVAVLSGLEAGETVA
FT                   ADGSFKLREGMLVTVNGLYTRPAPGGEAATDAAGAPAH"
FT   gene            277393..280476
FT                   /locus_tag="RC1_0281"
FT   CDS_pept        277393..280476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0281"
FT                   /product="AcrB"
FT                   /note="identified by match to protein family HMM PF00593
FT                   match to protein family HMM PF07715"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97730"
FT                   /db_xref="GOA:B6IQJ4"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQJ4"
FT                   /protein_id="ACI97730.1"
FT                   /translation="MRFVELFVRRPVVAIVVNLLILLIGLRAAQELPVQQFPQIESASV
FT                   VVTTVYVGAPAEVVKGFITTPVERAVSSISGVDYVESSSVAGVSTVTVRLRLNHSSTVA
FT                   LAEIGNRLDQIRNELPNEAEPPTVEVIRADRSYAAFYVAVTATTLDLPRLTEYLDREVQ
FT                   PRLTVLPGVQKVGLEGARPQAMRIWLDAARMDAFGISADDVQAALTRNNFLAAIGQSKG
FT                   NAVQVDLLTDTDLKTEAEFEQLIVRESADSIIRLSDIARISLASEEPAADVRLDHVPAV
FT                   YLSVWPLPGSNEITLGYDLRAELDRIRAALPPGVEIKMAYDGTIYMERALTEIGKTLAE
FT                   TVLIVGLVVFLFLGSVRTALVPLVAIPVSLIGAAGMMLALGFSFNLLTLLAIVLSVGLV
FT                   VDDAIVVVENVSRFMREGRSRTEAALASARQLFGPIVAMTITLAAVYAPIGFLSGLTGV
FT                   LFREFAFTLAIAVLMSGVVAITLSPVMSARFAAEGGREGWFTRRVNTIFDAVRDAYARG
FT                   LDRTLRYRPPVLAFGLFVALLSVPLFLFSGKELAPVEDQGDIFIMVTSAPDATLDYTSG
FT                   HMDALVDTAKTFPETNFLWQVVLPSNGFGGVVLKDWTERDRSAQELQPLFFEALSQISG
FT                   IQAFPVLFPALPVSGNYDVELVVKGIASPEEMAAFSQRLVGAAFGSGLFMYADTDLRID
FT                   LPQVKIAVDRERVADLGMDLAEVGRQLGVLLAGNYVNRFNYDGRAYKVVPQVGNDAKAT
FT                   ADQLLDLKIRTPSGAAVPVSSIARLETGAAPRALTRFQQADSFRVYGGVVPGVTKEQAL
FT                   SALEQAAREILPADYVLDHAGESRQIRQEGNTLIGTLGFALLLIYLVLAAQFGSFRDPL
FT                   VVLLGSVPLALSSALVFPFLSLTTVNIYSQVGLITLVGLIAKNGILVVEFANHLQEEGR
FT                   SKLEAVREAALTRLRPVLMTTAATVVGHFPLVLVEGPGAAARNSIGIVLVAGMAIGALF
FT                   TLFILPSVYMLIAADRRAAPEAVPGTGETLPPVRAAAE"
FT   gene            complement(280665..281366)
FT                   /gene="bchJ"
FT                   /locus_tag="RC1_0282"
FT   CDS_pept        complement(280665..281366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bchJ"
FT                   /locus_tag="RC1_0282"
FT                   /product="bacteriochlorophyll synthase 23 kDa chain"
FT                   /note="[synonyms] bacteriochlorophyll 4-vinyl reductase
FT                   identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97731"
FT                   /db_xref="GOA:B6IQJ5"
FT                   /db_xref="InterPro:IPR004096"
FT                   /db_xref="InterPro:IPR010249"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQJ5"
FT                   /protein_id="ACI97731.1"
FT                   /translation="MSVDSVSPLPAPVADRGGQGQPPGGSGHGADQGGTDHGVDMAFRI
FT                   GPNAIIQMEAVLRDRLGPAETVRLLTEAGLSRYLDTPPGQMVDEREVNALHRVLRAELG
FT                   VAQARRLSHEAGQRTGDYLLAHRIPKPVQVILKLLPAPLASRVLLSAIGKHSWTFSGSG
FT                   TFTIRSASPAVVSIENCPIARGATGTEPVCDFYTGTFERLYRVLVHPRAQAEETECEVT
FT                   GASRCTFEVRW"
FT   gene            complement(281379..283151)
FT                   /gene="bchE"
FT                   /locus_tag="RC1_0283"
FT   CDS_pept        complement(281379..283151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bchE"
FT                   /locus_tag="RC1_0283"
FT                   /product="magnesium-protoporphyrin IX monomethyl ester
FT                   anaerobic oxidative cyclase"
FT                   /EC_number="1.14.13.-"
FT                   /note="identified by match to protein family HMM PF00529
FT                   match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97732"
FT                   /db_xref="GOA:B6IQJ6"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQJ6"
FT                   /protein_id="ACI97732.1"
FT                   /translation="MRVLLIHPNYHSGGAEIAGNWPPAWAAYLAGALKQAGYTDFIFVD
FT                   AMTNNLSEDEVRAIFEKEKPDLVGATSITPSIYKAERLLQIAKEVNPNIVTILGGIHAT
FT                   FMYQQVLSEAPWVDAIARGEGEAILVNLCRAIEDGTWATDRKSIKGIAFIEDGKIVATP
FT                   AEPPIADVDTINPDWSILEWDKYIYIPMGVRVAIPNMARGCPFTCSFCSQWKFWRNYRV
FT                   RDPKKVVDEIETLVRDHKVGFFILADEEPTIHRKKFIQFCEEMERRKLPVLWGINTRVT
FT                   DILRDEELLPLYRRAGLVHVSLGTEAAAQLKLDLFNKETTIAQNKKAIELLQKNGIVAE
FT                   AQFIVGLENETAETLEQTYQMAMDWGPDMANWAMYTPWPFSDLFRDLGDKVEIYDFEKY
FT                   NFVTPIIKPAAMDRAELLDRVMNNYRRFYMRKSLFHYPWIRDKVKRKYMLGCLKAFLKS
FT                   GFERKFYDLGRVDYWGPQSKKKVDFKFDRNRTAALLPLADDWEAAADKARKARLKAAEK
FT                   EKANQQPVDEVELEDTADIEAKGIVIPMACGGGKDQLPDEVEETTEAGKKPAAVPMACG
FT                   GGKEQLAETVGGDD"
FT   gene            283326..283745
FT                   /locus_tag="RC1_0284"
FT   CDS_pept        283326..283745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00873"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97733"
FT                   /db_xref="GOA:B6IQJ7"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR041088"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQJ7"
FT                   /protein_id="ACI97733.1"
FT                   /translation="MVETVHELRPKAAESEKITINLGFVDLGHIDLLVAEGFYSNRTDF
FT                   IRTAIRNQIERHGEAVRQSVKRKAVDLGLRHYTRQDLEAARDAGSPLRIQVLGLASIAT
FT                   DVTPELARAAIASVSVLGALHASPAVKAALADRIR"
FT   gene            283771..284889
FT                   /locus_tag="RC1_0286"
FT   CDS_pept        283771..284889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0286"
FT                   /product="polyhydroxyalkanoic acid depolymerase"
FT                   /EC_number="3.1.1.-"
FT                   /note="[synonyms] PHA depolymerase PHB depolymerase
FT                   identified by match to protein family HMM PF02310 match to
FT                   protein family HMM PF04055 match to protein family HMM
FT                   TIGR02026"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97734"
FT                   /db_xref="GOA:B6IQJ8"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQJ8"
FT                   /protein_id="ACI97734.1"
FT                   /translation="MKLDDLMPGMSEATRLTRSGRLAEATALIQRLLGRQSGNRTPSPP
FT                   PADARVLDPPTLDLAAESVRVAEPERPPPEPGDGRMTAHRFANAAGARDYRLFVPAGTP
FT                   ERPRPLIVMLHGCTQTPEDFAAGTRMNLLAQQHGCIVVWPAQTSGANPSGCWNWFRPED
FT                   QGRDRGEPAIIAGITREIMRAHDADPARVYVAGLSAGGAKAAILALAYPELFAAVGVHS
FT                   GLACGAARDLPGAFTAMRQGAAPGRPVHHGSHGRPVPAIVFHGDRDSTVNPRNGEAVVT
FT                   QFSGTVVTGTPRVERGRAQGGRSFTRALHAGRDGRVLVEHWTIHGAGHAWAGGSAEGSY
FT                   TDPRGPDASREMLRFFLEHPHPAAGRAAGGQS"
FT   gene            complement(284880..285887)
FT                   /locus_tag="RC1_0285"
FT   CDS_pept        complement(284880..285887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0285"
FT                   /product="quinol oxidase, subunit II, putative"
FT                   /note="identified by match to protein family HMM PF02830
FT                   match to protein family HMM TIGR02019"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97735"
FT                   /db_xref="GOA:B6IQJ9"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQJ9"
FT                   /protein_id="ACI97735.1"
FT                   /translation="MEMMDSGHWLPVAFTVLMGVAVLAYVVLDGYDLGVGILMADADDA
FT                   QRDRMVASIGPFWDANETWLVLAVGLLLVAFPVAHGMILGALYLPVAAMLLGLILRGVS
FT                   FEFRAKTEGVQRRWWNQAFIAGSLLAALAQGYMLGLYVLGLPQGPAAMAFGMLTGLCLA
FT                   AGYAFIGAAWLILKTDGPLQAKAVVWARRTLGLAALGMVAVSVATPLASGRIAERWFAL
FT                   PELFLLAPVPLMAALLFGIVALALRGLPRADDRWSWVPFAGAVGIFVLGFHGLAYSFFP
FT                   YVVPERLTVWEAASAPESLMIILVGAAVVLPLIAAYTLFVYRVFRGKATELRYD"
FT   gene            complement(285896..287242)
FT                   /locus_tag="RC1_0287"
FT   CDS_pept        complement(285896..287242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0287"
FT                   /product="quinol oxidase subunit I, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97736"
FT                   /db_xref="GOA:B6IQK0"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQK0"
FT                   /protein_id="ACI97736.1"
FT                   /translation="MEALTLARLQFAANITFHILFPTITIALGWLLLFFKLRFRATGES
FT                   RWMEAYGFWVKVFALSFALGVVSGITMSFQFGTNWPGFMETVGNIAGPLLAYEVLTAFF
FT                   LEATFVAIMLFGFRRVPDWVHTGATLLVAVGTTLSAFWILVLNSWMHTPAGFEMRDGVA
FT                   HATDWLAIIFNPSMPYRLVHMLLASGLTAAFLVAGLSAWRWRRGDRSPGVLAALRTGVA
FT                   VAAVLIPLQIVAGDLHGLNTLEHQPAKVAAMEGNWQTRPNVPLLLFAVPDEETRTNRFE
FT                   IAVPGGASLILKHDTAGVVPGLDDFVGQHPPVAPVFYGFRIMVGVGLLMLLVSWAALWQ
FT                   LRGGREPRPWLLLALVGMTFSGWVATVAGWYVTEIGRQPWLVSGLLLTRDAAGAVPAAS
FT                   IGMTLAMYLILYAGLLAAYVAVLFRLAAKAGGAVGHRPVAAPLPVPAVG"
FT   gene            complement(287453..287773)
FT                   /locus_tag="RC1_0288"
FT   CDS_pept        complement(287453..287773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0288"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02322"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97737"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQK1"
FT                   /protein_id="ACI97737.1"
FT                   /translation="MGMAVDWADPVFAESVEILADAMDGIGDRTADARRIAFALRARPE
FT                   AKTMAAVEGSFNSLPGRVRREIARQGLMIARLRAVAGAPEPDPYGNPWAMSPFRSTLDA
FT                   AG"
FT   gene            287943..289076
FT                   /gene="glpQ"
FT                   /locus_tag="RC1_0289"
FT   CDS_pept        287943..289076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpQ"
FT                   /locus_tag="RC1_0289"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /EC_number="3.1.4.46"
FT                   /note="identified by match to protein family HMM TIGR01840"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97738"
FT                   /db_xref="GOA:B6IQK2"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQK2"
FT                   /protein_id="ACI97738.1"
FT                   /translation="MMGVRRAGLAVLALAATLGSAVPGTDGRAAEPGNAETAARPVLVI
FT                   AHRGASGERPEHTLMAYERAIDQGADFIEPDLVATRDGVLVARHENEISGTTDVADRPE
FT                   FAGRRTTKRIDGAEVSGWFTEDFTLAELKTLRARERLPQLRPGNTAFDGQETVPTLAEV
FT                   IALVRRKEAETGRRIGLYPETKHPGHFRALGLALEPRLVEALHAAGYRGRTAPVFIQSF
FT                   EVGNLKELRGMTDLPLVQLVAADGAPADLAAAGDSRSYADLLTETGLTEIARYADGIGA
FT                   EKVLVIPRDAEARSLPATDLVRRAHAAGLAVHVWTLRSENYFLPAELRRGDSSDPRFPA
FT                   LKGDAGAEAAAFAAAGVDGVFADFPADALAALRPARK"
FT   gene            complement(289105..291207)
FT                   /locus_tag="RC1_0290"
FT   CDS_pept        complement(289105..291207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0290"
FT                   /product="phosphodiesterase"
FT                   /EC_number="3.1.3.1"
FT                   /note="identified by match to protein family HMM PF01654"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97739"
FT                   /db_xref="GOA:B6IQK3"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="InterPro:IPR032093"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQK3"
FT                   /protein_id="ACI97739.1"
FT                   /translation="MTSQTKTGGISRRSFLDLMLAAGAMTAVTAGAGLVPGLRTALAAA
FT                   GESFHFPQGLASGDPMPDRVVLWTRVEAKDPAAAARPVDLTLHVSETPDFATVVVERTV
FT                   AARPEHDHTVRVLVDGLRPDRVYHYRFVAPDGAVPEFTGRTRTAPAPDADRTVRLAFVS
FT                   CQNFEDGFYGAYRTLLKQDAAAGADGIDFVLHLGDQIYETVGGGHARTIPPLPSGGGET
FT                   KWGAARNALTLEDFRYLYRTYLSDPDYREARARFPFISIWDDHEFVNDYWQSVITYTPA
FT                   GKSAPTTKAAANQAWFEYIPALLTGTVGVPGVAPAAKDFQPVSVTDVDATHAPVDDDNL
FT                   LQEPNNLAAIGSLTIYRSLRFGRHVELVLTDTRSYRSDHAVPDELGIAVSGQATYMLPL
FT                   PLVAVMDAGRTANGGNPPAVLTLGDKQVPNPRKDSPAGTLLGGPQKTWLKETLVRSDAT
FT                   WKLLATSVPFLPMRVDMARIDPKAQTLVLTADAWDGYLAERRELMGFLRSRGVGNVVSL
FT                   SGDHHQSFAGLIYDDYEAAEPVPVSMEFSITGVASTPVFQAFAAAVSKDENPLKPLIVA
FT                   DGAVFGRPGTVAEMLNMTLRYGTLASVTAVKTGDLAQGLAARNPAQNPHLRYVDSNSNG
FT                   FGLVTVDARGTRVELVTVAPARRSYGPDGAPVLRTARFDIAPWGEGAPAVLDEPAIEGE
FT                   KPFPLA"
FT   gene            complement(291221..293494)
FT                   /locus_tag="RC1_0291"
FT   CDS_pept        complement(291221..293494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0291"
FT                   /product="TonB dependent receptor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97740"
FT                   /db_xref="GOA:B6IQK4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQK4"
FT                   /protein_id="ACI97740.1"
FT                   /translation="MSRPVVSRVLPFLGAALVAAAVPAAAGAQEIEEIIVTAQKRAQSA
FT                   QDVPIALTAYSGEFLDRLGIDQLDKLSDYVPGLQIQLQSPNNPGFVIRGITSDSGSSQQ
FT                   EARVSVFVDGVPASRARGAVVEMFDLERVEVLKGPQGTLFGRGAQIGAVSIITAKPTLD
FT                   EVEVKAEGSVGNYGQRRLEAAVNLPVNDRVAVRLAGTTRDRDGYIDNIAGSKALMGVGV
FT                   QAARGSFLLVPNDDLTITGVVNYQEDDYTGTAFKNKRFAPAGGSTSPFTAAQLNRGDEL
FT                   GTDRSLFNATLTAEYELNDSLMLTSITGYREFNALEEFDADGTQAYLLEFAEDAQGKQW
FT                   SQEFRLNYEIGDKLEGFAGVSYFYEDGFQRVPLRTDERQLAIFNPGGALPFPNLGPIIT
FT                   PAGTLNPLVALLGLPRSAGNPLPFPLPALATGEFTNFGTNKAYEAFADATYHVTEEFSL
FT                   TGGIRFTHEEQESAFQQSVSPTAILLPALFPNVPRRELSEDFDSVVGRLVASYQPTPDS
FT                   LFYASVSRGRRPAVVQVDATNREVLKNEIVWSYEAGSKLSLLDDRLTAEASAFWYDYSN
FT                   FQTSVRVPNSALVRVDDAGEARSYGFEVALNAQATEWLTLFATYGYINARIDDEDSNGQ
FT                   QQELGGNTFRLTPKHAASVGANAVYAVADNLEVFFTPSFTFKSRVYFEDANTPGIEQGA
FT                   YGLLNLRGGVQSADGVWTLTAFVENALDREYIIDAGNTGGSFGLPTFIAGTPRFYGVEV
FT                   SARF"
FT   gene            complement(293735..293902)
FT                   /locus_tag="RC1_0292"
FT   CDS_pept        complement(293735..293902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0292"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97741"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQK5"
FT                   /protein_id="ACI97741.1"
FT                   /translation="MPGRHGRKPVWEGRPRRPAGADRGIPGPGRRPAGSDAARSRGRPC
FT                   RPRVTRVKVR"
FT   gene            293888..296167
FT                   /locus_tag="RC1_0293"
FT   CDS_pept        293888..296167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0293"
FT                   /product="TonB-dependent receptor, putative"
FT                   /note="identified by match to protein family HMM PF00245
FT                   match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97742"
FT                   /db_xref="GOA:B6IQK6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQK6"
FT                   /protein_id="ACI97742.1"
FT                   /translation="MTSWHRPRLTAALLLSALSLPALTAPALAQEAPAPQGGTAGGTAG
FT                   TAAGKAAVRQEIEEIIITGTIAFRNRTSDPNPVLAYDLEYFQRFEPVSVGEMLKRVPGV
FT                   TFTSDVLEYDAVQMRGLPAGYTQVLINGRTAPGGEADRSFFVDRIPAELVERVEIVRAP
FT                   RADQPSEGVAGTLNVITKDSARFAGGFAKIGGLINDDGKIRPSAAVAYADTLRSGDTSY
FT                   WVALNYQGRRNPKEKVTDFYDGDFEEFTGRELQSDTRDGVDISANGELTTTLGGGSLRL
FT                   FGLVVDTDRDEDETSLTYEGDSPAALELDEVEIQRERIGQRTYALGAEATLPLGAGDLG
FT                   LAAGWSGFREDTTAETDEGDTVAEAGLVERETLDTDDDEVTGTVSYRFGPEGFRTKLGV
FT                   DLLHKKRDNAERTFEIDGGDVEEETPPGAIYTIKETRIDPYARLSLDLTDRVMLDLGAR
FT                   YEMTDREVDSDGEDGSHDSKNLNPSAHLRYNPTASDHFLLSVARTVRRPDYDLLAPYRQ
FT                   EEEPADDDELIGNPSLANEMAWGIDVGYERQIGRRGIFGVNVFYRDVTDVIELVNTGEE
FT                   AEAGGSVYQARNIGDGETWGVEADLSLPLDFAGLPDTGVFANYTWLDSSITDPFTGEDR
FT                   RFNNQPRHVYNVGFIQTLPSWDVSFGASLSGRSGAEESSLDETIDLRYGQELEAFIEKR
FT                   FAERFVLRLTGTNLLNRKKKEDFRFFDGDSVAEMLEARRTGDVDEAEKEREESGALFQV
FT                   TLRAAF"
FT   gene            296199..297548
FT                   /gene="phy"
FT                   /locus_tag="RC1_0294"
FT   CDS_pept        296199..297548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phy"
FT                   /locus_tag="RC1_0294"
FT                   /product="3-phytase"
FT                   /EC_number="3.1.3.8"
FT                   /note="[Synonyms] Phytate 3-phosphatase
FT                   Myo-inositol-hexaphosphate 3-phosphohydrolase identified by
FT                   match to protein family HMM PF00593 match to protein family
FT                   HMM PF07715"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97743"
FT                   /db_xref="GOA:B6IQK7"
FT                   /db_xref="InterPro:IPR003431"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQK7"
FT                   /protein_id="ACI97743.1"
FT                   /translation="MTRLPFPAAPVLALLLLAGVACAAPVAPVATVQPSLETAPGLPDT
FT                   PDEADADDPAVWLHPTDPARSLIITAVKDAGLRVYDLQGRLVQRVEAARAGADGLPGRY
FT                   NNVDVAYGLALPGGGVMDVAVASDRGRDRIMVWRIDPNSAATPLADVTDPEQPRVFPTR
FT                   RAPDGSGEIANPAADQRSAYGLTTWKGPDGHRVIVAQRKEARLVEHRLVVNPDGTVGHV
FT                   RLRHWDFPYSHRGQSLTAEDDHDPARDWQPQFEGLVVDQERGILFAGQEDVGLWRVNLT
FT                   TGTADAAPFHETRGSTRSPFDNRASRVARDVEGLALYYGPEGTGYLVASSQGDAHGDEK
FT                   APDPEGLDDTFAVFERGGDNRYLGSFRIVAGGGVDGVQECDGAEIVSYALPGFPNGLMV
FT                   VQDGYNDDLNGLSGEPEATNFKYVDWKAIAGSFDPALMVTPQAWTPRPTP"
FT   gene            297935..299932
FT                   /locus_tag="RC1_0295"
FT   CDS_pept        297935..299932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0295"
FT                   /product="methyl-accepting chemotaxis protein, putative"
FT                   /note="Also called sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97744"
FT                   /db_xref="GOA:B6IQK8"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQK8"
FT                   /protein_id="ACI97744.1"
FT                   /translation="MDKYLSRVTVGQRLVLLIAVLVVALAGMTTADLLASRRSAFDSRK
FT                   DLVRSMAESARSIVASFHAAAKRGEATEAEAKAAALAALGAMRYGDGDYVWVNDRQPQM
FT                   VMHPIKPEMIGTDLSGTKDAEGKLLFMNMLAATEGGKSGFVDYLWPKPGQSEPAAKISF
FT                   VTPFEPWGWVVGTGLYVDDVQARFIADAKAAGLLTALILLIAGCAGYILIRSIRQPLDR
FT                   TTAAVRRLAEGDLDVQIVDSDRKDEMGEIARALEVFRRNAREARRLESAAATERAIRER
FT                   RRAALEQHTADLNAAVSGVLQGLSGAATDMQGTARSMSDTAGRTRDQASDVTSNAAQSA
FT                   ENLTTVAAATEEMLSSIQEIGRQVEEARRVANEAVDETGRTDTIMRGLVDAAAQIGDVL
FT                   KLITEIAARTNLLALNATIEAARAGEAGKGFAVVAGEVKTLANQTARATEEITAKIQAV
FT                   QAATGQASGSLTHISGIIGRMDQISSSIAAAIDEQSATTQEIVRNVQNASGSTAQVTAL
FT                   IGDVSRAARETGTASEQVLSATGDLARQAESLRHEVESFMQQMEGAGDQRNYERVPCAL
FT                   EIGIACGERTVSTKTLYLSIGGLATPDVLPGAQPGLGVTIGFGQRRVAARIARVEAGTI
FT                   AYTFSLAGDADGQAFIDALVERQRGNRTAA"
FT   gene            complement(299996..300439)
FT                   /locus_tag="RC1_0296"
FT   CDS_pept        complement(299996..300439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0296"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00593
FT                   match to protein family HMM PF07715"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97745"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQK9"
FT                   /protein_id="ACI97745.1"
FT                   /translation="MKVPMRIGLVITLLFAAVGAHAADFGTADEAKAMLERAVTAIQQD
FT                   KDKALRQFAAGEGGFKDRDLYPFCGGPDGMFTAHPTLTGKSLRDLKDKTGKALGEEIYA
FT                   TATEGKISEVSYMWPRPGETEPVQKITYVTKADDQVCAVGYYK"
FT   gene            300917..302647
FT                   /locus_tag="RC1_0297"
FT   CDS_pept        300917..302647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0297"
FT                   /product="methyl-accepting chemotaxis protein, putative"
FT                   /note="identified by match to protein family HMM PF02333"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97746"
FT                   /db_xref="GOA:B6IQL0"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQL0"
FT                   /protein_id="ACI97746.1"
FT                   /translation="MPSAFPGSTARTTRSRIPPMTLTQKILAPVAILSLVAAIIAGSAF
FT                   LSLDRIGEAVTQMKAQSNRVIAASELRSTSRALQRDALNLVFEPAENRQAIAERFNRRL
FT                   ASMSAQIVAIEPKLTTAEARFTPLQRDVVAALTQVRDAALSGDTAGAHDLFKTKVRTAE
FT                   RAASELTDPMIEDGIKRVAELETSLAETSAMETWIMGAVALVGILAGLAVSLLVAQRGV
FT                   IRPVDRVTEAMTKLQAKDYGFELPDHGRSDAIGGMARAVMVFRDAMRRADALEAEQRRE
FT                   QERRNRQAARLTAQVKDFVDGMNAITDELARESGMLKADADSLAAAAGRTAQMTEEATT
FT                   ATERTASNVQTVAAATEELSASIHEISARAGETAARSTEGATQAKETAERVARLRDTVA
FT                   EIGQVVDIINGIAAQTNLLALNATIEAARAGEAGKGFAVVAHEVKSLATQTAKATEEIR
FT                   AQVEGVQGATVDAAAAIERIVGLIGDISAMTGAIAAAVEEQSAVTNEITRSIQGAASGT
FT                   ETIRVEVHQLHATASDTGSVAGRVNGAASDLAGRSDQVRSRVRAFVTELSADTGDRAAG
FT                   "
FT   gene            302777..305413
FT                   /locus_tag="RC1_0298"
FT   CDS_pept        302777..305413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0298"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="identified by match to protein family HMM PF00015
FT                   match to protein family HMM PF00672 match to protein family
FT                   HMM PF07238"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97747"
FT                   /db_xref="GOA:B6IQL1"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="InterPro:IPR024320"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQL1"
FT                   /protein_id="ACI97747.1"
FT                   /translation="MPHSADTTLPAAPVDRGAGPLPFLSLLRRLLPWAVAVLVASLAVV
FT                   AAGRLRAEFDLAALGREVATLPAAALAGCVLFTLASYTALVGYDLSALRWIGARLPLAR
FT                   AAMGSFVGFAFSNTLSFTAFSGGAIRYRLYTSAGLSGMQVAKAVFFLSTAFMVGISLVG
FT                   SVGLWLAPERAASVLHLPPGAVRSLAVTVALTVPLLLLAAALRRRPLVLLGREITLPGA
FT                   KLLLMQLVISTADIAFSAGALYVLLPADAPVGFAAFAGVYCAAIVLGLLSHLPGGIGVF
FT                   DGIMMLALADAVPAERMGAALLVYRAVYYLLPLLAAVALLAGHEGRALRGRLPLADLHR
FT                   RAADALRLGRGALPAAAAAVAVTAGIVLLVSGALPAVPGRVHAAAALVSLPVVEVSHIL
FT                   NSVVGLGLVLIGRGLYQRLDSAWTLTMGLLGAGVVLNLLKGLDWEEAVILAGCAAILWA
FT                   AREEFYRRGSLTEVRLTPGWVLGSAGLVAGAVVLTLFAFEHVEYRDALWWQVATTADAP
FT                   RSMRALVATGVALLGLSLHTLLRPAPRTTPRPDATTVERAAALLPASPRTEGNLVLLGD
FT                   KAVLFNEAGTGFLMYGVRGRSWIAMGDPVGPVETWPDLVWSFRQMVHRHGGQAAFYQVR
FT                   PESLPLYLDAGLLPVKIGEEARVPLAGFDLEGPERRDLRYAVRKGGRDGLSFALVGRDE
FT                   VPAILDELRTVSDGWLAGRKVREKGFSVGWFDPDYLSRFDHAVVRHEGRIVAFANIWAG
FT                   APGGELSVDLMRHRPDAHPLTMDFLFAHLMLWGTGAGFSWFNLGMAPLSGLTGRPLAPL
FT                   WHRLGAFVFKRGEPFYGFRGLRQYKEKFRPRWEPRYLCSPGGLAPATILADVAALVAGG
FT                   LDGTIGK"
FT   gene            305424..306788
FT                   /gene="acvB"
FT                   /locus_tag="RC1_0299"
FT   CDS_pept        305424..306788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acvB"
FT                   /locus_tag="RC1_0299"
FT                   /product="virulence protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97748"
FT                   /db_xref="InterPro:IPR010333"
FT                   /db_xref="InterPro:IPR011225"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQL2"
FT                   /protein_id="ACI97748.1"
FT                   /translation="MMGRRLRTAVLLTGTLLALGAALALVIGPKDPAPRRLDGGEAGTL
FT                   RLYGPAGAVGRVVVALSDGTGWADADDRVARALAGDDALVAGIDLREMAAALNHQTDGC
FT                   HWISGKLEAVSRLVQQHEGLPRYLTPVLLGRGAGGMVAYGAAVQGLGGMFAGALALRPG
FT                   ATMPFVAPICLGVESVAVPGGRRYPPLDRQETPVTLLDAGAESVAGSGIERVEGAADLA
FT                   DLRRRVVALAPAQEDGAAAEDLPVVELPAERPGDTLVLFWSGDGGWRDIDATIGEALAA
FT                   AGVPVLGIDSFSYFWHRRSPAEVARDMDALIQRQSARWGTRRVILIGFSFGAAILPAAV
FT                   NALPAESRAQVAALWLLSPDRKADWEINVAAYLGGDGDGASPVAPELAGLRGLPVHCVH
FT                   GSAESADSLCTDPAATGLIRLELPGDHHFDGDYDRVVRAILASLHSRPHAPVGAG"
FT   gene            306856..309483
FT                   /gene="mgtA"
FT                   /locus_tag="RC1_0300"
FT   CDS_pept        306856..309483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgtA"
FT                   /locus_tag="RC1_0300"
FT                   /product="magnesium-transporting ATPase, P-type 1"
FT                   /note="identified by match to protein family HMM PF00015
FT                   match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97749"
FT                   /db_xref="GOA:B6IQL3"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006415"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQL3"
FT                   /protein_id="ACI97749.1"
FT                   /translation="MMGAMRVTGTEAPCWSEPADAVAERAGSGRDGLTTAEAAARLAAT
FT                   RRRGSGDSALLAAVRLFLRQILSPLVLILLFGAGVSAVLGDWMDTGIILTIVLGSALLS
FT                   FTQEFRASAAVAELRQRLSLKATVLRDGQPVRIDATEVVAGDVVLLSAGNLVPADGILL
FT                   EAKDLLVAEAALTGESFPVEKQPGVLPAATELGARSNCLFQGTSVRSGTGRLLVVATGD
FT                   ATELGRIGFRLRTAPPETDFARGLRRFGIMLTQVMLVIVVLVLTMNLLRDRPLAETLLF
FT                   AVALAVGLSPELLPAIVSVTLSAGARALARTGVIVRRLEAIENLGSMDILCTDKTGTLT
FT                   QGIARLDRTLDPDGAPSDEVLRLAFLNAAFETGIENPLDAAITEAGRARGLDTAGWRKI
FT                   DEIPYDFVRRRLTVVVAGGGPGNLPPGNLPPDSHLPDSHLPDSHLPDSHLIVTKGAVEP
FT                   VLDCCTVLGLEAPRPLDKDARAAILERFQRLGGDGYRVLALAARRVPARAAYGHGDEAE
FT                   MAFLGFLLLRDPPKPDAAATLDDLHRLGVRTKIITGDNRHVAASLAREVGLDPAALLTG
FT                   ADLDRLSDDALWHRAPRTDLFAEVDPQQKERIIRALRRAGHVVGYMGDGVNDAPALHAA
FT                   DIGISVEGAVDVARESADIVLLRPDLGVLRQGIEDGRRTFANTQKYIAITVSANFGNML
FT                   SMAVASLVLPFLPMLAKQILLNNFLSDFPSVAISTDRVDPESIRRPPRWSIREIRRFML
FT                   VFGIVSSLFDVLTFALLLLVFDASEPLFQTSWFFVSLLTELMVVLVLRTRRPAFGSRPG
FT                   LLLLASTLAVAGLAVAIPYAGWLAGPLGFVPLPPALLATLLGVVALYVAATELAKRRFY
FT                   RAAP"
FT   gene            309641..310843
FT                   /gene="rpFG"
FT                   /locus_tag="RC1_0301"
FT   CDS_pept        309641..310843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpFG"
FT                   /locus_tag="RC1_0301"
FT                   /product="response regulator R PFG"
FT                   /note="Contains PF01966 identified by match to protein
FT                   family HMM PF04329 match to protein family HMM PF04330
FT                   match to protein family HMM PF04331"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97750"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQL4"
FT                   /protein_id="ACI97750.1"
FT                   /translation="MGTAHASSFVMADDPWVGLNGGLEAQLAGLHREIRETPELAAIDR
FT                   IAVAVHDPASGRLRTFVESNIGSRPFDRFSDRLELHPTLAAVATTGIPFINNAIGTGAA
FT                   VGADGLNDRLLALGLRSRYIVRIHRAGTLYGFIFFNSGRPGFFTEATVAALTPYRRLID
FT                   VLVVGTLTSQRTMLAAVRSALQVSHYRNEETGAHLDRMSRYAELIAQTLATRYLLSDEF
FT                   VEYVLQYAPLHDIGKVAVPDHILLKRGKLLPDEYEVMKTHVAKGVEIIDAMIHDHGLEA
FT                   LPYRDLLRNVVAHHHECYDGSGYPHGLAGEAISLEGRIVAVADVFDALTSQRPYKDAWS
FT                   NDTAAAFLRAQAGRRFDPACVEALLADPGAIRDIQQRFRETPGGFGLAALRQRAAQAAA
FT                   C"
FT   gene            complement(310868..311989)
FT                   /gene="yhhJ"
FT                   /locus_tag="RC1_0302"
FT   CDS_pept        complement(310868..311989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhhJ"
FT                   /locus_tag="RC1_0302"
FT                   /product="inner membrane transport permease YhhJ, putative"
FT                   /note="identified by match to protein family HMM PF06057"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97751"
FT                   /db_xref="GOA:B6IQL5"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQL5"
FT                   /protein_id="ACI97751.1"
FT                   /translation="MRPGNVLQLGVKELRSLLRDPVMLVLIAYAFTLSIYTAAKALPDT
FT                   LNLAPIAIVDEDRSPLSSRIASAFFPPYFLPPALITQAEMDARMDAGLDTFALGIPPDF
FT                   QSDLLAGRRPTIQLNVDATRMSQAFTGNGYIQTIISDEVTAFAKRYREVAEMPVDLALR
FT                   LRFNPELNRTWFGSIMEVINNITMLSIVLTGAALIREREHGTVEHLLVMPVTPFEIMAA
FT                   KVWSMGLVVLLACTVSLLFVVRGALEVPVQGSVALFLAGAVLHLFATTSMGILLATVAR
FT                   SMPQFGLLLILVLLPLQMLSGGDTPRESMPEAVQTIMLAAPTTHFIMLAQAVLFRGAGL
FT                   DVVWPQFLTLAGIGTTLFGIALRRFRSTIAQMA"
FT   gene            complement(311993..314755)
FT                   /locus_tag="RC1_0303"
FT   CDS_pept        complement(311993..314755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0303"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00122
FT                   match to protein family HMM PF00702 match to protein family
FT                   HMM TIGR01494 match to protein family HMM TIGR01524"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97752"
FT                   /db_xref="GOA:B6IQL6"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQL6"
FT                   /protein_id="ACI97752.1"
FT                   /translation="MADRPDPEAPVVRLRGVTQRFGRVAALDGIDLDIPAGCMIGLIGP
FT                   DGVGKSTLLSLIAGARVIRGGRVEVLGGDMASAGHRRLVCPRIAFMPQGLGKNLYPTLS
FT                   VAENLEFFGRLFGHDAAECRRRILDLTRSTGLAPFLDRPAGKLSGGMKQKLGLCGALIH
FT                   DPDLLILDEPTTGVDPLSRRQFWDLIDRIRRDRPGMSVLVATAYMEEAARFDWLVAMDA
FT                   GRVLATGTPAELLARTGSETLEAAFVHLLPEEKRRGHAAVVIPPRTDGDGEDGIAIEAQ
FT                   DLTMRFGAFTAVDRVNFRIRRGEIFGFLGSNGCGKTTTMKMLTGLLAPSGGRAWLFGRP
FT                   VAPDDLATRSRVGYMSQAFSLYTELTVRQNLDLHARLFRVPVAEVPGRVAEMLERFGLR
FT                   DVADALPEALPLGMRQRLSLAVAMIHKPEMLILDEPTSGVDPVARDGFWRILVELSRRD
FT                   RVTIFISTHFMNEAERCDRISLMHAGRVLVTGAPAELVAARGAASLEDTFIGYLEEAAG
FT                   PEAAPAAGVEKDAEADAAAPARATVVRQGFDPGRTLSFARREALELRRDPIRLTLALLG
FT                   SVILMLVMGYGISMDVEDLTFAVLDRDQTAISQNYALNLSGSRYFIEQPPLTDYQDLDR
FT                   RMRAGQITLAIEIPSGFGRDIARGRPVAVGAWVDGSMPMRAETVRGYVQGMHAQWLAGK
FT                   AAEAGRAAEAAGLVNIETRYRYNPDVRSLVAMVPAVIPLLLIMIPAMLATLAVVREKEL
FT                   GSIVNFYVTPTTRLEFLLGKQMPYVALSTVSLLLLTLLAVTLFGVPFTGSFWAFLAGGL
FT                   LYVGTATALGLLVSSFIRSQIAAVFATSILTILPAVSFSGLTNPVSSLEGAGRLVGEVF
FT                   PTTHFLTIARGTFSKALGFADLQASFLPLIVANIVLVALAALLLKKQEG"
FT   gene            complement(314748..315824)
FT                   /locus_tag="RC1_0304"
FT   CDS_pept        complement(314748..315824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0304"
FT                   /product="HlyD family secretion protein"
FT                   /note="identified by match to protein family HMM PF01966"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97753"
FT                   /db_xref="GOA:B6IQL7"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQL7"
FT                   /protein_id="ACI97753.1"
FT                   /translation="MNATLKSWGLRLGVVAIVAAVGVPLWRSLQPDALPEGFAAGNGRI
FT                   EAVEIDAAAKIAGRVKDILVNEGDFVTAGQVLAVMDTAVLDAQLKEAQAQLRQVEIAVE
FT                   TARSLVTQRQAEREAAVAVVAQREAELVAAQKRLARSQDLGTRGNISPQQIDDDRAEFQ
FT                   STKAAVAAAKANLAAADAAIGSATSQVVGAEAQVEATRATLQRIQADIDDSTLRAPRDG
FT                   RVQYRVAQPGEVLSAGGAVLNMVDLADVYMTFFLPTADAGRVALGGEARIVLDAAPNLV
FT                   IPASISFVADVAQFTPKTVETAEERQKLMFRVKARIPADLLKRHITSVKTGLPGMTYVR
FT                   LDPGADWPAELQVRLPNG"
FT   gene            complement(315821..316480)
FT                   /gene="ttgR"
FT                   /locus_tag="RC1_0305"
FT   CDS_pept        complement(315821..316480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ttgR"
FT                   /locus_tag="RC1_0305"
FT                   /product="HTH-type transcriptional regulator TtgR"
FT                   /note="identified by match to protein family HMM PF01061"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97754"
FT                   /db_xref="GOA:B6IQL8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013572"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQL8"
FT                   /protein_id="ACI97754.1"
FT                   /translation="MRRTKEDAERTRERILDAAETVFYDRGVARTTLEQVAHAAGVTRG
FT                   AIYWHFDSKATLLEAVHQRVRQPLTDLLYRMIDDDPPDALARVEAQASDVILRLYQDDR
FT                   TRRVMTIVLLKCEQTEEMAAILEHEQAQRQKFLTSLARFFARLQDRGLIAPGVPEVQAS
FT                   ALHAFMLGLFSDVLRFPAHFPTPDHALAQVRYFFTIFAPRRGEAPPGGVATSGVLP"
FT   gene            complement(316659..319163)
FT                   /locus_tag="RC1_0306"
FT   CDS_pept        complement(316659..319163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0306"
FT                   /product="TonB dependent receptor, putative"
FT                   /note="identified by match to protein family HMM PF00005
FT                   match to protein family HMM PF01061"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97755"
FT                   /db_xref="GOA:B6IQL9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQL9"
FT                   /protein_id="ACI97755.1"
FT                   /translation="MEKRRETCAPGSVACPSTAAPAVPRRHPAVRAGLAGLVAPVALIQ
FT                   TAGMATALAQTAPEPRAAVEGPQRRAAVEEIVVTAQRRQQSAQDVPISLQVVDSARIER
FT                   VAAQDMGDLAAFVPGLQVKADSPTQPKYTIRGVVTDDFGVGTDPAVGIYVDGFYSARSG
FT                   ASLLAFNDVERIEVLKGPQGTLFGRNSAAGAVSIITRKPSDEAEGRFLFRVGSYDKRRA
FT                   EAMMNLPAGDDLALRVNAVFNQRDGWLKDDATGEGLSREDNWATRAALRWGPTAGTNAI
FT                   LTWEHEELDQDARPAISVIDVPPFPGRPSLPYNPATFIDPRDGPVLNDVIDNHETRELD
FT                   SVTLTLTHPLSWGELASLTAFRHFETENREDEDGTNRRDLYFDTNNIEDNTSFYQEFKL
FT                   SGAAGPVDWVAGASFWHEKAEQQASTSATTDSINAVLGNIGVGTPFSDLDNFVLIPFGI
FT                   PFRLLGNSWNETMANEGTFKAYAVYGDAIWHVTDRLNLTLGGRLTYDKKTFSWFNGPRL
FT                   APELDETIRTLADLGVLDLAGVPPEALRFDVVFDVGALEGRKVELSDSWTDFSPRVVLD
FT                   YALTDSVMAYASYTQGYKAGGFNSVEPLSRFDNEKVRNYEIGVKTSFPETGLQVNVAGY
FT                   KYFYDDKQRVRLVQETSGSSVPQYIVETSDDKAVGIDLDALWRPIDPLEINLAVSWIDA
FT                   EIDSKVTREGLDLSGQPTGEPRWTLSGGAAWTQPLGDGATVQVAVQHAYRGAPRCNTES
FT                   LAVGTCGDILPFDVGGPYHRTDLRVAWTSASGAYTVAAFANNVFDNRYVTSLNRLTADT
FT                   LGTVFSALSEPRMLGVDFAVRF"
FT   gene            complement(319342..320514)
FT                   /locus_tag="RC1_0307"
FT   CDS_pept        complement(319342..320514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0307"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97756"
FT                   /db_xref="InterPro:IPR022269"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQM0"
FT                   /protein_id="ACI97756.1"
FT                   /translation="MMRARVRGIALAAALLAATGCDGGDGTSAPAGPSAVVFHAGDNPE
FT                   RLSDWGVLPVAGGRLTLAGGVVPYDLATPLFTDHAGKLRTIWMPAGTSARYDATATFDF
FT                   PVGTVITKTFYYPRAGAEEGLVAPGDRAAGQGGASQGGFGLDLSRVRLIETRVLVRRES
FT                   GWAALPYLWDADQKDARLHRTGAVIPLTLAREDGGRERFAYVMPNANQCAGCHVDNLAS
FT                   RAFQPIGPKARHLNIEFDYPGGRENQLRHLAAAGYLTGTPEPAAAPRSADWRDPAQPLE
FT                   ARARAYLDINCGHCHNPAGAAKTSGLHLGPEVTDARELGFCKPPVAAGQGTGGHRFDIV
FT                   PGRPDESILVYRLASVKPGAMMPELGRTLAHDQGVALIRDWVAAMAGRCD"
FT   gene            complement(320511..321815)
FT                   /locus_tag="RC1_0308"
FT   CDS_pept        complement(320511..321815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0308"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97757"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR022442"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQM1"
FT                   /protein_id="ACI97757.1"
FT                   /translation="MTLALCAMLAATQLAACDQSDQKQAQAPQAAPPGPTASGDPGAGA
FT                   AGFQDTLQQKLLDAKPGDVILVPAGRHAFDRSLSLTVDGVTLRGEGMDRSVLSFKGQIA
FT                   GAEGLLVNASDFTIEDLAIEDTKGDALKINDGRNIVIRRIRTEWTNGPDTENGAYGIYP
FT                   VQTTNVLVEDSVAIGASDAGIYVGQSRDVVVRRNRAELNVAGIEIENTVNADVYENVAT
FT                   RNTGGILVFNMPNLPVAGHGTRVFNNRVFANNTGNFAAKGAAVASVPAGTGIIVNSNDE
FT                   VEIFANEVADNDTANIIISSYFSTGYMNQYGVAENFDPYPERIFIYDNRFSGGGGSPDG
FT                   IELKTLKTLLYGPFGRFPDILWDGWVDPKKLVDGKLPPELAICVANGEAQMLNVDGPDG
FT                   NRNPGVDMAAHDCTLPRRAPVELAPPLDQLTKKGA"
FT   gene            322014..322733
FT                   /locus_tag="RC1_0309"
FT   CDS_pept        322014..322733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0309"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="identified by match to protein family HMM PF00593
FT                   match to protein family HMM PF07715"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97758"
FT                   /db_xref="GOA:B6IQM2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041669"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQM2"
FT                   /protein_id="ACI97758.1"
FT                   /translation="MGTGRIGTSGKRAGRPAAGERPGGREAAGAVDLGSRTIPQQRRAL
FT                   MRRDAILDATLALLMEREAGEITTTLIAARAGVPVGLVYRYFPNKFAILSELARRSMDR
FT                   VDTRLEALMAGGMEPQAIVRAVDEGIETIIETYRREPGPRRLFRAVRTVPELAAVLATS
FT                   NARMVAALRRTLAALRPDASAPEVEAVARTTVQVYTHLEALAIECDDPELFPLLLAEWK
FT                   RLAAGYLTRFATGPGAE"
FT   gene            322951..324459
FT                   /locus_tag="RC1_0310"
FT   CDS_pept        322951..324459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0310"
FT                   /product="succinyl-CoA transferase"
FT                   /EC_number="2.8.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97759"
FT                   /db_xref="GOA:B6IQM3"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR017821"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQM3"
FT                   /protein_id="ACI97759.1"
FT                   /translation="MPRDRIRLKSLWDRITDAEEAALHVRDGMTVGMSGFTRAGDAKAV
FT                   PAAIAARALHDPLKITLMTGASLGGNVDRELTEAKALARRLPFQADPTLRSAINRGEVM
FT                   FIDQHLSETVELLRSRQMGPVDVAIVEAAAITEEGGIIPTTSVGNTATFAILAEKVIVE
FT                   LNLSQPAALEGLHDIYIPTRRPHRDPIPVLQPESRPGVPYIPVDPAKIAAIVVTDRTDS
FT                   AASILPGDADTTAIAGHLTEFLQSEVRKGRLGPSLSPLQAGIGSIANAVMQGLADGPFS
FT                   GLTMYSEVLQDSTFDLFDAGCLRFASGSSITLGPERQRDVLNRLEHYKPKLVLRPQEVS
FT                   NHPEVVRRLGVIAVNTALEFDIYGNVNSTHVGGTHMMNGVGGSGDFARNAYMSIFVTKS
FT                   LAKGGTISSVVPMVSHVDHCEHDVDILVTEVGLADLRGLAPRERAATIIRNCVHPTYRE
FT                   LASDYFKAASARGGHTPHLLEEAFSWHLRLRETGSMLPRQTVLA"
FT   gene            324611..325642
FT                   /locus_tag="RC1_0311"
FT   CDS_pept        324611..325642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0311"
FT                   /product="oxidoreductase, aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97760"
FT                   /db_xref="GOA:B6IQM4"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQM4"
FT                   /protein_id="ACI97760.1"
FT                   /translation="MEHRQLGRSGLKVPVLSLGTGTFGGGNAFFERWGRTDVAEATRLV
FT                   DICLEAGVNFFDTADVYSGGASEEILGQALKGRRDKVLISSKATFAMGEGPNQVGSSRH
FT                   HLIRSCEDSLRRLGTDHIDLYFMHAFDALTPVEETLRALDDLIRAGKIGYIGASNFSGW
FT                   QLMKSLAVSEKYGLGRYVVYQAYYSLIGRDYEWELMPLGLDQGVGLMIWSPLGWGRLTG
FT                   KIRRGRPATEGRIAMGGAVGGPEVEDEYLYTVVDALEAVAEEVGRSIPQVALNWLLTRP
FT                   TVCNVVIGARNEEQLRQNLGAVGWSLSPEQVARLEAASQRTPAYPYWHQRGFDDRNPKP
FT                   TRW"
FT   gene            complement(325659..326525)
FT                   /locus_tag="RC1_0312"
FT   CDS_pept        complement(325659..326525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0312"
FT                   /product="periplasmic binding protein, putative"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97761"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQM5"
FT                   /protein_id="ACI97761.1"
FT                   /translation="MFRLLPRLLPAALLLLPVLLFPPAAVAQEAPPRRIVSMNLCADQF
FT                   LVDLADRDQVLALSEYARDPILSSIAERARSWPVGRGTAEEVLALKPDLIIASRLRRQE
FT                   TRALLAGFQIKVLELGTARTFEEIVAQARTIAAAVGHPERGEALVARMRAVLDALPAPA
FT                   ETRPVAVHYQRRGFVSGGETLMDEIMGRAGLVNMARSLDGAFVVRVPLERIVTTAPEYL
FT                   LLTTAPVESPDLGSDMLEHPVLSGLYGPERRLELPEAVAMCGGPAYPEAVASLMAQLGR
FT                   GRAAPTP"
FT   gene            326752..327828
FT                   /gene="hmuU"
FT                   /locus_tag="RC1_0313"
FT   CDS_pept        326752..327828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuU"
FT                   /locus_tag="RC1_0313"
FT                   /product="hemin transport system permease protein, HmuU"
FT                   /note="identified by match to protein family HMM PF02550"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97762"
FT                   /db_xref="GOA:B6IQM6"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQM6"
FT                   /protein_id="ACI97762.1"
FT                   /translation="MTPAPDLHRAGAPPRTAAPAAPLPATVRPPAGRPGFVPLLAVALL
FT                   AAALLSLLAGPADIAAGDALAGLVGQGDPLVVAVMQKLRLPRLLVGLGAGAMLGLAGAS
FT                   LQGYLRNPLAEPSVLGVSNAAALGAVVALYNGFAATMPLALPLMAIGAAMAAIAGVMLL
FT                   AARAESALSVVLAGLAVGTLCGALISLTLNLAPSPFAAAEISFWLLGSLEDRSMTHVVL
FT                   ALPLIGVGAVLLLWDGRALDALTLGEEAARSLGCNLARVRVRLMLGVAIGVGAAVAVSG
FT                   AIGFVGLVIPHMVRAVVGQRPSRLLLPSALAGALLLVLADLLVRMLPTANEIRLGVVTA
FT                   LLGVPIFLSQLLKARRSW"
FT   gene            327888..328004
FT                   /locus_tag="RC1_0314"
FT   CDS_pept        327888..328004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0314"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97763"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQM7"
FT                   /protein_id="ACI97763.1"
FT                   /translation="MGGACRGRPGYPPVRRRRPLMDACSTPPLSRPATDAMP"
FT   gene            328001..328792
FT                   /gene="fecE"
FT                   /locus_tag="RC1_0315"
FT   CDS_pept        328001..328792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fecE"
FT                   /locus_tag="RC1_0315"
FT                   /product="iron(III) dicitrate transport ATP-binding protein
FT                   FecE"
FT                   /note="identified by match to protein family HMM PF01497"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97764"
FT                   /db_xref="GOA:B6IQM8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQM8"
FT                   /protein_id="ACI97764.1"
FT                   /translation="MTILHVEGAGVRLGGRPILEAIGLSAGAGEVVGLIGPNGAGKSTL
FT                   VRAIAGLLPLESGQVRIAGRPLSAYSRRELANTVAYLPQGHTVHWPLDAYHVVALGRLP
FT                   HLGPLGRPTPEDEAAIARAMETADAAAFAPRTITSLSGGERARVMLARALAVEAPILLA
FT                   DEPVAALDPYHQLQVMELLRGIAATGRLVVAVLHDLPLAARFCDRLVLLGSGRVVADGE
FT                   PEAVLARPNLEAAYRVQGLYGSEGEERYVLPWRRLAADPVS"
FT   gene            complement(328815..329561)
FT                   /locus_tag="RC1_0316"
FT   CDS_pept        complement(328815..329561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0316"
FT                   /product="Acyl-CoA thioester hydrolase, putative"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97765"
FT                   /db_xref="GOA:B6IQM9"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQM9"
FT                   /protein_id="ACI97765.1"
FT                   /translation="MRRETSLIDLIFPGDTNHHGTLFGGAALAHMDKVAFIAATRHAHV
FT                   DFVTASCERIDFAAPAQLGEIVEVTGRIARVGRRSLTVEVDLVAEALLTGERRLCTRGR
FT                   FNMVSVDRDAAVPPLEEAAEEPQAVGVRMVELVFPDQASHNHILFGGHAMAQMGKAAFV
FT                   AATRHCRRAVVLAASKRLDFTSPVKVGEIMEIEAAVTGTGTSSMQVTVDLWGENLKTGE
FT                   RRKAAEGVFVMVALDADQRPTPVRPL"
FT   gene            complement(329540..330193)
FT                   /locus_tag="RC1_0317"
FT   CDS_pept        complement(329540..330193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0317"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97766"
FT                   /db_xref="GOA:B6IQN0"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012840"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQN0"
FT                   /protein_id="ACI97766.1"
FT                   /translation="MADLRVGGLSRLSTCDWPGELVATVFCQGCPWACPYCHNPDLLPA
FT                   RGQRELAWEQVLAFLEGRRGLLDGVVFSGGEATLQAALPDAMRTVRGMGFRIGLHTGGP
FT                   YPERLADLLPLLDWVGFDVKAPFAEYERITGASGSGERARESLRLLLDAGIACDVRTTV
FT                   HPRLLDAAALERLRADLDALGVRQHRLQPFRATGCRPDQLARLSGDAPCAARPA"
FT   gene            complement(330208..330378)
FT                   /pseudo
FT                   /locus_tag="RC1_0318"
FT   CDS_pept        complement(330208..330378)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0318"
FT                   /note="pseudogene;identified by match to protein family HMM
FT                   PF00005"
FT   gene            complement(330456..332483)
FT                   /gene="nrdD"
FT                   /locus_tag="RC1_0319"
FT   CDS_pept        complement(330456..332483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdD"
FT                   /locus_tag="RC1_0319"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /EC_number="1.17.4.2"
FT                   /note="identified by match to protein family HMM PF03061"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97767"
FT                   /db_xref="GOA:B6IQN1"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQN1"
FT                   /protein_id="ACI97767.1"
FT                   /translation="MPVHALATLPKSVIKRSGEVSAFNGDKIRSAIERAGKATGEFDGA
FT                   EAHLLAIQAIKVIGHRFHTDAPHIEQIQDVVEQVLISANHFATARAYIVYREQRARLRR
FT                   DRKTVVDVETSINEYLNRADWRVNANANQGYSLGGLILNISGKVVANYWLSHVYPAEVG
FT                   RAHREGDIHIHDLDMLAGYCAGWSLRTLLTEGLNGVPGKVEAAPPKHLSSAVGQIVNFL
FT                   GTLQNEWAGAQAFSSFDTYLAPFIRKDNLPYEQVLQCIQELVYNLNVPSRWGTQTPFTN
FT                   LTFDWTCPEDLRDQVPVIGGEEMDFTYGELQAEMDLINRAYMEVMTRGDSKGRVFTFPI
FT                   PTYNITPDFPWQSENADRLFEMTAKYGLPYFQNFVNSELKPNMVRSMCCRLQLDLSELL
FT                   KRGNGLFGSAEQTGSLGVVTVNCARLGYLHKGDEAALFRALDEMLDVSRTSLEIKRKVI
FT                   QHHMDNGLFPYTKRYLGTLRNHFSTLGVNGINEMIRNFTDDAEDVTTERGYAFAVRFLD
FT                   HVRARIVQFQEETGNMYNLEATPAEGTTYRFAKEDQKRFPGILQAGTADQPYYTNSSQL
FT                   PVGFTDDPFEALERQEELQRKYTGGTVLHLYMGERVSSADACRKLVRRALENFRLPYIT
FT                   VTPTFSICPKHGYIEGEHAFCPKCDAELIARKRQTCAAAE"
FT   gene            332472..332657
FT                   /locus_tag="RC1_0320"
FT   CDS_pept        332472..332657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0320"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97768"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQN2"
FT                   /protein_id="ACI97768.1"
FT                   /translation="MNGHAGLSPSGTRTGVGNRPARRRRVPFGSPRPKMVDWVTAGLLA
FT                   CGSAPPSGLPGAGRHQ"
FT   gene            333224..334810
FT                   /gene="cobQ"
FT                   /locus_tag="RC1_0321"
FT   CDS_pept        333224..334810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobQ"
FT                   /locus_tag="RC1_0321"
FT                   /product="cobyric acid synthase CobQ"
FT                   /EC_number="6.3.5.10"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97769"
FT                   /db_xref="GOA:B6IQN3"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQN3"
FT                   /protein_id="ACI97769.1"
FT                   /translation="MSDSATTPGDGLAPIIYTPRSTDAPRRARALMIQGTSSDVGKSML
FT                   VAGLCRAFTRRGLVVRPFKAQNMSNNAAVVPDADAPPEADGTPARGEIGRAQALQARAC
FT                   KVAPSIHMNPVLLKPQTNIGSQVVLRGRVLGNCPARTYHRMRKGLMPPIMDSFERLAAE
FT                   ADLVIVEGAGSGAEIYLRASDITNMHLAERLGLPVVVLGDLDRGGTMAALVGTHALLDE
FT                   ADRARVVGYIVNKFRGDFSLFEPACGTITAMTNWPFLGVVRWFEEADRLPAEDSLALER
FT                   PATGVGSGLKVAVPRLSRVANFDDLDPLAAEPGVDLRWVSPGHPIPADTDVVVLPGSKT
FT                   TRADLDVLRQQGWDVDILAHVRHGGRVVGLCAGFQMLGRVVRDPAGIEGPAGETPGLGL
FT                   LDIETEIGGDKRLVEIDRLDRNSGRRVTGYEMHMGRTTGPGLERPWMMLDAGDGSAPRA
FT                   EGAVSADGRVTGSYIHGLFGSDGFRSAWLERVGAQASALDFEARTEAALEALADHVEAN
FT                   LDLDALLALAR"
FT   gene            334859..335770
FT                   /gene="cobD"
FT                   /locus_tag="RC1_0322"
FT   CDS_pept        334859..335770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobD"
FT                   /locus_tag="RC1_0322"
FT                   /product="cobalamin biosynthesis protein CobD"
FT                   /note="identified by match to protein family HMM PF03477
FT                   match to protein family HMM TIGR02487"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97770"
FT                   /db_xref="GOA:B6IQN4"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQN4"
FT                   /protein_id="ACI97770.1"
FT                   /translation="MTILLALLIDRFLGEPPARLHPVIWMGQYLEHAGRRLPDLPPWLA
FT                   LPAGAVAWAVGAAATVAGAGAATWLVSDLPAWLELVLLAFLLKPMFALTLLLSEVAATE
FT                   TALREGLAAGRARLGSLVSRDTAELEPEQVREAAIESLAENLSDSLVAPLFWFLVAGLP
FT                   GAALYRFANTADAMWGYRGRWEWAGKVAARADDLLNLIPARLTALALLGADALRRDRRT
FT                   VLAAEARRTASPNSGWPMAAMAMALGLRLGKPGHYVLNEGGTAPGPEDLPRALERARRA
FT                   GLGLALLAAVVQVAMAEVIIHV"
FT   gene            335798..336316
FT                   /gene="cobU"
FT                   /locus_tag="RC1_0323"
FT   CDS_pept        335798..336316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobU"
FT                   /locus_tag="RC1_0323"
FT                   /product="bifunctional adenosylcobalamin biosynthesis
FT                   protein CobU"
FT                   /EC_number="2.7.1.156"
FT                   /EC_number="2.7.7.62"
FT                   /note="[Includes] Adenosylcobinamide kinase
FT                   Adenosylcobinamide-phosphate guanylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97771"
FT                   /db_xref="GOA:B6IQN5"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQN5"
FT                   /protein_id="ACI97771.1"
FT                   /translation="MGTVTFLTGPVRSGKSARAVEIARGWGGNVVFAATYRVDPADAEM
FT                   LARVRRHQEERPEGWRTLEAPDDLTAALDALDPPPSGLILDSIVIWAAMRFDRDDSTIL
FT                   TEWSAVLEHLRAAPWPTVIVGDEIGWSPVPMEAELRRFRDLVGWLGQRTAAAADEAWLM
FT                   VAGCPVRLK"
FT   gene            336417..336974
FT                   /locus_tag="RC1_0324"
FT   CDS_pept        336417..336974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0324"
FT                   /product="ATP:cob(1)alamin adenosyltransferase, putative"
FT                   /note="identified by match to protein family HMM PF01656
FT                   match to protein family HMM PF07685 match to protein family
FT                   HMM TIGR00313"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97772"
FT                   /db_xref="GOA:B6IQN6"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQN6"
FT                   /protein_id="ACI97772.1"
FT                   /translation="MSKTKVVTRTGDGGETSLGRGVRVPKCSDRVEAYGSVDEVGAMIG
FT                   VLRSMLEDNAAVDARLRAIQIDLYNICADLHMPGEAGAALRIDGSGLERIEAELGEMNE
FT                   GLPRLANFVLAGGTRAAAFAHLTRTVTRRAERRVVALARAEEVNPEVLRYMNRLSDYLF
FT                   ILARTLNENGAKDDLWAPRGVR"
FT   gene            complement(337030..338337)
FT                   /locus_tag="RC1_0325"
FT   CDS_pept        complement(337030..338337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0325"
FT                   /product="Isopenicillin N epimerase, putative"
FT                   /EC_number="5.1.1.17"
FT                   /note="identified by match to protein family HMM PF03186
FT                   match to protein family HMM TIGR00380"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97773"
FT                   /db_xref="GOA:B6IQN7"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQN7"
FT                   /protein_id="ACI97773.1"
FT                   /translation="MGVTRRDLLRAGGAGLAAGMTVPAAWNGAGAAVPDLPPVPALAPS
FT                   ALARDTGFWEAVAGQYDATRAVVHLENGNWGMMARPVLQAYRRHQDRVNRETSYYTRRE
FT                   FGRDAREVVRRVAALLGAGEDEIALTRGATEALLTLIAGYHRLGPGDAVLHADLDYDSM
FT                   QAGLESLRRRRGVEVVRIALPEPATHQGLIDAYERALTANPRVRLMLLTHLSHRTGLVL
FT                   PVAEIVAMARARGVDVIVDAAHSLGQVPFDAAGLGADFVGYNLHKWIGAPLGVGVMYIR
FT                   RDRLDAIEPHMGEPEGAQGIRARIHTGTTDFATLLAVPAAIDFQQRIGTPAIAARLRHL
FT                   RDLWAETLRGHPGIEILTPEDPRLTAGITSFRLAGKASAEENAAVAGQLLERFGIFTVH
FT                   RTGVAKGACVRVTPALFTREEDIRKLTAALRLLAGG"
FT   gene            complement(338424..340823)
FT                   /locus_tag="RC1_0326"
FT   CDS_pept        complement(338424..340823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0326"
FT                   /product="TonB dependent receptor, putative"
FT                   /note="identified by match to protein family HMM PF02283"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97774"
FT                   /db_xref="GOA:B6IQN8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQN8"
FT                   /protein_id="ACI97774.1"
FT                   /translation="MRFRTSTALVALALTTAALPAGAQQGGVTAGQEALEEIIVTGTRG
FT                   TQRTLYETLSPVDVISGDTIDSTVSSELVDSLAQTIPSFNVQRLPANDGLAFVRPARLR
FT                   GLSPDQTLVLVNGKRRHRSALLGSRGSQGPDLAQIPSFAIKRIEVLRDGAAAQYGSDAI
FT                   AGVINIILDDQPGYRFFTQASQYYEGDGENYQFGAQGGWEIGNGGFLTATAEWSDQNAT
FT                   SRTRQRPDAIAFQAANPNLSVPNPVQRWGQPDLETVRLAVNGELPLGESVQAYLFGTYG
FT                   EGDGWTDFNWRNPDSTSNVYKTTPIFPGWDARSLYPTGFTPRFGQEDQDYSIVGGVRGD
FT                   VTDDLTWDLSGSYGRNRIDYKMRETINASLGPDSPTSFDDGSLIQEEFNLNLDFVYSLH
FT                   TGLLEAPVNVAFGGERREETYKIVAGDEASWVVGPGASAGLATGSNGFPGYGDAQAGSF
FT                   DQESYAGYVDVEVPVTDIWTIGLAGRYEDFSEFGSTTDGKISTRVEVLPNLALRGSAST
FT                   GFRAPTPGQAYSTRTSQGLDTVTLNTFTSGRLEPSNPVAQYFGAKPLKPEESVNLSAGL
FT                   AFQTDTGFSATVDVYQIKVTDRFSQSSSFTVTDTIRQQLIAQGVPGANTFTSVSFFTND
FT                   FDTRTRGIDIVGSYATDAGPGHLTLSAAYNYNKTEVTGGSLASNPTQALLFEEGLPQHN
FT                   ATLSADYRLGPVNLMARLRYYGEWTDSSGNATGDIFQTFGAESFVDMAVTWDITDAFSL
FT                   RVGAENVFDNYPGEATYQSNRGLIYSRNAPYDTDGGQYYVRLDVRY"
FT   gene            341300..342784
FT                   /locus_tag="RC1_0327"
FT   CDS_pept        341300..342784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0327"
FT                   /product="methyl-accepting chemotaxis protein, putative"
FT                   /note="identified by match to protein family HMM PF01923
FT                   match to protein family HMM TIGR00636"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97775"
FT                   /db_xref="GOA:B6IQN9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQN9"
FT                   /protein_id="ACI97775.1"
FT                   /translation="MLDLFRSRTIGVMQAQLAALDRSLAVIEFTMDGKVLTANANFLKL
FT                   MGYSLAEIQGREHTLFVDPRERSSAAYRDFWAKLGRGEYHSGEFKRIAKGGREVWIEGT
FT                   YNPVLDPDGRPVKVVKYAADITAQKMEFANLLGQVNAITRSQAVIEFGLDGTVLTANEN
FT                   FLKLMGYTLQEIVGRPHAQFVEAAARDSEEYRTFWQTLRSGRFLNGQYKRIAKGGREVW
FT                   IEGSYNPVLDLNGKPCKIVKFATDITAQMELLGNLKTLIDRNFGEIDSALDVSERQAGR
FT                   ASEAAGDTLANVQMVASSAEELAASIREISQNMQRSRDATDQAVERAGAADQATQRLTD
FT                   AATAMTGIVDLIRTIAGQINLLALNATIEAARAGEAGRGFAVVATEVKNLANQAAQATS
FT                   QITREIEGVQSVSGEVVGTLREIREAIGMVREHVAGTASAIEEQSAVTRDMSQTMQTTA
FT                   QDVGSATRSLGEIGAALQQVGQAIARTKEAAQVLAR"
FT   gene            343342..343758
FT                   /locus_tag="RC1_0329"
FT   CDS_pept        343342..343758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0329"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97776"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQP0"
FT                   /protein_id="ACI97776.1"
FT                   /translation="MADAVVIQFDHITVGIAVAEGEGFRFFASDVRYYGLENRFFPDTQ
FT                   AISRACRAIRSPAAARSAAAPADRPVRSTPSQGRARQPAPGSEEAALPSRIGLRQETGG
FT                   PLPSRGRSPLPRLPDGRSGQASRASSATGASAAP"
FT   gene            complement(343710..344030)
FT                   /locus_tag="RC1_0328"
FT   CDS_pept        complement(343710..344030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0328"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00155
FT                   match to protein family HMM PF00266 match to protein family
FT                   HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97777"
FT                   /db_xref="GOA:B6IQP1"
FT                   /db_xref="InterPro:IPR021762"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQP1"
FT                   /protein_id="ACI97777.1"
FT                   /translation="MFIALLLTAFAGFVLLALTMDRHGAQLLTRPLPRRLHRPGTLAGS
FT                   ALLLLSAAIGVEGWGWGTGLTLWSGSAAIAATVLAGVLAYRPRLALYGAALAPVALLAL
FT                   LA"
FT   gene            complement(344040..345632)
FT                   /locus_tag="RC1_0330"
FT   CDS_pept        complement(344040..345632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0330"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00015
FT                   match to protein family HMM PF00989 match to protein family
FT                   HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97778"
FT                   /db_xref="GOA:B6IQP2"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQP2"
FT                   /protein_id="ACI97778.1"
FT                   /translation="MVPGFRQVNSWLHGWSGLILGWLLYAVFLTGTYSFFRDEITWWMQ
FT                   PELHGSIPDAETPERALAKVAELAPTAALWSVILPSDRTESVRLLWREAGQGEMRGRRM
FT                   SGRHMDAGTGALLTPRETSGGEFLYHFHFELYAMPRTWGRWIVGIATMAMFVAIVSGVI
FT                   THKKIFTDFFTFRPGKGQRSWLDAHNVTAVLSLPFHVMITFSGLVLLAGTLMPWGNLAA
FT                   GVQGRGGQPATVAAGPAPEVEPGSRFAPLAPMLAAAEVAWGQPVGRFVVSDPAGPRPVL
FT                   ELAPRYNPSLLEGGGGGATRMRFDARSGTLLESVGTPERSAARAVAASLNSLHRGRFAD
FT                   PLLRWVYFLAGVGGTLMVATGLVLWSVKRAAQRRDAPAPFGHRLVANLNVGAVAGMPVA
FT                   IAAHFWANRLLPVDLPDRAGWEINVFFLVWLLTFLHPLLRPLKRAWVEQLAAAAALLAL
FT                   LPVLNALTTPFTLIDTLAAGRWLLAGFDLTMLGLAALFAVAAWKMHRHDPTRKAGRAGP
FT                   ARREDQPAPVAAE"
FT   gene            complement(345639..345965)
FT                   /locus_tag="RC1_0331"
FT   CDS_pept        complement(345639..345965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0331"
FT                   /product="iron uptake protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97779"
FT                   /db_xref="GOA:B6IQP3"
FT                   /db_xref="InterPro:IPR022109"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQP3"
FT                   /protein_id="ACI97779.1"
FT                   /translation="MTARTTTTSTPAPGRRKPGFGGRSRLEVLSRSVAGILAGYGLAAA
FT                   SAACLAVLLPGEKADAALAATMLSFLVYTAAIIWAFAAASPRRAWVGILLPAALLLALF
FT                   LLLR"
FT   gene            complement(345962..346942)
FT                   /locus_tag="RC1_0332"
FT   CDS_pept        complement(345962..346942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0332"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97780"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQP4"
FT                   /protein_id="ACI97780.1"
FT                   /translation="MDIASLPDRRSVLGGLAALLAAGPAIAQPDLSRPMDPTIADRGST
FT                   FYRFERIGLVSRDGGRRYRVTVGVPRRPAPAAGYPVLHMLDGNAALGVLTEPLLEDLDR
FT                   GGPPVLVAIGYETDRRFDVVARAFDYTPPTSLSGETWENRERGRRGGGADAFLDLIEAE
FT                   IKPRVGALAAVDPARQALWGHSYGGLFTLHCLFTRPDRFSTYIAASPSLWWQDGFILSE
FT                   EARFTGAPARLLLTRGGAEGLRREGRRREGPRPDGGADAVRQAPPPGREGFPADALPQM
FT                   AARLRALPDLSVDVIEFPGLSHGEALAASLPPALRFAAGFAGGVK"
FT   gene            complement(347011..349248)
FT                   /gene="fepA"
FT                   /locus_tag="RC1_0333"
FT   CDS_pept        complement(347011..349248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepA"
FT                   /locus_tag="RC1_0333"
FT                   /product="ferric enterobactin receptor, putative"
FT                   /note="Gene symbol synonyms identified by match to protein
FT                   family HMM PF03929"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97781"
FT                   /db_xref="GOA:B6IQP5"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQP5"
FT                   /protein_id="ACI97781.1"
FT                   /translation="MNARLTICRTATAIGLVLAATPYAALAQETAPATEKTDGTALVLP
FT                   TVKVVDTAEQELKQAPGVSLITAEDIAKRPPANDLSEVIRRMPGVNLTGNSSSGQYGNN
FT                   RQIDLRGMGPENTLILIDGKPVASRNSVRFGRSGERNTRGDSNWVPAEQVERIEVIRGP
FT                   AAARYGSGASGGVVNIITRPPTDTLAGSVTLFTNQPESGDEGDSRRIGFSLSGPLMDAL
FT                   SFRLYGNYNKTDGDDPDINRDASGAAAGTNPPAGREGVENKDIDGLLRWQMTPAQVLEA
FT                   EAGYSRQGNIYAGDRALGGTTSPIISDLAKKGAETNVMKRTTASLTHKGDWERATSRLM
FT                   FQYEHTDNTRLQEGLAGGGEGNINTTANFVTSKLKNYIATGELNIPLTVPVDMMLTTGV
FT                   EWRREELNDPFSMSQAVSSGSIPGIDNTGRSGKADADTSAVFAEANIAVTDRLMLTPGV
FT                   RFDHHTQFGDNWSPSLNASYDIFDGLQVKGGIARAFKAPNLYQSNPNYLYYTRGNGCPL
FT                   AYQSLGGGCYIQGNDALDAETSLNKEIGLVYNMDGWAASATYFHNDYEDRIQAGMVPVG
FT                   LIPSTRARIFKWENVPKAVVAGWEGNVLVPVLETLSFNTNFTYMTESKNKDTGEPLSII
FT                   PEYTINSTLDWQATDQLTLLLSMTHYGKQEPRRLNSLGGAATGAELDERGAYTLFGVNA
FT                   SYEFNDSYRLAAGISNLFDRRLYRQDTQSAAGANTYNEPGRAYTLSLTASF"
FT   gene            349306..349503
FT                   /locus_tag="RC1_0334"
FT   CDS_pept        349306..349503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0334"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97782"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQP6"
FT                   /protein_id="ACI97782.1"
FT                   /translation="MPNGPVAPDRPIRHGKRYANTTQSHFCIRNDPRADPAHPPSDIPP
FT                   ALPSIRTGIIMRVILITTPA"
FT   gene            complement(349577..352570)
FT                   /locus_tag="RC1_0335"
FT   CDS_pept        complement(349577..352570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0335"
FT                   /product="histidine kinase"
FT                   /note="identified by match to protein family HMM PF00756"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97783"
FT                   /db_xref="GOA:B6IQP7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011102"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQP7"
FT                   /protein_id="ACI97783.1"
FT                   /translation="MRLDMPFRLALSGGLFAFGLAALALTGWSLGDTAPARLLGGPAMQ
FT                   PVAAVGIMAGAAALLLRLCRPRGARRAADLTAGLVVAVTAWTAAAYAFDLPLPLDHLFF
FT                   ADAVAMQTDTVVSGRMAPGTTLGLLPVALALLLAGRGRFQAWVPALATAGLLAPGLAMI
FT                   RYLFGQDPLEGLGVVAGMAATTAVALLALGMGTLALLPERGWLGALTGDDAGARTARSL
FT                   LPWAILAPLATTWVLSLGVRAGFYSNEFGLALIAFASIAVLSTAIFRHAGALSRTEARL
FT                   RAERDRAGLYLHSAQVILLVLDRQGRIETINRAGRELLGHPPDADLAGRDWMALAVPPS
FT                   HRAELRRLFEASIQSDIDLPERFENPVCRPDGSERLIAWRNTTLRDGAGRITGVISSGM
FT                   DITERVATGTELAEREALLSAVLDALPVGVIIADAEGRIVRDNAANREIWGLPPETASW
FT                   EGYADWVGWWPQTGERIKAHEWGMARALRTGETVRGELVECAQFGSGRRRFYLNNAAPV
FT                   RNAAGQIVAGVVVEQDVTERMVADSVLRRVVEGAPFPVMVHAEDGTVVHVSQAWLSLTG
FT                   YEPEEIGTLADWTRLAHGTEPPGPCAAFDALYDLDGPRDDGDQEVRTADGRHLLWSFRS
FT                   APVGVDARGRRLAVSMAADLTARREAEARLRLLMREVDHRAKNVLAVVQAVVRLTEAAT
FT                   PEEFAAAVEGRIGAMARAHSLLAVGGWSGVDLGRLVADELAAWEDGDRIAVTGTPVRLR
FT                   AEAAQPVSLALHELATNAAKYGALSVPAGRLRLSWEERDGWLDLRWQERGGPAVQGPPT
FT                   RRGFGTDLLDSTVAGQLGGRLDRFWDAEGLTCRIRLPADCWLSGASAGVDDARPGSPLT
FT                   DPVPVPQGRAAILVVEDEPLTAMMIRRHLEGAGYTVIGPAARVPDALVLVGQRRIDAAV
FT                   LDARLFGAFVTPVAAVLGAMGVPFLLCSGYASLAGLPTALRDVPLLPKPMEADALVRAV
FT                   GGLLGRSS"
FT   gene            complement(352680..352826)
FT                   /locus_tag="RC1_0336"
FT   CDS_pept        complement(352680..352826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0336"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00593
FT                   match to protein family HMM PF07715 match to protein family
FT                   HMM TIGR01783"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97784"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQP8"
FT                   /protein_id="ACI97784.2"
FT                   /translation="MQDEAVTMLDLGRCQGMHTAVLQLVRASGVPVVALPADALLAGLL
FT                   SAP"
FT   gene            complement(352891..355524)
FT                   /gene="cheA2"
FT                   /locus_tag="RC1_0337"
FT   CDS_pept        complement(352891..355524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheA2"
FT                   /locus_tag="RC1_0337"
FT                   /product="chemotaxis protein CheA"
FT                   /note="identified by match to protein family HMM PF00593
FT                   match to protein family HMM PF07715 match to protein family
FT                   HMM TIGR01783"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68620"
FT                   /db_xref="GOA:D3PKA0"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:D3PKA0"
FT                   /protein_id="ADC68620.1"
FT                   /translation="MNPLLAQFLVEGREQIAATTDGLLALERDTADADLLNGVFRSVHT
FT                   LKGSSGLFDLPALTATLHAAEDLLVTLRDRRLTLVPAMMDQILGALDLVSGWLDAVEDT
FT                   GRLPDTAAAEAAPAVAALRSWLGGPATPAAAPAAAPAEAVAPPGWLATVPEPALQAAFL
FT                   YGLSHGVPLSVLCYRPEPQCFFKGDDPLALVRQVPEALSVGLEEPESWPDLADYDPFSC
FT                   GIGFRVISGAPRSELLHLLRYVADQAEVTEVEAADLLRFAPPPPDDPLVRDLAREAGAL
FT                   LRLGDVTGVREAALAAAEALEARGCDPGPVRWLARLCDVPGAAGEVVASLAAVLVTALA
FT                   TGTTPDPATIMPAAGTDAVPGAPAAAAFSPAVALLLREQAAMLAQPCDLAERAGRIGSA
FT                   AKVAAGALRHDGRFEPAGAVAAAGRQALAAADPAPLRAALERLLDGPSSPLTAAGTAAG
FT                   ASVAPLSAGPEKPRRPERAGPAGEEGHDRAATVLRVDQTRIDAMMNLIGELVVAKNGLP
FT                   FLARRAEDVFGSRELAREVKEQYAVIDRIALDLRNAIMQVRMLPVSTVFQRFPRLVRDL
FT                   SRKLGKQVELVIEGEDTQADKTVIENLFEPLLHLVRNALDHGIEADRTAAGKPGTATLT
FT                   LAARQDNDQVVIRVEDDGRGIDPALMRRKAVEKGLIDADAAARMGDDEAVRLIFAAGFS
FT                   TAAEVTDVSGRGVGMDAVRTTVEKSGGRIDVSSRVGQGTAISLFLPLSMAVTRVMTVGV
FT                   SGRQFGIPMDQINETVRIRRSDIASIKDREVFVLRNGIIPLVHLDRLLDLPPRPQAEEV
FT                   AVLVVQVDAQTVGLAIDAFGESMEVIVRPLEGVLADTPDYLGTALLGDGRVLLVLNLKE
FT                   IVRCRS"
FT   gene            complement(355521..355934)
FT                   /gene="cheY2"
FT                   /locus_tag="RC1_0339"
FT   CDS_pept        complement(355521..355934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheY2"
FT                   /locus_tag="RC1_0339"
FT                   /product="chemotaxis protein CheY"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97785"
FT                   /db_xref="GOA:B6IQP9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQP9"
FT                   /protein_id="ACI97785.1"
FT                   /translation="MMDETASPFRPGAGRRLLVIDDAAIVRAYYRQALEPEGYGVEEAF
FT                   NGIEALEKVLTAPFDLAIVDVNMPKMDGLTFVRRLRATEEGACLPVMMTSTRDQEADFA
FT                   AARAAGVNLYLVKPISTADLRLYAGIMTGAENP"
FT   gene            complement(355931..356842)
FT                   /gene="cheR2"
FT                   /locus_tag="RC1_0340"
FT   CDS_pept        complement(355931..356842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheR2"
FT                   /locus_tag="RC1_0340"
FT                   /product="chemotaxis protein methyltransferase CheR"
FT                   /EC_number="2.1.1.80"
FT                   /note="identified by match to protein family HMM PF01584
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97786"
FT                   /db_xref="GOA:B6IQQ0"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQQ0"
FT                   /protein_id="ACI97786.1"
FT                   /translation="MPAPGPPGKAPKAMLKTATRPGSRSAVTTVSDDEFRKFCDLIYRR
FT                   TGMSYGETKRYFVDHRLLERVAQTESPSVQSYLSLLRFDTTGRELELIVNALTVNETYF
FT                   WREEHQFACLTRSILPDILARKRRGDRLRIWSLPCSTGEEPYSIALWLLENWPEVDHWD
FT                   VEILASDIDTRVLEAARAGIFDARSVQRLSHSVLGRYFTRLPDDRWQILDALRGSIEFS
FT                   RVNVSDRDQMAGFRDVDVIFCRNMLIYFDDVSRREAAEAMFSCLTPGGYVCLGHSESMS
FT                   RISSLFDVRRFDDAIVYQRPFR"
FT   gene            complement(356856..357470)
FT                   /locus_tag="RC1_0341"
FT   CDS_pept        complement(356856..357470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0341"
FT                   /product="HEAT repeat-containing PBS lyase, putative"
FT                   /note="identified by match to protein family HMM PF01627"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97787"
FT                   /db_xref="GOA:B6IQQ1"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQQ1"
FT                   /protein_id="ACI97787.1"
FT                   /translation="MPLVKGNTPAGAAAPAFPDRASVIAALAGGDPARRRAAAHAAHAC
FT                   ADAVALIAAALAVEEDPSVAEGMILALVEIGGEDAAAALAPLLRSEDATRRFAAAEALR
FT                   DAGDEALPFFEALIRDHDPQVRIMAAEIARGPLGRTAAATLEALLPGEEEINVACAFID
FT                   VLSEIGTAATAAVLHDFAARHPGKPYVRFTVDAALALLPTE"
FT   gene            complement(357472..358527)
FT                   /gene="cheB2"
FT                   /locus_tag="RC1_0342"
FT   CDS_pept        complement(357472..358527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheB2"
FT                   /locus_tag="RC1_0342"
FT                   /product="chemotaxis response regulator protein-glutamate
FT                   methylesterase CheB"
FT                   /EC_number="3.1.1.61"
FT                   /note="Chemotaxis response regulator; identified by match
FT                   to protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97788"
FT                   /db_xref="GOA:B6IQQ2"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQQ2"
FT                   /protein_id="ACI97788.1"
FT                   /translation="MIKLLVVDDSALMRRHLGRIFQELPDFQVSFARNGAEALAAVRDQ
FT                   QPDVVTLDINMPEMDGLTCLSHIMTESPRPVVMVSSLTTKGAMATLEALELGAVDFIPK
FT                   PDGTVSLSIDRIEADLVAKVRAAAKVRMRTRLMARRGRAAEEAAPAPKRMPAPAGGTVA
FT                   GLVLIGVSTGGPGALDCVLPPLREDFRWPVLVCQHMPANFTGVLARRLDAASRVRVVEV
FT                   TGPTPLQPGCAYIAKGDADMLIATRPTGLIALPTPASSRHLWHPSVDRMVFSAMEHMEP
FT                   SRLIGVLMTGMGNDGAEAMAALRQKGGRTIAEAEETAVVWGMPQDLIRRGGADMVLPVQ
FT                   SVADQLERWVR"
FT   gene            complement(358553..360088)
FT                   /gene="cheW2"
FT                   /locus_tag="RC1_0343"
FT   CDS_pept        complement(358553..360088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheW2"
FT                   /locus_tag="RC1_0343"
FT                   /product="chemotaxis signal transduction protein CheW"
FT                   /note="identified by match to protein family HMM PF01739
FT                   match to protein family HMM PF03705"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97789"
FT                   /db_xref="GOA:B6IQQ3"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQQ3"
FT                   /protein_id="ACI97789.1"
FT                   /translation="MNMTNAAADPGGDAGTGDARQYVTFYVQNEMFAVPLAEVQEIIRM
FT                   PEIVGVPKSPPSLQGLANLRGTVLSVTSLRRIFHFPDVPHDDSTRVVVIDQGAPVGFVV
FT                   DRMAAVVTVDADRIEPAEAIGATIDTDLLRGMIKGVEGHAMIMILDPARLLSTEKPKGR
FT                   RKGTSRVAAGSAGSRGTEEERLSDELQLVSFEVAGQEYALGIESVQEIVQVPDNVSRIP
FT                   CTDAHVLGVMTLRNRLLPLVSLRAMFNLPDREIDERSKIVVVPLDEANSVGIVMDTVRE
FT                   VLRVRKDTVDPLPGMLGDGQGEIRSICRLNGGRRLVSILSADQLFRHDAVRSAVAVASG
FT                   REESMAEATEGGRAAAVADEEEQFVVFRLGNEEYGAPIESVNEIVRVPEVLTRVPKTAA
FT                   FIEGVVNLRGSVLPVIDQRRRFDLPELERNDRQRIMVFTINGVRTGFIVDSVLEVLKIA
FT                   RGTIRPTPSLSDEQARLIGRVANLESSKRMILLLDVGNLLDAAEMTAVVEAVH"
FT   gene            complement(360117..362045)
FT                   /gene="mcp2"
FT                   /locus_tag="RC1_0344"
FT   CDS_pept        complement(360117..362045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcp2"
FT                   /locus_tag="RC1_0344"
FT                   /product="methyl-accepting chemotaxis protein Mcp"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97790"
FT                   /db_xref="GOA:B6IQQ4"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQQ4"
FT                   /protein_id="ACI97790.1"
FT                   /translation="MSLVKKMDVGRASASSAAAPVGTRATSTAADAQRKRARTFARQQK
FT                   VAERVASATTQMASGISESASASEQLRKSMEQIAAGAQQAAGAAQQSLTAITGINAAIL
FT                   EARGRADASRQKSEQLQVLLAEVGAQITASVGSIGVNAERQMTSVTMIIELEQQAANIG
FT                   EIVKAVARIADQTNLLALNAAIEAARAGQHGKGFAVVADEVRTLAETSEKSAREIQDLV
FT                   GQIQSEVKVIADGINRGADAARSEMEKGRTVGVQLDQIRQDMTGLVKGAADIASAAVES
FT                   ERAAREAQKGSESVAAAAEEQSSACDEALRTVDQQTAALNQSQTASGELQTIAEELRNS
FT                   TDITKSAEEVASAAEELSAAVQEISGAATQIMAAIEQISRGSQQASAATAQSSAAINQI
FT                   ERGARLSQGNAGQALERARGMAELLDSSRASVEGLIKGVVQALDETRRSNEQITALELV
FT                   SRRIDKIVDAISTVAIQTNMLAVNGSIEAARAGEFGKGFAVVSTDIRNLARDSAENAER
FT                   IKDVVKATQDQIVAVRRDLEFIAQASASEVEKNKAITVNIASATRDMAIVVEGNDVILK
FT                   GADGILAALEDAKQGVQQIAAAAEEASRAAAEASAAAKQQARGAEELAAAVEEIASLAD
FT                   ELQNSAD"
FT   gene            complement(362135..363610)
FT                   /gene="hdpA"
FT                   /locus_tag="RC1_0345"
FT   CDS_pept        complement(362135..363610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hdpA"
FT                   /locus_tag="RC1_0345"
FT                   /product="hybrid phosphotransfer protein, HdpA"
FT                   /note="[contains] response regulator receiver domain; PAS
FT                   domain S-box; identified by match to protein family HMM
FT                   PF00072 match to protein family HMM PF01339"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97791"
FT                   /db_xref="GOA:B6IQQ5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQQ5"
FT                   /protein_id="ACI97791.1"
FT                   /translation="MVAFPPDPGIPEAGTVPLVLRHLEGLDLGVVIVDGEGRILRDNAW
FT                   VRRRFGAGTRSVRGIRLEPLLPELRPGRLAGALADALATGLSVLLSPDPGAAGSAAPAA
FT                   SAADGRPPASLAIVRPLRVEGAGCCLVQLFDGSAAMPRGGGPGRGRQRGARYHAALETA
FT                   QDSFVTLDAAGRIAWINPAAERRFGRSLAETLGRPLSLLLPDTTGQLPTGGLVRTRALA
FT                   AGGRPFEAEIATGCWVGGTVRYRTLFIRDAGAGPGGDDGPPSDGAAETPGFEWQVGRIV
FT                   HEFNNLLMVIQANAGLLSDHVADTDLADAVREIGEAAGRGATLTGRLLSVAGGTGRPPG
FT                   GGPSLMPPSPPPWPVRPEPLPPLRILRVAADTDLCRTLDDALAGGGHAVTPAADGYQAL
FT                   ECLEAMPFDLLLSDARLPGGLSGALLAREVRPLFPDLAIVLVAGGDAAVAAPAVLLPEE
FT                   APVLRLPFSPDDLSSAVAGALAAAAVPAGKGFP"
FT   gene            complement(363613..365138)
FT                   /pseudo
FT                   /gene="rsbT"
FT                   /locus_tag="RC1_0346"
FT   CDS_pept        complement(363613..365138)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbT"
FT                   /locus_tag="RC1_0346"
FT                   /note="serine;Alternate names identified by match to
FT                   protein family HMM PF01584"
FT   gene            complement(365135..365500)
FT                   /gene="rsbS"
FT                   /locus_tag="RC1_0348"
FT   CDS_pept        complement(365135..365500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbS"
FT                   /locus_tag="RC1_0348"
FT                   /product="antagonist protein RsbS"
FT                   /note="Part of the sigB operon.Alternate name: modulator
FT                   protein RsbR identified by match to protein family HMM
FT                   PF00072 match to protein family HMM PF00989 match to
FT                   protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97792"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQQ6"
FT                   /protein_id="ACI97792.1"
FT                   /translation="MEGVHILTVEGVLVVTLPGVTDDRMAERLVEEVAGRLVEHRARAV
FT                   VIDVSNARLIDSFMGRVLEQMARTARLMGVEPMLTGMRPEVAITLIELGMTLGGIATAL
FT                   SLEHGLARLRERAGGRS"
FT   gene            complement(365504..366331)
FT                   /gene="rsbR"
FT                   /locus_tag="RC1_0349"
FT   CDS_pept        complement(365504..366331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbR"
FT                   /locus_tag="RC1_0349"
FT                   /product="sigma-B modulator protein"
FT                   /note="identified by match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97793"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR025751"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQQ7"
FT                   /protein_id="ACI97793.1"
FT                   /translation="MQDTAPAADAGPTPESLRRDRLSVLDGWASYLSREIQTHGIEARL
FT                   LREFSAGLYDGMVEALGRQPVVLSEDLRELLSALSIEFAERGVSPSQTATFVFSLKHVL
FT                   QERYGDGTPAMTSVHLLVDAMGLHSMDALITRREQIIRRQSQELLELSVPVVPLWEGVL
FT                   SLPIIGTLDSVRAQAITEKLLFEIARTGSRYAILDISGVPTVDTQTAQHLAKTAGAARL
FT                   MGAECIITGIRPAIAQVMVALGIDLSNIETRFSLAEGLRHCFTRMRLTVVPGA"
FT   gene            complement(366364..366741)
FT                   /locus_tag="RC1_0350"
FT   CDS_pept        complement(366364..366741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0350"
FT                   /product="response regulator receiver domain protein REC"
FT                   /note="identified by match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97794"
FT                   /db_xref="GOA:B6IQQ8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQQ8"
FT                   /protein_id="ACI97794.1"
FT                   /translation="MATILVVEDVPSVMLSLRIVLEGCGHTVVGAANAEEGLGRLRQGG
FT                   IDLVVTDIWMPGQPGTAVISEGRRLAPGTRFLAITGGAPNGSFTAEDLRREGTDFGADQ
FT                   VLYKPFQRAELIQAVSHLLPA"
FT   gene            complement(366719..367825)
FT                   /locus_tag="RC1_0351"
FT   CDS_pept        complement(366719..367825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0351"
FT                   /product="multi-sensor hybrid histidine kinase, putative"
FT                   /note="identified by match to protein family HMM PF01740"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97795"
FT                   /db_xref="GOA:B6IQQ9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQQ9"
FT                   /protein_id="ACI97795.1"
FT                   /translation="MREREMLLAVIDACPISIAVADARRPDTPLIYVNRIFQTLTGYDR
FT                   AEVMGRNCRFLHGPGTDDAAVGVLHEAIRTGSRADVRLLNYRKDGSTFLNHLVLAPIHD
FT                   ETGTLSAYIGLQSDVTDEARREEIDRQRQRVEALGRMMGGVAHEINNLLQPVTLLTEEL
FT                   MRRQRSTADTACLHTILDCALSARRIIGDLLAFSRPGGRETEVVDAAALLRDALVLVRK
FT                   AVGPGILIRFDDGGGTADIHADRTAFIQVLLNLANNAAAAMGGEGTIDVTLSVGPAPRG
FT                   AGGQVRIAVADTGCGMDGALLERAFEPFFTTKPVGQGTGLGLSVAFGLVKEMGGEIILE
FT                   STPDRGTTAIVLLPAVQGKLEDGHDSRR"
FT   gene            complement(368217..368588)
FT                   /gene="cheZ"
FT                   /locus_tag="RC1_0352"
FT   CDS_pept        complement(368217..368588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheZ"
FT                   /locus_tag="RC1_0352"
FT                   /product="probable chemotaxis phosphatase, CheZ"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97796"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQR0"
FT                   /protein_id="ACI97796.1"
FT                   /translation="MQTHKDCVRVCRVLAAQLAEVQARFEKSSGELIATLDRLDGAVVT
FT                   GEGKEDAGRLRNLVDDILFSQAQEHDLIRQMMEVVAQALALLPDDIDVEGLAALYISEA
FT                   QHRVHRQTLMAPSETGDAG"
FT   gene            complement(368598..368966)
FT                   /gene="cheY"
FT                   /locus_tag="RC1_0353"
FT   CDS_pept        complement(368598..368966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheY"
FT                   /locus_tag="RC1_0353"
FT                   /product="chemotaxis protein CheY, putative"
FT                   /note="Also called response regulator receiver; identified
FT                   by match to protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97797"
FT                   /db_xref="GOA:B6IQR1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQR1"
FT                   /protein_id="ACI97797.1"
FT                   /translation="MSLIFVIDDSPTMVMSLSRILAKYGYSVETATNGQDGLKRLKGGM
FT                   KPNLILTDINMPEMDGITFIKEARKHAPTRFTPIVVLTTESVATKQSEARSAGASGWLT
FT                   KPTQPDDLIATIRQLLPA"
FT   gene            complement(368957..370267)
FT                   /locus_tag="RC1_0354"
FT   CDS_pept        complement(368957..370267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0354"
FT                   /product="methyl-accepting chemotaxis sensory transducer,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF00512
FT                   match to protein family HMM PF00989 match to protein family
FT                   HMM PF02518 match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97798"
FT                   /db_xref="GOA:B6IQR2"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQR2"
FT                   /protein_id="ACI97798.1"
FT                   /translation="MTPMERHGTAGRRFASAGPVLSVLVAAAAVASLAVVLAAGHPSVV
FT                   RALGIVSALLCVAALVPALRARRPDGAVPAPSARIQPPSSSAPSLPDLSLPGRPLVPVL
FT                   GPTGGPVPAARFEPGPAGGTSNDLQTAMGLFGSVIMEQVETSVTAVVKENLQMREMAEE
FT                   MSTAAQQANEQFRRSMTGASDTETCIERLSTVGEGLFAAIGVIGKEVESTLDVVKTATS
FT                   RAAATSERVDTMAALAEDVAETIGLINDIARQTRMLALNATIEAVRAGDAGRGFAVVAS
FT                   EIKQLAHQTAVATDTISARIASMRETTQSTVAALRVLVDTIAMTDTASGRIATALHDQE
FT                   TLATEVSGSLGQMRESVFGLSREIREAAQIAANSGMLSDLVLDTANQVDGLMINLRDQL
FT                   RTVGAGMIPAQADPDAGPLAAAPVQVAPHQKDVTECR"
FT   gene            complement(370333..370962)
FT                   /gene="fixJ"
FT                   /locus_tag="RC1_0355"
FT   CDS_pept        complement(370333..370962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixJ"
FT                   /locus_tag="RC1_0355"
FT                   /product="transcriptional regulatory protein FixJ"
FT                   /note="Contains PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97799"
FT                   /db_xref="GOA:B6IQR3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQR3"
FT                   /protein_id="ACI97799.1"
FT                   /translation="MPYDGAAGVVVHIVDDEPTVLKALRTLLEADGYTCRTYEDGGPFL
FT                   AAGVGERDCVIADVQLHDMTGIDLLLTLRARGQRNPVLVITGYASVEVAVEAMKAGATD
FT                   FLTKPFEKAELVGKVRACLAIARLRASETARRRAAAEKLAALSEREVEVLGQVIEGRTN
FT                   RAIGDVLGISIKTVEAHRARIMEKTGALSLVDLTRLWDTAGPCAAL"
FT   gene            371825..372838
FT                   /locus_tag="RC1_0356"
FT   CDS_pept        371825..372838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0356"
FT                   /product="glycosyl transferase, family 2, putative"
FT                   /EC_number="2.4.1.-"
FT                   /note="PF00535 identified by match to protein family HMM
FT                   PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97800"
FT                   /db_xref="GOA:B6IQR4"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQR4"
FT                   /protein_id="ACI97800.1"
FT                   /translation="MTHSSSRAVRPDDGSMLPGSRTAPTIDVIIVNFRSEALIRACVGS
FT                   LRRYPPATCAVGRILVVDNSSDMSEASLDEKVEILRPGRNLGFGAACNLAAQRSAADLL
FT                   LFLNPDAEILEGTLDRALAALGEPIPGDTGSGPFPVGIVGVQLVDGCGRVQRTCSRFPR
FT                   PVTLLGQALGLHLLAPGRFGPFMTDWDHSETRAVDQVMGAVMLMRRSTFLDLDGFDPRF
FT                   FLYYEDLDLCLRVKAAGQQVLYIADAQARHIGQGSSRTAVALRLHQFLRSRVLYTRKHF
FT                   GVIPALALAIASATVEPVLRLAQAAARRESPGPVVLGFLGFWRDLPTLFRSRDTAP"
FT   gene            372997..374724
FT                   /gene="prtD"
FT                   /locus_tag="RC1_0357"
FT   CDS_pept        372997..374724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prtD"
FT                   /locus_tag="RC1_0357"
FT                   /product="proteases secretion ATP-binding protein PrtD"
FT                   /note="identified by match to protein family HMM PF00015"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97801"
FT                   /db_xref="GOA:B6IQR5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010128"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQR5"
FT                   /protein_id="ACI97801.1"
FT                   /translation="MRTKPKTELTLALKACGGGFAMAGVFSFFINMLMLVSPLYMLQVY
FT                   DRVLGSRSEATLLMLTIVIIGLLGVMGALELLRSRVLVRISNRIDTRLAERLFEIVYER
FT                   ALRMPQASRSQPLSDLLTLRQFLTGQGLFAFFDAPWAPLYMLVVFLLHPLLGIIAVCGA
FT                   VILVALAVATEMLTRKPLAQANQEQMLGGQFAETNLRNAEVLEAMGMLPGIRRRWYDRH
FT                   RKMLTLQAVASDRAGAISSITKFVRISLQSLILGAGAWLAIRHEITPGVMIAASIIVGR
FT                   ALAPVEQAIGTWKLLLQARSSYERLTEMFQKVPPRPQPMPLPAPTGALAVEGLVAVPPG
FT                   STVPALRGISFQVEAGEAVGIIGPSAAGKSTLVRMLVGVWPAYAGKIRLDGADIGQWDR
FT                   TQLGPHIGYLPQDVELFSGTIAENIARFGEVDADKVVTAARMAGVHDLIVRLPQGYDTQ
FT                   IGEGGSVLSGGQRQRVALARALYGDPVLVILDEPNSNLDDEGEAALVRAMAQLRDRGAT
FT                   VLIVAHRPSVLGGVDKILVLRDGAVQMFGPRADVMARFARPATAVQTENVTQLKSGVA"
FT   gene            374721..376082
FT                   /locus_tag="RC1_0358"
FT   CDS_pept        374721..376082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0358"
FT                   /product="HlyD family secretion protein"
FT                   /note="identified by match to protein family HMM PF00072
FT                   match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97802"
FT                   /db_xref="GOA:B6IQR6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQR6"
FT                   /protein_id="ACI97802.1"
FT                   /translation="MMTMIDLVPTQRAATTIDNRLPEAPVPTSFKGVAISGLLLLGITF
FT                   GGVGTWAAVAPLSSAAIATGVLTVASNNKMIQHLEGGIVKEIRVKEGDMVAAGATLVVL
FT                   DPTRAEAQVDIVRGQLDATLALEARLLAERSGADAVRFPDSLVKNTSDPDVAAIIDSQK
FT                   KLFEARRLSLEGQVTILRKRIVQAREQIGGLEAQRDSNDRQITLIEDELKGLRELYEKG
FT                   YAPRTRILALEREASRLLGERGQYGGEVSRVQQVIGETELQIIQVRKNFQEEVAKQLQE
FT                   TQNQIFDLRERLRAAEDVLARTVITSPEAGKVTGLKVHTVGGVVPPGDVMLQIVPDNDD
FT                   LIIEAQLQVTDVDNVHVGQQADVHLTAFSQRITPVVTGTVENVSGDRFQDQRTGLPYYT
FT                   VRIVVSEEERVKLGDLQLLPGMPADAYIKTGEKTPLRYLFDPLIQVINRSFREN"
FT   gene            376228..378018
FT                   /locus_tag="RC1_0359"
FT   CDS_pept        376228..378018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0359"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97803"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQR7"
FT                   /protein_id="ACI97803.1"
FT                   /translation="MEGVVSSVVIPLRRPVQHQTKSWANQELAEFYRVVEILNRAGLAV
FT                   SIDSGWSDEGDPWLVFLRDDSSEVIAHFAKIDGRLVASNGATGDTIRGSNFRDLLNALV
FT                   RMQPLVLPPASPATAKLYLHPSVILSAFVAAALMLLSDASPAEASEASADPGPGGDDAA
FT                   QVREATPDPETMIRPVSGHVIPAVRAFDGQRQWEALRSPTSKADSIFTQAQFAALTAVL
FT                   GTAMMLLDQAGDVAGLPKTEAETAAASTGPSQQTGAEAAPTEWAVAALGHDEPQKPILT
FT                   ETSSAPEAAPATASDSAHALSAASLSSFLEQETAGDVYRSGIDSVRISDDTIVVSHDLL
FT                   NVEGVAFRAHDGVATEPPVTLETAPAIVFLTQGGLIEVRIVPVLAEILLLNPGKAVEVE
FT                   FDILLDTVAASADVAPPPASPDAARERPVSSPGAAPEEMNSDRSDDAGAKKVADTPAAQ
FT                   TPDQPGSPVPTPPSDSSSPSPPADSGHPTTQPGHPLPEAPQATVPHAPELAAFGKIILA
FT                   DGSSDYLLTAGRETIVFTGGQVTLFNFQFGTDRLIIETSNINPSSMEITWSDQGSLIMT
FT                   FDDNSKLTFVGITGWENPGG"
FT   gene            378162..378944
FT                   /locus_tag="RC1_0360"
FT   CDS_pept        378162..378944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0360"
FT                   /product="SapC family protein"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97804"
FT                   /db_xref="InterPro:IPR010836"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQR8"
FT                   /protein_id="ACI97804.1"
FT                   /translation="MDNSIVAVSADAHGRKRLKPVTDYSFAATLTAFPLTVPEVMVAAA
FT                   EYPIAFTKNADSLEPSALLSLGSSRNLFVDANGRWLGNYIPAIIRRYPFVIGQVPEENN
FT                   LALCIDESSGLLSETEGEPLFTDDLKPSQTLAKAIQFCNEMESARGATLSATAAIAEAG
FT                   LIQPWPLKIQQGSSVREISGLFKIEKSAFFSLPDDIILRLRANGGLTLIYAHLVSVNRL
FT                   QALAKMVPAPVSSFPAPAPAKPAPDLPRGPSEELVFRF"
FT   gene            379211..380674
FT                   /gene="atpD"
FT                   /locus_tag="RC1_0361"
FT   CDS_pept        379211..380674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="RC1_0361"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="[synonyms] ATP synt Hase subunit beta ATPase subunit
FT                   beta identified by match to protein family HMM PF00005
FT                   match to protein family HMM TIGR01842"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97805"
FT                   /db_xref="GOA:B6IQR9"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQR9"
FT                   /protein_id="ACI97805.1"
FT                   /translation="MPDMLTQSPDGRVISVRGSVVDLAFPQEALPALNEAVEVLWDAGE
FT                   PLICEVHAHLDPGTVRTLALAATGGLARGTPARRTGAPLSVPVGEPLLGRLVDVLGRPG
FT                   DAGEPITAEAPRWPIHRPAPPLAGQTPRRDVFETGIKVIDLLAPLARGGKGGMFGGAGV
FT                   GKTVLVTELIHNMVAQQTGLSVFAGIGERSREGQELLEEMRRSGVLERTALVFGQMNEP
FT                   PGARWRVGLTALTIAEWFRDEARRDVLLLMDNVFRFVQAGAEVSGLLGRLPSRVGYQPT
FT                   LITEIAELEERIASVPGATVTAIQAVYVPADDFTDPAVAELFGHLDSAIVLSRSMAAEG
FT                   LYPAVDPLASSSALLDPLVVGEEHYRTAEDVRALLAHYRELQDIIALLGIEELSPADRL
FT                   AVKRARRLQRFLTQPFAVTEAFTGRKGGSVARVETLAGCRAILDGQTDDWAESSLYMVG
FT                   TLAEARAKEAADSRPAGSATSGGTTGSTG"
FT   gene            380671..381117
FT                   /gene="atpC"
FT                   /locus_tag="RC1_0362"
FT   CDS_pept        380671..381117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="RC1_0362"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="[synonyms] ATP synt Hase epsilon chain identified by
FT                   match to protein family HMM PF00529 match to protein family
FT                   HMM TIGR01843"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97806"
FT                   /db_xref="GOA:B6IQS0"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR024037"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQS0"
FT                   /protein_id="ACI97806.1"
FT                   /translation="MMRLTITTPTAVAVDVADAVQVRAEDFSGGFGIRTGHADFLTALV
FT                   PSVVIWRREDGSEGYCAVRGGVLTVSGGRTVAVATREAVPGDDLDRLEHEVRDSFIVRQ
FT                   REEQEARSGARILQVSALRHMLGYLRPDGGGPSRRAPREEGAEG"
FT   gene            381114..381404
FT                   /locus_tag="RC1_0363"
FT   CDS_pept        381114..381404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0363"
FT                   /product="F0F1-ATPase subunit, putative (H+transporting ATP
FT                   synthase protein1)"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97807"
FT                   /db_xref="GOA:B6IQS1"
FT                   /db_xref="InterPro:IPR011744"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQS1"
FT                   /protein_id="ACI97807.1"
FT                   /translation="MSGPDGNHGNEHLGRDVRRRRERRERWQREGERPLGRNLALVGSL
FT                   GWAIVLPGVGGLFLGRWLDGGVGAFWTISLLVGGLGAGCWMAWERIRQEER"
FT   gene            381401..381709
FT                   /locus_tag="RC1_0364"
FT   CDS_pept        381401..381709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0364"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97808"
FT                   /db_xref="GOA:B6IQS2"
FT                   /db_xref="InterPro:IPR017581"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQS2"
FT                   /protein_id="ACI97808.1"
FT                   /translation="MTMLLAHPWMPTALAALAALAAGLAGGVIYFRALRLNARLWLAGR
FT                   GVALPLLLHAGRLLLAGGLFVLAAQAGAAALLAGFAGFLAARRLTVRPGTAEPEGVA"
FT   gene            381706..382377
FT                   /gene="atpB"
FT                   /locus_tag="RC1_0365"
FT   CDS_pept        381706..382377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="RC1_0365"
FT                   /product="ATP synthase F0, A subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="[synonyms] ATP synt Hase subunit a identified by
FT                   match to protein family HMM PF00006 match to protein family
FT                   HMM PF00306 match to protein family HMM PF02874 match to
FT                   protein family HMM TIGR01039"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97809"
FT                   /db_xref="GOA:B6IQS3"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQS3"
FT                   /protein_id="ACI97809.1"
FT                   /translation="MTESPLLTPVLFSIGPVPVALPVVTTWGLMAFLAIGSALATRRLA
FT                   LRPGTAQSLVELVVTTIEQQLDETMQTSSRPYLPLLGTLFLYLVVANLSGIVPGMKAPT
FT                   AALETAAALALITFLSVQVWGVLRRGPGGYLASFAKPTVLMLPLNLLAEVTRAFSLMVR
FT                   LFGNVMSGEFVIAMILALAGLFVPVPLMALEILLGLIQAYIFTILAAVFIGGAVGSIEK
FT                   G"
FT   gene            382384..382626
FT                   /gene="atpE"
FT                   /locus_tag="RC1_0366"
FT   CDS_pept        382384..382626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="RC1_0366"
FT                   /product="ATP synthase F0, C subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="[Synonyms] ATP synt Hase C chain Lipid-binding
FT                   protein identified by match to protein family HMM PF02823"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97810"
FT                   /db_xref="GOA:B6IQS4"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQS4"
FT                   /protein_id="ACI97810.1"
FT                   /translation="MTIEMISILAAAFAVGLGAIGPALAEGKAVAAAMDAIARQPEAAN
FT                   VLSRTLFVGLAMIETMAIYCLVVALLVLFANPFVG"
FT   gene            382630..383391
FT                   /gene="atpF"
FT                   /locus_tag="RC1_0367"
FT   CDS_pept        382630..383391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="RC1_0367"
FT                   /product="ATP synthase F0, B subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM TIGR02230"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97811"
FT                   /db_xref="GOA:B6IQS5"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6IQS5"
FT                   /protein_id="ACI97811.1"
FT                   /translation="MAIDGWTVALQAVNFLILVLLLRHFLYRPVLAMIDRRKAEATRLL
FT                   DDAALRVEAAKAERQKAETLRADLEAQADALLADSRARAGKELEELRTRARREADGILA
FT                   EGRKALAEERRAAEADLRGKAAGLAVEIAGRLLAAATPGARVEPFLDRVCTRLTALPEP
FT                   ERQVLAGQAADGGIRIVTAVPLDEAGRAHCRDRAHTLLGPDIALTFADDPELLAGVELH
FT                   FAHTVIRDSWRDLLGRIGLELDGHDDAHRIA"
FT   gene            383366..384928
FT                   /gene="atpA"
FT                   /locus_tag="RC1_0368"
FT   CDS_pept        383366..384928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="RC1_0368"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="[synonyms] ATP synt Hase subunit alpha Vegetative
FT                   protein 100"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97812"
FT                   /db_xref="GOA:B6IQS6"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQS6"
FT                   /protein_id="ACI97812.1"
FT                   /translation="MTTLTGSLDRWLPEASQRAGTVPAGPRVEETGRIERVGDGVALVS
FT                   GLPGARADEILVLPGGVPGLAMTLDRDTIGCVLLGDGARLSAGGTVHGSGAIVRVPVGP
FT                   GLLGRVLDPLGRPLDGGPPPHASRLNPVERPAPAIAERAEVTQPLHTGLTVVDAMFPIG
FT                   RGQRELIIGDRATGKTALALDAMLAQRDGDVVCIYAAIAQKASSVREVVEALRAGGMLE
FT                   RSIVVVASPDAPPGLQWLAPYAAMTMAEFFRDSGGHALVVLDDLTKHAAIHRQIALLLR
FT                   QPPGREAFPGDVFYLHSRLLERSAKLSDAQGGGSLTALPVAETLAGNLSAYIPTNLISI
FT                   TDGQIVLDTKLFHQGQKPAVDVGRSVSRVGGKTQSRSLRPLAESLRLDYAQFAELEAFT
FT                   RFGGMTDERTRRAVEHGRRLRSLLAQPRLAPLPLVAQVALLLALAEGLLDPLPLDRIPR
FT                   FRADALAALADHGAIAARLATGEALDDTTRAALLAAMRRLLPAAPPAAPSATPSAAAGR
FT                   TGG"
FT   gene            384925..385743
FT                   /gene="atpG"
FT                   /locus_tag="RC1_0369"
FT   CDS_pept        384925..385743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /locus_tag="RC1_0369"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="[synonyms] ATP synt Hase gamma chain identified by
FT                   match to protein family HMM PF00119 match to protein family
FT                   HMM TIGR01131"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97813"
FT                   /db_xref="GOA:B6IQS7"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQS7"
FT                   /protein_id="ACI97813.1"
FT                   /translation="MSERLEEVETRLAAIGDLGSVVDAMRALAAVRLQQAMAALGGTRT
FT                   YAGVVQSAFARALSALPEPRPDGKGLRTARGVIVFAAEHGFVGAFEEPLLERLQAEGPV
FT                   AAVMVAGSRGAAMLEEHGVRPAWCVPMATQVGGVMAVARRVADRLTTLTAHRLGRVDLL
FT                   YRTHPHGVALEPLYPAGLPNHVAVPGRAPLFGLPPRELVEHLADEYLFARLAHAAVESF
FT                   AAENAARLSVMLSAGQNVKDRLEDLSRLANRLRQDLTTQELTELTIGRDD"
FT   gene            complement(385846..386244)
FT                   /locus_tag="RC1_0370"
FT   CDS_pept        complement(385846..386244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0370"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97814"
FT                   /db_xref="GOA:B6IQS8"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQS8"
FT                   /protein_id="ACI97814.1"
FT                   /translation="MRRFPWGAWVTLGLAWAVGTTLVLTGTDAPLHVAPIAGFFLGAIL
FT                   SVVLVLLLWLLGLGGVVVLTVFILGALLWTALGPLGTGLIVATLAGLGGLMWLGRREMQ
FT                   RQSRSTDPTAPRTGPPAPRPGRPPLPLP"
FT   gene            complement(386533..386609)
FT                   /locus_tag="RC1_0371"
FT   tRNA            complement(386533..386609)
FT                   /locus_tag="RC1_0371"
FT                   /product="tRNA-Met"
FT   gene            complement(386897..389634)
FT                   /gene="rrlA"
FT                   /locus_tag="RC1_0372"
FT   rRNA            complement(386897..389634)
FT                   /gene="rrlA"
FT                   /locus_tag="RC1_0372"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(389843..389963)
FT                   /gene="rrfA"
FT                   /locus_tag="RC1_0373"
FT   rRNA            complement(389843..389963)
FT                   /gene="rrfA"
FT                   /locus_tag="RC1_0373"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(390082..391505)
FT                   /gene="rrsA"
FT                   /locus_tag="RC1_0374"
FT   rRNA            complement(390082..391505)
FT                   /gene="rrsA"
FT                   /locus_tag="RC1_0374"
FT                   /product="16S ribosomal RNA"
FT   gene            complement(392129..392551)
FT                   /locus_tag="RC1_0375"
FT   CDS_pept        complement(392129..392551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0375"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00430"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97815"
FT                   /db_xref="InterPro:IPR008320"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQS9"
FT                   /protein_id="ACI97815.1"
FT                   /translation="MTIHLLRLAVGADSLDSMRAWRAGNQIDWQGRRVVPTWTRRPPSR
FT                   QTELLDGGCIYWVVKGFIRCRQRFVGFDLVTAPDGETHCTMLMDPELVETVAVPKRPFQ
FT                   GWRYLKPEDAPADLQGAGGDELPPHLLAELRALGLA"
FT   gene            complement(392639..393028)
FT                   /locus_tag="RC1_0376"
FT   CDS_pept        complement(392639..393028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0376"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97816"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQT0"
FT                   /protein_id="ACI97816.1"
FT                   /translation="MGESEGRTVCEAKEADAVSRSVEGVANWMHLFRWIVKLIRDEYGV
FT                   DEKILVRTAILETDCGLSIEQVEEVLDIIAESFDIRFPAGTLDEVVKLEELCMLAAWLK
FT                   GLFKRPEFLSDGYGEACRSLNAAAA"
FT   gene            complement(393072..393968)
FT                   /locus_tag="RC1_0377"
FT   CDS_pept        complement(393072..393968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0377"
FT                   /product="3-hydroxy-3-methylglutaryl-CoA lyase"
FT                   /EC_number="4.1.3.4"
FT                   /note="[synonyms] Hydroxymethylglutaryl-CoA lyase HMG-CoA
FT                   lyase identified by match to protein family HMM PF00231"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97817"
FT                   /db_xref="GOA:B6IQT1"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027167"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQT1"
FT                   /protein_id="ACI97817.1"
FT                   /translation="MTRIRIVEVGPRDGLQNEPRTVPLDTKVELVERLAGAGLPAVEAG
FT                   AFVSPKWVPQMADTAALLARLRRRPGVSYPVLVPNAKGLEAALAAGVEEIAVFGAASES
FT                   FSQRNINCSIAESLERFRPVAAQALAAGVRVRGYVSCVLGCPYEGEVDPGRVAEVAARL
FT                   IDLGCYEVSLGDTIGVGTPARARALVRRVAGAVPVERLALHFHDTWGQAVANILACLET
FT                   GVTVVDSAVAGLGGCPYARGASGNVATEDVLYLLHGLGLETGVDLDSVARTGEWISAAL
FT                   TRPNGSKAGHAWMARQA"
FT   gene            complement(394059..395210)
FT                   /locus_tag="RC1_0378"
FT   CDS_pept        complement(394059..395210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0378"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.-"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97818"
FT                   /db_xref="GOA:B6IQT2"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQT2"
FT                   /protein_id="ACI97818.1"
FT                   /translation="MGHDFNPRWMTEDLRIFHDAALKFFERECAPHAKRWDEQGVVDRE
FT                   VWTRAGEAGLLCASMPEEYGGAGGDFAHEAVLIDARMKAGAGHFGISLHNGIVAPYILH
FT                   YGSEEQKRRWLPRLASGELVGAIAMTEPGTGSDLQGVRTSARLDGNQYVLNGSKTFITN
FT                   GQTANLIIVVAKTDPAAGAKGTSLIVVETDAVDGFRRGRNLDKIGLKGQDTSELFFDDV
FT                   RVPTSSLLGPQPGLGFVQLMQQLPQERLIIALEALAGIEAGIAATLDYVKQRKAFGQRI
FT                   IDFQNTRFTLAQAVTEMRVARAFCDDCTERHLKGELDAATAAMAKLWLTERQCAILDDC
FT                   LQLHGGYGYMNEYPIARLWADARVGKIYGGTNEIMKELIGRTL"
FT   gene            395416..395871
FT                   /locus_tag="RC1_0379"
FT   CDS_pept        395416..395871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0379"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07370"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97819"
FT                   /db_xref="GOA:B6IQT3"
FT                   /db_xref="InterPro:IPR020143"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQT3"
FT                   /protein_id="ACI97819.1"
FT                   /translation="MTAVAALLADPVLWSLFGAAFAAATLVPAQSEILLVTLLLQSDRD
FT                   PWLLVTVATVGNTLGSCVNWALGRFLRHMADKPWFPAPHKALARAERVYNRWGLPSLLL
FT                   AWVPVLGDPLTVVAGSLRVPFLPFVVLVGLGKGARYGVLALGTLGWF"
FT   gene            complement(395962..397977)
FT                   /gene="ptr"
FT                   /locus_tag="RC1_0380"
FT   CDS_pept        complement(395962..397977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptr"
FT                   /locus_tag="RC1_0380"
FT                   /product="Methyl-accepting chemotaxis-like domains
FT                   (chemotaxis sensory transducer)"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97820"
FT                   /db_xref="GOA:B6IQT4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR032255"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQT4"
FT                   /protein_id="ACI97820.1"
FT                   /translation="MLKWLDDLRIAVRINIGFGLMAALLVILGGVAIVGALRMGDLFTE
FT                   YRIAARQNLQFADIQSNMFEAQLASREWHRTPTTEKAAVVRLNIDEVLDGLRKADEIVA
FT                   DPAMRQRLAQIRKTTTDYIAAFEQAVEFENRREELEPEVLNMAEALSAGLNGLVMETFD
FT                   AGNGLMETANAAALSLMQGEIYLSRFLADGSPKSRDNMLTELMAVEGQLGMLAEETEAP
FT                   EKVRAIAQGQLAMLAGLGEQFRLLVTATEERDSRITDGMDRLGATVLSDLAAAVGSVVA
FT                   KQTAIDPKAESTIEGGITMIAAAAVLCLVLSTLLGLLLGRIISTPIVGLTATMRRLATG
FT                   DTNVDISGQKRKDEIGEMGRAVAVFRDGLIERQRLRIEQDRAKQRAEEERKAALTRLAD
FT                   SFEAGVRGVVTEVSGMAHHIQDNAGELSAAARQTSSQAEVVAAASGQASNNVQTVAASA
FT                   EELSASIAEIGRQVQRSSERAQAATGMAQGANEQVEALAAQADAIGSVVQLISEIAAQT
FT                   NLLALNATIEAARAGEAGKGFAVVAGEVKSLASQTARATEDIGRQIARMQQASHGTVSA
FT                   IRGIAGMITEMNEIAAGIAAAVQQQAAATGEISRSVQQAASGTEEIDRSIGDVRSAADR
FT                   TGRASADLLDAARLLSSQADTLRRQVDGFLETVRAA"
FT   gene            complement(398578..400599)
FT                   /gene="mccA"
FT                   /locus_tag="RC1_0381"
FT   CDS_pept        complement(398578..400599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mccA"
FT                   /locus_tag="RC1_0381"
FT                   /product="methylcrotonoyl-CoA carboxylase subunit alpha"
FT                   /EC_number="6.4.1.4"
FT                   /note="[synonyms] 3-methylcrotonyl-CoA carboxylase
FT                   biotin-containing subunit identified by match to protein
FT                   family HMM PF00682"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97821"
FT                   /db_xref="GOA:B6IQT5"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQT5"
FT                   /protein_id="ACI97821.1"
FT                   /translation="MFRTLLIANRGEIACRIIRTARRLGLATVAVHSDADAGARHVALA
FT                   DAAVRIGPAPARDSYLRIDAILDAARRTGADAVHPGYGFLSENAAFAEACAGAGLVFVG
FT                   PPAAAIRAMGGKSEAKALMAAAGVPLVPGYHGEAQDGALLRAEAERIGWPVLIKASAGG
FT                   GGKGMKVATGPEDFTDQLASAKREALAAFGDDRVLIEKYLARPRHVEIQVFADAHGGCV
FT                   YLFERDCSIQRRHQKVVEEAPAPGLDPALRRRMGEAAVAAARAIGYVGAGTVEFLLDQD
FT                   GRFYFMEMNTRLQVEHPVTEMITGQDLVEWQVRVAAGERLPLAQDDLAIDGHAIEVRLY
FT                   AEDPARGFLPQTGTLEHLRFPAEGPHVRVDAGVRTGDAISIHYDPMIAKLIVWDRDRPA
FT                   AVRRLRAALAETEIAGLTANVGFLSTLAAHPAFLAADLDTRFIERHQADLLPAAAPAPE
FT                   EAQVLAALGLLLDRAARTERQAAAGADPRSPWARADGWRLNDEAHDTITLREPPRDPGA
FT                   TGPEHVLRLTYGRDGYRFHLSGGDLAARGELAEDGRLTAELGGIRCIASWVRRDGGITL
FT                   FHRGGTQRFHLVEPLASAAAESGTGGRLTAPMPGKVIALLAEEGAAVAAGQPLVVLEAM
FT                   KMEHTLKAPVAGTVRRHRFRVGDQVPEGTELMEFEEGA"
FT   gene            complement(400659..402356)
FT                   /gene="kefB"
FT                   /locus_tag="RC1_0382"
FT   CDS_pept        complement(400659..402356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kefB"
FT                   /locus_tag="RC1_0382"
FT                   /product="glutathione-regulated potassium-efflux system
FT                   protein KefB"
FT                   /note="Gene symbol synonym Alternate names: K(+)"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97822"
FT                   /db_xref="GOA:B6IQT6"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQT6"
FT                   /protein_id="ACI97822.1"
FT                   /translation="MPNAAEHALPFVQEAILFLAASIVVVLVLSRLRISPVLGYLLAGL
FT                   LIGPSGLALIGDVDKIRSFAELGVVFLLFIIGLELSVERLQALRRWVFGLGAAQVGLTA
FT                   GLIGGIAWFWGNSPEASMVLGACLALSSTAVVVQLLVERGEVASATGRVTFAVLLFQDL
FT                   AVVPVLVLVSVLSNPGDQPLLLALGLSLLKAVVAVTVILVIGRFTLGPLLRRVAATRST
FT                   EIFTATALLIVLAMGWATSLGGLSAALGAFLAGLVLAGSEFRHQIESDIQPFKGLLLGL
FT                   FFLTVGMGIDLDLVMENVAWALVSVFGLIAIKAGLTTGLALAFGAPRDVAIRSGLLLGE
FT                   GGEFAFVVVGAALSAHMLPPEIGQFMFAVVGLSMLLTPFLPTLADRIVSVLGPQKAEPA
FT                   GPEPDVAEMSGHVIVNGFGRVGQTVAALLSEQQVPYVALDMNPELVRAMREKGYPIHYG
FT                   DGSRPELLQKLGADNAAAVIVTLDQPAATERAVGAVRHHWPKLQVFARARDRARAAELA
FT                   KLGVEGVVPETFESSLSLAKGALQALGVPTQAVEELVTRHRESGTTAD"
FT   gene            complement(402496..404184)
FT                   /locus_tag="RC1_0383"
FT   CDS_pept        complement(402496..404184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0383"
FT                   /product="methyl-accepting chemotaxis protein, putative"
FT                   /note="Also called methyl-accepting chemotaxis receptor"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97823"
FT                   /db_xref="GOA:B6IQT7"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQT7"
FT                   /protein_id="ACI97823.1"
FT                   /translation="MVLVSKLRIAGKVYSIVAILSLAALGLGITAATQLIGFNTAVQEM
FT                   QTTSSRAQIGERVNATILSVVMDSRGVYMSRDGAEVEKFAKPMTAALDRLDALVAEWKA
FT                   LVPPESAGDFGEALARVADFRAKRLELIRLGREVSPAAAREFGDNDANRKSRQDLNKAV
FT                   TKLAEADQQAVQQSADRVHAALTFGLTAIGIIALAGIGLGVALAWMISRKEIAGPVRSI
FT                   TACMATMAGGNLGVTVPSQDKKDEIGEMARSLEVFRTGLVQARELEQRQATERAERERR
FT                   AIALEELLKTFDTTASRVLGTVAQAAEAMGGTAEEMARMADQTNGQATASAAAAEETSA
FT                   NVQTVAAATEEMAASIQEISRQVSSSTQLTAGAVAQARQTGATVNGLNEAVQRIGEIVD
FT                   LIQSIASQTNLLALNATIEAARAGEAGKGFAVVAGEVKALATQTAKATEEIAQQIGSIQ
FT                   TATHDTVGAIQSIGRTIASLSEVSAAIAAAIEEQNATTGDITRSVQRAAQGTQEVSENV
FT                   AMVSEAATRTGTAAARVVESAGTLAEQSGLLQREIEQFLKGVRAA"
FT   gene            complement(404480..405433)
FT                   /locus_tag="RC1_0384"
FT   CDS_pept        complement(404480..405433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0384"
FT                   /product="potassium channel protein, putative"
FT                   /note="identified by match to protein family HMM PF00015
FT                   match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97824"
FT                   /db_xref="GOA:B6IQT8"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQT8"
FT                   /protein_id="ACI97824.1"
FT                   /translation="MPQDTPSPRTLAHPTPSRSRHPVVAVGFTVGLLSLMLLSVSAVAG
FT                   WVSLGVLVSVSAVVGAFHYLFPGSRFFTIALANFIGIYACIFLFFVELHFTLVSQVSLS
FT                   VGFTLPLLTFLAGAVWQREAIRAVVLEEGPVLRHRLGRAIVWLLPVAGVGVGTFLIPSG
FT                   MDPDALTLAYLGAMGLIAGVVLVAARAIAILLLHTGLLFEEFFEGIARLVEPALAFFTF
FT                   YSLLVIVFASVYTVIDRFSVQPQFIINGQARDIQFAEALYFSVITLSTVGYGDMLPFSD
FT                   LIRILVSVEVVCGVLLLLFGFNAIFAYSSEQRRNRP"
FT   gene            complement(405518..406303)
FT                   /locus_tag="RC1_0385"
FT   CDS_pept        complement(405518..406303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0385"
FT                   /product="enoyl-CoA hydratase"
FT                   /note="identified by match to protein family HMM PF00289
FT                   match to protein family HMM PF00364 match to protein family
FT                   HMM PF01071 match to protein family HMM PF02222 match to
FT                   protein family HMM PF02785 match to protein family HMM
FT                   PF02786"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97825"
FT                   /db_xref="GOA:B6IQT9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQT9"
FT                   /protein_id="ACI97825.1"
FT                   /translation="MPDVLSHTRADGVATVTLNRPEVHNAFNDAVIGELTAVFRRLGGD
FT                   PAVRAVLLRGNGPSFSAGGDLAWMRRMAGYGPEENRRDALALAEMLRTLNELPKPTVAV
FT                   VHGNAFAGAVGLVSCCDVALAADSVQFALTEVRLGLIPATIAPYVIAALGARACRRYFL
FT                   TAERFSALEAHRLGLVHEVVPAHILDAAVEKLVSRLLEGGPRALAESKRLIREVAGRPV
FT                   DDALMADTAERIAAARASEEGREGVAGFLEKRPPAWKPG"
FT   gene            406483..407085
FT                   /locus_tag="RC1_0386"
FT   CDS_pept        406483..407085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0386"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97826"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQU0"
FT                   /protein_id="ACI97826.1"
FT                   /translation="MRPPISSHTHGLIDYAAAAAFAAVPRLFGWDRMMTRTMDAAALGT
FT                   VAYAHLTDYEAGAVPVLSMRQHLAVDALEGATFLAAAWMLDEEPPAVRWTLAGFGAFAL
FT                   LASGLTRRQAGGHPGDFLSSPGAARGGHRTRAGAWVMDADGEDRTMHLPSGRGRRPETA
FT                   GRQPRGPEFRRHIAADRGSVGPADRDPSLVTGPGQGI"
FT   gene            complement(407099..407914)
FT                   /locus_tag="RC1_0387"
FT   CDS_pept        complement(407099..407914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0387"
FT                   /product="lipoprotein, putative"
FT                   /note="identified by match to protein family HMM PF00015
FT                   match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97827"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQU1"
FT                   /protein_id="ACI97827.1"
FT                   /translation="MPRIAGLLFLLTLAAAGPVAAACSCTGMTLKVGGTPTSFCVNSAS
FT                   TFSECATVSTTACGTGKKQIQCPLGLATGSDTNGSWMGFGFEIHAALSGTASQCTHGQG
FT                   LQRTLTEQSGTTVTTLSNGKVGYTTPAKATYTISNGSVSYSGYVDNDRRKNYPQVGTQT
FT                   SSVDSYGADNYSAIGDPNGSETIQMSGNTVIWSDLPSIYFDNSDLAKTVSLKDQVFSFA
FT                   YNPGQAGSGCSCTFQIQATKPPLSNWTELATRATGASALVKGVSCTVTP"
FT   gene            complement(408074..408394)
FT                   /locus_tag="RC1_0388"
FT   CDS_pept        complement(408074..408394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0388"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97828"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQU2"
FT                   /protein_id="ACI97828.1"
FT                   /translation="MAILHRIGRLADNTWAHILVAAAMVLASLMELKEVLVTDLADLQG
FT                   EHGMLLFGIQQLLLTLPKAAEAARHTREGAKTIRRTLRKDPSGDSSPGGPSPGGPSPPG
FT                   PP"
FT   gene            408622..410697
FT                   /locus_tag="RC1_0389"
FT   CDS_pept        408622..410697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0389"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97829"
FT                   /db_xref="GOA:B6IQU3"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQU3"
FT                   /protein_id="ACI97829.1"
FT                   /translation="MPAARPMPTDLPENDRALVEAAQRGVPWAPAGEGQPNFDGEMPTV
FT                   QASTIRALCLGLWDDVRLDPRGIHIVGVRIDGDLDLSEGTCIGPLKLRACHLTAPLRLW
FT                   GATLPSLYLSASRLDAGLLADSVRITGDLVCDHGFRATGDLRLLGARVGGDMSFRTATL
FT                   AGGAMGALSADGVTVEGSLFCDEGFNARGTVRLPFAQIGRDAYFRKAVLNGGETIALFA
FT                   DGSAIKGNLFCDQSFITMGAVRIATAHVGGGAFFHGAILNGGGESALIGDRAEIRGNLF
FT                   CKDGFTARGSIKIIAARIGGSADFNGAHLDGGGNAALFADGADIRGELSFGSGFTAKGT
FT                   VCLPSAHIGVTVSFIDAVLDGGSGQALNAENLKVQGGLLCRDKTRINGGVSVAGISIQG
FT                   LLDWRPASWTGMLDLSHARAVVWADNWSGRKWDCDGAPRIILRDFRFDSFLVADFVKSD
FT                   AVSRLNWLKAALGDDFVPGPYENLARVLRAAGDDAGAKRVGLEKERARTRHEVKSSNGR
FT                   LPRSARWLWGAFLDLTIGYGYQWWRGGAFGLLFLLLVGWGVFNSSGPLDTGGSGIIKPA
FT                   LPVAFIEDLGRRIDDRPLWPGETPSHHGIGYRLPPEYPPFSGFCYSLDTLLPLIDLGQS
FT                   GAWSPSPIAPSFWDDKRGWAVTFYLYFHIFAGWGLSTLIAVDLTGVIQRGTGRPSE"
FT   gene            complement(410707..412314)
FT                   /gene="mccB"
FT                   /locus_tag="RC1_0390"
FT   CDS_pept        complement(410707..412314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mccB"
FT                   /locus_tag="RC1_0390"
FT                   /product="Methylcrotonoyl-CoA carboxylase"
FT                   /EC_number="6.4.1.4"
FT                   /note="[synonyms] 3-Methylcrotonyl-CoA carboxylase
FT                   non-biotin-containing subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97830"
FT                   /db_xref="GOA:B6IQU4"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQU4"
FT                   /protein_id="ACI97830.1"
FT                   /translation="MPVLSSTIDTRSPAFAENDAAMRALVADLKVTVARIKLGGGEAAR
FT                   EKHLSRGKLLPRDRVRHLLDPGSPYLELSQLAAHGVYADDVPAAGILTGIGRVEGQECV
FT                   IVANDATVKGGTYYPLTVKKHLRAQEIAAQNNLPCLYLVDSGGANLPNQDEVFPDRDHF
FT                   GRIFYNQATMSAAGIPQIAVVMGSCTAGGAYVPAMADESVIVKGQGTIFLGGPPLVKAA
FT                   TGEVVSAEDLGGADVHSRVSGVTDHHAADDRHALAIARRIVANLNRRKQPQVALRAPVE
FT                   PRFAAEELYGVIPTDTRKPYDVREVIARIVDASEFDEFKALYGTTLVCGFAHIWGCPVG
FT                   IIANNGILFSESALKGAHFIELCCQRGIPLLFLQNITGFMVGRKYENAGIAKDGAKLVT
FT                   AVACASVPKVTVIIGGSFGAGNYGMCGRAYSPRFLWMWPNARISVMGGEQAATVLATVR
FT                   RDGIEARGGTWSPEEEDAFKAPIREQYERQGHPYYASARLWDDGIIDPAETRTVVALSL
FT                   SAALNAPVERTRFGVFRM"
FT   gene            412495..413382
FT                   /gene="yfdC"
FT                   /locus_tag="RC1_0391"
FT   CDS_pept        412495..413382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfdC"
FT                   /locus_tag="RC1_0391"
FT                   /product="inner membrane protein YfdC, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97831"
FT                   /db_xref="GOA:B6IQU5"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQU5"
FT                   /protein_id="ACI97831.1"
FT                   /translation="MTDQDAPFRRDLYTRENAVPEPEPSPRLRQTEKKDVRRMSAPRAA
FT                   VIHEAIRKEGEEQLGRPTSALVWSALAAGLSMGFSMVGLGVMRAGMPDGAEWAGLVASF
FT                   GYAFGFLIVILGRQQLFTENTLTVMLPLLHHRSWRTLRALLRLWGIVFAFNVVGTLAFA
FT                   FVAHRTAIFEPPLKEAFVDLGTHVAGFPWWTTFGKAVVAGWLIALLVWLQPLSGAARPF
FT                   VIILITYLIALLDLAHVIAGSAEVSYAAFAGAITWSDYAAGFLLPTLLGNVTGGVVLVA
FT                   LVHHAQIRAEMYED"
FT   gene            complement(413488..415491)
FT                   /locus_tag="RC1_0392"
FT   CDS_pept        complement(413488..415491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0392"
FT                   /product="prolyl oligopeptidase family protein, putative"
FT                   /EC_number="3.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97832"
FT                   /db_xref="GOA:B6IQU6"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQU6"
FT                   /protein_id="ACI97832.1"
FT                   /translation="MMTIEWNKRLRAGTLALALTAALPLALAALPADARDVQRVERGTL
FT                   VTEDVPAVDEALAERYRAYLNARSAGVLDWTADGAGLLISTRFGETNQLHLVMQPLGAR
FT                   QQLTFKEEPITSGRLSPRAGSADLIYSWDRGGSEQFQLFRQDLKTGAVAMLTDGKSRNQ
FT                   GLLWSSKGDRIAFASTRRDGRNTDVYVATPEQAATVQPLVAETGSWGPVAWSADDGRLL
FT                   VGKSISVARSQLWVVDVKTGEKTRVKPEMDDVHLSGVGFTPDGKGVVLVSDEAGEFKRL
FT                   GIYDLAGGKTRWISEEQPWDVEEAELSHDGRLLAYTVNEAGYSTLHLLDMTSLKPLPAA
FT                   DLPKGTVGGLRFSPDGTRLAVSVSRPTAPSDVFVVDIAGRTVTQWTRSEVGGLNTDSFA
FT                   DATLVQYPTFDKVDGKPRQIPAFVYKPQGASGKLPVIIDIHGGPEGQTRPSFSSGVQFW
FT                   VNELGAAVVRPNVRGSTGYGKTYVGLDNGFKREDSVKDIGALLDWIATQPDLDPKRVVV
FT                   VGGSYGGYMTLASMTHFNDRLAGGSSSVGISNFVTFLESTADYRRDLRRVEYGDERDAR
FT                   MREHLVAISPLTNAGKITKPMLIIQGANDPRVPRGESEQMVAQIRKNGGDVWYVLAMDE
FT                   GHGFRKRTNQFYAGMAQAMFFRKVFAGNGNAG"
FT   gene            complement(415618..416646)
FT                   /gene="alkB"
FT                   /locus_tag="RC1_0393"
FT   CDS_pept        complement(415618..416646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alkB"
FT                   /locus_tag="RC1_0393"
FT                   /product="alkane 1-monooxygenase"
FT                   /EC_number="1.14.15.3"
FT                   /note="[Synonyms] Alkane omega-hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97833"
FT                   /db_xref="GOA:B6IQU7"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR033885"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQU7"
FT                   /protein_id="ACI97833.1"
FT                   /translation="MGGLGHAFGAFVVPVLAALGLGLGGWWVLLPVIWFAGLAALLDLL
FT                   LPEQTRFRVPPGGTGGAWVVWAMFPLLAGLLVYALHLVAAGAFTVWEFLGAALAVGLVQ
FT                   GSVGLTAAHELIHRPRAWERGLGVAISSLVLWAVFRIEHVHGHHRTVGTPDDPTTARLG
FT                   ESLYAYIPRSVLGGLRESWRLERERLHRRGMGPWHWRNRNLHYAVIQGALLVGVTLWTG
FT                   LPGLLFFLIQAWIAVQLLMTTGYIEHYGLQRRPDGRGGWERIGARHSWNSAHRLTNWTT
FT                   FNLGLHAEHHRWPGKAFPELVDDLDAMRMPFGYPGMALLAMVPPLWFRVMDPLVLQTRA
FT                   AA"
FT   gene            complement(416655..417257)
FT                   /locus_tag="RC1_0394"
FT   CDS_pept        complement(416655..417257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0394"
FT                   /product="2-hydroxychromene-2-carboxylate isomerase,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF01039"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97834"
FT                   /db_xref="GOA:B6IQU8"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQU8"
FT                   /protein_id="ACI97834.1"
FT                   /translation="MAAPIEFYFDFASPYGYLAATQIDALGARAGRTVDWKPILLGAVF
FT                   KVTGQRPLMERPLAGDYLLHDVPRFARLLGVKLTIPERMPIAALAACRAFWWLQPDRPE
FT                   LARLLAQAVYRAHWGEGRDLGPAEAVAEVAADLGIDPAALAEGIQDPAVKDRLRAVNEE
FT                   AVAKGVFGSPFFIVDGEPFWGADRMGQLERWLETGGW"
FT   gene            complement(417389..418075)
FT                   /gene="csgA"
FT                   /locus_tag="RC1_0395"
FT   CDS_pept        complement(417389..418075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csgA"
FT                   /locus_tag="RC1_0395"
FT                   /product="C-factor protein"
FT                   /note="[Synonyms] C signal"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97835"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQU9"
FT                   /protein_id="ACI97835.1"
FT                   /translation="MPTLVVTGASRGIGLEFARQYAADGWRVIAGVRNPDQADALRAVS
FT                   GVEIRRLDVADPAGIEAFAAGLEGEVVDLLINNAGIMGPHPHQQSQVTLDTAGWEETLR
FT                   VNALGPVLVTLALTPNLTRALRPVVATVSSQMGSMADNSSGGYYAYRMSKAAVNMGMKN
FT                   LSLDLRDRNIAVVVLHPGWVQTDMGGDQAPVKPAESVAGLRRVLAGVGIGHSGRFYSYR
FT                   GEELPW"
FT   gene            complement(418240..419127)
FT                   /locus_tag="RC1_0396"
FT   CDS_pept        complement(418240..419127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0396"
FT                   /product="chitinase class II protein, putative"
FT                   /note="identified by match to protein family HMM PF00326
FT                   match to protein family HMM PF02129"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97836"
FT                   /db_xref="GOA:B6IQV0"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQV0"
FT                   /protein_id="ACI97836.1"
FT                   /translation="MATYPWEDDMLDNATPNANRLVIYYNSNLIPLSSFASSDYTHVIL
FT                   SFARPDPSGTMVLDGNLTSTVMAQIPALKSAGKKVMMAIGGGACSSAQWQQMAGNVQFS
FT                   AAQIAAMVQTYGLDGIDIDFEDSAAFTGSAGYDGTQFMINLTQALYGALPASARLISHA
FT                   PQAPYFFPTWSSAYIRIMEAVGTQIDFLNLQYYNNPGFQEPSFILGTSAGSVAGMIAAG
FT                   IPATKIVIGKPVGQNDAGSGWMPVSDIVGQIVTPLVSTYRYIGGVMGWQAASDPTGSWG
FT                   ATLAAALSPTAAVA"
FT   gene            complement(419313..420506)
FT                   /locus_tag="RC1_0397"
FT   CDS_pept        complement(419313..420506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0397"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="identified by match to protein family HMM PF00487"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97837"
FT                   /db_xref="GOA:B6IQV1"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQV1"
FT                   /protein_id="ACI97837.1"
FT                   /translation="MNAMSHDPVVIVSAARTAMGGMMGDLSPLPAAQLGAAAIRAAVER
FT                   SGVAPEEIDEVVMGNVLQAGQGQAPGRQAALGAGLPMGVPCTTLNKMCGSGMKAAMQIH
FT                   DAIVAGSIGIGLAGGMESMSNAPYLLDRARGGYRYGHATVYDHMALDGLEDAYDRGRAM
FT                   GTYAEDTATRYQFTREQQDGYALESLRRAREAGETGRFAAELVPVSVKTRAGETVVDRD
FT                   EQPAKARPEKIPTLKPAFRKDGTVTAANSSSISDGAAALVLMRRSEAERRGLKVLGAIR
FT                   GHASYAQEPAWFTTAPVGAMRTLFEKTGWQARDVDLFEINEAFAVVSMAAMREFDLPRD
FT                   KVNVHGGACALGHPIGASGARILVTLLNALEQYGLKRGVASLCIGGGEATAMAVERL"
FT   gene            complement(420676..421269)
FT                   /locus_tag="RC1_0398"
FT   CDS_pept        complement(420676..421269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0398"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="identified by match to protein family HMM PF01323"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97838"
FT                   /db_xref="GOA:B6IQV2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQV2"
FT                   /protein_id="ACI97838.1"
FT                   /translation="MGKGERTRAAILDQALAVTSTEGVTGLTIGTLADRLGMSKSGLFA
FT                   HFGSKELLQQAVLEHALALFTERVLRPAVARPRGLPRVETFFDGWIVWIREGVPPGGCP
FT                   LETAAKELDDKPGPLRDLVARTHGQLIDFATDLARRAVAEGHLRRDLDAELFAFEMTGI
FT                   AFGFSHMHRMMRHPGAERLARTAFAALLDRSRPT"
FT   gene            421405..421800
FT                   /locus_tag="RC1_0399"
FT   CDS_pept        421405..421800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0399"
FT                   /product="cyclic nucleotide-binding domain protein"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97839"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQV3"
FT                   /protein_id="ACI97839.1"
FT                   /translation="MSAAFQRRTVEPGDIIFREGDPGDSLYVVESGRVVVWRGDPAHPT
FT                   RIGTVEKGGVFGEMAIFDRKPRMANASAEERSTVMRMPASVLRESLYGADPLLHQLVQI
FT                   LIDNIRHMARRLDELEGRIAPPDGPMG"
FT   gene            421923..423098
FT                   /locus_tag="RC1_0400"
FT   CDS_pept        421923..423098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0400"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00704"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97840"
FT                   /db_xref="GOA:B6IQV4"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQV4"
FT                   /protein_id="ACI97840.1"
FT                   /translation="MDAAAGTGAGSTGAGRTGAPGPWSGDRTYVRRVLIALLLVGLAAT
FT                   LWLASHALLLLFGAILFAVAIRGLAGLLRRVLPVGEETSVVIVLLILLALAGGVGFLFG
FT                   SQISQQFSKVAQQVPDSLQKLEDTLRSTGWGQQLLALTGGVPLTGDGGQGGGQGGGQGG
FT                   AGAAPDGGSGGAGLGWLVRQAGSVAVAITGALGDLLLVLFGAVYLAFQPGLYRAGIEKL
FT                   VPKDRTDQIVRALDATGGALWKWSAGMLVEMVLVGALTMVGLWLLGVPAPLALGLIAGT
FT                   LEFIPIVGPILAAIPAILLAFTVSPDLALWTALFYVALQQVEGNLILPLIQRRAVALPP
FT                   VVSLFALLVFGSLFGAIGVLLAVPLAVTAMTLVQVLYVRDTLGKPVTVEGG"
FT   gene            complement(423109..424281)
FT                   /gene="ivd2"
FT                   /locus_tag="RC1_0401"
FT   CDS_pept        complement(423109..424281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ivd2"
FT                   /locus_tag="RC1_0401"
FT                   /product="isovaleryl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.4"
FT                   /note="identified by match to protein family HMM PF00108
FT                   match to protein family HMM PF02803 match to protein family
FT                   HMM TIGR01930"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97841"
FT                   /db_xref="GOA:B6IQV5"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR034183"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQV5"
FT                   /protein_id="ACI97841.1"
FT                   /translation="MIPNSLPLMDFGLGETADMLRDTVRSFSSDEIAPRAAEIDRTDQF
FT                   PMDLWRKFGDLGLLGVTVEEEWGGAGLGYVEHMVAMEEISRASASVGLSYGAHSNLCVN
FT                   QIRLNGSPEQKRRYLPKLISGEHVGALAMSETGAGSDVVSMKLRAERRGDRFVLNGSKM
FT                   WITNGPDADVLVVYAKTDPTAGPKGITAFLIEKGFKGFSCAQKLDKLGMRGSHTGELVF
FT                   QDCEVPEENVLGRMNGGVRVLMSGLDYERALLSAGPIGIMQAALDVVVPYVHQREQFGQ
FT                   PIGEFQFIQGKLADMYVALNSTRAYAYAVGKAADLGRITRKDAAGVILMAAENATKVAL
FT                   DAIQVLGGNGYINEFPTGRLLRDAKLYEIGAGTSEIRRMLIGRELFRETA"
FT   gene            complement(424410..427490)
FT                   /locus_tag="RC1_0402"
FT   CDS_pept        complement(424410..427490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0402"
FT                   /product="TonB dependent receptor, putative"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97842"
FT                   /db_xref="GOA:B6IQV6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQV6"
FT                   /protein_id="ACI97842.1"
FT                   /translation="MSIQQGVDTRGLKTALLTGVAAFLMTTGYAAAQDAVVKGRSDAMA
FT                   EPTTQVAQAQVAQATGTAAANDGSKVEEIVITGSRLRRTQFDVLQPTVEVNIGYIDRRG
FT                   FTNIADALNDVPGFGTAVSPIGDQSTFNVGQNFVNLFSLGSARTLTLVNGRRFVAGRAP
FT                   SLFGDAGPGLQVDMNVIPTAFIERIDRIAVGGAPIYGADAIAGTVNVILRDDYEGGEVD
FT                   LLFGNSDDDDAKNKRVRAAYGVNFDNDRGNIALAVEYNDTQGLLYTDRKRTAKDITFVP
FT                   NPADTGAADGIPGQLYREGRTIPLVTAGGIPLTVNSGGGSAAAITSRFFRIPDPNNPGQ
FT                   TVPAQFVDGRLVPFDPGQIFSGSVAIGGDGLRLSSVTSLQAPVERKLGAIMGHYDILDN
FT                   LRFFVEGNYSKTIGYENVNQPVYNSPLFSGEGSGLTMRTDNAFLSPADRAVLSAGGRTT
FT                   FVLSRGHLDLVDGNENRSENELKRIVTGFSGDFDVADRAVNWSLSYNYGKTEGEFTTTQ
FT                   VLDATFPLAIDAVVDPATNQIVCRSRAAGCVPLNIFGNGSPSPEAIAYVTGRDVSSSAI
FT                   TQEVVEFNADTSIITLPAGDLQVGVGALWRKEKGDFNPGEITLAGAGRTVAISPVSGDY
FT                   TSKEVYGEVLIPLLDDSMGIPLVHRLEAEGSIRYVDNSLSGGDDTWTIGGRYSPIRDIT
FT                   FRGNWTESIRSPAITELFLPKSDLFTTATDPCATRNVSGGPNPAVRQANCRAALEALGR
FT                   DPNAPFVSRIETATIQGETAGNPSLTNEQAKSWSVGVVVNPRFLEDLTIAVDWVDIEIS
FT                   EAITNLSASALLQVCYDNPGYPSAACDRFVRTPRSAGLINEDDIGQITFIRTGYVNAGY
FT                   TNFSGLTATANYDFDFGDYGQLALGGSYYYIHQLETSVTGLGFDLGSDAGEVGQSKHQF
FT                   QIQADYTYDKIGLLVQANYLSSAKFNNDFTVESRDILEVDDYWRFDTTATYMLADNVEV
FT                   RLAINNLFDVEPPKYVTGAGVYDLIGRYYSVGLNAKF"
FT   gene            complement(427873..430698)
FT                   /locus_tag="RC1_0403"
FT   CDS_pept        complement(427873..430698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0403"
FT                   /product="TonB-dependent receptor, putative"
FT                   /note="identified by match to protein family HMM PF00027"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97843"
FT                   /db_xref="GOA:B6IQV7"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQV7"
FT                   /protein_id="ACI97843.1"
FT                   /translation="MKIRTRSTDNGLEGALRRRCLAGAALVALVVPLTALPALAQEGTQ
FT                   GGIEEIVVTGSRIQRSNLTAPTPVQVIDAATIQLKGSTNAADLINELPAAGVPGVSTTN
FT                   SNFLVSATGLNLVDLRNLGTDRTLVLVNGRRHVGGIEGSTSVDLNSIPSDFIERVEVVT
FT                   GGASAVYGSEAIAGVVNIILKRDFQGASFSAQSGVTDEGDGENYNASATFGSNFAEDRG
FT                   NIIVNFTYDKTNEVESKDRAISEVDAFSSADGVISRPALSSYGPGGRFIIPGVGNRNPD
FT                   GTPFVTAVNGYNRNQDRLIAVPIERYLLSTITRYDLVEDVTFFFEGTYARTETSSRSEP
FT                   IAFGDNTTIGVGIDAPVLSIPVTNPFIPAGLRSLIPAGTDEILFARRFNEIGPRESDIT
FT                   RQTFRFATGFEGELANGWNWQTYYQFGKVTQDQISTGVFNVVRMQEALNAEAGPGGALQ
FT                   CSDALARAQGCVPIDIFGTGTATGAGLDYVTANSTFDSTIQQQTAGAFLSGDVVELPAG
FT                   PLGAAVGLEWRKEESEFRPDALSIAGISSGNQSAFTAGEYDVWEAYAETVIPILSGLPF
FT                   VESLSVEGAVRYADYSTIGNVWAYKAGAEYQPVPDVRLRGVWSRSVRAPNIGELFTPPR
FT                   QTFVSVNDPCAGVVAGATDTVSANCLATPGIAQAVAAGGFNPTQLDLSSIPGFNSGNST
FT                   LQEEKADTLTLGVVFTPSFIPGLALTVDYFDIDIEDAIQGFGTQTTVDQCVQQPTYPDN
FT                   IFCNLIRRDPTTGLIVEINSQQENVATQTAKGVDVELDYRFDLADGSLNLNLIGTYLIE
FT                   NENVPFEDADPVESAGSVGLSKYRFNLRTTYDQGPLTFSWLLRYIGAANIDNESEFPSN
FT                   RIGSHIYNDIQARYRVAEGYTVFAGIDNLLDEKPPLIASPFDANVTGTETAADVYDPVG
FT                   RFFYVGVRAEF"
FT   gene            complement(431065..432495)
FT                   /gene="mgtE"
FT                   /locus_tag="RC1_0404"
FT   CDS_pept        complement(431065..432495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgtE"
FT                   /locus_tag="RC1_0404"
FT                   /product="magnesium transporter, putative"
FT                   /note="identified by match to protein family HMM PF01594"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97844"
FT                   /db_xref="GOA:B6IQV8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQV8"
FT                   /protein_id="ACI97844.1"
FT                   /translation="MPSSQGLDERPPGERQDQPERDRRQEADEQEARFRAVRDRLEADE
FT                   PDVVAALLADWHAGDVAHLLEQSDAEERERLVALLRPSFDAEILAYLPLDLRDEVVSLL
FT                   NPKELAAAVAELDTDDAVDVIQDLDDGARQAILENLPAETRALVEEGLTFPESSAGRLM
FT                   SREFVSVPQFWTVGRLLDYLRAAAGTDESALPEQFYDIFVVDPMHRVIGAVPLSRVMRS
FT                   KRTVRLMDILTKDIHSFSATADQEEVARSFRRYGLVSAPVVDKAGRLIGVVTVDDVVDV
FT                   IEEEAEEDMLRLGGVGEGDLYRAVLDTTKSRFSWLAVNLVTAIVASVVIGFFETTIAQV
FT                   VALAVLMPIVASMGGNAGTQTLTVAVRALATRELSEANAARVIGKEMLVGTANGVLFAV
FT                   LAGGIACLWFRDPLIGLVIGIAMIVNMMCAGLFGALIPFALHRMKIDPAVASSVFLTTV
FT                   TDVVGFLAFLGLASLILL"
FT   gene            complement(432504..434816)
FT                   /gene="dme"
FT                   /locus_tag="RC1_0405"
FT   CDS_pept        complement(432504..434816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dme"
FT                   /locus_tag="RC1_0405"
FT                   /product="NAD-dependent malic enzyme"
FT                   /EC_number="1.1.1.39"
FT                   /note="identified by match to protein family HMM PF00441
FT                   match to protein family HMM PF02770 match to protein family
FT                   HMM PF02771 match to protein family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97845"
FT                   /db_xref="GOA:B6IQV9"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR019793"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQV9"
FT                   /protein_id="ACI97845.1"
FT                   /translation="MSDTFRDAALDYHRLPTPGKISVTATKPLATQRDLALAYSPGVAA
FT                   ACEAIVTDPAEASRVTARGNLVAVITNGTAVLGLGPIGPLAAKPVMEGKGVLFKKFAGI
FT                   DVFDIEINETDPDRLVDIIAALEPTFGGINLEDIKAPECFLVERRLRERLKIPVFHDDQ
FT                   HGTAIIVAAAILNALDLTGRDIRTVKLVASGAGAAALACLDLLVDLGMPVENIWVSDIA
FT                   GVVHEGRRELMDERKARYAKRTEARRLGEIIDGADIFLGLSAPRVLAAEMVARMADRPI
FT                   VMALANPTPEIMPEEVRAVRPDAIIATGRSDYPNQVNNVLCFPFIFRGALDVGATVINE
FT                   AMKIAAVHAIARLAKAEAHDVVAMAYGEQPPAFGPDYLIPRPFDPRLIIEIAPAVAKAA
FT                   MDSGVATRPVEDFAAYREQLGQFVFRSGLLMKPVFARAKADPRRIVYAEGEEERVLRAA
FT                   QQLVDEGLARPILIGRRDVVVRRLQRLGLRIRVDQDVDLVDPTSDPAFTDYWQTYHALM
FT                   ERRGVSPDRARQVLRTNTTVIGSLMVRKGDADALICGTFGLYDWHLKHVLDVIGLKPGV
FT                   RVPAALSVLILSRGTFFLADTYITPDPDPDEIAEMTALAAEEVRRFGLAPKVALLSHSN
FT                   FGSHNDASAVKMREALREIEQRCPGLEVEGEMHADAALSEEIRLRIFPNSRLKGQANLL
FT                   IMPSRDAANIAFNLVKVLGEGLAVGPVLLGASRPVHILTPSVTVRGIVNMSALAVVDAQ
FT                   MHAAGEGAAAPSAAADA"
FT   gene            complement(435147..435231)
FT                   /locus_tag="RC1_0406"
FT   tRNA            complement(435147..435231)
FT                   /locus_tag="RC1_0406"
FT                   /product="tRNA-Leu"
FT   gene            435397..436134
FT                   /gene="lipB"
FT                   /locus_tag="RC1_0407"
FT   CDS_pept        435397..436134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipB"
FT                   /locus_tag="RC1_0407"
FT                   /product="lipoate-protein ligase B"
FT                   /EC_number="2.3.1.-"
FT                   /note="[synonyms] Lipoyl-[acyl-carrier protein]
FT                   -protein-N-lipoyltransferase Lipoate-protein ligase B
FT                   identified by match to protein family HMM PF00593 match to
FT                   protein family HMM PF07715"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97846"
FT                   /db_xref="GOA:B6IQW0"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQW0"
FT                   /protein_id="ACI97846.1"
FT                   /translation="MDPDSATTDRTTAGWTPQEGGPVEWRISEAPVPYPEALAFMEERV
FT                   AAIRAGTAPETVWLLEHPPLYTAGTSARAEDLLTPSRFPVYQTGRGGQFTYHGPGQRIA
FT                   YVMLDLQARGGDVRDFVWRLEEWLIRTLAQFAVRGERRCGRVGVWVDLSPYGRPGREAK
FT                   IAALGVRVRRGVSFHGVALNVEPDLSHFDGIVPCGIREHGVTSLADLGHILSLPEVDAA
FT                   LRDVFQALFMAGGDPRPCGGPSA"
FT   gene            436131..436340
FT                   /locus_tag="RC1_0408"
FT   CDS_pept        436131..436340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0408"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97847"
FT                   /db_xref="GOA:B6IQW1"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQW1"
FT                   /protein_id="ACI97847.1"
FT                   /translation="MRDDRSVTALVLYAVGGGSVFVSLFLLTSPTVDTFAPGLIGLLLG
FT                   FVLLGLGRVCAHLARIQGLLERRG"
FT   gene            436516..437604
FT                   /locus_tag="RC1_0409"
FT   CDS_pept        436516..437604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0409"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00571
FT                   match to protein family HMM PF01769 match to protein family
FT                   HMM PF03448 match to protein family HMM TIGR00400"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97848"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR025859"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQW2"
FT                   /protein_id="ACI97848.1"
FT                   /translation="MAATQINYTLPVEQTKWFVPGGAETAFTWDYDDMRGSLLSLYDKG
FT                   KRQQWDASDRIDWSQDLDPENPMQLPDESLLIFGTPMWDRMTEAERRRFRHHAQAWQIS
FT                   QFLHGEQGALICTAKIVQTVPDIDSKFYAATQVADEARHVEAYSRLLREKFELAYPINP
FT                   HLKTLLDQAISDRRWDFTYLAMQILIEGLALAAFQRIRDYSQNPLSAAINAYVMQDEAR
FT                   HVAFGRLALRDYYPHLTQKERDEREEFVQEACWLMRDRFTGFEILEHLDLPVAEIREHA
FT                   EHSEAMRLFRTFLFSRIVPTVRDIGLWGPRVQKTYTDMGVIMFSQIDSAEMLAQDQKVA
FT                   EEFDAEKRLRDLEKAIAQGEAD"
FT   gene            complement(437659..438000)
FT                   /locus_tag="RC1_0410"
FT   CDS_pept        complement(437659..438000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0410"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97849"
FT                   /db_xref="GOA:B6IQW3"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQW3"
FT                   /protein_id="ACI97849.1"
FT                   /translation="MWACVLICVAAVGLMSLLSFRADRRLDPAELLPMQWGLDGQPTWS
FT                   APRRVALFFTPTLAALILTSLLWITGAVGDSVLGAVPLLAIVCFAFVAAHLLHLSLLAQ
FT                   RQKPGSHLG"
FT   gene            complement(438111..438470)
FT                   /locus_tag="RC1_0411"
FT   CDS_pept        complement(438111..438470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0411"
FT                   /product="acylphosphatase, putative"
FT                   /EC_number="3.6.1.7"
FT                   /note="[synonyms] Acylphosphate phosphohydrolase identified
FT                   by match to protein family HMM PF03099 match to protein
FT                   family HMM TIGR00214"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97850"
FT                   /db_xref="GOA:B6IQW4"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQW4"
FT                   /protein_id="ACI97850.1"
FT                   /translation="MSRRVPAFPWTRRSWSSSEPGGSTMSGGRTAVLARITGRVQGVGY
FT                   RAWTVRRAGAAGLDGWVRNRADGSVEALFAGPAAAVEAMLADCREGPPASLVAEVRTEP
FT                   GDDPGSTGFGQRATA"
FT   gene            complement(438415..440415)
FT                   /gene="pccA"
FT                   /locus_tag="RC1_0412"
FT   CDS_pept        complement(438415..440415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pccA"
FT                   /locus_tag="RC1_0412"
FT                   /product="propionyl-CoA carboxylase alpha chain"
FT                   /EC_number="6.4.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97851"
FT                   /db_xref="GOA:B6IQW5"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR041265"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQW5"
FT                   /protein_id="ACI97851.1"
FT                   /translation="MFSKILIANRGEIACRVIKTARRMGIRTVAVYSEADAGALHVEMA
FT                   DEAVAIGPAPSAQSYLVADRIIEACRRTGAQAVHPGYGFLSEKAEFCEKLKADGIVFIG
FT                   PDVHAIGAMGDKIESKKLAKAAGVSTVPGYLGVIADDAEAVAIAREIGYPVMIKASAGG
FT                   GGKGMRVAWNDAEARDGFRSATNEARSSFADDRVFIEKYIIDPRHIEIQVLADAHGNCV
FT                   YLGERECSIQRRHQKVIEEAPSPFLDAATRRAMGEQAVALAKAVQYRSAGTVEFIVDKD
FT                   RNFYFLEMNTRLQVEHPVTEMITGLDLVELMIRVAAGETLPFTQQDVTLTGWSMEARVY
FT                   AEEPTRNFLPSTGRVIRYRPPAEATHPDGTVVRVDTGVYEGGEISMFYDPMVAKLITYG
FT                   PDRAAAIRAMGTALDGFEIRGVGHNISFLAAVMQKERFRDGRLSTNFIAEEFPDGFHGL
FT                   TPDPDTLRRVLAVALFCQRRLAERDGMVSGQVCGHGRRTTDNWMARCNGENHAAAVHPH
FT                   DHGATVEIGGETLDVLSDWELGHTLWTGTVGGRPMVVQVERQGIRWKLFHAGAALSVEV
FT                   LTARTADLAGRMPVKLPPDMSKFLLSPMPGLLVTVAVKEGDKVEAGQELAVVEAMKMEN
FT                   ILRADAAGTVKKVYVQKGASLSVDEKIMEFE"
FT   gene            complement(440598..440873)
FT                   /locus_tag="RC1_0413"
FT   CDS_pept        complement(440598..440873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0413"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97852"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQW6"
FT                   /protein_id="ACI97852.1"
FT                   /translation="MPDCEGCGACCAYSWEWPALLGPGDGAGIPAYFIEDGRMRCDGDR
FT                   CSALAGTLGEAVHCRVYADRPLVCREFTAGSDDCRELRRLFGFDSG"
FT   gene            complement(440906..441232)
FT                   /locus_tag="RC1_0414"
FT   CDS_pept        complement(440906..441232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0414"
FT                   /product="H-proteinspecies of closest matc"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97853"
FT                   /db_xref="GOA:B6IQW7"
FT                   /db_xref="InterPro:IPR025698"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQW7"
FT                   /protein_id="ACI97853.1"
FT                   /translation="MAAMHGGRRRGALQSARRSVHPSRNQVPSPMPTRDADPGSDPDAR
FT                   ARRRRGTLLNHLLAYFGTMVVLVPVNFLTTPDYPWFLFPLVAWFAPLGVHVAWVLGLFD
FT                   RPRS"
FT   gene            441384..442823
FT                   /gene="cioA"
FT                   /locus_tag="RC1_0415"
FT   CDS_pept        441384..442823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cioA"
FT                   /locus_tag="RC1_0415"
FT                   /product="ubiquinol oxidase subunit I, cyanide insensitive"
FT                   /note="identified by match to protein family HMM PF00708"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97854"
FT                   /db_xref="GOA:B6IQW8"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQW8"
FT                   /protein_id="ACI97854.1"
FT                   /translation="MELDPVLLARIQFAFTISFHILFPAFTIGLATWIAVLEGRWIWSG
FT                   RDIYRQLSEYWTKIFAVSFGMGVVSGIVMSYQFGTNWSRYSDIGGNILGPLINYEVVTA
FT                   FFLEATFLGILLFGRDRVPRRVHFFAACMVALGTLISAFWILSANSFMQTPAGYELRDG
FT                   RLFPADWWAIVFNPSFPTRYFHMVIACFLTTAFVVAGVSAWHLLRRRHQEYARIGLSMA
FT                   LGLIAVLAPAQVVVGDLSGLNTLEHQPTKLAAIEGHWETRAGAPLILFALPDQEAETNR
FT                   FSIEVPNLGSLILTHDWNGVVSGLKEVPPADRPPVLPVFFSFRVMVGLGLVMLAVGFYG
FT                   LWLRTRGRLYDTRWFLHTLVWCTPIGFFAILAGWITTEVGRQPWTVYGLLRTADSVSPA
FT                   ITGPGVLASLITFFVVYCIVFSAGTYYLVRLFQRGPGGPTQPADPPTGRPKRPLSKAEE
FT                   GLDAAPDEGPAPFRHRPTPAE"
FT   gene            442883..443902
FT                   /gene="cioB"
FT                   /locus_tag="RC1_0416"
FT   CDS_pept        442883..443902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cioB"
FT                   /locus_tag="RC1_0416"
FT                   /product="ubiquinol oxidase subunit II, cyanide
FT                   insensitive"
FT                   /note="identified by match to protein family HMM PF00289
FT                   match to protein family HMM PF00364 match to protein family
FT                   HMM PF02222 match to protein family HMM PF02785 match to
FT                   protein family HMM PF02786"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97855"
FT                   /db_xref="GOA:B6IQW9"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQW9"
FT                   /protein_id="ACI97855.1"
FT                   /translation="MSGIDVDLTLIFAGIGAFAVFMYVLLDGFDLGVGILFPWAPGGDA
FT                   DRDLMMNSVAPIWDGNETWLILGGAALFAGFPLAYAVLLPALYLPLLLMLIALIFRGVA
FT                   FEFRFKADTSRRLWDWSFHLGSLFATFAQGVILGGFIQGFEVQGRDYAGGLFDWLTPFS
FT                   IMTGVALVAGYALLGAAWLVMKTDGALQDWSYRVAGLALLAVLVFIAVVSLWTPLHSDA
FT                   IRDRWFSLPNLYYLSPVPLLTAAVAAALFGALRRRRETAPFVLAMGLFLLSYLGLAISL
FT                   WPYLVPPAFTLWDAASPPESQVFLLVGLAFLIPTTLLYTAFTYWVFRGKVRPGAGYQH"
FT   gene            complement(444007..444309)
FT                   /locus_tag="RC1_0417"
FT   CDS_pept        complement(444007..444309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0417"
FT                   /product="sterol carrier family protein, putative"
FT                   /note="identified by match to protein family HMM PF03692"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97856"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR039543"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQX0"
FT                   /protein_id="ACI97856.1"
FT                   /translation="MSLQQILTEMQSSSSRFNGLNSTVKFDFGDQGSIFIDGTRTPPEI
FT                   TEGGEDAKCVLKISLEDFMKLQHGQLSPMMAFTMGKLKVQGDMGVAMKLSTMLDD"
FT   gene            complement(444347..445879)
FT                   /gene="pccB"
FT                   /locus_tag="RC1_0418"
FT   CDS_pept        complement(444347..445879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pccB"
FT                   /locus_tag="RC1_0418"
FT                   /product="propionyl-CoA carboxylase, beta chain"
FT                   /EC_number="6.4.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97857"
FT                   /db_xref="GOA:B6IQX1"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQX1"
FT                   /protein_id="ACI97857.1"
FT                   /translation="MQEILAKLEAKRAAARLGGGERRIAAQHSKGKLAARERIDVLLDE
FT                   GSFEEWDMFVEHRCIDFGMDAQKVPGDGVVIGHGTINGRLVFVFSQDFTVFGGSLSEAH
FT                   AEKICKVMDQAMKVGAPVIGLNDSGGARIQEGVASLGGYAEVFQRNVLASGVVPQISLI
FT                   MGPCAGGAVYSPAMTDFIFMVKDSSYMFVTGPDVVKTVTHEVVTAEELGGAVTHSHKSG
FT                   VADMAFENDIETLLQTRRLFDFLPLSNREQPPVRPTPDPANREEMSLDTLIPANPNKPY
FT                   DMKELILKVVDEGDFFELQPDYAKNIITGFGRMQGATVGFVANQPMVLAGCLDIQSSIK
FT                   AARFVRFCDAFNIPIVTFVDVPGFLPGTAQEYGGIIKHGAKLLFAYAEATVPKVTVITR
FT                   KAYGGAYDVMASKHLRGDVNYAWPSAEIAVMGPKGAVEIIFRQDIGDQAKIEARTEEYR
FT                   QKFANPFVAASRGYIDDIIRPHGTRRRLCKALAMLKNKNLQNPWKKHDNLPL"
FT   gene            complement(446023..446718)
FT                   /locus_tag="RC1_0419"
FT   CDS_pept        complement(446023..446718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0419"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01654"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97858"
FT                   /db_xref="GOA:B6IQX2"
FT                   /db_xref="InterPro:IPR011419"
FT                   /db_xref="InterPro:IPR023335"
FT                   /db_xref="InterPro:IPR042272"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQX2"
FT                   /protein_id="ACI97858.1"
FT                   /translation="MKRVYREVGTAAVEGGWEVRLDGRSLKSPARAPLVLPTRALAEAV
FT                   AAEWDAQTETVEPHSMPMMQLASTTVDRIVPQRAAIVDGVAAYAGTDLLCYRADHPRSL
FT                   VARQEEAWQPLLDWVASRYDAMLLPTTGIVHRPQSDLTLAALRRAVEAQDDWRLSGLQN
FT                   AVALSGSLVVALALLEGRIDAEEAFAVSQLDESWQSETWGVDAEAAARRAGIRADLGAT
FT                   ERFLRLLAG"
FT   gene            complement(446744..447427)
FT                   /locus_tag="RC1_0420"
FT   CDS_pept        complement(446744..447427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0420"
FT                   /product="HAD-superfamily hydrolase, subfamily IA"
FT                   /note="identified by match to protein family HMM PF02322
FT                   match to protein family HMM TIGR00203"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97859"
FT                   /db_xref="GOA:B6IQX3"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQX3"
FT                   /protein_id="ACI97859.1"
FT                   /translation="MKLALFDCDGTLVDSQYAIVAAMTAGFAAANLPPPPAEAVRRVVG
FT                   LPLVGAVATLAPLLEPALHVEIAEAYKAAFHENRLLARVPEPLFPGVVEALDALEAAGC
FT                   LLGVATGKSRRGLLATLDHHGLRGRFVTLQTSDLLPGKPHPDMVHHAMAEAGAEREETV
FT                   VIGDTTFDMLMARNARVPVVGVSWGYHEVEELTAAGADRIVTDCAALPAAVLALMAPSG
FT                   PAALN"
FT   gene            447672..447785
FT                   /locus_tag="RC1_0421"
FT   CDS_pept        447672..447785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0421"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97860"
FT                   /db_xref="GOA:B6IQX4"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQX4"
FT                   /protein_id="ACI97860.1"
FT                   /translation="MKRVNMIRAETLADRLTVAGLVGGVLFYLGYGVYLFG"
FT   gene            complement(447845..448855)
FT                   /locus_tag="RC1_0422"
FT   CDS_pept        complement(447845..448855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0422"
FT                   /product="RNA pseudouridine synthase"
FT                   /note="identified by match to protein family HMM PF01039"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97861"
FT                   /db_xref="GOA:B6IQX5"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQX5"
FT                   /protein_id="ACI97861.1"
FT                   /translation="MSESEKKQVETRLVGDDEGEVRLDRWFKRHYPLLSHIQLQKLLRT
FT                   GQVRVDGKRAEASTRLLPGQSVRIPPLPDAPPPDAVRPKARPEVDERAAKELRARVLFR
FT                   DHDVIVLDKPAGLATQGGTNQVKHLDAMLDALKFEAEGRPKLVHRLDKDTSGCLVLARS
FT                   AAAAAKLTAAFRSREARKIYWAVTVGVPKPMKGRIDLPVAKEAGTRGERMTVDEDEGVH
FT                   AITYYTVLEHAHKQAAFVALWPRTGRTHQLRVHMAALGTPILGDGKYAGQGAFLEGAGD
FT                   LPRQLHLHARRIILPHPRGGVIDVTAPLPKHMRPAWDYFGFEDKRKDDPFAELEF"
FT   gene            complement(448852..449232)
FT                   /locus_tag="RC1_0423"
FT   CDS_pept        complement(448852..449232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0423"
FT                   /product="CrcB-like protein"
FT                   /note="identified by match to protein family HMM PF07542"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97862"
FT                   /db_xref="GOA:B6IQX6"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6IQX6"
FT                   /protein_id="ACI97862.1"
FT                   /translation="MKMILAVAAGGGLGAVARYLTGVGLGHWLGTAYPWATMTVNVTGS
FT                   FAMGVLAGLGAHVWQPAPELRAFLMVGVLGGFTTFSSFSLDVALLVERGAIGAAAAYVA
FT                   ASFLLSVGGLFAGLALIRTAVA"
FT   gene            complement(449229..450122)
FT                   /locus_tag="RC1_0424"
FT   CDS_pept        complement(449229..450122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0424"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00702
FT                   match to protein family HMM TIGR01509 match to protein
FT                   family HMM TIGR01549"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97863"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQX7"
FT                   /protein_id="ACI97863.1"
FT                   /translation="MLPDPFPTAFDLHVGIDWTGAQPARGIAIAVVSPLDRIVRPVPPP
FT                   GRHWRREEAVNWLLDRLAQGRRLLIGIDCAFSLPWVPGAGYLDGRVPGVADLFALWDLV
FT                   EAAAGEASDDFAGAVVHDPRFAPSFWIAGPTPPHWGDGSTKRRRVEVAAAAGGFGTPVS
FT                   VFKLAAASKQVGKASLAGMRSLRRLRREAGGRLAVWPAEPVGARSVVCEIYPTLFRRRA
FT                   GHGTAKLRTLAELERALAAFGCALPPGFPEGFDDHTGDAMISAAGLLALAGEARVWTAP
FT                   EAETARREGWIFGVDA"
FT   gene            452134..452451
FT                   /locus_tag="RC1_0425"
FT   CDS_pept        452134..452451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0425"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97864"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQX8"
FT                   /protein_id="ACI97864.1"
FT                   /translation="MAAFFLLPGPARAQGTPPPAGPPQDAGSNAAEEPPEEIVIIGRRR
FT                   PTPDFQEQYEFHKAEFERLRQIYEEPPPPPRYSPGERKLRVQESISSTLPGKPTLLDRA
FT                   N"
FT   gene            complement(452527..454749)
FT                   /locus_tag="RC1_0426"
FT   CDS_pept        complement(452527..454749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0426"
FT                   /product="TonB-dependent receptor, putative"
FT                   /note="identified by match to protein family HMM PF00849
FT                   match to protein family HMM PF01479 match to protein family
FT                   HMM TIGR00005"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97865"
FT                   /db_xref="GOA:B6IQX9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQX9"
FT                   /protein_id="ACI97865.1"
FT                   /translation="MQLKHALNAGLSALALLVPAGVAAQTAQPAEPALEEIIVTAQRRS
FT                   ENLQEVPVSVAAISGDTFRDYLAGGGDVLALSGRVPGLYAETSTGRIFPRFYIRGLGNN
FT                   DFYLGASQPVSIIIDDVVMENVVLKSSPLFDTQQVEVMRGPQGTLFGRNTTAGIIKFDS
FT                   IAPSHETQGRGTVTYGTFGTVTADAGVGGSLIDGVLAIRASAMVQHRGDWVDNTADGTK
FT                   LGGYDDKAARVQFLLTPGEDTDVLLNVHGRDLDATSTLFRGYALTKGSHKLNGNYDKDK
FT                   VAYNDGDANDQSYEGWGSSLKVDHDFGNVVLTSITAYETTNGYSRGDTDGTAGNFAESQ
FT                   GNIDDLDQWTQELRLASDTTGPLNWQVGGFYFDSDEQLTFRPYNFFETGGASGFVTLGN
FT                   ENRSWALFGQAGYRITDDLKLTGGLRWTEDKKEMNVLRALQAGTFTSVEDGRRITQASY
FT                   TGIRHVELKDDELSWDASAFYDLTDEVSVFGRIARGFRGPTIQGRTVSFNGAPTTATSE
FT                   TILSYEAGLKSSLLDDRLRLNGAVYTYTVNDIQLTAFDGNGTARLLNADKGVAYGLEVD
FT                   AEAFLTPDFIITAGLTYTDTEIKDDQVTTSICSGGVCTVKDPLVNGRAKIDGNPFPNAP
FT                   EYILSLTARYNMPLADGSNLFLFTDWNMTGRTNFVLYESEEFYSKGDFEGGLKIGYENP
FT                   DRTYEVALFGRNITNEKNVKGVIENYLAAVVNDPMTVGISFTARLP"
FT   gene            454750..454905
FT                   /locus_tag="RC1_0427"
FT   CDS_pept        454750..454905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0427"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97866"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQY0"
FT                   /protein_id="ACI97866.1"
FT                   /translation="MGPHQSVQAAGHPGLQGGRPHVRGMPFAPNADVDGPPRRWRPGYS
FT                   RSATER"
FT   gene            complement(454988..456286)
FT                   /locus_tag="RC1_0428"
FT   CDS_pept        complement(454988..456286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0428"
FT                   /product="ATPase, AAA family"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97867"
FT                   /db_xref="GOA:B6IQY1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQY1"
FT                   /protein_id="ACI97867.1"
FT                   /translation="MSGTLFEDQAPRPLADRLRPRRLEEVVGQEHLLAPEGPVGRQVKA
FT                   RRLTSMILWGPPGCGKTTIARLLAQSTDLHFEPLSAVFSGVADLRKVFEAAKARRAMGQ
FT                   GTLLFIDEIHRFNRSQQDGFLPYVEDGTVTLVGATTENPSFELNAALLSRAQVFVLNRL
FT                   DEAALEKLLQRAEAETGRPLPLDEDARLALKAMADGDGRYCLNLCEELFQLPDGTALDT
FT                   TGLTAAVQRRMPLYDKAQEGHYNLISALHKSLRGSDTDAALYWFARMLAGGEDPRYIAR
FT                   RLCRFAVEDVGLADPQALTQAIAAWEAYERLGSPEGDLAIAQLVIYLGTAPKSNAAYKA
FT                   HGAALRAARETGSLMPPMHILNAPTKLMKQLGYGHGYAYDHDTADGFSGQNYFPDGMER
FT                   QVFYNPVERGFEREIRKRLDYWARLRTERQGQG"
FT   gene            complement(456362..457789)
FT                   /gene="degP"
FT                   /locus_tag="RC1_0429"
FT   CDS_pept        complement(456362..457789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degP"
FT                   /locus_tag="RC1_0429"
FT                   /product="periplasmic serine protease, Do"
FT                   /EC_number="3.4.21.-"
FT                   /note="[synonyms] protease Do"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97868"
FT                   /db_xref="GOA:B6IQY2"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQY2"
FT                   /protein_id="ACI97868.1"
FT                   /translation="MMPRFLSPLGRGGVALALLLAASFVPAPASAQRAVPDNREQIQLS
FT                   FAPVVKQVIPAVVNIYTTRTVRQRVSPLFDDPLFRRFFGDALGGVPRERMEASLGSGVI
FT                   VSADGLIITNAHVIQDSDQIQVVLADRREFPAKLVSQDERVDLAVLRIDTKGERLPFLQ
FT                   LRDSDDLEVGDLVLAIGNPFGVGQTVTSGIVSAVARTAVGVSDYNFFIQTDAAINPGNS
FT                   GGALVTMDGRLVGINSAIYSRNGGSIGIGFAIPSNMVRTVIDAVAAGGKLVRPWIGADG
FT                   QAVTADLAAGLNLARPGGVLINQVRPGGPADKAGLRRGDVITGVNGREVDGPDALRYRI
FT                   ATLPIGGKATLTVLRGGKEQQLTLGLIAPPEDPPREVTTLQGRNPLAGAEVGNLNPALI
FT                   EEIGFSGAQEGVVVLQVARGSPAAMTGLRPGDVILRINGTAIERVRDLSAELARRARAW
FT                   TIDVQRGDQVLTTTIGG"
FT   gene            complement(457857..458105)
FT                   /locus_tag="RC1_0430"
FT   CDS_pept        complement(457857..458105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0430"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97869"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQY3"
FT                   /protein_id="ACI97869.1"
FT                   /translation="MRPRQIALAALLPVLLTACMAPPARREAQGATDGHQACLAQCNRE
FT                   ADVCFDQRSAQDGNTTYGMGATCQAEMKSCLNRCGGR"
FT   gene            458259..458957
FT                   /locus_tag="RC1_0431"
FT   CDS_pept        458259..458957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0431"
FT                   /product="aspartate racemase, putative"
FT                   /EC_number="5.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97870"
FT                   /db_xref="GOA:B6IQY4"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004380"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQY4"
FT                   /protein_id="ACI97870.1"
FT                   /translation="MRTLGLIGGMSWESTAVYYRLLNGMVRDRLGGLHSARLLLLSVDF
FT                   AEIAALQAEGRWSVLTERMVDAGRHLRAGGAEALLICTNTMHLMAAAVEEAAGLPLIHI
FT                   ADTTAAACRKAGVRRPLLLATRYTMEHPFYAERLHRHGLEPLVPGPEDRTTIHRIIYEE
FT                   LCRGEIREDSRAAYRAVIERMRAEGADGVILGCTEIGLLIRQEDSPLPVFDTTEIHCAA
FT                   AVDFALAPGP"
FT   gene            complement(459363..460046)
FT                   /gene="kdpE"
FT                   /locus_tag="RC1_0432"
FT   CDS_pept        complement(459363..460046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpE"
FT                   /locus_tag="RC1_0432"
FT                   /product="KDP operon transcriptional regulatory protein
FT                   KdpE"
FT                   /EC_number="2.7.3.-"
FT                   /note="Member of the two-component regulatory system kdpD"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97871"
FT                   /db_xref="GOA:B6IQY5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQY5"
FT                   /protein_id="ACI97871.1"
FT                   /translation="MSRILVVDDEAQIRRFLRISLAANGHAVLEAETGAEAVALVRAEA
FT                   PDLVILDLGLPDMDGQEVVSAIREIGRVPILVLSVRTGETDKVEALDRGAEDYVAKPFG
FT                   IAELMARVRVALRRAPQDPRPAVVVAGGVMIDLDRRVVERDGGEVRLSRREQDLLFVLA
FT                   RSADHVLTHQQILREVWGPAHVEDTAYLRVYVNQLRQKLEPDPGQPALIVTEPGVGYRL
FT                   RTDGT"
FT   gene            complement(460043..462796)
FT                   /gene="kdpD"
FT                   /locus_tag="RC1_0433"
FT   CDS_pept        complement(460043..462796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpD"
FT                   /locus_tag="RC1_0433"
FT                   /product="sensor protein KdpD"
FT                   /EC_number="2.7.3.-"
FT                   /note="Part of the kdp operon.Also matched to PF02702:
FT                   Osmosensitive K+ channel His kinase sensor domain;
FT                   identified by match to protein family HMM PF00089 match to
FT                   protein family HMM PF00595 match to protein family HMM
FT                   TIGR02037"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97872"
FT                   /db_xref="GOA:B6IQY6"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQY6"
FT                   /protein_id="ACI97872.1"
FT                   /translation="MARPEDQDRPSPDALLEHARREQRGKLKIFLGAAPGVGKTYAMLE
FT                   AAQSARRDGVALVVGIVETHGRAETERLVHGLEVVPRSRIDYRGRSFEEMDLDAILVRR
FT                   PALVLVDELAHTNIPGSRHLKRWQDVEELLAAGIDVWSTLNVQHLDSLNDVIERIAGIK
FT                   VRETVPDSVLRGADEIEMIDLPPQELRKRLGEGKVYVPAQARMAVEKFFSVGNLTALRE
FT                   MALRQAAERVDAQMLSYMRRNGIAGPWPTRDRILVAIGPEPNAATLVRSARRMADRRQA
FT                   PWTVAYVETHRHQTLSETRKAHVTEALRLAHQLGGETVVLPGDDIAGELIGWARANNVS
FT                   QIVLGRSRQRRRFGLTSTDDMLKRATAYDLLLVGGTEEKPEPSGQGAAGQALAGPAGSD
FT                   RRGWRAYAWAGVALILATALSWGVFSVLPVANVSLVYLLAVLLIATRFGLVPSIVTAVL
FT                   AFFAFNFFFTEPRQTFLVNTSEDLLTIGFFLVAAVFTGHLASRLRAQIELSRTSQRRTA
FT                   NLYDFARKVASAASEDDVLWAVVHHVAATLKAKALVLLPLDGELAIRAGYPPEDRLDQR
FT                   AAAAAQWAWSNGERAGRGSDTLPASEWLFLPLKTQRGTVGVLGVQGYEGGSRLSADQAR
FT                   LLDALVDQAALVLERTQLVRDIEAAQIAGEKEQLRAALLSSLSHDLRTPLVSILGSASS
FT                   LLTLEHELDDDARRELARTIQEEAERMNRFVQNLLDMTKLGSGGLKPKTDWTDLADIVG
FT                   RALARAKPLLKGRRIKVDLAPDLPLLQLDPVLMEQVLFNLLDNAARYSPAQGAITVWAR
FT                   RRGDRVVAEVCDQGPGIPVADRDRVFDMFYRVAGGDQQTAGTGLGLAIAKGIVEAHGGS
FT                   IGVLDGMHGVGACLVLRLPVPEEAPPAPAEMSAEVAVAVPAGGGPA"
FT   gene            complement(462852..463481)
FT                   /gene="kdpC"
FT                   /locus_tag="RC1_0434"
FT   CDS_pept        complement(462852..463481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpC"
FT                   /locus_tag="RC1_0434"
FT                   /product="potassium-transporting ATPase C chain"
FT                   /EC_number="3.6.3.12"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97873"
FT                   /db_xref="GOA:B6IQY7"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6IQY7"
FT                   /protein_id="ACI97873.1"
FT                   /translation="MLTHLRPALTMILALTVLTGLAYPLAVTAVARLAFPEQAAGSLIH
FT                   RADGTVLGSALIGQTFTRPEYFWSRPSAAGDGYDAANSSGTNLGPSNTALVAAVQARVE
FT                   ALKAANPDAVGPVPVDLVTASASGLDPHISPAAALWQAPRVAAARGLETGRVVELIRQA
FT                   TEGRVFGFLGEPSVNVLKLNLALDAQAPTPRQPEPGHPEPGRPEVR"
FT   gene            complement(463493..465673)
FT                   /gene="kdpB"
FT                   /locus_tag="RC1_0435"
FT   CDS_pept        complement(463493..465673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpB"
FT                   /locus_tag="RC1_0435"
FT                   /product="potassium-transporting ATPase B chain"
FT                   /EC_number="3.6.3.12"
FT                   /note="identified by match to protein family HMM PF01177
FT                   match to protein family HMM TIGR00035"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97874"
FT                   /db_xref="GOA:B6IQY8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQY8"
FT                   /protein_id="ACI97874.1"
FT                   /translation="MTDPVKRAEAAHRRVWRRYMKDNSAPVLNSTQATLLDGRIARQAL
FT                   GEAFLKLDPRRLVRNPVMFVTAVVALLTTLIFVRDLVTGGSALASREIASWLLLTGGDP
FT                   SITGQIAAWLWFTVLFANFAEAVAEGRGKAQAASLRRTRTETTARRATTADGAFWEEVP
FT                   ATALRAGDLVVVEAGDTIPGDGEVVEGIATVNESAITGESAPVIRESGGDRSAVTGGTV
FT                   VVSDRIVVRITANPGESFLDRMIALVEGAKRQKTPNEIALTILLVGMTIIFLLVTVTLQ
FT                   GFAGYSGFLIPVVFLIALLVTLIPTTIGGLLSAIGIAGMDRLVKFNVIAKSGRAVEAAG
FT                   DVGVLLLDKTGTITLGNRQATEFLPLGGVHERELGEAALLASLADDTAEGRSIVALARQ
FT                   KFRFSADSFDPRGLDFIPFTAQTRMSGVNIGPRCIRKGAVDTMRAWVEAQSSIGYAPGR
FT                   ELAQRVEQVARSGGTPLVVADGARVLGVVHLKDIVKPGIRERFTTLREMGIRTVMITGD
FT                   NPLTAAAIAAEAGVDDFLAEATPEKKLELIRQYQAEGRLVAMCGDGSNDAPALAQADVG
FT                   VAMNTGTQAAREAGNMVDLDSDPTKLIEIVMIGKQLLMSRGALTTFSIANDVAKYFAII
FT                   PALFVAAYPPLQALNIMGLESPASAILSAIIFNALVILFLIPLALRGVAYRPAPAATLL
FT                   ARNLALYGVGGLVVPFLGIKAIDLAITSLGLV"
FT   gene            complement(465670..467391)
FT                   /gene="kdpA"
FT                   /locus_tag="RC1_0436"
FT   CDS_pept        complement(465670..467391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpA"
FT                   /locus_tag="RC1_0436"
FT                   /product="potassium-transporting ATPase A chain"
FT                   /EC_number="3.6.3.12"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97875"
FT                   /db_xref="GOA:B6IQY9"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6IQY9"
FT                   /protein_id="ACI97875.1"
FT                   /translation="MTAEGLLQILLYLGLLAAVTPLLGRYMARVFEGERTLPGIVLGPL
FT                   ERGLYRIAGIDPAREQHWTGYTLALLSFNLLGLLLLYALLRFQALLPLNPAELGPVGPD
FT                   LAFNTAVSFTTNTNWQSYGGETTLSYLSQMLGLTVQNFVSAATGIAVAVALIRGFARRA
FT                   GKTVGNFWADLVRATLYVLLPLAFLGALVLVWQGVPQNFDAYVTATTLEGGNQVLAQGP
FT                   AASQIAIKQLGSNGGGFFNVNSAHPYENPTALTNLLESFYLLMIAAALIYSFGRMVGDT
FT                   RQGRALWTAVFILFVAGLAVTWWAEAQGNPAVTALGVETTDGNMEGKEVRYGTALSALW
FT                   AVATTAASNGSVNAMHDSFMPLGGMVPMLNMMLGEVIYGGVGAGLYGLLVFVILAVFIA
FT                   GLMVGRTPEYLGKKIEAREIKLAVIAVLVFPLGILGGAALTTVVPQMLASVQDPGPHGL
FT                   SEILYAYTSATGNNGSAFAGFGANTPWHNTGLGLAMLLGRFAVIVPTLAIAGSLVAKRA
FT                   APAGPGTLPTHGTLFITLLIATILIVGGLTFFPALALGPIAEHLSLTAGTLFGAVP"
FT   gene            complement(467498..467635)
FT                   /locus_tag="RC1_0437"
FT   CDS_pept        complement(467498..467635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0437"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97876"
FT                   /db_xref="GOA:B6IQZ0"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQZ0"
FT                   /protein_id="ACI97876.1"
FT                   /translation="MRPSPILPPCETTQGGNPMADIIFLGLVLAAFAAFAGLTYGCDRL
FT                   "
FT   gene            complement(467722..468627)
FT                   /gene="oxyR"
FT                   /locus_tag="RC1_0438"
FT   CDS_pept        complement(467722..468627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oxyR"
FT                   /locus_tag="RC1_0438"
FT                   /product="hydrogen peroxide-inducible genes activator
FT                   protein"
FT                   /note="Alternate name; Gene symbol synonyms: momR, mor
FT                   identified by match to protein family HMM PF00512 match to
FT                   protein family HMM PF00582 match to protein family HMM
FT                   PF02518 match to protein family HMM PF02702"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97877"
FT                   /db_xref="GOA:B6IQZ1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQZ1"
FT                   /protein_id="ACI97877.1"
FT                   /translation="MTAITLRQLRYLVALADTLHFGRAAAACHVSQPSLSAQIQQLESL
FT                   LGTALVERTKHRVLLTPAGKDTVRRARDVLAAVDDMSQMARAAGRPLCGALRLGVIPTI
FT                   GPYLLPGVLPGLRRDYPDLRLYLREDLTERLLDRLRAGDLDAAVLALPVAEPGLETVDL
FT                   FEEPFLVALPQNHPLSERTAVRQSDLSGEVLLLLEDGHCFRDQALDVCRLSGAREDPGF
FT                   AATSLPTLVEMVAGGLGLTLLPARAAPLLTAAGQVVLRPFVAPVPVRRVGLVWRRGSVR
FT                   EADLQRLAGHLAEGTRSCRC"
FT   gene            468785..469324
FT                   /gene="ahpC"
FT                   /locus_tag="RC1_0439"
FT   CDS_pept        468785..469324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpC"
FT                   /locus_tag="RC1_0439"
FT                   /product="alkyl hydroperoxide reductase C"
FT                   /note="identified by match to protein family HMM PF02669
FT                   match to protein family HMM TIGR00681"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97878"
FT                   /db_xref="GOA:B6IQZ2"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQZ2"
FT                   /protein_id="ACI97878.1"
FT                   /translation="MLTVGDKFPAFDLKAVVSTDPKTAFTQINNETYKGKWLVVFFWPK
FT                   DFTFVCPTEIAAFGKLSGEFADRDAQVLGASTDSEFVHLAWRQHHADLKDLPIPMLADI
FT                   KRELSGELGILHKLEGVALRATYIVDPEGVIRFASVHDLSVGRNVNEVLRTLDALQTDE
FT                   LCPCNWQKGDEVLKAA"
FT   gene            469489..470049
FT                   /gene="ahpD"
FT                   /locus_tag="RC1_0440"
FT   CDS_pept        469489..470049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpD"
FT                   /locus_tag="RC1_0440"
FT                   /product="alkyl hydroperoxide reductase D"
FT                   /note="identified by match to protein family HMM PF00122
FT                   match to protein family HMM PF00702 match to protein family
FT                   HMM TIGR01494 match to protein family HMM TIGR01497"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97879"
FT                   /db_xref="GOA:B6IQZ3"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004674"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6IQZ3"
FT                   /protein_id="ACI97879.1"
FT                   /translation="MSIEALKARLPDYAKDLRLNLGSVLTTSSLKPGQVWGAAIAAAYA
FT                   ARNDDVTRAIVAEAAQHLDAAGLTAAKAAGAIMGMNNVYYRTVHLSGNADFKKIPARLR
FT                   MNVIGNPGVEKVDFELWSLAASAVNGCGMCIEAHEREVMHKGMSTENIQDAVRIAAVIH
FT                   AVATVLDAEAALSGQDGSTAVAA"
FT   gene            complement(470165..471247)
FT                   /locus_tag="RC1_0441"
FT   CDS_pept        complement(470165..471247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0441"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03814
FT                   match to protein family HMM TIGR00680"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97880"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQZ4"
FT                   /protein_id="ACI97880.1"
FT                   /translation="MPVVLGPHGDVPVLRADGVAASASAQEAARDALNVLPLAMLPLET
FT                   AGLAGARLVKTARLESLVEVFDSGGAGSGRREIAAAVGAMAGPADAMERDAKLLQAVSR
FT                   MASFDVFNLCTALRELRVAPPRGEGVGLSPRKRRELAGHLRPYTRALTDGVFGATVPAG
FT                   VPLDDGLVQLHRAAVRANLDAIARRLRIDRQALPELLTRYADAALSLAYYQSCDRGLRN
FT                   LLGDFSAWLGALTAIAVVTGTPANMRLVQEVQGALAELTLRLDDCLRHLERHLQHYWRQ
FT                   PTPLTGAQGQRVLSAYQGAIGAMLCGLVTKLTAWEQRFGEVPGSPGQRIDWLRQEMLPG
FT                   LPELRLTSEQAVLDITRLSA"
FT   gene            complement(471434..472063)
FT                   /locus_tag="RC1_0442"
FT   CDS_pept        complement(471434..472063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0442"
FT                   /product="translocator protein, LysE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97881"
FT                   /db_xref="GOA:B6IQZ5"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQZ5"
FT                   /protein_id="ACI97881.1"
FT                   /translation="MLAEIGVFLRGIILGIAIAAPVGPIGLLCIRRTLERGIAVGIATG
FT                   MGAAIADALFSAIAAFGVNAILELVIGHEGELRVFGGLFLLGVALHSFLREPRPPAQEP
FT                   EARNLLGATGSGLALTMGNPVTILGITALVVGFSGGLETYQAVTLVAGIFVGSGIWWFI
FT                   LCGGVTLVRHRITRRSVLWINRGTGIMLGALGVWALGGVGWNWLVG"
FT   gene            472164..472649
FT                   /locus_tag="RC1_0443"
FT   CDS_pept        472164..472649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0443"
FT                   /product="transcriptional regulator, AsnC family protein"
FT                   /note="identified by match to protein family HMM PF00126
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97882"
FT                   /db_xref="GOA:B6IQZ6"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQZ6"
FT                   /protein_id="ACI97882.1"
FT                   /translation="MDAPSSPPGHSVAGSRPLDATGWRILQELQRDARLPFAELGRRVG
FT                   LTAPAVAERVRRMELAGLIQGYRAEVNRAALGAALTAFVRIRAFPGRDGAIESFAATRG
FT                   EVLECHEVTGEDSYLLKIAAGSVRQLDRVVTDLAPFGTTHSLLVLSTKVAGKPVSGG"
FT   gene            472822..473301
FT                   /locus_tag="RC1_0444"
FT   CDS_pept        472822..473301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0444"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97883"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQZ7"
FT                   /protein_id="ACI97883.1"
FT                   /translation="MNTWNPMSPWKSVASGLALLSLTALPAVAAEQSGTSTVKLTNLYG
FT                   VEQTGSRNPGADAACKKAFGSFVGSSMTTTWKVDPSSMMMSAEATYEGAQVRMFPLGIA
FT                   GTYNFMSDGVPESLAAKKINRLIFALDTSFQNPAGTVLFLMDEKDNCVLSSQPAS"
FT   gene            complement(473386..474543)
FT                   /gene="proB"
FT                   /locus_tag="RC1_0445"
FT   CDS_pept        complement(473386..474543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="RC1_0445"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="identified by match to protein family HMM PF02627
FT                   match to protein family HMM TIGR00777 match to protein
FT                   family HMM TIGR00778"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97884"
FT                   /db_xref="GOA:B6IQZ8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:B6IQZ8"
FT                   /protein_id="ACI97884.1"
FT                   /translation="MSAPAESPAVSTDAPLAGARRLIVKIGSALLVDDHNIRRDWLDSV
FT                   ADDIAVLRARGVEVVVVTSGAIAVGREHLGLVGRPLRLEEKQAAAATGQIRLAAVYQET
FT                   LARHGITVAQVLLTLDDTEMRRRHLNGRATIEALLKLGAVPVINENDTVATAEIRFGDN
FT                   DRLAARVAQMISADTLVLLSDIDGLYTADPRKDPDARHIPVVTEVTPEITAMAGEPPPG
FT                   YSSGGMVTKIAAARIAMAAGCRMAIAKGKRLNPLAALLEPPAAGGAPATWFLPQAEPLT
FT                   ARKRWIAGALKPHGRLTVDAGAVAALARGGSLLPAGVRAVEGEFERGDLVQVLGPDGRE
FT                   VGRGLSAYSAEDARRLAGRRSAEIEALLGYRGRDEVIHRDDLVVG"
FT   gene            complement(474637..475692)
FT                   /locus_tag="RC1_0446"
FT   CDS_pept        complement(474637..475692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0446"
FT                   /product="GTP-binding protein GTP1"
FT                   /note="PF01018 PF01926: GTPase of unknown function; With a
FT                   good score above the trusted cutoff and uncharacterized
FT                   homologs"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97885"
FT                   /db_xref="GOA:B6IQZ9"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6IQZ9"
FT                   /protein_id="ACI97885.1"
FT                   /translation="MKFLDQCKIYLKSGDGGPGAVAFRREKFIEFGGPDGGNGGRGGDV
FT                   IIEAVDGLNTLIDYRYQQHFKAKRGGHGMGRSRSGAKGEDAVLRVPVGTQVLDDDQETV
FT                   LADMTEVGQRIVLLKGGDGGFGNEHYKSSTNRAPRQFTPGWPGEERWVWLRLKLIADAG
FT                   LVGLPNAGKSTFLAAVSRARPKIADYPFTTLTPNLGVVQAGEEEFVLADIPGLIEGAHE
FT                   GRGIGTRFLGHVERTRVLLHLVDGTQEDVQLAYRTIRRELRLYGGGLAEKPEIVALNKI
FT                   DALTPEELEFKRTKLRRSAKKPVMLLSGATGQGVQEMLFELLRHIREARGAEAEAAEEI
FT                   ERRIRYAPIEE"
FT   gene            complement(475956..476243)
FT                   /gene="rpmA"
FT                   /locus_tag="RC1_0447"
FT   CDS_pept        complement(475956..476243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmA"
FT                   /locus_tag="RC1_0447"
FT                   /product="ribosomal protein L27"
FT                   /note="PF01016 TIGR00062: ribosomal protein L27; With a
FT                   good score above the trusted cutoff and uncharacterized
FT                   homologs; identified by match to protein family HMM
FT                   PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97886"
FT                   /db_xref="GOA:B6IR00"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6IR00"
FT                   /protein_id="ACI97886.1"
FT                   /translation="MAHKKAGGSSRNGRDSAGRRLGVKRFGGEQVLSGNIIIRQRGTKY
FT                   HPGANVGLGKDHTIFATADGTVKFHTGLKGRTFVSIVPGADEAVPAVAAE"
FT   gene            complement(476275..476586)
FT                   /gene="rplU"
FT                   /locus_tag="RC1_0448"
FT   CDS_pept        complement(476275..476586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /locus_tag="RC1_0448"
FT                   /product="ribosomal protein L21"
FT                   /note="PF00829 TIGR00061: ribosomal protein L21; With a
FT                   good score above the trusted cutoff and uncharacterized
FT                   homologs; identified by match to protein family HMM PF01037
FT                   match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97887"
FT                   /db_xref="GOA:B6IR01"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6IR01"
FT                   /protein_id="ACI97887.1"
FT                   /translation="MFAVIRTGGKQYKVANGDVIKVEKLVADAGATVTLDDVLMVSDAG
FT                   KTTIGTPVVQGAAVTAEVVAQSRGPKIIIFKKKRRQNYRRKNGHRQDLTVLRITGIQA"
FT   gene            complement(476857..480411)
FT                   /locus_tag="RC1_0449"
FT   CDS_pept        complement(476857..480411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0449"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97888"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038734"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR02"
FT                   /protein_id="ACI97888.1"
FT                   /translation="MRIDRLALERYGHFEDRELDLSGPDVLLHVVHGPNEAGKSTTLQA
FT                   IYDLLFGFGHTTDYAFRHDTGSLRIGATLVNREGRAISFRRRKGRGDTILSADGAALPE
FT                   AVLAPFLGGTTREEFERLFGLDHRRLREGGDAMLDARGDIGRSLFEAGSGTAGLSAVAE
FT                   ALKTAADEIGAPNARASAKKPYFAALARFEDAQRRCRNDGLRTEDWTKAVRAADEAQAR
FT                   RDRIAAELSALQAERNRIERLCRVLPLLRRIEALEALLGTLGDGPDLDDGFEADWRQAL
FT                   ETQRTRADQLRARRENREAAKAALDALGGIGPWAQHEKTINALVSGLGEYRSFMESIPN
FT                   RKRDLAAGAERIADLLRRLGLPGRDPASVAALLPDAATVARIQALRTGRTTLDADHRNA
FT                   AEELREAERRTARATAALEAAGTPADPADLEAGFERLREMGDVWTPLREADAALDLARR
FT                   ELADALLAVGRGDWQPETLLALAPPSLETLHQVEARRSALARRRDELEEARARLQAELD
FT                   GIALDLRTLQAGGEVPTETAVAAARERRDTGWRLIRRHHVEGGPVAAEEIDAFRAGTPL
FT                   ADAYEASVRHADGLVDRKEREAARVERDRQLRGRLEKTEAELRTVVATAAETTDALAAW
FT                   AAGWEAAWLPTGLRPGSPDEMRGWLERRQAALDRLGGVRKAEAALATRRRAESDLHRGL
FT                   LVLADRLSLADAGRLTAPELRDAVKAAVGRAKAAWTEAAAARKALADARTEETERRRAL
FT                   EDVQRRLEDWKTLWAEAAPRLGLSPAATAEEAEAALALWQQVALEEKGQVEQRHRRDQM
FT                   QEATDAYRTRVAALLHDLGGAAGDIDPAADPTELVPLMQKRLAENRDLGIRIAEARSRL
FT                   AAAEEEAGKAELAARDADDAVVALRERHGLDPALDVIAATRAAAERRRLRREIADLTGR
FT                   LLEAGDGLDGARLRTEAATVDLDAAMAERQRLEPEIARLQAELEAAMQELATARADQRT
FT                   LEKSEGAADAAGEMNNAAAEIGALVEQWLRTRTAGMLLNRAIERYRRENEHPLISRASA
FT                   IFAAVAGTGDDPIVRLSVDYADEAHPVPIAHRRDGRRVPVTGLSEGTRDQLYLALRIAS
FT                   VERHIENREPLPFIADDLFITSDEERTAPGIRALAELGRRTQVILFTHHRYVVEAARDA
FT                   VPARQLRVHALAPLLQPA"
FT   gene            complement(480422..481666)
FT                   /locus_tag="RC1_0450"
FT   CDS_pept        complement(480422..481666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0450"
FT                   /product="exonuclease, putative"
FT                   /note="identified by match to protein family HMM PF00696
FT                   match to protein family HMM PF01472 match to protein family
FT                   HMM TIGR01027"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97889"
FT                   /db_xref="GOA:B6IR03"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR014576"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR03"
FT                   /protein_id="ACI97889.1"
FT                   /translation="MLRFIHAADIHLDSPLAGLCLRAEHRADDFVKAPRRAFERLIDHA
FT                   LRERVDLFLIAGDLFDGDWRDFSTGLFFVSQMARLHGAGIPVGIIKGNHDAVSVVTRTL
FT                   NLPPNVHLFGSARPETWEPPGLGVAVHGQSFPNRAVPENIALDYPAPRPGLLNIGLLHT
FT                   SLDGRPGHAAYAPCALRDLTARGYDYWALGHVHGREVVSQSPWVVYPGNLQGRHANETG
FT                   AKGFTLVTAEGQTIRSAEAVTADVVRWARVTADLTGCDTFDDACGRIGRGLVTELEAAD
FT                   GRALAVRLTLSGRTAAHRRIAGDLERTRAECAALAERAGDVWIERVVVETAEPGRDGPP
FT                   SADAFAELLRTVEAIKADPLEMAELRQDLEQALAKVPAPARRLVGLEDLDEARLASVLD
FT                   GAAATLLHHLLDGSR"
FT   gene            complement(481780..482499)
FT                   /gene="mobA"
FT                   /locus_tag="RC1_0451"
FT   CDS_pept        complement(481780..482499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mobA"
FT                   /locus_tag="RC1_0451"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein A"
FT                   /note="identified by match to protein family HMM PF01018
FT                   match to protein family HMM PF01926 match to protein family
FT                   HMM TIGR00231 match to protein family HMM TIGR02729"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97890"
FT                   /db_xref="GOA:B6IR04"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR04"
FT                   /protein_id="ACI97890.1"
FT                   /translation="MRTVGVILAGGRARRLGGGDKGLVAVGGTPMLERIVARFGSQVDR
FT                   LVLSANGDPGRFRSRPPLTGLPVLPDAGADGAPAAGDEDGAGPLAGILAALDWIAAQGL
FT                   DATHLVSVPTDCPFLPADLVARLAAASAGAQASGAVAPRIVAVARSCPDGSGWIPPRLH
FT                   PVVARWPVTLRSDLRRALYREGVRSVGAFLARCPVIPVDFAPLDVGPGGGIDPFFNVNT
FT                   PDDLAAADRLAHAPDAG"
FT   gene            complement(482511..483095)
FT                   /locus_tag="RC1_0452"
FT   CDS_pept        complement(482511..483095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0452"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97891"
FT                   /db_xref="InterPro:IPR025419"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR05"
FT                   /protein_id="ACI97891.1"
FT                   /translation="MTGWRERRAPALLLAAALAAAPVLTAAAGQARPEAPAAAAGFDAT
FT                   HLQQAYQRGLGELAQVELALSRTVRPEVRALAEAAGDRLAGLNGDLAVVARRLAVALPT
FT                   APLPEDRAVQDRLATLEDPAFQDGFLRDRAQGLMRQVNTLEKLAAQASDPALRAAAAQA
FT                   LPGLDALRRQALDLRVALAPVGDGPVGAAPP"
FT   gene            483131..483256
FT                   /locus_tag="RC1_0453"
FT   CDS_pept        483131..483256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0453"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97892"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR06"
FT                   /protein_id="ACI97892.1"
FT                   /translation="MIVHPLPQNTASRATARPPAPHGGDKFRSVGMRGTRCAGPG"
FT   gene            483336..483542
FT                   /gene="napE"
FT                   /locus_tag="RC1_0454"
FT   CDS_pept        483336..483542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napE"
FT                   /locus_tag="RC1_0454"
FT                   /product="periplasmic reductase, NapE"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97893"
FT                   /db_xref="GOA:B6IR07"
FT                   /db_xref="InterPro:IPR004448"
FT                   /db_xref="InterPro:IPR010649"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR07"
FT                   /protein_id="ACI97893.1"
FT                   /translation="MSQAPAPPAPDSADPVGDAHDRRRVELVAFFFLAFVIWPFLAVAV
FT                   VGGYGFLVWMYQLVMGPPGPSQV"
FT   gene            483553..484083
FT                   /gene="napF"
FT                   /locus_tag="RC1_0455"
FT   CDS_pept        483553..484083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napF"
FT                   /locus_tag="RC1_0455"
FT                   /product="ferredoxin-type protein Na PF"
FT                   /note="contain iron-sulphur centres similar to those of
FT                   bacterial-type 4FE-4S ferredoxins identified by match to
FT                   protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97894"
FT                   /db_xref="GOA:B6IR08"
FT                   /db_xref="InterPro:IPR004496"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR08"
FT                   /protein_id="ACI97894.1"
FT                   /translation="MPGIDLARRRFLRGGRSVPDPVRPPWSVDRAFTDLCTRCGACVAA
FT                   CGPGPLTTGDGGFPAMDFGRGECSFCAACADACPEPLFLPRTLPPWRLRAEIGPGCLAA
FT                   GGTYCRSCGDACPAGAIRFAVRLGGRADAEVASDACTGCGACVSACPAGVVTVTAAEPL
FT                   TGGALSGEAVHGT"
FT   gene            484073..484360
FT                   /gene="napD"
FT                   /locus_tag="RC1_0456"
FT   CDS_pept        484073..484360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napD"
FT                   /locus_tag="RC1_0456"
FT                   /product="NapD protein"
FT                   /note="identified by match to protein family HMM TIGR02665"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97895"
FT                   /db_xref="GOA:B6IR09"
FT                   /db_xref="InterPro:IPR005623"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR09"
FT                   /protein_id="ACI97895.1"
FT                   /translation="MGPEDIGELHIASLLVQRDPGQAGMVRDGLAGVPGAELQIEEGAK
FT                   AIVTVEGASAGDIAEALTRIQLLPGVMSAVMVFHHQEAGEPDGGAERGVP"
FT   gene            484357..486882
FT                   /gene="napA"
FT                   /locus_tag="RC1_0457"
FT   CDS_pept        484357..486882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napA"
FT                   /locus_tag="RC1_0457"
FT                   /product="periplasmic nitrate reductase, large subunit"
FT                   /EC_number="1.7.99.4"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97896"
FT                   /db_xref="GOA:B6IR10"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010051"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR041957"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR10"
FT                   /protein_id="ACI97896.1"
FT                   /translation="MTAMQTIPTGLSRRDFIKAQAVATAAVAAGISLPASAQAPLAVGE
FT                   AAQLRWSKAPCRFCGTGCGVMVGVKDDRVVATHGDMQAEVNRGLNCVKGYFLSKIMYGA
FT                   DRLTTPLLRMRDGRYAKDGEFMPVTWDRAFDEMARQWKRVLKEKGPKAVGMFGSGQATI
FT                   WEGYAQSKLMRAGFRSNNLDPNARHCMASAAVGFIRTFGMDEPMGCYDDIEQTDAFVLW
FT                   GSNMAEMHPILWTRVTDRRLSAPHVKVAVLSTFEHRTFDLADVPMVFHPGTDLAILNWI
FT                   ANHIISTGRINKDFVTRHTTFHEGTTDIGYGLRPEHELEMRATHAREAADAKPCDLARY
FT                   TELVRPYTLEHTARLTGVPEERLLALAELYADPKTKVVSFWTMGFNQHVRGVWCNHLVT
FT                   NIHLLTGKISEPGNGPFSLTGQPSACGTAREVGVFAHRLPADMVVTNADHRRRAEEIWK
FT                   VPTGLLSGEPGYHAVLQDRMLKDGRLNAYWVMCNNNLQAAPNTAQETWPGYRNPDNFIV
FT                   VTDAYPTVTAMAADLVLPAAMWVEKEGAYGNAERRTHFWHQLVPAPGESRSDLWQLMEF
FT                   SRRFTTDEAWPEEILAANPAYRGRTLYDVLFANGETNRYPLSDIEAGYANHESEHFGFY
FT                   VQKGLFEEYAAFGRHHGHDLAPFDTYHEERGLRWPVVDGKETRWRYREGLDPYVPAGEG
FT                   VRFYGMSDGKAKIISYPYEAPAESPDTEFDLWLVTGRVLEHWHSGSMTMRVPELYKAFP
FT                   MAVVFMHPDDARARGLRRGSEVEVASRRGMIRTRVETRGRNRPPRGVVFVPWFDSARLI
FT                   NKVTLDATDPISKQTDFKKCAVKVVPVQA"
FT   gene            486897..487403
FT                   /gene="napB"
FT                   /locus_tag="RC1_0458"
FT   CDS_pept        486897..487403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napB"
FT                   /locus_tag="RC1_0458"
FT                   /product="Diheme cytochrome c napB"
FT                   /EC_number="1.7.99.4"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97897"
FT                   /db_xref="GOA:B6IR11"
FT                   /db_xref="InterPro:IPR005591"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR11"
FT                   /protein_id="ACI97897.1"
FT                   /translation="MRAAVRMALLSGGLVVACAAVAVQGRAAQEGTGRAGTDTPFRPPV
FT                   GFTDEAAAPPLAKEITDDRRRARNYPEQPPVIPHNIVGYQVNLQLNQCLTCHSRQYTEQ
FT                   VQAPMVSISHYQTREGQTLGAVAPRRYFCTQCHVPQTDARPVVENRFRPFDALVEPTPD
FT                   SGSGR"
FT   gene            487400..488071
FT                   /gene="napC"
FT                   /locus_tag="RC1_0459"
FT   CDS_pept        487400..488071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napC"
FT                   /locus_tag="RC1_0459"
FT                   /product="membrane-anchored tetraheme c-type cytochrome,
FT                   NapC"
FT                   /EC_number="1.7.99.4"
FT                   /note="identified by match to protein family HMM PF06796
FT                   match to protein family HMM TIGR02973"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97898"
FT                   /db_xref="GOA:B6IR12"
FT                   /db_xref="InterPro:IPR005126"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR011885"
FT                   /db_xref="InterPro:IPR024717"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR038266"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR12"
FT                   /protein_id="ACI97898.1"
FT                   /translation="MRLPGFLLRPWLRSWQVFSRPATRLSLGFLTLGGFLAGVLFWGGF
FT                   NTALELTNREAFCVGCHEMRDNVFEELKTTIHFSNRSGVRASCPDCHVPHEWTDKIARK
FT                   MQASKEVWGTIFGSIDTRDKFVAKRRELAEHEWARLKANDSLECRNCHSAASMDITRQG
FT                   ARAARVHEAFLFTGQRTCIDCHKGIAHRLPDMHGVPPGWSETVAGGPAADGPWPAPAAI
FT                   R"
FT   gene            complement(488117..488845)
FT                   /locus_tag="RC1_0460"
FT   CDS_pept        complement(488117..488845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0460"
FT                   /product="RNA pseudouridine synthase, putative"
FT                   /note="identified by match to protein family HMM PF00037
FT                   match to protein family HMM TIGR00402"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97899"
FT                   /db_xref="GOA:B6IR13"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR13"
FT                   /protein_id="ACI97899.1"
FT                   /translation="MPYTAGEIRARVLHRDADVLILDKPHGLPVHYGTKTVEHLEQYLP
FT                   WIAFEREEPPRLAHRLDKDTSGCLVLARDAEVAARLGRLFLHGHVGKTYWAVVLGRPRG
FT                   DAGRIDLPLLKVHIPGCSKVVVDPDGKPALTDWRLLATDGRLSWLELTPRTGRMHQLRA
FT                   HCACSGFPILGDPIYGAEQPPPVPLHLHARTVSFHLGPADGPPVAATAPPPRHMAATLA
FT                   RIAGEAAPLAGCYEGERAFS"
FT   gene            489002..491460
FT                   /pseudo
FT                   /gene="copA"
FT                   /locus_tag="RC1_0461"
FT   CDS_pept        489002..491460
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="copA"
FT                   /locus_tag="RC1_0461"
FT                   /note="copper-transporting P-type ATPase;identified by
FT                   match to protein family HMM PF03927"
FT   gene            492047..495286
FT                   /locus_tag="RC1_0463"
FT   CDS_pept        492047..495286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0463"
FT                   /product="tonB-dependent outer membrane receptor, putative"
FT                   /note="identified by match to protein family HMM PF03892"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97900"
FT                   /db_xref="GOA:B6IR14"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR14"
FT                   /protein_id="ACI97900.1"
FT                   /translation="MTMQTKRAAAALRRHLNVLKLGTGAMALAVASAWVVPAVAQETTS
FT                   SIRGQIFTAEGEPAAGVNVEIIHTPSGTRSSAAVNSQGSFLATGLRIGGPYTIRFTGSG
FT                   IQTQQVENVFITLGEPFSLDLVLQSGQQQSVEEIVVTGQRTTALVIGSGTQFDRRAIEN
FT                   TPTATRDLKDVIKRDPKVSLDPTNGNAITIAGANNRFNSLTVDGVKQNDDFGLNANGYP
FT                   TQRVPISLDAIDQLSVLTAPYDVEYSGFTGGTVNIVTKSGTNEFTGSLFYYYSDDNLSG
FT                   DRSKDNKNIISPYKDKTYGGSIGGPLIEDKLFFFVNYEKYSGDSSISYGPEGSGAGQTV
FT                   RGITQAEYEQVAEIARRVYGYDAMGLGEPQPESDEKILAKVDWNLTDDHRISAAYQRDE
FT                   GNNYVTSSNNTRLGYDSYSYDRSQKMESYSLQVFSDWTTDFSTEAKVGYKKVDSLRPTT
FT                   SPLNFSSIIIRDPGGSQFVLGTESSSQSNVLETETLSYKLKGTYLLGDHKVEAGWERDD
FT                   YDYYNLFVQRSLGEFEFNTIADFEARRASRFRYNSAAGTNNPLDAAADWGYKVDSLFVQ
FT                   DEWNITPDFTLTAGLRYEYYSSDDKPRLNTNFVSRYGFGNDENLDGRDLWLPRAGFNWK
FT                   VQESTTLRGGVGLFSALGPTVWMSNNYSNDGITQVGVDIRRANTTPANSILNNVDPNSS
FT                   AVVPAAGQLLASGSDSFVNALDPDFKIPSTWRASFAVDQVFDLGPLGSDYVVTAEAIYS
FT                   RVKEAISYTDLRLVKVGTAPDGRPIYQSRADGRPSIGTNSDLMVTNTDEGEGVVLTLGL
FT                   AKTWETDYGDFDLGAGYAYQNIDEVHALTSSVASSNYENVAVSDPNDPGSDTSDYEVKH
FT                   RFTTSVSWSKAFFGDFETTLSLFHESREGRPYSYAFRCGSSGGNANPFGDPACTNNNRS
FT                   RQLFYVPSGANDPLVTYAPGFSYDQLLPYLEENGLTKYAGRIAPRNGFTSPWVHTFDLH
FT                   IAQEIPGLLEGHRGVFTFDIRNLGNMLNKDWGRLEQVSFSAGRTVDVLEARIVDGKYVY
FT                   APGSAGLKDPNSQVSARSSVWSILVGVRYEF"
FT   gene            complement(495387..496058)
FT                   /locus_tag="RC1_0464"
FT   CDS_pept        complement(495387..496058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0464"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97901"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR15"
FT                   /protein_id="ACI97901.1"
FT                   /translation="MRTVPPGPDDTFASHVPAWKIPGLRARLTAAEHEGRLGEPCGHEH
FT                   RALVRRWARGYALHSRQQAEKERQGKAGRAPGGWKAGAERGPGTGRRRIATGARLKAIE
FT                   AATAASFAPRDWLTAELLPGDIVRAYEATQDPLRAMGSVRPSYRRYLQWLHWRRSLGPV
FT                   ADLRVEAGPVLRHHPELREFGLAHQGAGLYRGTVEGELVPTLRVFCARHRIPLRVLPGA
FT                   G"
FT   gene            complement(496055..496570)
FT                   /locus_tag="RC1_0465"
FT   CDS_pept        complement(496055..496570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0465"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97902"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR16"
FT                   /protein_id="ACI97902.1"
FT                   /translation="MDWDRRSGRGAGRWPDGATALLALALALPLTVVPLPARAELEDDL
FT                   VRLDLLVLDVENAHTTRRIELAEGATARVPLDGRAITALAGFALDLRRSGGRLEVRLLS
FT                   RERRPLLRLADRMPAGDRLAIPVRPGERVAALRLAPWVDVAAAAGLPCLLLSRAAERTG
FT                   LDRSGAGP"
FT   gene            496709..497188
FT                   /locus_tag="RC1_0466"
FT   CDS_pept        496709..497188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0466"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF00122
FT                   match to protein family HMM PF00403 match to protein family
FT                   HMM PF00702 match to protein family HMM TIGR01494 match to
FT                   protein family HMM TIGR01511 match to protein family HMM
FT                   TIGR01525"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97903"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR17"
FT                   /protein_id="ACI97903.1"
FT                   /translation="MSACPCGSGRPLDACCGPHLSGAALPPTAEALMRSRYAAYATGAV
FT                   DYLEQTLLPETRGDFDREQTANWSGTSEWTGLEVRATEKGGAGDEEGWVEFVARFRTDG
FT                   KDYVHHETSRFVRRDGRWFYADGIIGTKPRSAPKVGRNDPCPCGSGRKFKKCCGA"
FT   gene            complement(497270..499474)
FT                   /locus_tag="RC1_0467"
FT   CDS_pept        complement(497270..499474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0467"
FT                   /product="NAD-binding flavodoxin, putative"
FT                   /note="identified by match to protein family HMM TIGR01494"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97904"
FT                   /db_xref="GOA:B6IR18"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR18"
FT                   /protein_id="ACI97904.1"
FT                   /translation="MSAHDLKSILLIAHRWVALILTPLFVLIILSGAVLAVKPILEAVP
FT                   RDAAAPAPVDTAALVGLLDRVDPGGAARMAVIGGDGHTLVLAKPGGVRDTYDLATGAAV
FT                   SAPQQGADFFGLVKRFHEDLLLEAGLLVEIATWAMTLLIIIGPVLAWPRLNRTLAGWHR
FT                   GIGWVLFPLVLLTPLTAVLMILHIGGPARPQLPPSAAPASIARALEQAAPAADLSGLVW
FT                   ARWMGNGVMLLTGTPDGRVAYLVGGGAVAPMEGGPGLIHELHEGTWAGGWSGLVNLLAS
FT                   VALLGLTVTGVLPWVRRWRQARRRSGGADADILVAFASQTGRAARLAEATAAALAAGGG
FT                   KVSCAALAALAPEELKHFRQVLLVVSTTGEGEIPDQGRAFLQRLRGTDLKGVPFALLAL
FT                   GDSRYPDYCAGGIAVRDALLAAGAVEAVGMACVDGEAMGPWRDWLAAVGTRIGVDTGSV
FT                   AAPEADRPLSLTLVSRRQLNDPADPDTHEAWSLLFQGDGPLDYRSGDLLMVSPGPGEPP
FT                   RPYSVSAAPGQGPEHLLLTVGLTWRREADGSESLGKASGLLCRGLRPGDRLDATLRRHP
FT                   AFNPPSPEADHPMILLCAGCGIAPFIGFLAEREETGARQPVWLVFGNRKRKADFFYGDL
FT                   LEGWMRRGVLARLDTAFSREPEGGYAPDRLIEAGAEFLEWMDEKGAVLYACGRASTLGA
FT                   GLDRALHTILARHRGMDADAATRQIARWDAEGRLRRDLFD"
FT   gene            499463..499600
FT                   /locus_tag="RC1_0468"
FT   CDS_pept        499463..499600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0468"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97905"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR19"
FT                   /protein_id="ACI97905.1"
FT                   /translation="MSGHRPPPLQARCRGGIRRRRGAVLVTAVSVMQERLPGAGDPAPG
FT                   "
FT   gene            complement(499622..500173)
FT                   /locus_tag="RC1_0469"
FT   CDS_pept        complement(499622..500173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0469"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97906"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR20"
FT                   /protein_id="ACI97906.1"
FT                   /translation="MRVLTASFLALSLSLPAASVAMAQSQPPASPPVAEADDTPLYGSQ
FT                   LMTPQERMDLRSRMRQARSMEEREQIRQEHHARMQARAKEQGVTLPDEPPAMPARGMGQ
FT                   GRGMGPGQGMAPGQGMGPGQGMGQGRGMGQGMGPGQGMGPGQGMGPGQGMGPGMRGQAP
FT                   AAQPPASPPPAAQTDRTGGQ"
FT   gene            complement(500311..500772)
FT                   /locus_tag="RC1_0470"
FT   CDS_pept        complement(500311..500772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0470"
FT                   /product="DHC, diheme Cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97907"
FT                   /db_xref="InterPro:IPR018588"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR21"
FT                   /protein_id="ACI97907.1"
FT                   /translation="MSLRHAFAAAALIAAAAPLFASPSLADRGGHDRDGAARPVTHAAT
FT                   LKECGQCHMAFPAALLPAAGWDRLMDTLPRHFGEDASLPAEVAADIRAYLTANAARRGD
FT                   TDTIRITEQRWWLREHDFRPQIWERPHIRSKANCEACHDRAGQGVFEDE"
FT   gene            complement(500840..501304)
FT                   /locus_tag="RC1_0471"
FT   CDS_pept        complement(500840..501304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0471"
FT                   /product="mono-heme class I cytochrome c"
FT                   /note="identified by match to protein family HMM PF02810"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97908"
FT                   /db_xref="GOA:B6IR22"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR015170"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR22"
FT                   /protein_id="ACI97908.1"
FT                   /translation="MTNDAFPSAASVRSRRLRPLVAAAFLLVAGPALAAGDDAASRDAL
FT                   LASYAAQAKAQDPAFTGFSAERGRAVYLGQVAGAEADGCAACHTADPRATGQHRKTGRA
FT                   IKPVAVSVSPWRFTDADYVEKHFRRDCPGVLGRECSAQEKGDYITFLASQ"
FT   gene            complement(501479..502042)
FT                   /locus_tag="RC1_0472"
FT   CDS_pept        complement(501479..502042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0472"
FT                   /product="cytochrome b561 family protein"
FT                   /note="identified by match to protein family HMM PF00175
FT                   match to protein family HMM PF00258"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97909"
FT                   /db_xref="GOA:B6IR23"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR23"
FT                   /protein_id="ACI97909.1"
FT                   /translation="MSEAITPDAAEPPPASVRVWDPLVRVSHWTLALAVAVAWISSGDA
FT                   STAHLAAGFTVLTIVAVRSFWGLAGSPHARFDDFVPTPAGFLAYCRDLIGGHARRYIGH
FT                   TPAGGAMIVALLACLLLTTATGVGLQYGVPGDFIREHDLEEIHEAAATGILVLVGLHVA
FT                   GVLLTGLMHRENLVRAMLTGRKHA"
FT   gene            complement(502072..502419)
FT                   /locus_tag="RC1_0473"
FT   CDS_pept        complement(502072..502419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0473"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97910"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR24"
FT                   /protein_id="ACI97910.1"
FT                   /translation="MIYAKLTAATLLAGSVLVGGYAVAKEILQDTGPATTTASPAVSSQ
FT                   APAPMPIPQLIDLLAKQGYTDVSEVERKTGAIYEIKARDANGNRRELYVDARTGDILKE
FT                   ERSGKDGWGHR"
FT   gene            502541..502918
FT                   /locus_tag="RC1_0474"
FT   CDS_pept        502541..502918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0474"
FT                   /product="Peptidase propeptide and YPEB domain protein,
FT                   putative"
FT                   /note="Also called Propeptide, PepSY amd peptidase M4"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97911"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR25"
FT                   /protein_id="ACI97911.1"
FT                   /translation="MQKKTILALTGLALGGFLLTAAPLPLRADDDHRRDHDRAREAVLR
FT                   GEVLPLRDILERAEAEFPGRLLEAELEDDHGRLTYEVKLLTEDGRVLELVYDARDGTLL
FT                   GVEGRDLERRRGHRGWREQDR"
FT   gene            502915..503574
FT                   /locus_tag="RC1_0475"
FT   CDS_pept        502915..503574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0475"
FT                   /product="two component response transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97912"
FT                   /db_xref="GOA:B6IR26"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR26"
FT                   /protein_id="ACI97912.1"
FT                   /translation="MRVLVAEDDEALRRQLRDALAASGYAVDEAPDGEEAAFLGETEPY
FT                   DAVVLDLGLPVRDGLSALRGWRQQGIVTPVLILTARGTWQEKVEGIDAGADDYLAKPFR
FT                   MEELLARLRALIRRAGGHAAADLRCGPVLLDTRTGRVSVDGRLVSLTAHELKVLDYLMH
FT                   HQGRVVSRTELTEHVYAQDFDRDSNTIEVFVGRLRRKLGVDVIRTERGLGYRMDAG"
FT   gene            503574..504941
FT                   /locus_tag="RC1_0476"
FT   CDS_pept        503574..504941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0476"
FT                   /product="sensor histidine kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97913"
FT                   /db_xref="GOA:B6IR27"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR27"
FT                   /protein_id="ACI97913.1"
FT                   /translation="MASGSLNGRLLALAAVWVTAALVIAGIFLTDLFRRHAEADLARRM
FT                   GHQLDELAAALEIGADGRLAVTRDPGDPRFHRPLSGLYWEVMVGDAEVLRSRSLWDQTL
FT                   ALPVDRPASGELHRHELTGPAGERLVAWERTLELSGIDLPVRVAVIADAADIQAATADF
FT                   SQVLALSLAILAAGLMAAALVQVRLGLVPLRRMRAALAQLRAGTATRLEGRFPDEVQPL
FT                   ADDLNQLLTENAAMVERARAEAADLAHALKTPLAVIANAVSGGGEDAAGVVAREADRMQ
FT                   RQIERHLARARAAAAGRTLGSAGSPALATLRPLAAAVQRLHADRGIRIDLSGDPAIRIR
FT                   GDAQDVQEMAGNLIDNAAKWGRSLVRVGVTRIGTVAVVTVEDDGPGIPPGRRAVLPERG
FT                   RRLDETVPGTGLGLAISDELARLHGGTLRLDDSPLGGLRVTLELPAVPPRVPGNAP"
FT   gene            505183..506865
FT                   /locus_tag="RC1_0477"
FT   CDS_pept        505183..506865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0477"
FT                   /product="methyl-accepting chemotaxis protein, putative"
FT                   /note="Also called methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97914"
FT                   /db_xref="GOA:B6IR28"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR28"
FT                   /protein_id="ACI97914.1"
FT                   /translation="MPRLVDVSIRIRIFAAFGLVLFVTLALGGFGLVQLSRIDDAADVV
FT                   VGNSLPSVSESNAILKGVLNYRRHQAAMMLNDDPQVRAERRQRLVEMSADLAARRKAYE
FT                   ALITTDRDAFERFDRAWARFLPLAAEIDSLMEAGKRDEYLAIYNGPARQALEEALVALE
FT                   EAVGINERDGKDGGDAIIAARESATFGTIVALLAAAGLSIGAGLLTVTTVAGPVNRLTD
FT                   TMNRLSRRELTAAVDGTDRKDEIGAMARAVQVFKDGLIEAERLTAAQKAEEKAKAARTA
FT                   RIDSLIRSFDGTSSESLRAVAAAATELDATAQSMAAIADETGRQASSAASAAEETTANV
FT                   QTVASAAEEMAASIQEINRQVNRAKGVAQRAAESVQETNVTVEGLTAATQKIGEVVSLI
FT                   QAIAAQTNLLALNATIEAARAGEAGKGFAVVASEVKNLAGQTAKATEEIAAQISAVQKV
FT                   SAETSTAIQSIGTIIEEVNGISATIAAAMEQQGASTNEISRNVTQAAAGTQEVSANIGQ
FT                   VTQVTGQAGAAATQVLGAAGELARQSETLKQEVERFLAAIKAA"
FT   gene            complement(506954..508165)
FT                   /gene="nifS"
FT                   /locus_tag="RC1_0478"
FT   CDS_pept        complement(506954..508165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifS"
FT                   /locus_tag="RC1_0478"
FT                   /product="cysteine desulfurase"
FT                   /EC_number="2.8.1.7"
FT                   /note="[synonyms] Nitrogenase metalloclusters biosynthesis
FT                   protein nifS"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97915"
FT                   /db_xref="GOA:B6IR29"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR017772"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR29"
FT                   /protein_id="ACI97915.1"
FT                   /translation="MDTPVYLDNNATTRTDPRVLEAMLPCFTELFGNPSSMHRFGEAVG
FT                   AAIRTARGQVQALVGAAHDHEILFLSGATEANSTAIHSALRAQPERRAVVTSAVEHHAV
FT                   LGVLEHLEKTDGIEVRIMPVDRHGRLDLEAYRRALRPDVALVSLMWANNETGVVNPVPE
FT                   LAELAKEVGATFHTDAVQAVGKLPVSVAGTGIDMLSLSAHKLHGPKGIGALYVRKGTRF
FT                   RPLLRGGGQERGRRAGTENVPGIVGLGMAAELAARSVAEDADRIRTLRDRLEHGILGAV
FT                   GHCFAVGGEAERVPNTSTIAFEFIEGEAILLLLDKAGIAASSGSACTSGSLEPSHVLRA
FT                   MDVPFTAAHGAIRFSLSRETTEAEVDRVIAAVPPIVARLRAFSPFWDAGRATGQAGNFA
FT                   PVYS"
FT   gene            complement(508183..509163)
FT                   /gene="nifU"
FT                   /locus_tag="RC1_0479"
FT   CDS_pept        complement(508183..509163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifU"
FT                   /locus_tag="RC1_0479"
FT                   /product="Fe-S cluster assembly protein NifU"
FT                   /note="identified by match to protein family HMM PF03413"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97916"
FT                   /db_xref="GOA:B6IR30"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR010238"
FT                   /db_xref="InterPro:IPR016217"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR30"
FT                   /protein_id="ACI97916.1"
FT                   /translation="MWDYTDKVKAYFFEPKNAGVLADANAVGEVGSLTCGDALKLMLKV
FT                   DPATEVIQDARFQTFGCGSAIASSSALTELVIGRTLDDAARLTNQDIAAFLGGLPAQKM
FT                   HCSVMGAEALHAAIAHYRGVAIDDDHDEGALICKCFAVDEPMLRRAVRTNRLTSMEQVT
FT                   FYTKAGGSCGACNERMEEVLAAVNAEMVAEGLLGAAEAFAGAPARPALKPAGALVSLSP
FT                   PVKAVPTAPPAKPAPPALAPAPVTPGPKLTLVQRIRLIEEAIAEARPTFLADGGDCELV
FT                   DVDGRHVHVRLTGACAGCRMARMTVDGLAARVTEKLGAPVIVIPV"
FT   gene            complement(509269..509592)
FT                   /locus_tag="RC1_0480"
FT   CDS_pept        complement(509269..509592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0480"
FT                   /product="Iron-sulfur cluster assembly accessory protein"
FT                   /note="[contains] HesB-like domain identified by match to
FT                   protein family HMM PF00072 match to protein family HMM
FT                   PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97917"
FT                   /db_xref="GOA:B6IR31"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR31"
FT                   /protein_id="ACI97917.1"
FT                   /translation="MVALTDSAVQAARTAVEAAAGQAAGLRIMVRPAGCAGLQFGLQLE
FT                   EGPGDADAVIRFEGLDVYVDQDSVPLLDAVTVDFVERLEGAGFVFENAAPGGGCTCSTR
FT                   SCH"
FT   gene            509867..510448
FT                   /gene="nifQ"
FT                   /locus_tag="RC1_0481"
FT   CDS_pept        509867..510448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifQ"
FT                   /locus_tag="RC1_0481"
FT                   /product="nitrogen fixation protein NifQ"
FT                   /note="identified by match to protein family HMM PF00512
FT                   match to protein family HMM PF00672 match to protein family
FT                   HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97918"
FT                   /db_xref="GOA:B6IR32"
FT                   /db_xref="InterPro:IPR006975"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR32"
FT                   /protein_id="ACI97918.1"
FT                   /translation="MPPPYGPDLSPCGADSLDTYLFGRILALAATAPARPLTAATGLTR
FT                   AALERLLRRHLPDRLALLDAVPPDAGTGEDAPEEPDLRQLLLEHGATGAEEEVWLAAIV
FT                   ARRSLEPNHLWQDLGLASRADLNALFRRHFPALVRRNAGDMKWKKFFYRELCRREGMLI
FT                   CKSPNCEVCTDVHACFGQEDGPALLTGLWR"
FT   gene            complement(510478..510771)
FT                   /gene="fdxB"
FT                   /locus_tag="RC1_0482"
FT   CDS_pept        complement(510478..510771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdxB"
FT                   /locus_tag="RC1_0482"
FT                   /product="Ferredoxin III"
FT                   /note="[Synonyms] ferredoxin 2[4Fe-4S] III identified by
FT                   match to protein family HMM PF00015 match to protein family
FT                   HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97919"
FT                   /db_xref="GOA:B6IR33"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR014283"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR33"
FT                   /protein_id="ACI97919.1"
FT                   /translation="MAVFLTRGGAPWTPAYLLSIDQTKCIGCGRCFKVCSRAVMSLKGV
FT                   TEDDELVDADPDGDDDEEFLRKVMVVADAGNCIGCGACARVCPKGCQKHGEA"
FT   gene            complement(510834..511553)
FT                   /locus_tag="RC1_0483"
FT   CDS_pept        complement(510834..511553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0483"
FT                   /product="transposase and inactivated derivative"
FT                   /note="identified by match to protein family HMM PF00266
FT                   match to protein family HMM PF01212"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97920"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR34"
FT                   /protein_id="ACI97920.1"
FT                   /translation="MRGDRRTLRQDAASGQPVAHRPPAQPVEAEDAAPPSAVRRQDPGR
FT                   LPKKGLREALKAAGAAHPERRLQLWFQDEARIGQKGRTAHRWWERGQRPLGLCDKRFTS
FT                   AWLYAAVCPASGADFALVMPTVSTAVMSLFLDGFSRSLEPDVQAVLVLDQAGWHGARAL
FT                   VVPDNITLVPLPPYSPELNPVERVWLYLRERFLSHQILDDYDAVVQACCDAWNALTATP
FT                   ERLRSLTSYPWLPCVNA"
FT   gene            complement(511388..511900)
FT                   /locus_tag="RC1_0484"
FT   CDS_pept        complement(511388..511900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0484"
FT                   /product="transposase, putative"
FT                   /note="identified by match to protein family HMM PF01106
FT                   match to protein family HMM PF01592 match to protein family
FT                   HMM PF04324 match to protein family HMM TIGR02000"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97921"
FT                   /db_xref="GOA:B6IR35"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR35"
FT                   /protein_id="ACI97921.1"
FT                   /translation="MPAALPIREDLSASELRALARRESKGRVAARMFAIAHALEGVSRA
FT                   EAARLAGMDRQALRDAVVRYNAEGVAGLYDRPLPGRPEWLSEGEQATLKAIILAGPDPK
FT                   RHGCVEWTLPILCEVIAERFAKTLHPASLSRIVRRLNLSKQKTRPRHPQSDAKTQAAFQ
FT                   KRGCAKP"
FT   gene            complement(511991..513025)
FT                   /locus_tag="RC1_0485"
FT   CDS_pept        complement(511991..513025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0485"
FT                   /product="conserved hypothetical protein"
FT                   /note="[contains] Appr-1-p processing enzyme family domain
FT                   identified by match to protein family HMM PF01521 match to
FT                   protein family HMM TIGR00049"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97922"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR36"
FT                   /protein_id="ACI97922.1"
FT                   /translation="MIRYTTGDILRADAEAIVNTVNCVGIMGRGIALQFKNAFPANFKA
FT                   YEAACKRDEVQPGKMFVFDTGTFTNPKYIINFPTKRHWRGKSRMDDIDSGLVALAEEVR
FT                   QRSIRSIAIPPLGSGLGGLNWEDVRPRIEAALRDLPDLDVIVFEPNNAPVTTKSQEVPT
FT                   MSPGRAALVVLMNRYLGGLMDPFVTLLELHKLMYFMQEAGEPLRLKYAKAPYGPYAENL
FT                   RHVLHAVEGHLVSGYADGGDAPDKQLELVPGAVKDAESFLSDKQDTTARLDRVAELVEG
FT                   FETPFGLELLATVHWVTTRENAISAEDAMAKVYAWNERKKRFSPRQIGIALQTLQNKGW
FT                   LASA"
FT   gene            complement(514296..514418)
FT                   /locus_tag="RC1_0486"
FT   CDS_pept        complement(514296..514418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0486"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97923"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR37"
FT                   /protein_id="ACI97923.1"
FT                   /translation="MMSRSRFLEHRREPDRIADPEPDEPPEQQIVVQRLHQTST"
FT   gene            complement(514468..514821)
FT                   /locus_tag="RC1_0487"
FT   CDS_pept        complement(514468..514821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0487"
FT                   /product="Iron-sulfur cluster assembly accessory protein"
FT                   /note="identified by match to protein family HMM PF00037
FT                   match to protein family HMM TIGR02936"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97924"
FT                   /db_xref="GOA:B6IR38"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR38"
FT                   /protein_id="ACI97924.1"
FT                   /translation="MSTTLKERPKALTLTDAAAERVRLLMARSSEPILGLRVGVKARGC
FT                   SGMSYFVEYAKDRKKFEEVVEDKGVTILIDPAATMFLLGSEMDYVEDRFQSGFTFRNPN
FT                   EKARCGCGESFTV"
FT   gene            complement(514850..515242)
FT                   /locus_tag="RC1_0488"
FT   CDS_pept        complement(514850..515242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0488"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97925"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR014291"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR39"
FT                   /protein_id="ACI97925.1"
FT                   /translation="MMMNSMRPIAPGLSMGDPVEIPPEERLPPDAPLHDRVVEALRTVY
FT                   DPEIPVNIYEMGLVYKCEVDADGDVRIEMTLTAPGCPVAEEMPGTVERAVEAVAGVRSV
FT                   SVDIVWEPSWHPGMMSDEARVALDMF"
FT   gene            complement(515261..515743)
FT                   /locus_tag="RC1_0489"
FT   CDS_pept        complement(515261..515743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0489"
FT                   /product="SUF system FeS assembly protein, NifU family"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97926"
FT                   /db_xref="GOA:B6IR40"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR40"
FT                   /protein_id="ACI97926.1"
FT                   /translation="MFDDLRDLYQEVILDHGRHPRNFGRPATFNRTARGDNPMCGDKIT
FT                   IYLTVSDDGVITDAGFDGRGCAISQASASLMTEILKGRPVAEAEALFGRFHDMCTKDED
FT                   QWGTHGPVDEEALDKLQVLSGVREFPMRVKCATLAWHTMHAALQGEGKASSESAGF"
FT   gene            complement(515743..517032)
FT                   /gene="sufS"
FT                   /locus_tag="RC1_0490"
FT   CDS_pept        complement(515743..517032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufS"
FT                   /locus_tag="RC1_0490"
FT                   /product="cysteine desulfurase"
FT                   /EC_number="2.8.1.7"
FT                   /EC_number="4.4.1.16"
FT                   /note="identified by match to protein family HMM PF01661"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97927"
FT                   /db_xref="GOA:B6IR41"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR41"
FT                   /protein_id="ACI97927.1"
FT                   /translation="MTGATAHRTTPAHDHNAPYDVARVREDFPILTRRIHEKPGRPGKP
FT                   LVYLDNAASAQKPRAVIEAMTRFLEEDYANVHRGVHFLSQRATDLYEATRDRLARFLNA
FT                   PSRETIVFTRNATEAFNLVAQSWGRAHLKAGDVVVLSEMEHHANIVPWQLLQAQTGIVL
FT                   KVVPVLDDGSLDLDALEGLLRDPAVRLLAVSHASNVLGTVNPARQIARMAHERGVPVLF
FT                   DGSQAAVHMPVDVQAIDADFYVMTGHKLYGPTGIGALYAKAELLAAMPPWQGGGDMISA
FT                   VSFAGTSFREPPYRFEAGTPPIIEGVGLGAAIDYVTALGMDAILAHEQRLLAHAMDRLS
FT                   GIEGLRVVGTAPGKAAIISFTIDGIHPHDIGTLLDRAGVAVRVGRHCAEPLMDRFGVGA
FT                   TARASFGLYNTEAEAEALADAVRACKEFFG"
FT   gene            complement(517037..518356)
FT                   /gene="sufD"
FT                   /locus_tag="RC1_0491"
FT   CDS_pept        complement(517037..518356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufD"
FT                   /locus_tag="RC1_0491"
FT                   /product="FeS assembly protein SufD"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97928"
FT                   /db_xref="GOA:B6IR42"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR42"
FT                   /protein_id="ACI97928.1"
FT                   /translation="MASETPALQSYVEQFKAHAATLPGAGLPWLDELRAAGLDRFVKTG
FT                   FPTPRQESWKFTSLRPLERQSFGLAPALTAPVPAASIPTVAPDGGSHRMVFLGGRYRPD
FT                   LSDIGGLPPGATLESLGEALVRAPDGVAEHLGRTATLDGHPLLALNLAFLTDGVVLRLA
FT                   RGTVVAKPVELVFLSSDDGLPAAWHPRILVLAEENAEATLVEHHVGLGSATCFSNIVAE
FT                   IVLGAGARLHHYKIQRESLSTIHLATTTAHVGRDATYDTFILNLGAALSRHEGRSVLEG
FT                   TGTTCRISGAYAVRGTQHTDITTLIDHAKPRGTSREVVKGVIDGQARAVFQGKIIVRPD
FT                   AQKTDGYQLNRALLLSDQAEIDSKPELEIYADDVKCSHGATAGELDDAQLFYLRSRGLP
FT                   LERARALLIAAFLDEALEEIPVEAVREHFKAAVHGWLGER"
FT   gene            complement(518370..519128)
FT                   /gene="sufC"
FT                   /locus_tag="RC1_0492"
FT   CDS_pept        complement(518370..519128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufC"
FT                   /locus_tag="RC1_0492"
FT                   /product="FeS assembly ATPase SufC"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97929"
FT                   /db_xref="GOA:B6IR43"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR43"
FT                   /protein_id="ACI97929.1"
FT                   /translation="MPLLEIKNLHATVDGKPILKGIDLTIEPGTVHAIMGPNGSGKSTL
FT                   SYVLAGREGYEVTEGSVLLDGEDLLAKEAEERAAAGVFLAFQYPVEIPGVSNTTFLKEA
FT                   LNALRKAKGEKELDAMQFLKLIRQKAGALNMTDEMIRRAVNVGFSGGEKKRNEVLQMAV
FT                   LEPKLAILDETDSGLDIDALKIVADGVNSLRRPDRSMLVITHYQRLLDYIVPDVVHVLA
FT                   HGRIQKTGGKELALELEQKGYAEFGVNEAA"
FT   gene            complement(519227..520708)
FT                   /gene="sufB"
FT                   /locus_tag="RC1_0493"
FT   CDS_pept        complement(519227..520708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufB"
FT                   /locus_tag="RC1_0493"
FT                   /product="FeS assembly protein SufB"
FT                   /note="identified by match to protein family HMM PF01521
FT                   match to protein family HMM TIGR00049"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97930"
FT                   /db_xref="GOA:B6IR44"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR44"
FT                   /protein_id="ACI97930.1"
FT                   /translation="MAATDQTLEQVRNLTETKYKYGFFTDIESEMAPKGLNEDIVRFIS
FT                   AKKQEPEWLLEWRLKAYRHWLTMTEPDWAMLKYPPIDFQDSYYYAAPKVTEKPKSLDEV
FT                   DPELLRTYEKLGIPLREQEILAGVEGAGDVPAVAVDAVFDSVSVATTFKKKLEEKGIIF
FT                   CSISEAIQTHPELVRQYLGSVVPYSDNFYATLNSAVFTDGSFVYIPKGVRCPMELSTYF
FT                   RINAKNTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELIALDDAQIKYSTV
FT                   QNWYPGDENGKGGIYNFVTKRGACRGRNSKISWTQVETGSAITWKYPSCILQGDNSVGE
FT                   FYSVAITNNMQQADTGTKMIHIGKNTRSTIVSKGISAGRAQNTYRGLVKILPKADGARN
FT                   YTQCDSLLIGDRCGAHTVPYIENRNRSARVEHEATTAKISEDQLFYCRSRGLAEEDAVG
FT                   LIVNGFCKEVLKELPMEFAVEAQKLVAISLEGSVG"
FT   gene            complement(520737..521225)
FT                   /locus_tag="RC1_0494"
FT   CDS_pept        complement(520737..521225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0494"
FT                   /product="rrf2 family protein (putative transcriptional
FT                   regulator)"
FT                   /note="identified by match to protein family HMM PF01883"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97931"
FT                   /db_xref="GOA:B6IR45"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR014290"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR45"
FT                   /protein_id="ACI97931.1"
FT                   /translation="MLRLSKLTDYAVVVLTAMARSDAPVHTAASLAERTGLPVPTVQKL
FT                   LKQLARGGILASQRGAAGGYALLREDTDVTVAEIIEAIDGPIALTDCVDGAEGACGVQS
FT                   LCPRRGSWDKVNEAVRRALDGVSLADMALPSIPDFGIAPALATDPRSEDKVRRAALAG"
FT   gene            complement(521470..522591)
FT                   /locus_tag="RC1_0495"
FT   CDS_pept        complement(521470..522591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0495"
FT                   /product="transposase, is4 family"
FT                   /note="identified by match to protein family HMM PF01592
FT                   match to protein family HMM TIGR01994"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97932"
FT                   /db_xref="GOA:B6IML7"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:B6IML7"
FT                   /protein_id="ACI97932.1"
FT                   /translation="MAGIFRISFQGLPDPRTGNARRHALLDVLTIALTASICGAESCVD
FT                   FATFARDRRALFEEFLELPGGLPSHDTFSRVFRLLDPVAFSRCFQQFLDHLGEDGAGVL
FT                   AIDGKTLRRSFDRAAGRSALHVVSAFASGARMIVGQRAVAAGENEIVAARALLELFDLK
FT                   GVLVTGDALHAQERTAQTILERGGDWLFPLKDNRPALRAEVERYFADPATVLAVPHVTT
FT                   DADHGRIEVRRHWVSHDVAWLASDRRFPDEAVLPGLKILGLVERTVTSPDGRTTATRTL
FT                   YLSSAALEPKTLARAVRAHWSIEAAVHWVLDTSFDEDRARNRKDHGPENLATLRKLALN
FT                   VVRSANNQDSIRLRRKRAGWSDDYARTILGQMR"
FT   gene            complement(522726..523667)
FT                   /locus_tag="RC1_0496"
FT   CDS_pept        complement(522726..523667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0496"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00266
FT                   match to protein family HMM PF01212 match to protein family
FT                   HMM TIGR01979"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97933"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR47"
FT                   /protein_id="ACI97933.1"
FT                   /translation="MSYDYQGGYARSFGDDTGLYGRGGYGEDERGWGGMLQDNTVPLAL
FT                   IGIGVGWMLLSGGGRSAETGRAGYGGSAFGGEGRWAGDRTRGMHDHEGGRIGQAMSSLR
FT                   EGAEHLRERAGDRFEAVRHRAGDAMEHARDRFSGRSGRNIDTGAGYDRIADYDSRDEDL
FT                   YGDDLYGPGSSYASYGAGQGGGSWSDRASGLMHDAGQRAGYATESFWDMVEEHPLAAGL
FT                   LSLALGAAVGATLPSTRTEDEWLGQYRDRLADDLWQRGEGTARDATDVAKHALQAGVDA
FT                   ARETAEREADERGLTGSRSDDPTRSKADAGSR"
FT   gene            complement(523696..524157)
FT                   /locus_tag="RC1_0497"
FT   CDS_pept        complement(523696..524157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0497"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01458
FT                   match to protein family HMM TIGR01981"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97934"
FT                   /db_xref="GOA:B6IR48"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR48"
FT                   /protein_id="ACI97934.1"
FT                   /translation="MSTESAHGGSGAPGPEDRLDGRPEAGRTERPLTALLTDLAQETGD
FT                   LVRKEVELARAELSEKATQATRGAINLTVGGAVCFLGLIFLLLSATLALATVVEPWAAA
FT                   LIVGGAVLLIGGIMVLSGRSKLSADNLQPRRTVETLKEDGRWAKAQIGR"
FT   gene            complement(524154..525275)
FT                   /locus_tag="RC1_0498"
FT   CDS_pept        complement(524154..525275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0498"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00005
FT                   match to protein family HMM TIGR01978"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97935"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR49"
FT                   /protein_id="ACI97935.1"
FT                   /translation="MAMGERTGSTPQGGSQETTDRTRSGQTAAGKGSAGNGSDTKGGAT
FT                   AGGMAHELSERARETGERLTETARAKVRGQYERQQTFAADQISGIATALRQTERQLRDQ
FT                   DQGFPARYVGMAAEQVEDLAEQVSRYGFEDLLSRTETFARRQPEMFIGGAMLAGVALGR
FT                   FLRASGERRRARISGQGTPYAGASYGSGGGWSGSSGQRGAGGRAYTPDRDDDVGSYGAS
FT                   GGMDERTRPLRTRSSRADEYAHYPAADGLRGRNVESPVGATAPMHAGAGGQGAAPGGTG
FT                   PGGLGDTGSSRAGTPGGSGTGTGAGPGGAGGGLGTGLGSAGTTPSGTMTSGSGAAAGGT
FT                   SGKAASGTAGKRESAQDGASSQKPATSQGSSKP"
FT   gene            526174..526806
FT                   /locus_tag="RC1_0499"
FT   CDS_pept        526174..526806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0499"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97936"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR50"
FT                   /protein_id="ACI97936.1"
FT                   /translation="MTHAAGISGTVAIGRTLGAASDVAVGSGPSRSVPGRGADGLLTGA
FT                   VCLLAAAVLLVSCADPGSRPPEPTPVALTVPGPPPAPPARVPTSPVPRPKPPVPVTQLA
FT                   GVPAALPGPSAAPPHLQETSFDPKTLVGMTEQETMRLLGQPSWTEEIPPAKTWRYANDR
FT                   CVLRVFFFMEMTTRDFRTLSYELTSTDDQPNVAQQCFAELVAQAWHP"
FT   gene            526811..527623
FT                   /gene="chvl"
FT                   /locus_tag="RC1_0500"
FT   CDS_pept        526811..527623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chvl"
FT                   /locus_tag="RC1_0500"
FT                   /product="transcriptional regulatory protein ChvI"
FT                   /note="DNA-binding response regulator.Matched to PF00072:
FT                   Response regulator receiver domain and PF00486:
FT                   Transcriptional regulatory protein, C terminal; identified
FT                   by match to protein family HMM PF02082 match to protein
FT                   family HMM TIGR00738 match to protein family HMM TIGR02944"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97937"
FT                   /db_xref="GOA:B6IR51"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR51"
FT                   /protein_id="ACI97937.1"
FT                   /translation="MPAPAPVARVALVDDDDLFRESLGMNLTDEGFEVVPFDRGHTALD
FT                   YFAGGGTADLILLDWRMPRMDGIETLRQLRARNIDIPVIFLTVLSDQIYEETALTGGAV
FT                   DFVEKSRSLPILLKRMQLIIQGRKPGGEEGPGAPSAATDAAGAGGQMFRRGPLELKLEV
FT                   ARAFWAGSRIDLTLTEFNIVKLMSTRAGEDVSYRDLYDLVHGKDFVAGYGPAGYRANVR
FT                   AFIKRIRHKFRAVDAGFDEIENYPGFGYRWSDRHPAEYVGGIGGRDRA"
FT   gene            527620..529167
FT                   /locus_tag="RC1_0501"
FT   CDS_pept        527620..529167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0501"
FT                   /product="sensor histidine kinase, putative"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97938"
FT                   /db_xref="GOA:B6IR52"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR52"
FT                   /protein_id="ACI97938.1"
FT                   /translation="MSRSGRGWRGTGRWLLRSLAGRLVLVSIVFLAVPLLIYEQFRNAD
FT                   AEKQILLLRSAQQQGQLIARAVEPLLAGLDGPSLAGLGQTLTRFSDENTRVRVLLRPNA
FT                   PGGVTGRGFYYVASAPAVPTAMLDLERERLIEQGVLVRLAASCAGDQALAIPVPTEKGG
FT                   VELLTSITPIKTEMGCWAVVTSHAAAAYLGLGMGQPYWRTPEVQAAALVYIAMAALVLV
FT                   LLLEVWRNLRRFGELARDIVMHRGPAGSFSEQNTVPELEPVAEDFDRLVATLHSSAVNL
FT                   RRAAEDNAHAFKTPIAVIRQAVEPLKRLIPPEDVRGRRAIDMIEGSVERLDGLVSFARR
FT                   MDETAADLLEPPRQRVDLSALLERVLLGYRNVLEERGVTLLPRIEGGLVVRAGEELLET
FT                   VIENVVDNALSFSPAGGSLRVACKREGARILLSVDDEGPGVDPANMERIFERYFSQRPV
FT                   APGTALAEPAGALPDGMPHYGIGLWIVRRNVEAVGGRVDAENRPDGGFGIRIRLPAV"
FT   gene            complement(529171..531717)
FT                   /gene="nhaP"
FT                   /locus_tag="RC1_0502"
FT   CDS_pept        complement(529171..531717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaP"
FT                   /locus_tag="RC1_0502"
FT                   /product="Na+/H+ antiporter NhaP, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97939"
FT                   /db_xref="GOA:B6IR53"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR53"
FT                   /protein_id="ACI97939.1"
FT                   /translation="MGTLIPTLLAVAGLLALVSLLPPLARRLRLPYTVLLAAVGVALGV
FT                   SRLWITGGGTAGELGPAGDFLTALSDLELSSSAFLYIFLPVLLFETALSVDVRRLLDDL
FT                   WPVMILAVVAVVLCTIIAGLGMAGAWWVWKGTLGTHAIIVCLTLAAIVATTDPAAVVGI
FT                   FRDLGAPRRLSILVEGESLFNDAAAIALFTLLLGMLTARGPAGSMAEADWAGAALSFLV
FT                   KFFGGIAVGVLMGWLVGIIVTPLRNLPQSEISLTVSLAYLAFIIAERYLEVSGVVAVVT
FT                   AGLVIASEGRTRISPESWEGLRNVWGQLGFWANSLIFLLASMLIPPTLMEAQWGHMLLL
FT                   AALVVCALLARALVIYGMLPGLTAIGAADRISGPYKAVMLWGGLRGAVSLALALAVTEN
FT                   RRVPEPTQEMVAVVATGFVLFTLFVQGTTLRPLIRLVGLNRLSPVEEALRNRAFGLSLS
FT                   RVRQDVETIARDFHINPAPAVAPLLERGAALAQEQIDLDERHGGLSLDDRVYIGLSTLA
FT                   RREEELYLTLFRDGVISRRTVQSLVANAGRLQDGVKAARREGYEGAARKEVKLSRGLRR
FT                   ALWVQRRLGADRYLALKLSERFAQLVVVRIVVEGLKRFTDELLAPMLGRDAATTLTEVL
FT                   QTRQAAVQEALDALRLQYPAYVEEVQVRYLTRAALRVEERTMRRLFDEAIISREILADL
FT                   ERDLRRRRTQVEEPPRLDLGLSTTELIGRVPLFAGLAPDRLGRIERLLRPSLAMPGEVL
FT                   VRRGERGDSMYFISSGAVAVTLPGLAQPVRLGSGDFFGELALLDDRPRNADVVALAYCR
FT                   LLVLDRRDFHRLLDEDADLRGHVEEIAAARRLPSAG"
FT   gene            complement(531909..532517)
FT                   /gene="uspA"
FT                   /locus_tag="RC1_0503"
FT   CDS_pept        complement(531909..532517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uspA"
FT                   /locus_tag="RC1_0503"
FT                   /product="universal stress family protein"
FT                   /note="identified by match to protein family HMM PF07332"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97940"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR54"
FT                   /protein_id="ACI97940.1"
FT                   /translation="MLTMRPAPGAPQGPPLAFPPLATALSGALPAPSAASRTASRTADA
FT                   ASAPERFKFMVCVDDSPQSRAALRFAALRAANVGGLLALLHVTEPAEFGEWMSIAQAME
FT                   QERREEAERLLHRMAAEVHDLTGLRPEVQIRSGTLGAEILAAIREDGDIHALVVGAAPP
FT                   SVRKGQLISWLAGQLAGTLEIPLVVVPGNLTDTQIDRLA"
FT   gene            complement(532532..532966)
FT                   /locus_tag="RC1_0504"
FT   CDS_pept        complement(532532..532966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0504"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97941"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR55"
FT                   /protein_id="ACI97941.1"
FT                   /translation="MHVSAILRTKGSAIITTRPSETVGSVVRLLTVNRIGAALAIDDDG
FT                   GIAGIISERDIVRGLGEHGAAVMERKVSDLMTRKVVGCAPSDTVASVMTKMTSGRFRHL
FT                   PVMEGGRLVGFISIGDVVKHRLEETTQEVESLRQYVAGGI"
FT   gene            complement(533462..533983)
FT                   /locus_tag="RC1_0505"
FT   CDS_pept        complement(533462..533983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0505"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97942"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR56"
FT                   /protein_id="ACI97942.1"
FT                   /translation="MQSGHAQTMKPARSALATAALCGLAAVGLAACANPQAEQAVYAQQ
FT                   AFIGMPVQTLLACAGVPERRASVDNVDYFTYSSERIITRPATMHGYSAWHPWYGWGPYW
FT                   GYGPGWGWNDYPEIESRSCEATFTLKNGAVTQVVYGGASSGSVRLGQCYQIVENCLSLI
FT                   PRQTAQQGMR"
FT   gene            533963..534076
FT                   /locus_tag="RC1_0506"
FT   CDS_pept        533963..534076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0506"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97943"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR57"
FT                   /protein_id="ACI97943.1"
FT                   /translation="MGMTRLHGDRSCEPLPGTVPIQARAPIPHNTLHGISA"
FT   gene            complement(534155..537682)
FT                   /gene="smc"
FT                   /locus_tag="RC1_0507"
FT   CDS_pept        complement(534155..537682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smc"
FT                   /locus_tag="RC1_0507"
FT                   /product="SMC family protein"
FT                   /note="Also called chromosome segregation protein SMC;
FT                   identified by match to protein family HMM PF00512 match to
FT                   protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97944"
FT                   /db_xref="GOA:B6IR58"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR58"
FT                   /protein_id="ACI97944.1"
FT                   /translation="MQFTRLRISGFKSFVDATELQIEPGMTGIVGPNGCGKSNLVEALR
FT                   WVMGETSAKKMRGADMDDVIFGGTATRPARNICEVTLSLDNAGRTAPAQFNDWPELEVT
FT                   RKLERASGSDYRINGKGVRARDVHILFADNASGANSPALVSQGRVGALINARPTDRRQL
FT                   LEDAAGISGLHARKHEAELRLRAAETNLTRLDDVLTTMDGQLQGLRRQARQAARYRNLQ
FT                   DHIRRAEAVLLHLKWTQAQGQLDRAMAGFAEAENAVRALMLAATQATTLRTEMTAGLQP
FT                   KRQAEAAAAAALQRLLLAREQLDAEERRAQEAFAALQRRLAQIDGDLTRERALAADARQ
FT                   AMDRLAEERHALAEAQAEEALLNEEAQTALIEAKDGVEGLDRELSRAMEGLAAEEAKRA
FT                   ALDRQVRELDGRAETLRRRLEEQQATREALARDDTVGGDAAEAEAEVAEAETRLELMRE
FT                   EAETAETAKAAAEARAEALRAEAQAVQSRAREAVQQADSVRAKLKAEADGLAALLKIRS
FT                   GDLFPPVIDTVTVAPGYEQALAAALGEDLTAPLDEAAPVHWRTLPALPDSAPLPPGAEP
FT                   LARHVKAPPALARCLAHVGVVTDAASGAAAAPRLRPGQVLVTRQGHAWRWDGLTVTAGA
FT                   ETAAAQRLRQRNRLAELELELEAADERLDAAREALAEAEETAERALADGRAAVEAAAGR
FT                   DRQARDAVRAAFAALGQAQARHAKLAQAAAALATRLQAQAEAVESLEADRAEVEEAREE
FT                   ARAALAELPDPAEARHRLAELRARLAERRAIQAERQNALDRLLRESEARQRRLAAIAQE
FT                   ERSWRTRLDGTGGRLEELQERAEETRAELERLAERPAAIETERGDLLDRIAEAERLRRR
FT                   AADELVALEVQVAEVERELKAAETQLADAREARAHAEAAVAAARQAMQTLRERVQERLD
FT                   CEPEKVLDVAGIDPAQEQPEAAAVEARLERLIAERETMGPVNLRAEQEVAELEGQIDVM
FT                   KGEREDLIAAIARLRQGISSLNREARERLLAAFELVDGHFQDLFTRLFGGGKAHLKLTE
FT                   AEDPLDAGLEIYASPPGKKLQVLSLLSGGEQALTALALLFAVFLCNPAPICVLDEVDAP
FT                   LDEANVGRFCDMVEEMARGGHTRFLIITHHRLTMARMDRLFGVTMAERGVSQLVSVDLS
FT                   SAEELTAAA"
FT   gene            complement(537895..538578)
FT                   /locus_tag="RC1_0508"
FT   CDS_pept        complement(537895..538578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0508"
FT                   /product="protein-disulfide isomerase, putative"
FT                   /note="Has several homologs identified as protein-disulfide
FT                   isomerase non of which are characterized; identified by
FT                   match to protein family HMM PF00027 match to protein family
FT                   HMM PF00999"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97945"
FT                   /db_xref="GOA:B6IR59"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR59"
FT                   /protein_id="ACI97945.1"
FT                   /translation="MRQNLRSTWTRRGFLGALALAAGIVALPLLAGPSALAQQPASLPG
FT                   FDLARATEDKVIGDPKAPITIIEYASLTCSHCAHMHTDILPRIKAEFIDTGQAKLIFRD
FT                   FPMDQVALTASMFSRCVAPERYFSMLSALFKSQKAWFAAKDPLAEVGKTARMAGLTPEQ
FT                   QEACLSNKQLETHILQTRLDGIKKYNISGTPTLILNDGAVVIDGAREEELINALVKLGA
FT                   KRKAE"
FT   gene            complement(538645..539112)
FT                   /locus_tag="RC1_0509"
FT   CDS_pept        complement(538645..539112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0509"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00582"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97946"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="InterPro:IPR010593"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR60"
FT                   /protein_id="ACI97946.1"
FT                   /translation="MSGPQRIGRQVATIAGKALGKNGLAFGGLLTEWATIVGPRLADQT
FT                   TPLKLAFPKGRRDEAVLHLRVSSPVALLLQHEEPQVLERINAFFGWRAVVRLKLVHGGP
FT                   ALKPSAPARPLRRLSAEEETAIAGRTAEVPDPDLRDALERLGRAVHGSAPR"
FT   gene            539111..540337
FT                   /gene="mutY"
FT                   /locus_tag="RC1_0510"
FT   CDS_pept        539111..540337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="RC1_0510"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="identified by match to protein family HMM PF00571"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97947"
FT                   /db_xref="GOA:B6IR61"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR61"
FT                   /protein_id="ACI97947.1"
FT                   /translation="MPPASTSSRAGKKAEAAPPDQRPGGLPDAGSRRDRGARLLSWYDR
FT                   HRRVLPWRAAPGERADPYRVWLSEIMLQQTTVATVGPYFQEFLRRWPTVLDLAAADLDD
FT                   VLRAWAGLGYYARARNLHRCAVAVARDHGGRFPDTEAELRHLPGIGDYTAAAVAAIAFD
FT                   RPAAAVDGNVERVLARVFRVEEPLPAAKPRLRALAGALVPEARAGDHTQALFDLGATIC
FT                   TPRRPRCILCPWQPDCAASAAGVQEDLPRKAAKAEKPTRRGTAFLLCDGDGAVLLRRRP
FT                   ETGLLGGMMEVPSTDWTGTVPGADAVRAAAPLPGIGWRPVPGTVRHTFTHFHLELEVLA
FT                   GRVPQPAPSVPGAVWVPRAGLEAEALPTVMRKVLRHALAADAAGPDGDGLAGDGLAGDG
FT                   LDEDEGADG"
FT   gene            540334..541062
FT                   /locus_tag="RC1_0511"
FT   CDS_pept        540334..541062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0511"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97948"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010607"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR62"
FT                   /protein_id="ACI97948.1"
FT                   /translation="MNGSDRVGRRALLAGLAGLPLLSPLGAAAARTAEGVAEGAAGAPV
FT                   DLSLVLAVDASASISRNALDFQLRGHAAAFRDPRVAAAVARGGHGRIAVTLVQFAGPDT
FT                   LTALVPWRLVSDAADCTAMADAIDAVPGIAMGGSTALGSAIVAAVALIERAPWRAARRK
FT                   IDLVSNGFNNAGIDPLSARAHAAAAGVTVNALAILDEFDWLESYYAENVIAGEGAFVRT
FT                   AAGADDFAAAFLSKLMAEIA"
FT   gene            541369..541686
FT                   /locus_tag="RC1_0512"
FT   CDS_pept        541369..541686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0512"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97949"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR63"
FT                   /protein_id="ACI97949.1"
FT                   /translation="MRTLICAAAAALCAAVLAGPSLAMETQTAMLPPGPAPAAVPATRP
FT                   AVTVSLHEARAEIAAQMKAELRQHLRRLGESLKSTEVAEESAPRATPSAAPAGSPAASP
FT                   F"
FT   gene            541737..541955
FT                   /locus_tag="RC1_0513"
FT   CDS_pept        541737..541955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0513"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97950"
FT                   /db_xref="GOA:B6IR64"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR64"
FT                   /protein_id="ACI97950.1"
FT                   /translation="MKSTRPRRPYRRGLFFCPSFPGAGPDEVPASLFPRGREDAMRSHG
FT                   TINEDRRGLAAVLGLLVGIIAGVALFA"
FT   gene            complement(541980..542486)
FT                   /locus_tag="RC1_0514"
FT   CDS_pept        complement(541980..542486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0514"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97951"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR65"
FT                   /protein_id="ACI97951.1"
FT                   /translation="MSPLHAHPPPVRALSGLLSGALLGLMLSTSPSAAAVSQRGTVPLH
FT                   GTVATSCYLVVTDHGSAIDMENGAFFQAVGSVGESCNHGLGYTVTIESENKGRMVNETG
FT                   QGVGYAISYGDLLLDTLRAPVELTRRYAQPELRTRQFRVLVPVAFRSLTAGTYSDTITL
FT                   TIAAR"
FT   gene            complement(542745..544985)
FT                   /gene="glgB"
FT                   /locus_tag="RC1_0515"
FT   CDS_pept        complement(542745..544985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgB"
FT                   /locus_tag="RC1_0515"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /EC_number="2.4.1.18"
FT                   /note="glycogen branching enzymeBE
FT                   1,4-alpha-D-glucan:1,4-alpha-D-glucan
FT                   6-glucosyl-transferase identified by match to protein
FT                   family HMM PF06647"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97952"
FT                   /db_xref="GOA:B6IR66"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR66"
FT                   /protein_id="ACI97952.1"
FT                   /translation="MSPDRHDRPSRDTADLVDAPFEAAIHALVHADHGDPFSVLGPHDG
FT                   PDGTWQVRGLFPDARTVEVVDAATGTTLAEARRVHPHGFWLAALDGPQRAYRLRIDFGT
FT                   GAMEFEDAYRFGPWLGELDRHLFAEGTHLRLWERLGAHPTEIDGVAGTAFAVWAPNARR
FT                   VSVVGDFCNWDGRRLPMRLHHGIGIWEIFVPHAGRGDLYKFEIKGPDGTMLPLKADPMA
FT                   FQAEAPPRTASVVHGTPPWTWADGDWLERRPDTSDLHSPMSIYEVHLGSWKRGPENRYL
FT                   TYRELADELIPYVAEMGFTHIEMLPVTEYPFDGSWGYQPVGLFAPTSRFGTPEDFRYFV
FT                   EAAHRAGIGILLDWVPGHFPTDPHGLGLFDGTHLYEHADPRQGFHQDWNTLIYNYGRRE
FT                   VQNFLLANALFWLDRYHLDGLRMDAVASMLYLDYSRKAGEWVPNRFGGRENLDAIELLR
FT                   RTNELAYGEQPGAITVAEESTAWPAVSRPTYLGGLGFGYKWNMGWMHDTLNYMSKDPVH
FT                   RRWHHHNLTFGLIYAFSENFVLPLSHDEVVHGKGSLLNKMPGDRWQKFANLRAYFGFMW
FT                   THPGKKLLFMGGEFAQEREWSHDRGLDWFLLGLPDHEGVQRLIRDLNHLYRELPALHRL
FT                   DCDPAGFEWLEANDSETSVLAFLRKDGAGRMTATVCNFTPLPRQGYRLGVPAEGWWAER
FT                   LNTDAERYGGSNVGNGGGVRTEEVPAHGRPYSLSLTLPPLGTVVLEFQTEPA"
FT   gene            complement(544982..548317)
FT                   /gene="treS"
FT                   /locus_tag="RC1_0516"
FT   CDS_pept        complement(544982..548317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treS"
FT                   /locus_tag="RC1_0516"
FT                   /product="trehalose synthase"
FT                   /EC_number="5.4.99.16"
FT                   /note="identified by match to protein family HMM PF00633
FT                   match to protein family HMM PF00730 match to protein family
FT                   HMM TIGR01084"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97953"
FT                   /db_xref="GOA:B6IR67"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012810"
FT                   /db_xref="InterPro:IPR012811"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="InterPro:IPR040999"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR67"
FT                   /protein_id="ACI97953.1"
FT                   /translation="MIDRSDRFWYKDAVIYQTHVKAFHDADNDGIGDFAGLAQKLDYIQ
FT                   ELGVTALWLLPFYPSPLKDDGYDIADYRDVNPRYGTLRDFRNFVRECHARGIRVITELV
FT                   VNHTSDQHPWFQRARRAPKGHPHRNFYVWSDTDQKYQGTRIIFLDTEKSNWTWDEQAKA
FT                   YFWHRFYSHQPDLNFDNPRVLREVMNVMRYWLDMGVDGLRLDAVPYLIEREGTNCENLP
FT                   ETHEILRRIRAEVDSHYGDRMLLAEANQWPEDVLPYFGNPEVGGDECHMAFHFPLMPRI
FT                   YMALAMEDRHPVTDIMRQTPEIPANAQWAVFLRNHDELTLEMVTDKERDYMWNFYATDR
FT                   RARINLGIRRRLAPLMDNDRHKIELLNSLLFSMPGTPVIYYGDEIGMGDNVYLGDRDGV
FT                   RTPMQWSPDRNGGFSRADPAGLYLPTIQDPVYGFQAVNVEAQARSSTSLLNWMRRLVAV
FT                   RQQYRAFGRGSLRFLYPGNRKVLAYLREYEGEVVLCVANLSRAPQAVELDLRQHRTCVP
FT                   VEMIGRSAFPPIGDLPYLLTLPGYGFYWFVLSSQAALPTWHEPVPEPLPDFVTLVLRDG
FT                   WREVVTGRGIRDLETEALPAFVPKQRWFGAKDARVTGVRVTGTAELPDPTGGGESYLLT
FT                   RIDVSHTASSEPVPYFLPLAMSWEEQAGTPGWPLFPFTVARTRRGARLGAAFDAMQSSR
FT                   FALALVEAVRKGLERPATRGSLLFLPTDRLDEVRFSVTEPPEVRTLGVEQSNTSVLLGD
FT                   QIVLKIYRRLEPGSHPELEMARFLTERVPYANTPPLLGTIEHRLEGDGTALAVLTGFVR
FT                   NQGNGWTFTLDYLTRELEDARLHLTAGRESGAVPPVLAEVEGENFGMYLTLARTLGERT
FT                   AQLHCALATTTGDPGFDPEPAGAADMEDWREAAMRQVEAGLHALRTARDGLPDEARAAA
FT                   DLLLGREEEVFERVHALARPIDGLTKTRIHGDYHLGQVLRSATDWFIIDFEGEPTKTLA
FT                   ERRRKHSPLRDVAGMLRSFDYAAWGAMFRLAEVHADAIDRLGPLAREWNQAARTAFLEG
FT                   YDGAIGACSACPQDGSADRLRALFELEKAFYEIAYEAGNRPTWLPIPIRGALAVLDRPL
FT                   EMPQ"
FT   gene            548618..549604
FT                   /locus_tag="RC1_0517"
FT   CDS_pept        548618..549604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0517"
FT                   /product="glycosyl transferase family protein"
FT                   /note="identified by match to protein family HMM PF00092
FT                   match to protein family HMM PF06707"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97954"
FT                   /db_xref="GOA:B6IR68"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR68"
FT                   /protein_id="ACI97954.1"
FT                   /translation="MPPSRSHILISGGDATYYPMLLELIASVRRFPQGRDCPFGIVDAG
FT                   LTADQRAHLEAIGCTVVTAQWHYDFPAGRIRDRGYLRANIAKLFLPEYFPGYEVLVWID
FT                   GDAWVQDWEAVDLYIRAARRGRFGIVAQTGRYRQGELTVKWLLGGIARVRSILYKNGRR
FT                   AGLPADILRPLAVRATLNAGAYALRADAPYWAAFQRWQDRVIHKGHIFTSDQLAMALAV
FT                   YVDGLPLELLPDWCNYMGPWRFDPAADRLVEFFLPHRPLGIVHLAGLDRMRRDPACTLS
FT                   VLDLEDRPHELTLRYPEWERRQAAVASVIASGTVGATARAPAEPEPV"
FT   gene            complement(549632..550309)
FT                   /gene="wsp"
FT                   /locus_tag="RC1_0518"
FT   CDS_pept        complement(549632..550309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wsp"
FT                   /locus_tag="RC1_0518"
FT                   /product="surface protein (Wolbachia endosymbiont),
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97955"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR69"
FT                   /protein_id="ACI97955.1"
FT                   /translation="MRAWAVRVWIVAGFLLASLPAQPVRAQDAASTTPQDDGFYLKSTT
FT                   GWDRGLGSASGLPVSSDLNLGSALTLGSPLSGGIAAGWRPMEMLRLEVEYMHGRADRGS
FT                   VTDLPAGADRLDRQSVMANALLDIDLSGWVTPYVGVGLGLTRLELDAGRLDGATLVGRD
FT                   DIISYQGIVGFSMPFSEQLSFFADGRYTGFSDIALDPGRTDAGNDLQSWSALAGLRYRF
FT                   GGP"
FT   gene            complement(550640..554029)
FT                   /locus_tag="RC1_0519"
FT   CDS_pept        complement(550640..554029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0519"
FT                   /product="Alpha amylase, catalytic domain family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97956"
FT                   /db_xref="GOA:B6IR70"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR021828"
FT                   /db_xref="InterPro:IPR026585"
FT                   /db_xref="InterPro:IPR032792"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR70"
FT                   /protein_id="ACI97956.1"
FT                   /translation="MSLTAQTRRESPGNARPTPATTTRPAGAGPRIYNLFPLLAGTVED
FT                   WKRHLPRIAAMGFDWVFLNPVHYPGFSGSLYAVKDPYRLNELFRGDTDADTDTLLRDFF
FT                   AEARRHGLTVMLDLVVNHTAKDALLAEQHPDWYVRNRDGSLRSPGAVNPQDPTDVTVWG
FT                   DLAELDYSRQESREGLIRYWADWVRHQVGLGAAGFRCDAAYQVPAGVWRALIEAARGTD
FT                   PEVLFFAETLGCTPEQVASLADAGFDYLFNSAKWWDFRSDWFLEQYELYRSIAPTIAFP
FT                   ESHDTERLAAETGTGDPRHLAALAKMRYLFSAAVSSGVMLPAGFEYGFTRRLNVVETRP
FT                   QDWQAEAAEPRLDLSGFIADVNAMKASVPALNREGPLRRITGAHDPVVALLRSDPASGE
FT                   SALLLLNPETDGPRSLDPAILLAAGDGGSFEDVTPSKAPAVLRPGVPVVLEPLELRVFR
FT                   GRPAKPAIAPDPGASLARLAALAEDRVAVEDVYPCVDGGRFAVKRVVGDIMEVWADIFA
FT                   DGHDRIAAVVQYRVAGEAAWAEAPMVFIDNDRWAGRVPLSRNARYEYRIEAWRDLFATW
FT                   RADFVKKRDAGRDVSLELVEGRGILEKAVEGAEGRGKATLTAHLEHLRGVPDQDRLRLA
FT                   DLLLGDSLAADMARFGPRTNRSHSQTLEVVADRLAARFSSWYELFPRSMSDDPARHGTF
FT                   DDVIAKLPYVRDMGFDVLYFPPIHPIGRSNRKGRNNSLTAGPDDPGSPYAIGSEAGGHD
FT                   AIHPELGTLDDFRRLVRAAKEHGLEIALDFAIQCSPDHPWIKEHPDWFDWRPDGSIRYA
FT                   ENPPKKYEDIVNVHFYRHALPDIWFALRDVVLFWVAQGVKIFRVDNPHTKPLPFWEWMI
FT                   REVQDRHPDTIFLAEAFTRPKMMKRLAKLGFTQSYTYFTWRRHKQELTDYLVELTQGPA
FT                   KEYYRPNFFVNTPDINPPYLHSGNPAMFRIRAVLATMLSSVWGMYSGFELCEGTPLPGK
FT                   EEYLDSEKYEIRAWNWDDPRNIRGYIRHLNQLRRKEPALQHLTNLRFYTAHHDGVLYFG
FT                   KADPRDSGSMILCAVSLNPDQGAYQVPFEVPLWELGLPDDAAVQVEDLFSGGRWFWYGK
FT                   WQNLTLEPWNNPAALWRISRPS"
FT   gene            554303..555109
FT                   /gene="ppk2"
FT                   /locus_tag="RC1_0520"
FT   CDS_pept        554303..555109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppk2"
FT                   /locus_tag="RC1_0520"
FT                   /product="polyP-AMP phosphotransferase"
FT                   /EC_number="2.7.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97957"
FT                   /db_xref="GOA:B6IR71"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR71"
FT                   /protein_id="ACI97957.1"
FT                   /translation="MALEIPDRFRLDRLPERQPRFADKADYEKTQKALQERMARIQFSY
FT                   FWQGLRAVIVFEGWDAAGKGGAIRRMTAELDPRGFHVWPISAPTADEQGRHYLWRFWQR
FT                   LPTPGSVAIFDRSWYGRVLVERVEGLAKREDWTRAYDEINAFEKMLTDDGIRVIKLFLS
FT                   ISPEEQGKRLRERLEKPWKRWKLTPDDLRARARWDEYVAAAQEMFVRTSTPAAPWTLIP
FT                   ANSKWCARIDILRTVADALAEGVPIDPPPLDPAFARLAEEALGDKG"
FT   gene            complement(555237..556508)
FT                   /locus_tag="RC1_0521"
FT   CDS_pept        complement(555237..556508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0521"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97958"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR72"
FT                   /protein_id="ACI97958.1"
FT                   /translation="MVPHVSLKLARLLLAGAALTVAASAAAQSTPQTEQPGSGGGLILP
FT                   GTVQSTPSGSTAAGTITQRPQQAPAAQQPRPAAQPQQQPRPAPQAQAQRAPSKPPEKTG
FT                   VPQGTWDIAPDVYSDGSFKLCAAENRFDNNLILIMLQGPNKKTNLMIGAPGAQMPPGAR
FT                   FKAQIKIDSKLDKEINGAVVAPELVALNTGQEEEIARGIGTGNVLTVMLPGQGVAFQLK
FT                   GTSKALSDLSACVDQAAAGTLKLPPPPPAMPPQLAKLLLDAGLKDARALPVDKMPPEQR
FT                   PGDFAWQIGQKVLGAIRNFPIREEAGDLAKISQTYVDSLAKTCQGTFTPTLGTVETVKQ
FT                   VTFRTGSALCEMKEGKVFVSLVMYLSAQRTLGVFSHEAMESERATAETASAGILKALKE
FT                   AAAKEPPAQQGQAAPQQPAPQPKK"
FT   gene            557130..557675
FT                   /locus_tag="RC1_0522"
FT   CDS_pept        557130..557675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0522"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00128
FT                   match to protein family HMM TIGR02456 match to protein
FT                   family HMM TIGR02457"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97959"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR73"
FT                   /protein_id="ACI97959.1"
FT                   /translation="MRLVAVLAFTLFLSAPMLADETLAPEEVGRFIAAAEQIAAAEQIA
FT                   AAEQVAAPGPAGPAAPQAHPFSRLLADTAVIEPIIARHGFSERRWRSVGNRVLAAHRAE
FT                   QILRPMAAAAAAPVRKRPDTPYDARVMQASATAADQVALRSVAREMRNDLAAFARDTEA
FT                   DRKAIAPFRDRLDALIPR"
FT   gene            complement(557730..558881)
FT                   /locus_tag="RC1_0523"
FT   CDS_pept        complement(557730..558881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0523"
FT                   /product="Cys"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97960"
FT                   /db_xref="GOA:B6IR74"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR74"
FT                   /protein_id="ACI97960.1"
FT                   /translation="MRPDPTHPDTLLARAQGAHDPATHGVVPAVHPATTFLRAGDLSYP
FT                   GGHSYARPFNPTFDGAETLLATLEGAAQALLFSSGMSAATAVFQALEPGDHVIAPQVMY
FT                   WGLRNWLKGFAAQWGLGLDLVDMRDPAAVAAAVRPGRTRLIWAETPANPTWEVTDLAAC
FT                   AEIAHRAGARLAVDNTVPTPLLTRPVEHGADIVMHSATKYLNGHSDVLGGALATARADG
FT                   FWERIAAIRANQGAIPGPFEAWLLLRGMRTLGLRVERACATAQRLAEHFAGHPKLEAVL
FT                   YPGLPTHPGHAVAARQMRGGFGGMLSVRVKGGAAGAVAASAALRIWTRATSLGGVESLV
FT                   EHRGSIEGPDSPCPQDLLRLSCGIEHADDLIADLEQALEHVPA"
FT   gene            complement(558918..559643)
FT                   /locus_tag="RC1_0524"
FT   CDS_pept        complement(558918..559643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0524"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97961"
FT                   /db_xref="InterPro:IPR009389"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR75"
FT                   /protein_id="ACI97961.1"
FT                   /translation="MSAGSTEDTGRWAVYYAPPHDGPHWRLGTAWLGRDPETGETPPRP
FT                   DTGIPAADLARLTATAAGYGFHATLKPPFALAAGRTETDLRAAVAELAAGLAPFDAPPL
FT                   RPARLGDFRALVPAADCLDLDRLAAACVRGLDGFRAPPTPAELARRLAAGLTPGQQAML
FT                   ERWGYPYVLGEFRFHMTLTDPVPPDAAAAVDTALEAVFAPLRRLPLPVRDLALFRQERR
FT                   GEPFRLVERFPLAAGRAAR"
FT   gene            complement(559640..560764)
FT                   /gene="phnM"
FT                   /locus_tag="RC1_0525"
FT   CDS_pept        complement(559640..560764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnM"
FT                   /locus_tag="RC1_0525"
FT                   /product="phosphonate metabolism protein PhnM"
FT                   /note="identified by match to protein family HMM PF00128"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97962"
FT                   /db_xref="GOA:B6IR76"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR012696"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR76"
FT                   /protein_id="ACI97962.1"
FT                   /translation="MILGNARLVLADAVVPGSVAVAGGTIAAIDGDRRPPPGALDLEGD
FT                   LLLPGLVEIHTDNLEKHLTPRPGVVWPAFSAVLAHDAQVAAAGITTVLDALCIGAGPGR
FT                   DWAGIAAAAIPGLAAAREAGHLRAEHLLHLRCEVTDPDLPALFEAHAGDPSVRLVSVMD
FT                   HTPGQRQFTDLTKFRRYQEAFGASAAEVDAAIDQSRERQARHAARHRALLADACRARGI
FT                   PVASHDDETPEHVAEAKALGFVISEFPTTAAAAAAAREHGMLTVLGAPNVVRGQSHSGN
FT                   VSALELARAGLLDMLSSDYMPASLMQAVFRLSGDRVIALPAAVAMVSRTPARALGLDDR
FT                   GEIAPGLRADLVQVRETDHGPVVRRVWRGGRRVL"
FT   gene            561195..562310
FT                   /gene="galE"
FT                   /locus_tag="RC1_0526"
FT   CDS_pept        561195..562310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="RC1_0526"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /note="Gene symbol synonym galDAlso matched to NAD
FT                   dependent epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97963"
FT                   /db_xref="GOA:B6IR77"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR77"
FT                   /protein_id="ACI97963.1"
FT                   /translation="MAKSILITGGAGFIGSHLADGLLAAGHRVRVLDSLSPQVHADAER
FT                   PAYLDPGVELLRGDVRDPGAVSRALTGVDVVYHFAAMVGVGQSMYQVADYTSVNDLGTA
FT                   VLLQALIERPVERLVVASSMSVYGEGLYRSPDGRVVEGVERGRAQLSRGEWELRDADGA
FT                   PLQPVPTPESKRPSLASVYALGKYVQERQCLLVGAAYGIATVALRFFNVYGTRQALSNP
FT                   YTGVLAIFASRLLNGNRPMIFEDGRQKRDFVHVRDVARACRLVLERPAAAGEVLNIGSG
FT                   QAIAIDDLAGRLAGIVGRPDLVPEITGRCRVGDIRHCFADIGKARAVLGYEPGVGLEEG
FT                   LTELADWLSGQIAVDRVEQAARELAARGLTV"
FT   gene            562397..563452
FT                   /gene="rfbE"
FT                   /locus_tag="RC1_0527"
FT   CDS_pept        562397..563452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbE"
FT                   /locus_tag="RC1_0527"
FT                   /product="CDP-paratose 2-epimerase"
FT                   /EC_number="5.1.3.10"
FT                   /note="identified by match to protein family HMM PF03976"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97964"
FT                   /db_xref="GOA:B6IR78"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR78"
FT                   /protein_id="ACI97964.1"
FT                   /translation="MLITGGAGFVGTNLADRLAREGRRVIVLDDLSRPGVERNLAWLRA
FT                   MHGDRILPELADIRDGERLGRAVARSAAVFHLAAQVAVTTSLRDPVHDFEVNACGTLRV
FT                   LEAVRAQPEPPPLVFSSTNKVYGALPDLELVEEADRCRPADPGHAGGVREDRPLDFHSP
FT                   YGCSKGAADQYVLDYARSYGLPATVFRMSCIYGPHQFGTEDQGWVAHFLIAAAEGRTIT
FT                   LFGTGRQVRDILHADDLVDAFLLALGNRDAVSGRAFNIGGGPANAVSLREVLEQIAGLD
FT                   GRLPAVEYGPWRTGDQPWYVADISRFRQATGWTPGIAAADGIARLHRWLHGERPGLPLV
FT                   EVVARSLPAAQ"
FT   gene            563490..564776
FT                   /locus_tag="RC1_0528"
FT   CDS_pept        563490..564776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0528"
FT                   /product="oxidoreductase With radical SAM domain, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97965"
FT                   /db_xref="GOA:B6IR79"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR027559"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR79"
FT                   /protein_id="ACI97965.1"
FT                   /translation="MRVALVNPNWSFEGSIYFGCREPHLPLEFGYAKALLERDGHVAEI
FT                   LDAQLLDLSDAALLARVREFRPDMTVVTTAPSYLFWRCCPPELRVPQAVVRLLRPVAGT
FT                   LVGVGPHSSTTPRAALAKLGVDVVVQGECEEPIALLASGRDWCSIPSLCHARDGAVRVQ
FT                   GGPHAGTFTDLPALSWPDGWIARHRHHHHRFDAPPAGPGAEVEASRGCPYSCTFCAKEN
FT                   FRDRYRRRPVEVVMREIDGLIAQGVEYVYFIDEIFLPNRPLLEALAERPVRFGVQTRID
FT                   IWKPEMIALLGRAGCVSIEAGVESLTAEGRQALDKDCRLSTDELTERLILARRHVAFVQ
FT                   ANLIDAGDDDPETVRAWRDRLRQHGVWANDPVPLFPYPGSPDYRRLWGLPDDRAWERAL
FT                   DHYLAAHGRFSDLQDERPRPLAELEAAHG"
FT   gene            564769..565908
FT                   /locus_tag="RC1_0529"
FT   CDS_pept        564769..565908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0529"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97966"
FT                   /db_xref="GOA:B6IR80"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR80"
FT                   /protein_id="ACI97966.1"
FT                   /translation="MAERPEVERPARPGEPLHVLMTADCLGGVWDHALTLAGQLGRAGA
FT                   RTTLAVLGGPLAPDQRQAAAAVSGLHLEESDWRLEWMPDAGADVARSGDWLLGLEDRLR
FT                   PNVVHVNGYAHAALPFRAPVLCAGHSCVRSWFAAVRGEPPLSDFDRYAEGVRAGLAAAG
FT                   MVVTPSRTMAAALAFHYGVPVEPVVIPNGVAVEDFAPAAKDDLILSVGRIWDEGKNIAA
FT                   LEAVAPLLGSPVAVAGESRHPDGSERAPRAVALLGRLPSAELRDWYARAAVFCLPARYE
FT                   PFGLAVLEAALSGCALVLGNSPGLRENWDGAAVFVDPDDTAGLARALNRLVCDHARRCD
FT                   LAERARIRGRRFRADTMARSYLGAYAALTGAPRRRYGVG"
FT   gene            565914..567050
FT                   /locus_tag="RC1_0530"
FT   CDS_pept        565914..567050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0530"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01053
FT                   match to protein family HMM PF01212"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97967"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR81"
FT                   /protein_id="ACI97967.1"
FT                   /translation="MRFVFFVHSLFSDWNHGNAHFLRGVVTELLSRRHEVSVWEPADGW
FT                   SRANLLAQHGEGALAEIRAAFPHLRSHDHDLSDPGSEAVLDRALDGADVVLVHEWNDPA
FT                   LVAALGRRRARGGRFRLLFHDTHHRSVTAPEEMARYDLSAYDGVLAFGQAVAERYRARG
FT                   WGRQARVWHEAADTRLFRPQPTPEARRDLIWIGNWGDGERTAELHEFLLEPVRTLGLRA
FT                   RVHGVRYPEDGRRALAEAGIAYRGWLPNHRAPAALAAHRVTVHVPRRPYVKALPGIPTI
FT                   RVFEALACGIPLVSAPWTDSEGLFRAGRDFRMVRSGTEMTKALRELLSDPDAAAAQARN
FT                   GVETIRSRHTCAHRVDELLACCADLGVRGSSPALAEVS"
FT   gene            567054..568172
FT                   /locus_tag="RC1_0531"
FT   CDS_pept        567054..568172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0531"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06299"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97968"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR82"
FT                   /protein_id="ACI97968.1"
FT                   /translation="MTGLSIAFYGSSLVSAYWNGAATYYRGIVKELAARGHRVTFFEPD
FT                   AYERQKHRDIPDPDWARVVVYEATEAGVSRALEQGRGADVVVKASGVGVFDALLEAAVP
FT                   EIRRPDGLAVFWDVDAPATLARLHADPADPFHAALRRYDAVLTYGGGQPVVDAYGALGA
FT                   RECVPVYNAVDPATHHPVPPDPRFAAALAFLGNRLPDREARVEESFLRAAALLPGRPCL
FT                   LGGAGWGDKPLPANVRHLGHVVTADHNAFNCTPLAVLNVSRESMAATGFSPATRVFEAA
FT                   GAAACLITDAWEGIGQFLEPGREVLVARDGAEVAELVAGLTPERARAIGAAARTRVLAE
FT                   HTYAHRAVLVDRLLTGRLAQERAQPAPAGMPA"
FT   gene            568169..569353
FT                   /locus_tag="RC1_0532"
FT   CDS_pept        568169..569353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0532"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01979
FT                   match to protein family HMM PF07969 match to protein family
FT                   HMM TIGR02318"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97969"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR83"
FT                   /protein_id="ACI97969.1"
FT                   /translation="MTGALDIVVLGLSITSSWGNGHATTYRGLLRELAARGHRVTFLER
FT                   DVPWYAAARDCPDPAGVRTALYGSLEELRDRFGAAVREADAVIVGSYVPDGVAVGDWVL
FT                   ATARGLTAFYDIDTPVTLAALAGGGGGNGGTDYLAARQIAAYRLYLSFTGGPTLRRLER
FT                   EFGAPMARALYCSADPALHRPQEVAVDWALGYLGTYSPDRQPVLERLLLEPARALPGER
FT                   FVVAGAQYPDGIAWPGNVARIAHLEPPRHPGFYSAQRFTLNVTRADMVRAGWSPSVRLF
FT                   EAACCGTPIISDPWPGLDSLFRPGREIVVARTAAEVLEVLTGMTAEAAAALGRRARTRV
FT                   LAAHTAAHRAAELEGHLHAALARRAVPARPAPAAPAAPPSVSALRRIAKGTAAG"
FT   gene            569451..570164
FT                   /locus_tag="RC1_0533"
FT   CDS_pept        569451..570164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0533"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity to protein tyrosine"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97970"
FT                   /db_xref="GOA:B6IR84"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR005939"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR84"
FT                   /protein_id="ACI97970.1"
FT                   /translation="MSQDRAGGERDLACTVDRFAFLADRRHLAGRWINSVFKDHAFLRM
FT                   AYKNMFRISPGMYRSSQPTPAHIAAAKRMGIRTVINLRGRRDDCGSYFLEERACREHGI
FT                   TLVDFPVNSRDAPRKHILHAARDIWAGVEYPVLMHCKAGSDRVGFMSALYMLVHEKRPL
FT                   EEAVRQLNWRYGHLRAAKTGILDQFFEEYAARNAESPIDFYDWVDQVYDPPALKARFMS
FT                   RWWANVLVDRVLKRE"
FT   gene            complement(570213..571358)
FT                   /locus_tag="RC1_0534"
FT   CDS_pept        complement(570213..571358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0534"
FT                   /product="acyl-CoA dehydrogenase, putative"
FT                   /note="identified by match to protein family HMM PF01073
FT                   match to protein family HMM PF01370 match to protein family
FT                   HMM PF02719 match to protein family HMM PF04321 match to
FT                   protein family HMM PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97971"
FT                   /db_xref="GOA:B6IR85"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR85"
FT                   /protein_id="ACI97971.1"
FT                   /translation="MDLSLSDEQRLLRDSVERFVRDAYGFEQRKAVVAEAGGFSRRHWA
FT                   TFAELGWLALPFAEADGGLGGGGPEVAILMEAFGRGLVVEPYLPTVLLCGGLVAALAEG
FT                   GRRSALLEPLLEGRLQLALAYAERQARYDLFDIATTAQRQEGGGYVLDGRKSVVLNAPS
FT                   ADWLIVAARTAGGRRDRDGISLFLVDRAAPGLDLRDYPTLDGQRAAEVTLTGVSVPTDA
FT                   LLGPEGGALSAIEAATDRAIAALCAEAVGCIDHLVTATVEYTRTRVQFGQPIARFQVLK
FT                   HRMADMAVCLEQARSMAAYAARHWDTADATVRGRAMSAAKAKVGQAARFVAQQAVQLHG
FT                   AMGVTEELNVGHYMKRLMAIEVAFGSTDHHLRRFGSLEEAA"
FT   gene            complement(571655..571984)
FT                   /locus_tag="RC1_0535"
FT   CDS_pept        complement(571655..571984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0535"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97972"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR86"
FT                   /protein_id="ACI97972.1"
FT                   /translation="MNGNTKCSDFLVGLHGDLPMRGVAVTLGDMPAGADVHEAMAEAAQ
FT                   GTAFALERVCGDGYGRMVAYFRLVTLENDGDEPVMALLQSVSRHCRWLSMEKMTSRVLP
FT                   EVWAA"
FT   gene            complement(572483..572899)
FT                   /locus_tag="RC1_0536"
FT   CDS_pept        complement(572483..572899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0536"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97973"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR87"
FT                   /protein_id="ACI97973.1"
FT                   /translation="MDERDRVLEVNRRFYAAFLGGDLPVMEAVWAWVHPVACIHPGWHP
FT                   MTDREEILRSWREIFTTRRTLEIRIEREQVLQLTADTALVICQEEVSIGLTAACNGFVL
FT                   EDGVWRLALHHATPLARIRTGDVARPHSGPPVLH"
FT   gene            complement(572984..574357)
FT                   /locus_tag="RC1_0537"
FT   CDS_pept        complement(572984..574357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0537"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97974"
FT                   /db_xref="GOA:B6IR88"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR017806"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR88"
FT                   /protein_id="ACI97974.1"
FT                   /translation="MITPDPAMAGPAFQPPQRAGSGDATATARPPPTARTVTPAADLRP
FT                   LLAARFRRIRTVTGQLAAPLTPEDQMVQSAPETSPVKWHLAHTSWSLERHVLERFAPGY
FT                   RAFDDRFAFLFNTCVEPQPTCHPAAARGLLSRPGHEELRQYRDHVNAAVLRLIDETPDA
FT                   DWSGVARRIELALQHEQYCQERLLADIKHAFWQNPLRPTYQPPQPAALTTAAGQSWSVH
FT                   PGGPEGIGHDGPGVVFDLEEPRHVVWLEPFRLSGRLVTNAEYLEFIEDGGYADATLWDP
FT                   DGWATAQREGWRAPLYWFRRGPDWFQFTLSGTRLLDGEEPVCHVSWHEAAAFARWDGRR
FT                   LPTEAEWEAAAQPLRRTGNLLDYGRLHPAVATCIGDGPWQIYGDCWEWTSSPLIAYPRW
FT                   SPGDKTVGEHAGLPAAGRMVLKGGSALTPGDLVRASFRHHLTPASRWHMTGIRLAEDV"
FT   gene            complement(574747..577374)
FT                   /locus_tag="RC1_0538"
FT   CDS_pept        complement(574747..577374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0538"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97975"
FT                   /db_xref="GOA:B6IR89"
FT                   /db_xref="InterPro:IPR000490"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR89"
FT                   /protein_id="ACI97975.1"
FT                   /translation="MRKILTMRGSAWAVLVLLVLGNIGAWAFSNRPAMPERPWSGTIAG
FT                   VAFNPYKVGQDPTEGKHPSRQDIAGDLDVVAPYVLSVRTYSALDGLEAIPELAAQRGLL
FT                   ATAGAWISQDLGANEQQINALVRIARRNDNVKRVMVGNEVMYRGDLEVEQLIDYVQRVK
FT                   RQVDVPVSTAEPPYVWHEHPELAEAVDFITIHLLPYWEKVPIEQAMDQILTEYNRIKTA
FT                   YPDKHILIGEVGWPSDGPYRGGAEASLVNQATFIRSFLNLAGEQRWDFYIMEAFDQPWK
FT                   RVLGGPVEANWGIWNADRQLKFPMDGSVWEVPGWPVLCAIATALAFLPIFWFVLRRDDL
FT                   KPAGQFFYGALIQTVASALVWTWTEAVTAGMGPLSTIVFALLLTAQIILLAVMLIDGLE
FT                   LTEVVWTQNWKRRFEPIRGDSSGYAPKVSIHVPCYNEPAHMVIETLDALARMTYPNFEV
FT                   LVIDNNTRDEAVWKPLEEHCRKLGANFRFFHLPKWPGYKAGALNFGIAMTAPDAEVIAV
FT                   IDSDYQVRPDWLSATVPYFRNPKVAFVQSPQDYREWNDHPFHRMINWEYQGFFKIGMIQ
FT                   RNERNAIIQHGTMTLIRTQVLKDVGWWAEWCICEDAELGLRLFEQGYESVYMPDSFGQG
FT                   LVPDSFAGYKTQRFRWAYGAVQIIKRHWREFLPGGKRLTFGQKYHFVTGWLPWFADAAH
FT                   MAFVIGGVFWSAGLLLLPRYFELPPTVFLFPTLSVFFFKVICGLWLYEARVQCSLLDKI
FT                   SAAVAGMALTHTVGRAVWQGLFTQGRPFVRTPKCENQPALIQGFLNAKEEVYLMLGLWI
FT                   AAAAVAWRIGGDNRDAYIWSLMLVVQSLPYIAALVVSCLNVLPKGRDAADDALPAPAGA
FT                   GGND"
FT   gene            577739..578182
FT                   /locus_tag="RC1_0539"
FT   CDS_pept        577739..578182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0539"
FT                   /product="histidine triad protein, putative"
FT                   /note="Also called HIT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97976"
FT                   /db_xref="GOA:B6IR90"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR026026"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR90"
FT                   /protein_id="ACI97976.1"
FT                   /translation="MTTPDGFDLHPRLAADTLPVTDLPLCRVLLMRNRAFPWLILVPRR
FT                   AGAREIHRLDAADRMLLTEELAQVSAALEAAVRPDKLNVGALGNLVPQLHVHVVARREG
FT                   DPAWPGPVWGSGVHESYAAGEGEALAARLAAALRQKHGQKDTY"
FT   gene            578358..580028
FT                   /locus_tag="RC1_0540"
FT   CDS_pept        578358..580028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0540"
FT                   /product="methyl-accepting chemotaxis protein, putative"
FT                   /note="Contains PF00015"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97977"
FT                   /db_xref="GOA:B6IR91"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR91"
FT                   /protein_id="ACI97977.1"
FT                   /translation="MTTIRARLLAAIGILALTILAIAAAGWAGLGDSHRRIGTIYSDRV
FT                   VPLRDLKVVADLYAVNIVDAVHKVRGGSLTWDQGTASVETAKAGIRQHWDAYMATWMVP
FT                   EEKALAAEVQRRLGPADAMVADLLRILAARDADALVRLAEKSLYPVIDPVSEAVTALIE
FT                   LQLRVADQEYQTNEIVSGQFRLVMTGLTLLGSVAVAFALYTVLRKVLHPLNGITAVMGR
FT                   MASGDLRVEVAGADGRDEVAAMARALRVFRDGLLESERLAQAQEAERAAKERRAAEVDR
FT                   LVRGFDQEAAAVLRAVGAAATELDSTAQSMASIAEETSRQAGAAATAAGQTTGNVRTVA
FT                   AASEEMAASIREIAEQVVRSKTVADQATEDLRQTNRSVAGLSAATDRIGTVVQLIQEIA
FT                   AQTNLLALNATIEAARAGEAGKGFAVVAAEVKALANQTAKATEEIGQQIAAVQSVSAEV
FT                   VAAIRGISRTVEAVNEISSSIAAAMDEQEAATSEISRNVAQAAVGTEGVSGNVEQVLEA
FT                   AGQTGAASSQVLGAARELAQQSETLRARVETFLAAIRAA"
FT   gene            complement(580061..581131)
FT                   /gene="phaC"
FT                   /locus_tag="RC1_0541"
FT   CDS_pept        complement(580061..581131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaC"
FT                   /locus_tag="RC1_0541"
FT                   /product="Polyhydroxyalkanoic acid synthase, putative"
FT                   /EC_number="2.3.1.-"
FT                   /note="PHA synt Hase,PHB polymerase,
FT                   poly-beta-hydroxybutyrate polymerase; identified by match
FT                   to protein family HMM PF00441 match to protein family HMM
FT                   PF02770 match to protein family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97978"
FT                   /db_xref="GOA:B6IR92"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR92"
FT                   /protein_id="ACI97978.1"
FT                   /translation="MLQPHLAAVGADALARAVDREMRHRLDRLLTGIERYRRHPYHRDL
FT                   EDPPTVWAEGAARLLDFGGRGAPALFVPSLVNRGYILDLSRHRSLLRWLAGNGVRPLLL
FT                   DWGRPVAAERSFDLTDLIAGRLTRALAAARRHLDGRRPALVGYCMGGLLTVAAAQRRPD
FT                   DVAALVALATPWDFHADTPAGARRTAALLPVFEPALGVLGELPVDAIQTLFLMLDPLLG
FT                   LKKFSRFAELPEGSEEADDFVALEDWLNDGVPLPAPVARECLGGWYGRNDPGRGRWHVA
FT                   GEPVGPARLTLPTLVVVPARDRIVPPASAAALAAAIPGAERWDPPLGHIGMVVSGGAEA
FT                   TLWRPLRDWLVRTVPA"
FT   gene            581234..581368
FT                   /locus_tag="RC1_0542"
FT   CDS_pept        581234..581368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0542"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97979"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR93"
FT                   /protein_id="ACI97979.1"
FT                   /translation="MQPQRPRALAPRGRRGRRRRRGGAHRAGPSGRARPRAPSCRAER"
FT   gene            581774..582373
FT                   /gene="phaR"
FT                   /locus_tag="RC1_0543"
FT   CDS_pept        581774..582373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaR"
FT                   /locus_tag="RC1_0543"
FT                   /product="polyhydroxyalkanoate synthesis repressor PhaR"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97980"
FT                   /db_xref="GOA:B6IR94"
FT                   /db_xref="InterPro:IPR007897"
FT                   /db_xref="InterPro:IPR010134"
FT                   /db_xref="InterPro:IPR012909"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR94"
FT                   /protein_id="ACI97980.1"
FT                   /translation="MADKEDSKPAPVTIKKYANRRLYNTATSSYVTLDHLCQMVKEGTD
FT                   FVVYDAKTGDDITRSVLTQIIVEEEAKGQNLLPIPFLRQLISFYGDNMQWLVPRYLEYS
FT                   MQSFTRNQEKMRDYFQNAFGGMFPFGPFEEMGKQNIAMFERAMRMFAPFAGAEPPKPDS
FT                   PAGEFRKGADDKFSELQQRLDELQSQLETLTRNKGS"
FT   gene            582654..582788
FT                   /locus_tag="RC1_0544"
FT   CDS_pept        582654..582788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0544"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97981"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR95"
FT                   /protein_id="ACI97981.1"
FT                   /translation="MTLEPEALPPPRRPAADLPAFRRACAAYRRAAALDGAAGHEVEV"
FT   gene            complement(582793..583137)
FT                   /locus_tag="RC1_0545"
FT   CDS_pept        complement(582793..583137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0545"
FT                   /product="HicB-related protein"
FT                   /note="identified by match to protein family HMM PF00332
FT                   match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97982"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR96"
FT                   /protein_id="ACI97982.1"
FT                   /translation="MLEYKGYIGSVEYSDTDEVLHGRLEFIRDLVTYEGVDARGLKAAF
FT                   HEAVDDYLDLCEAEGRQPDVPLKGSFNVRPGPDLHRRAMLLARRRGETLNTVVSDALRR
FT                   YLDSEAQGPA"
FT   gene            complement(583143..583397)
FT                   /locus_tag="RC1_0546"
FT   CDS_pept        complement(583143..583397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0546"
FT                   /product="HicA-related protein"
FT                   /note="identified by match to protein family HMM PF01230"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97983"
FT                   /db_xref="GOA:B6IR97"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR97"
FT                   /protein_id="ACI97983.1"
FT                   /translation="MSRRDKLVDRLKGRPTDFTWDELVRLLEGLGYSEAPTGRTGGSRR
FT                   RFVHATAPTIALHKPHPGSIVKMYVIEDLLRVLAEEGLI"
FT   gene            complement(583593..585689)
FT                   /locus_tag="RC1_0547"
FT   CDS_pept        complement(583593..585689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0547"
FT                   /product="peroxisomal bifunctional enzyme"
FT                   /EC_number="4.2.1.17"
FT                   /EC_number="5.3.3.8"
FT                   /EC_number="1.1.1.35"
FT                   /note="[synonyms] PBE PBFE [Includes] Enoyl-CoA hydratase
FT                   3,2-trans-enoyl-CoA isomerase 3-hydroxyacyl-CoA
FT                   dehydrogenase identified by match to protein family HMM
FT                   PF00015 match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97984"
FT                   /db_xref="GOA:B6IR98"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR98"
FT                   /protein_id="ACI97984.1"
FT                   /translation="MTQVVQYSRRGAVGVILVENPPVNALSQAVRQGLLDALRQGLEDD
FT                   GARALVLAGGGRTFIAGADIAEFGRPLAPPDLNDVIAAFEGAAKPVVAAIHGTALGGGL
FT                   EVALGCHYRVAVAKAMVGLPEVKLGILPGAGGTQRLPRLVGAHVALTMITSGEFVPAPK
FT                   AHELGILDAIVEGDPVDGAVRFAEALDLAGPYPRVRDRAERIAADRGSAVFDEKRRALE
FT                   KTARGLFAPQRCVDAVQAAAELPFEEGLKRERELFGQCMAHPQSAALIHVFFAERAIGK
FT                   IPDVPADTPARPVATAAVLGAGTMGGGIAMNFANAGIPVTLLETSQEALDRGLATIARN
FT                   YAGTVAKGRLTQAEMDRRLSLITPTLDMAALAGADMVVEAVFEDMAVKQDVFRRLDTVA
FT                   KPGAVLATNTSTLDIDAIAAVTSRPADVIGMHFFSPANVMKLLEVVRGSATARDVIATA
FT                   MQTGRKIGKVSVLVGNCDGFVGNRMLMPYSRQAELLVEEGAWPEQVDKALQDWGMAMGP
FT                   FAMGDLAGVDVTWRIRQRRLAEGKAAGSPLTDRLYLMDRYGQKTGAGWFRYEAGSRTPL
FT                   PDDVVKRMIENHRETHQIQPRAISDEEIVKRMIYALVNEGAKALEEGMALRASDIDVIY
FT                   LYGYGFPAWRGGPMHYADSVGLPTVLADIRDFQQRFGGDWTPAPLLERLAAEGSSFAAH
FT                   DRRR"
FT   gene            585925..586950
FT                   /locus_tag="RC1_0548"
FT   CDS_pept        585925..586950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0548"
FT                   /product="oxidoreductase, zinc-binding dehydrogenase
FT                   family"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97985"
FT                   /db_xref="GOA:B6IR99"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041694"
FT                   /db_xref="UniProtKB/TrEMBL:B6IR99"
FT                   /protein_id="ACI97985.1"
FT                   /translation="MPVNRRIVLAERPQGMPTPETFRLEEGPVPTAGPDQVLLRTVWLS
FT                   LDPYMRGRMSAAKSYAQPVEIGDVMVGGTVCEVVQSNAEGFAPGDLVLAQTGWQDYAAA
FT                   GAKAVQKLDPGAFPPSLALGTLGMPGLTAYVGLLDIGEPRNGETVVVSAAAGAVGSVVG
FT                   QIARIRGCRAVGIAGGKDKCDYVTGTLGFDACVDYKAPDFMQRLKEACPSGIDVYFDNV
FT                   GGDVADACMALLNNFARVPVCGRIANYNDTELPPGPNRVPQLMGLVLTRRLKVQGFIVS
FT                   DRWHRMADFHHDMGAWLRDGRIKYREDVVEGLEKAPEAFIGLLQGRNFGKLLVRVGPDR
FT                   A"
FT   gene            587021..587785
FT                   /locus_tag="RC1_0549"
FT   CDS_pept        587021..587785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0549"
FT                   /product="oxidoreductase, short chain dehydrogenase"
FT                   /EC_number="1.1.1.-"
FT                   /note="identified by match to protein family HMM PF05233
FT                   match to protein family HMM PF07879 match to protein family
FT                   HMM TIGR01848"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97986"
FT                   /db_xref="GOA:B6IRA0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRA0"
FT                   /protein_id="ACI97986.1"
FT                   /translation="MTGRLKDKVILITGGAGGIGSATARHAAREGARVVITDLSAARGE
FT                   QAAAEIGHGTLFLEQDVRDEARWQDVVDAVLRHHGRLDGLVNNAGVGVRGSIVETTLED
FT                   WRFVHAVNTEGVFLGCKHGILAMRETGGGSIVNLSSVAGMIGAPDLTAYCSSKGAVRLL
FT                   TKSVAVWCAEQKNGIRVNSVHPSFLMTPMVQMMIDTAPDPAMAHRMLSRAAPMGRLGEP
FT                   EDAAGMIVFLLSDEAGFMTGGEYVVDGGLTAR"
FT   gene            587849..588634
FT                   /locus_tag="RC1_0550"
FT   CDS_pept        587849..588634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0550"
FT                   /product="oxidoreductase, short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97987"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRA1"
FT                   /protein_id="ACI97987.1"
FT                   /translation="MHPLFDLTGKVALITGSSRGIGRAIAEEYARAGARVVISSRKLDV
FT                   CEQVRDAINAEHGAGRAIAVACNIGRKEDLERLVAETKAAFGQIDILVANAAINPVYGP
FT                   LAAVSDDAWDKIMGTNLRSTWWLCNMVMPEMAERKGGSVIVLSSIAGLRGNPVIGAYGI
FT                   SKAAEAALVRNLAVEYGRAGVRINAIAPGIIETDFAKALTDNPEIAKATMRKTPLGRFG
FT                   RPVEIAGVALMLASPAGGYLTGQTLVVDGGATIGDPLTV"
FT   gene            588649..589704
FT                   /gene="fadE36"
FT                   /locus_tag="RC1_0551"
FT   CDS_pept        588649..589704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadE36"
FT                   /locus_tag="RC1_0551"
FT                   /product="aminoglycoside phosphotransferase, putative"
FT                   /note="identified by match to protein family HMM PF05534"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97988"
FT                   /db_xref="GOA:B6IRA2"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR041726"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRA2"
FT                   /protein_id="ACI97988.1"
FT                   /translation="MASGAVLIDVLPQHRFDEAALWRYLSTALPEFQEPAEIRQFQGGQ
FT                   SNPTFLVTTPSARYVLRKKPPGKLLPSAHMVEREYRAMRALHDTAAPVPTVRLLCEDAG
FT                   VIGTPFYVMDYIDGRIFTDVTLPDLAPAERTALYDSMNATLAALHQVDWQACGLGDFGR
FT                   PEQYVARQVDRWTKQYLAARTDEIPAMDRLVDWLPRNIPAGDETTIAHGDFRLGNLMVD
FT                   RDEPRVVAILDWELATLGHPLSDLAYNCMAWHLPAGVKEFPGLKGIDLTAQGIPTEEEY
FT                   VAAYCRRTGRGGIPDWPFYMAFSFFRIASICQGVYARALQGNAADRRAIGYGEVARVTA
FT                   GIGWSLISDRA"
FT   gene            589980..590420
FT                   /locus_tag="RC1_0552"
FT   CDS_pept        589980..590420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0552"
FT                   /product="NUDIX family hydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97989"
FT                   /db_xref="GOA:B6IRA3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRA3"
FT                   /protein_id="ACI97989.1"
FT                   /translation="MAKKQAAKKKRMQVAALPYQMEDGHLRVLLVTSRETRRWILPKGW
FT                   TEKDLDGPGVAALEAYEEAGVRGVAAPKPIGSYQYFKRLSTGRTVPCDVKVYALEVMEE
FT                   LEDWPEAKERQRRWMSPSQAALHISETGLVDLLLRLGMPTVD"
FT   gene            complement(590444..591085)
FT                   /locus_tag="RC1_0553"
FT   CDS_pept        complement(590444..591085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0553"
FT                   /product="heme oxygenase"
FT                   /note="identified by match to protein family HMM PF00378
FT                   match to protein family HMM PF00725 match to protein family
FT                   HMM PF02737"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97990"
FT                   /db_xref="GOA:B6IRA4"
FT                   /db_xref="InterPro:IPR016053"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRA4"
FT                   /protein_id="ACI97990.1"
FT                   /translation="MIEAGSTGPEATRTPPRKTDLPVRLRLATRDQHVALEAQVDPERR
FT                   LRTLDGYLGWLGILLGFHRPLESVLGGLDWSETGLDFDQRRRTALLAADLEDLGLDPDS
FT                   APDCPDLPPVDGLARAFGALYVLEGSTLGGQVVVRQYGEVFGGLGGRAMRYYTSYGANI
FT                   GRQWRAFQQALATACADPEAETACIAAAQETFDALHAWVARCDAAAPRPV"
FT   gene            complement(591192..592436)
FT                   /pseudo
FT                   /locus_tag="RC1_0554"
FT   CDS_pept        complement(591192..592436)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0554"
FT                   /note="conserved hypothetical protein,
FT                   pseudogene;identified by match to protein family HMM
FT                   PF00107"
FT   gene            complement(592540..593907)
FT                   /gene="ctpA"
FT                   /locus_tag="RC1_0555"
FT   CDS_pept        complement(592540..593907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctpA"
FT                   /locus_tag="RC1_0555"
FT                   /product="carboxy-terminal processing protease CtpA"
FT                   /EC_number="3.4.21.102"
FT                   /note="TIGR00225 PF03572: Peptidase family S41B; PubMed:
FT                   9141685 Microbiology; 1997 Apr143 ( Pt 4):1221-33; This
FT                   article explains the characterization of this gene product;
FT                   identified by match to protein family HMM PF00106 match to
FT                   protein family HMM PF01370"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97991"
FT                   /db_xref="GOA:B6IRA5"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRA5"
FT                   /protein_id="ACI97991.1"
FT                   /translation="MRKFLTSVATVALLFTAPACAAAQSKQPAKSDTYKQLDLFVDVFE
FT                   RVRSEYVEQVSDEELIEAAINGMLTSLDPHSSYLNRKNFTDMQVQTRGEFGGLGIEVTQ
FT                   ENGVVKVVSPIDDTPAYRAGILPGDYITHINDEAVLGMSVSDAVEKMRGPAGTDIRITV
FT                   RRAEQAEPLQFTLTRAVIKVQSVRFRVEAENIGYIRISSFNEQTQPGLEKAIAKIEEQV
FT                   GDKLVGYVIDLRNNPGGLLEQAISVSDTFLERGEIVSTRGRKNGTGERYNAKSGDLARG
FT                   KPIVVLVNGGSASASEIVAGALQDHHRAIILGTQSFGKGSVQTIIPLQGQGAMRLTTAR
FT                   YYTPSGRSIQQLGISPDIEVQPARLEEIQQGQRRREADLPHALRNTDRPAGQQPAAPAA
FT                   PQAPQAPAGGEVQAPAAPQPTTAQGPGQEQPFDYQLARAVDLLRGVALFAQGKSIN"
FT   gene            complement(593909..595162)
FT                   /locus_tag="RC1_0556"
FT   CDS_pept        complement(593909..595162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0556"
FT                   /product="membrane-bound metallopeptidase, putative"
FT                   /note="PF01551 identified by match to protein family HMM
FT                   PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97992"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRA6"
FT                   /protein_id="ACI97992.1"
FT                   /translation="MATGPARKRRIATAGAGLLAVLLAGQVTAADTKQPDPQRELDRVQ
FT                   QDLKAGEAQRRQLDSAAEALESELADLRARAVQAATEQRRQEEALAHAEAALEAVARDE
FT                   AERSRRIDADRAAMAELLGALQRLSRLPPEALIARPEQPADTVRSALLLRALVPELKTR
FT                   ADGLAADLEKLAEVRTDLAARRDAAATAAAALGRQQREMAVLVARREELSRSTAAERKA
FT                   LDTKLTGLAAKAGDLKDLVDRLEAERRERDRKAAAEAARRATAEAEREKRARDSVAALG
FT                   RATGVPRLTGMIMPVAGEVTTRYGQADAFGGTSRGLTFKGRSGAVVVAPYDGSVLFAGP
FT                   FKGYGLILIVEHANGYHSLLAGLGRIDSQVGQRVLTGEPVGAMATDGSQSLYFELRRGG
FT                   QPINPLRGFAPSDGKGQG"
FT   gene            595542..596780
FT                   /gene="rocD"
FT                   /locus_tag="RC1_0557"
FT   CDS_pept        595542..596780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rocD"
FT                   /locus_tag="RC1_0557"
FT                   /product="ornithine aminotransferase"
FT                   /EC_number="2.6.1.13"
FT                   /note="synonym identified by match to protein family HMM
FT                   PF01636"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97993"
FT                   /db_xref="GOA:B6IRA7"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR010164"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR034757"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRA7"
FT                   /protein_id="ACI97993.1"
FT                   /translation="MDGGFGAAGGAMAIEARWCARNYRPLPVVISRAKGVWLWDSDGRR
FT                   YLDMMSAYSAVNVGHGHPRVLDALQQQAGRVAVVSRAFHTDRLGPFLARLCALAGLDAA
FT                   CPMNTGAEAVETAIKAARRWGHRVKGIPDGHAEIIVAEGNFHGRTTTIVGFSSEADYRD
FT                   GFGPFAPGFRAVPFGDAAAVEAAIGPHTAAVLVEPIQGEAGIVVPPGGYLRRLREICDR
FT                   HGVLLILDEVQSGLGRTGAWFAFEHEGIRPDGLCLGKALGGGVMPVSAFVARRGLIDMF
FT                   EPGNHGSTFGGNPLAAAVGEAALAVIEEEGLVARSAELGAHLMERLRRIDSPLVREVRG
FT                   RGLWVGVEIDPARVSARAVCEELMRRGVLSKETHETVIRLAPPLVIDRETLDHGIDRLE
FT                   EALAALAAGPAAA"
FT   gene            596812..597792
FT                   /locus_tag="RC1_0558"
FT   CDS_pept        596812..597792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0558"
FT                   /product="amidinotransferase, putative"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97994"
FT                   /db_xref="GOA:B6IRA8"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRA8"
FT                   /protein_id="ACI97994.1"
FT                   /translation="MTIDVTAPGQRPSAQPEPAPPRIIMCAPDHFEVSYTINPWMRPDE
FT                   WEARRSELSGAAAAGWSALRRRLQQLGAAVELVAPRSGLPDLVFTANAAVVLDGKALVA
FT                   RFRHPERRPEEPHFRRFFDGLAARGLLDEVHDMPPGVCLEGAGDCVHDAGRGVFFLGHG
FT                   FRSDREAAAVVADLFGEEVEPLELVDPRFYHMDTALCPLSGGEVLYVPGAFSAEGRGRL
FT                   RERIGADRLIEVPEADAVRLAANAVNLGRDVVLAEASDDLKAALAERGYSVHEVPIRSF
FT                   GLSGGSAFCLTLRLDRRSNRRSGRPVGGTGPGAAADAPGQPALLD"
FT   gene            597846..598343
FT                   /gene="lrp"
FT                   /locus_tag="RC1_0559"
FT   CDS_pept        597846..598343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lrp"
FT                   /locus_tag="RC1_0559"
FT                   /product="leucine-responsive regulatory protein"
FT                   /note="Gene symbol synonyms identified by match to protein
FT                   family HMM PF01126"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97995"
FT                   /db_xref="GOA:B6IRA9"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRA9"
FT                   /protein_id="ACI97995.1"
FT                   /translation="MRRRLDQIDLRILQELQDDGRITNQALSERVGLSPRPCLERVRRL
FT                   EKEGLIVRYQALVDVRKLQSCVFVLAQVALEKQGRDARHRFERRLRDTPEVIECFEVSG
FT                   PFDYIAKLVCEDLDAYQDLTTGWIDDPELGVARVVTNVVLRPVRDFGRYPIFAGEGPAS
FT                   AG"
FT   gene            complement(598363..598719)
FT                   /gene="nolR"
FT                   /locus_tag="RC1_0560"
FT   CDS_pept        complement(598363..598719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nolR"
FT                   /locus_tag="RC1_0560"
FT                   /product="nodulation protein NolR"
FT                   /note="identified by match to protein family HMM PF04748"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97996"
FT                   /db_xref="GOA:B6IRB0"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRB0"
FT                   /protein_id="ACI97996.1"
FT                   /translation="MNVNVLKVNARRAAALLKAMANERRILILCHLMEQERSVGELERL
FT                   VGLSQSALSQHLARLRRDKLVRTRRSAQTIYYSLNGDAAPLIMASLLELFGSEGPRVRR
FT                   DGKSPPCAPEPVGF"
FT   gene            598817..599047
FT                   /locus_tag="RC1_0561"
FT   CDS_pept        598817..599047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0561"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF00595
FT                   match to protein family HMM PF03572 match to protein family
FT                   HMM TIGR00225"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97997"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRB1"
FT                   /protein_id="ACI97997.1"
FT                   /translation="MDADRSLDCTGLVCPLPVLRARKVLSGMAPGQVLAVSATDPAAPR
FT                   DFDAFCAAAGHTLLDREERDGVFGFRIRRGG"
FT   gene            599145..600071
FT                   /locus_tag="RC1_0562"
FT   CDS_pept        599145..600071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0562"
FT                   /product="histone deacetylase"
FT                   /note="identified by match to protein family HMM PF01551"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97998"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRB2"
FT                   /protein_id="ACI97998.1"
FT                   /translation="MHTALFTHSACLDHDTGEGHPECQERLRAVLRALEDEAFMFLDRR
FT                   EAPRVTREQLERVHPASYLDSLEAAMPQSGYATLDADTLVSPGSWEAALRSAGAVCAAI
FT                   DAVLAGEARNAFCAVRPPGHHAEPDKAMGFCLFNNVAVGAAHARACGLRRVAIIDFDVH
FT                   HGNGTQTYCQHDPSLLYLSTHQWPLYPGTGSAREHGDYDNVVNACLGPMSGSPEFRHAV
FT                   QTKLLPRLDAFRPEILLISAGFDAHSRDPMAGLHLMEDDFAWVTEKLGEVAAKHAAGRM
FT                   VSALEGGYDLRALANSAAVHVKVLMAV"
FT   gene            600130..600381
FT                   /gene="xseB"
FT                   /locus_tag="RC1_0563"
FT   CDS_pept        600130..600381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="RC1_0563"
FT                   /product="exodeoxyribonuclease VII, small subunit,
FT                   putative"
FT                   /EC_number="3.1.11.6"
FT                   /note="identified by match to protein family HMM PF00202
FT                   match to protein family HMM TIGR01885"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACI97999"
FT                   /db_xref="GOA:B6IRB3"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRB3"
FT                   /protein_id="ACI97999.1"
FT                   /translation="MTDSSLPSDIAALSFEDALAELERIVRQLEEGKARLDDAIRFYER
FT                   GTLLKRHCEMKLRDAQQKVDRITVAADGALAAEPARLD"
FT   gene            600405..601295
FT                   /gene="ispA"
FT                   /locus_tag="RC1_0564"
FT   CDS_pept        600405..601295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispA"
FT                   /locus_tag="RC1_0564"
FT                   /product="geranylgeranyl pyrophosphate synthase"
FT                   /EC_number="2.5.1.10"
FT                   /note="[Synonyms] Geranyltranstransferase
FT                   Farnesyl-diphosphate synt Hase identified by match to
FT                   protein family HMM PF02274"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98000"
FT                   /db_xref="GOA:B6IRB4"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRB4"
FT                   /protein_id="ACI98000.1"
FT                   /translation="MPKTLTAAMADTVEQVEAAIDVLLPRVDLPEARLFEAMRYGCLGG
FT                   GKRLRPFLVMESARLFGVNPACALRAAAAVEFIHCYSLVHDDLPAMDDSDLRRGRPTLH
FT                   LEYDEATAILAGDALLTVAFEILADPETHEDAQVRCRLVSALAKAAGPRGMVGGQMLDL
FT                   MAEDRTFDIGAITRLQRLKTGELIAFSATAGAILGRASPPQHHALQAYAHDLGLAFQIA
FT                   DDLLDVEGTEAETGKSVGRDEGANKATFVSILGVERAREQAGRLADQAMAHLDIFEDRA
FT                   DMLKQVARYVVDRRS"
FT   gene            601340..603268
FT                   /gene="dxs"
FT                   /locus_tag="RC1_0565"
FT   CDS_pept        601340..603268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxs"
FT                   /locus_tag="RC1_0565"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98001"
FT                   /db_xref="GOA:B6IRB5"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6IRB5"
FT                   /protein_id="ACI98001.1"
FT                   /translation="MMVESKTPLLDTVNTPEDLRKLDPSQLRQFADELRTETINAVSVT
FT                   GGHLGAGLGVVELTVALHYVFNTPADRLIWDVGHQCYPHKILTGRRDRIRTLRMGGGLS
FT                   GFTKRAESEYDPFGAGHSSTSISAALGMAVGRDQLGHKNHVICVIGDGSISAGMAYEAM
FT                   NNAGAMNSRMIVILNDNDMSIAPPVGAMSGYLSRLISSRQYRGLRELGKQVAERLPRPL
FT                   QEAARRAEEYARGFVTGGTLFEEMGFYYVGPIDGHNLDHLLPVLENIRDDQGTGPVLIH
FT                   AVTQKGRGYGPAERSADKLHAVSKFDVITGAQAKAKANAPSYTRVFADSLIQEAEADSR
FT                   VVAITAAMPSGTGLDLFEKRFPDRTYDVGIAEQHAVTFAAGLAAEGLKPFCAIYSTFLQ
FT                   RAYDQVVHDVCIQNLPVRFAIDRAGLVGSDGCTHAGSFDVAYLGCVPNIVIMAAADEAE
FT                   LKHMVATAAAYDHGPIAVRYPRGEGVGLEMPERGQVLEIGKGRIVKEGTKVAILSLGTR
FT                   LKEALLAAEDLNARGLSTTVADARFAKPIDEALIRRLAQDHEVLITVEEGSIGGFGSYV
FT                   LHFLAQSGLLDQGLKVRPMVLPDIFQDQDAPAKQYDEAGLNARHIVETALKALGTGLAA
FT                   ETPAARA"
FT   gene            complement(603330..603518)
FT                   /locus_tag="RC1_0566"
FT   CDS_pept        complement(603330..603518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0566"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98002"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRB6"
FT                   /protein_id="ACI98002.1"
FT                   /translation="MTGRLSLDAMERYSAAFAARMETDCSGRDPSEEETRIHSEDAALF
FT                   LAEIRALSAADGPCQPP"
FT   gene            complement(603725..603913)
FT                   /locus_tag="RC1_0567"
FT   CDS_pept        complement(603725..603913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0567"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01206"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98003"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRB7"
FT                   /protein_id="ACI98003.1"
FT                   /translation="MLCCAPWTRASAPGGRTASAYPAGGADRTAGQGHHLARAADGEGD
FT                   RPAASLLPEGRARRGAV"
FT   gene            complement(603964..604119)
FT                   /locus_tag="RC1_0568"
FT   CDS_pept        complement(603964..604119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0568"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98004"
FT                   /db_xref="GOA:B6IRB8"
FT                   /db_xref="InterPro:IPR012556"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRB8"
FT                   /protein_id="ACI98004.1"
FT                   /translation="MQRTPRHRIAAALTLAAALFALAACNTVEGIGKDIQKAGQAIEGA
FT                   GQKGKK"
FT   gene            604184..604924
FT                   /gene="tlyA"
FT                   /locus_tag="RC1_0569"
FT   CDS_pept        604184..604924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlyA"
FT                   /locus_tag="RC1_0569"
FT                   /product="hemolysin A, putative"
FT                   /note="identified by match to protein family HMM PF00850"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98005"
FT                   /db_xref="GOA:B6IRB9"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRB9"
FT                   /protein_id="ACI98005.1"
FT                   /translation="MPKTRVDQALVDRGLAESRSKAQALVLAGLVFTGTRRIDKAGDTV
FT                   AADQPLTVKGQEHPWVSRGGLKLVKGLDTFGIDPAGFVCLDVGASTGGFTDVLLSRGAA
FT                   RVYAVDVGHGQLAWKLREDPRVVVLEKTNARHLTAEQVPEPVDLVVCDASFIGLETVLP
FT                   APLALARPGAGLVALIKPQFEVGKGRVGKGGVVREPELHQEVCERIGGWLAGLPGWSVL
FT                   GIVESPIQGPEGNREFLIGGRRDG"
FT   gene            complement(605002..606789)
FT                   /gene="sppA"
FT                   /locus_tag="RC1_0570"
FT   CDS_pept        complement(605002..606789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sppA"
FT                   /locus_tag="RC1_0570"
FT                   /product="signal peptide peptidase SppA, 67K type"
FT                   /EC_number="3.4.21.-"
FT                   /note="PF01343 TIGR00705: signal peptide peptidase SppA,
FT                   67K type, With a good score; PubMed: 3522590 'Molecular
FT                   cloning and sequencing of the sppA gene and
FT                   characterization of the encoded pr identified by match to
FT                   protein family HMM PF02609 match to protein family HMM
FT                   TIGR01280"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98006"
FT                   /db_xref="GOA:B6IRC0"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004634"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRC0"
FT                   /protein_id="ACI98006.1"
FT                   /translation="MMKVIVRIFAVIGLLAVLLVGGAVAIGMMLSPGRPTLPDSVVLEL
FT                   DLEKPLSEQAPGNPFAALSSDQTATLHDVVATLDRAARDPRVKGLIARAGTAEGGVATL
FT                   QELRDAVERFRAAGKFALVHAETFGEFSPGMQSYYLATAFDEIWLQPVGTVGITGILSE
FT                   RPLLRGTLEKLKIEPQIDKRYEYKTAAEQFMEREPTPANEEMTESLIGDLYEQMVAGIA
FT                   ADRKLPIDAVNAAVDRAPLLDKEALELKLVDRLGYYDELVETAKERTRSDKGTAKTVAL
FT                   TAYRDAAEETDAQAPVVALVVGEGGIARGESDDNPVTGSEGFGATDVAKAINAAAADSS
FT                   VKAILFRVNSPGGSAVGSEVVRRAVKRAREQGKPVIVSMGDLAASGGYWVSMDADRIVA
FT                   QPGTFTGSIGVLGGKLVTSGLTDMLGVNYGMTSRGRNATMWTTQQPYTPAELDRRAALL
FT                   DDIYAQFTTGVSAGRNLPLEKVQEVAKGRVWTGRQAKEIGLVDALGGYATALSLAREVM
FT                   GLSADAPVRVALFPKPKSQFELIMSLFDGGARVQLGQWVLADALAEYRPLLTQVEPLLR
FT                   ATRTEEQTVLMPPVGIAGH"
FT   gene            607021..608520
FT                   /gene="pabB"
FT                   /locus_tag="RC1_0571"
FT   CDS_pept        607021..608520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabB"
FT                   /locus_tag="RC1_0571"
FT                   /product="para-aminobenzoate synthase, component I"
FT                   /EC_number="4.1.3.-"
FT                   /note="identified by match to protein family HMM PF00348"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98007"
FT                   /db_xref="GOA:B6IRC1"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRC1"
FT                   /protein_id="ACI98007.1"
FT                   /translation="MTAAPVILDLPPFDPADAFTALAGRPRALLLDGAASPDRGRFSYI
FT                   VADPLAWLEAGPTGVTLDGVAPESCGGSGDPFALLETLLARGRRPAVPGLPPFQGGAVG
FT                   ILGYELGGRLERLPLPQAAGLAFPDMAVGLYDTVAAFDHAAGRAWVIGPDRARAQALAD
FT                   DLRRGAALAAETAAGEASAGEGESLLTPPGWQAEQTPERFRAAIARILDYIRAGDVYQV
FT                   NYTQRFLGRLAPGATPWRAYRALRRRTAAPFSACLDLGGGRVVASGSPERFLSLTADGR
FT                   IETRPIKGTRPRGATPEADAALAAELLASGKDRAENLMIVDLLRNDLSRVAAVGSVRVP
FT                   ALQTLESYRTVHHMVSVVEARLRPGLGPVDLLRAAFPGGSITGAPKIRAMQIIRDLEPA
FT                   RRGPYCGSVVWIGWDGAMDSSIVIRTLCAAGDRVQVQAGGGIVADSDPEAEYQESLTKA
FT                   RAVLLALDPAMPWPAAPRPATPRPATPCPPAADDGGQEAAE"
FT   gene            608517..609332
FT                   /gene="ilvE"
FT                   /locus_tag="RC1_0573"
FT   CDS_pept        608517..609332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="RC1_0573"
FT                   /product="branched-chain-amino-acid aminotransferase,
FT                   putative"
FT                   /EC_number="2.6.1.42"
FT                   /note="[Synonyms] Transaminase B"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98008"
FT                   /db_xref="GOA:B6IRC2"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRC2"
FT                   /protein_id="ACI98008.1"
FT                   /translation="MTPILWLDGTLRPAGEGRVDPGDRGLLLGDGLFETICVRGGRALR
FT                   LEAHFARLRTGAGILGLPVPAGDDALADALEQVVRANGLADAVVRLTLTAGPGPRGLPR
FT                   PAPPRPTLLLTAGPLPLPPPPARLLVARSTRRNEHSPLSRVKSLNYLDSILARREAAAA
FT                   GADDAVLLNTAGRVAEASAANLFLRLDCGWVTPPVSEGALPGTMRAVLAEAWDAAERPV
FT                   TVADLHRADAIVLTTALGVREVAGMLEPAALPEAAPPGTSPLSSNGSPR"
FT   gene            complement(609307..609501)
FT                   /locus_tag="RC1_0572"
FT   CDS_pept        complement(609307..609501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0572"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF02779
FT                   match to protein family HMM PF02780 match to protein family
FT                   HMM TIGR00204"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98009"
FT                   /db_xref="InterPro:IPR007423"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRC3"
FT                   /protein_id="ACI98009.1"
FT                   /translation="MAVAGPASFLRTAWQALREISGDDAYDRYLERHAATHPEEPPLDR
FT                   EAFYLSELDRRFSGVTRCC"
FT   gene            complement(609507..611573)
FT                   /gene="cstA"
FT                   /locus_tag="RC1_0574"
FT   CDS_pept        complement(609507..611573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cstA"
FT                   /locus_tag="RC1_0574"
FT                   /product="Carbon starvation protein CstA"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98010"
FT                   /db_xref="GOA:B6IRC4"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRC4"
FT                   /protein_id="ACI98010.1"
FT                   /translation="MSAVMRNLVWVVIGALGAVCLGVIALNRGETINAFWFIAAAAGVY
FT                   AVAYRLYAGWIAARVMSADPGRATPAQRLNDGRDYVPTHRWITFGHHFAAIAGAGPLVG
FT                   PTLAAQFGYLPGTLWLLAGAVLGGCVQDMIILWCSTRRDGRTLGQMARDEMGPIAGTAA
FT                   LIGTLLIMVLIVAVLGLVVVNAMKHSPWGTFTVAMTIPIAILVGIYMRTIRPGRVLEGS
FT                   LIGLVLLLAATVGGGWVAHHPVLGPLFDFDGPELALMVIGYGLVAAIMPVWLLLAPRDY
FT                   ISTFIKIGAILLLAFAVVILRPDMHMPALTRFVDGTGPVVAGDIYPFLFITIACGAVSG
FT                   FHALISSGTTPKLIANEADLRLVGYGSMAMESFVGIMALVAACVLEPGVYFAINSAAGV
FT                   VGATAEQATATITAWGFPVTPERMQELATAMGESTLFHRTGGAPSLAVGMATIFAGAFG
FT                   QGLLAVWYHFAIMFEALFILTAVDAGTRVGRFMLQDMLGNLWRPLGNTSSYPSTVVCSA
FT                   VFVAMWGYFLYIGVIDPLGGINILWPLFGISNQMLAAIALAVASTILVKSGKLRYVWVT
FT                   AAPAAFLAVTTTVAAWEKLFSADPRVGFLAGADALAAKLAAGTLPAAQLAAAPKLIFNQ
FT                   RLDAALTVFFVIVLWVTIVEAVRISRRHIAGRSVPPLTETPRVPLGAVPAAGD"
FT   gene            complement(611688..612326)
FT                   /locus_tag="RC1_0575"
FT   CDS_pept        complement(611688..612326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0575"
FT                   /product="3'-5' exonuclease"
FT                   /note="Has some homology to DNA polymerase III, epsilon
FT                   subunit; identified by match to protein family HMM PF08085"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98011"
FT                   /db_xref="GOA:B6IRC5"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRC5"
FT                   /protein_id="ACI98011.1"
FT                   /translation="MPVPPPLLAIDFETANEQRASACSIGLCRVENGRVVRTAEYLIRP
FT                   PELRFTPFTIAIHGIRPEDVVDAPEFPDIWDAMRPELEGAVLLAHNASFDMSVLRAMLG
FT                   TYGLAVPDHGYLCTLVAARRAWPDLEKHRLNHLARQFGIELEHHRAGSDARACAAIALR
FT                   AMADCGAAGPAELAAALGIGLGALGPATHQPCRALPRSATKPVRTAVMR"
FT   gene            complement(612379..613518)
FT                   /gene="aroC"
FT                   /locus_tag="RC1_0576"
FT   CDS_pept        complement(612379..613518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroC"
FT                   /locus_tag="RC1_0576"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="identified by match to protein family HMM PF01479
FT                   match to protein family HMM PF01728 match to protein family
FT                   HMM TIGR00478"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98012"
FT                   /db_xref="GOA:B6IRC6"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6IRC6"
FT                   /protein_id="ACI98012.1"
FT                   /translation="MAGNSFGTLFRFTTFGESHGPAIGCIVDGVPPRLPLDEAFIQGFL
FT                   DRRRPGQSRFVTQRQEPDAVRILSGVFEGLTTGTPVMLEIVNQDQRSRDYGEIRDRFRP
FT                   GHADWTYQAKYGIRDHRGGGRSSARETASRVAAGAVARRVLETAPAPVTVRGALVQVGP
FT                   HRVDRARWDWAEVERNPFFCPDAGTAALWADYLDGVRKAGSSIGAVVEVVASGVPAGWG
FT                   EPIYDKLDGDLARAMMTINAVKGVEIGAGFAAAELSGEENADEMRAGPDGQPLFLSNRA
FT                   GGILGGISTGQDIVVRFAVKPTSSILTPRRTIDTAGHETEIVTKGRHDPCVGIRAVPVG
FT                   EAMMACVLADHFLRHRALVGAPGPVGNGGPVEDGDPVGG"
FT   gene            complement(613551..614393)
FT                   /gene="fabI"
FT                   /locus_tag="RC1_0577"
FT   CDS_pept        complement(613551..614393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabI"
FT                   /locus_tag="RC1_0577"
FT                   /product="Enoyl-[acyl-carrier-protein] reductase (NADH)"
FT                   /EC_number="1.3.1.9"
FT                   /note="[synonyms] NADH-dependent enoyl-ACP reductase
FT                   identified by match to protein family HMM PF01343 match to
FT                   protein family HMM TIGR00705 match to protein family HMM
FT                   TIGR00706"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98013"
FT                   /db_xref="GOA:B6IRC7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRC7"
FT                   /protein_id="ACI98013.1"
FT                   /translation="MTTSSSLMAGKRGLIMGVANDRSIAWGIAQAVRAQGAQLGFTYVG
FT                   DALLKRVRPLAEQAGSDLILPCDVTDEASIDAAFATVKERWGGLDFVVHAIAFSDKNEL
FT                   DGLYLNTTRANFARTMDISCYSFTAVAQRAVPLMQPGGSLLTLSYYGAEQVMPHYNVMG
FT                   VAKAALESSVMYLANDLGPKGIRVNSISAGPIKTLAASGIGDFRFILKWNELNAPLRRN
FT                   VTIQDVGNAALFLLSDLGGGVTGENLHVDAGYHTVGMAAVDSAAETAKLLQSLGGDAG"
FT   gene            614624..615958
FT                   /gene="rbn"
FT                   /locus_tag="RC1_0578"
FT   CDS_pept        614624..615958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbn"
FT                   /locus_tag="RC1_0578"
FT                   /product="tRNA-processing ribonuclease BN"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by match to protein family HMM PF00425
FT                   match to protein family HMM PF04715 match to protein family
FT                   HMM TIGR00553"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98014"
FT                   /db_xref="GOA:B6IRC8"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="InterPro:IPR023679"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6IRC8"
FT                   /protein_id="ACI98014.1"
FT                   /translation="MLTSDRLRGMLRRLPGRLPDAVGVVRHAVPRFWNNNGFAIAASLT
FT                   YTTLLALVPLLTVTFAIFSAFPAYGRLRDTARELIFDSLAPSVSDEVQAYFDQFISNAA
FT                   ALTGFGVIGLSLTSILLFFSVEAALNVIFRATEPRPLVIRLLSFWAVLTIMPLLLGASL
FT                   SVTSGVVADLQATGRDAVTVLRFMLPGLLEAAAFTLMFLMIPNREVQWFDALVGGIAAA
FT                   LLMEVSKVGFGLYIAAFPTYETIYGALSVIPIFLFWLYTVWSVVLFGAEITATLPEWRA
FT                   GKITQVGPEGLLSAQRIVVAVAILHELQRAARLGVGIRRGTLSTRVPVGANVIDGMLEQ
FT                   LQAAHWVARTRDGAWVATRNLSDATVDDLRHSLGMAIRGNLRSVGHLSAGWQNRLADLF
FT                   ERAEAADREVLGVCFADLFADPPSGQPSGQVETAVRQRTGLQGRI"
FT   gene            complement(616105..616272)
FT                   /locus_tag="RC1_0579"
FT   CDS_pept        complement(616105..616272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0579"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98015"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRC9"
FT                   /protein_id="ACI98015.1"
FT                   /translation="MKSTVAPHPPLGRDVRGSCGCGYTRGRVHALRIPHSWLPEISDDL
FT                   HGGATLRQNP"
FT   gene            616291..619257
FT                   /locus_tag="RC1_0580"
FT   CDS_pept        616291..619257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0580"
FT                   /product="TonB-dependent receptor, putative"
FT                   /note="identified by match to protein family HMM PF01063"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98016"
FT                   /db_xref="GOA:B6IRD0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRD0"
FT                   /protein_id="ACI98016.1"
FT                   /translation="MKMTDTQRRVRRAALLAGAAVALAMPAMVPVHAVAQEAGALEEIV
FT                   VTGSRIRAPNLVSTSPVTAVTGEDIKAQGVTRVEDLVNSLPQAFAAQGGQVSNGSTGTA
FT                   TVNLRGLGSSRTLVLIDGRRLMPGDPSVPSPDLNFIPSSLVQRVDVNTGGASAVYGSDA
FT                   IAGVVNFIMERDFEGVRVDVQHGFYMHHNENDDVQSIIRAKSASASVPTDFAVPDSNVT
FT                   DGEQSEATLVIGANSADGKGNVTAYAGYREIKAVLQGDRDFSACSLNSGDVFTCGGSGT
FT                   AYPARFGNWVVDPAGPGNTFRARNASTDVYNFGPTNYYQRPDERYVLGAFAHYEIQPWA
FT                   DVYADVMYMDDRSIYQIAPGGIFAGTFSVNCDNPFMTPTQQQQLCGANAGTQNNFTGTI
FT                   ARRNIEGGGRQGDMRHSAYRFVTGVRGDITDEWNYDAYLQYGATSFNRAQTGFFQTQKI
FT                   RNALIARRDANGNIVCQAAIDGSDTSCVPYNIFKIGGVTQEALDYLETPSYATGNTEEM
FT                   ILSASLAGDLTNYGVVSPFATSGVGVAFGIEYRSEYLDSASDYTAAAGLLNGSGGASLP
FT                   VEGDFDTKEIYGEIRIPLVEDKPFAQSLELDAGFRYSEYSSVGSTDAYKAGLIWSPVSD
FT                   LRFRGSFQRAVRAPNILELYDPQVVQLDGSTDPCAGLSAGDALVARCAQAFGLTAAQVL
FT                   AIEENPASQYNGQNGGNPNLDPETSDTYSIGVVLTPEFAPGLTVSFDYFDIKVEDYISG
FT                   IGADLIISRCLETLDPYFCGLVNRDANGSLWLSDQGYITNTTLNTGSLKTTGIDVNIDY
FT                   SLDLEDVGLNNAGSLAFTMAGTWLDTLKTQPLPNDKAYDCTGYYGTVCGTPNPEWRHKA
FT                   RLTWTTPITGLTLSTQWRYYSKAELDATSDQPGLNNPAQVAGTDLKLGTQNYFDATITY
FT                   QFLESYTLRIGANNIFDRDPPLTGSANCPTGPCNGNTWPQVYQDAMGRYVFVGLTAKY"
FT   gene            619428..619952
FT                   /locus_tag="RC1_0581"
FT   CDS_pept        619428..619952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0581"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02554"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98017"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRD1"
FT                   /protein_id="ACI98017.1"
FT                   /translation="MRRPSLPVLLLGLPVLLAAAPASAQPVPPVAAVLGCLDLPDGPER
FT                   LACFNRTVPALRAAVPPAASSGAVPRVGAVSAPPAAAPDQSFAAEQLPRATEPGAEPVR
FT                   MTATVTEVGRDPSTGRLLVTLDNGQVWMQREAAAIRLKTGMSVTVKPGLFGSYAMVPED
FT                   GATMMKVRRVR"
FT   gene            complement(619989..620882)
FT                   /locus_tag="RC1_0582"
FT   CDS_pept        complement(619989..620882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0582"
FT                   /product="DnaJ family, molecular chaperone, putative"
FT                   /note="PF01556 PF00226: DnaJ domain; Has many homologs from
FT                   the same family; identified by match to protein family HMM
FT                   PF00929"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98018"
FT                   /db_xref="GOA:B6IRD2"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRD2"
FT                   /protein_id="ACI98018.1"
FT                   /translation="MRDPYQILGVGRTASAEEIKQAYRRLAKQYHPDLNPGRTDIELKF
FT                   KEVNGAYSLLSDADKRARFDRGEIDASGAERPDRSFRRAYAGAGRDDPFDFSDDPFADL
FT                   FGATRRRYGTGSKGRGSDVAYSVTVPFADACLGTKRRLTLSTGKSIDVTIPPGTRDQTK
FT                   LRLKGQGLAGVGGAPAGDAIVEVHVDPHPYFVRREDDIHMDVPVTLQEALLGATIKVPT
FT                   LDGLVAVKVPKGSNTGSVLRLKGKGVFSPERKAHGDQYVKLTVVLPERPDADLTAFVEK
FT                   WAKSHDYDVRRKAGLG"
FT   gene            complement(620988..621461)
FT                   /gene="omp"
FT                   /locus_tag="RC1_0583"
FT   CDS_pept        complement(620988..621461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="omp"
FT                   /locus_tag="RC1_0583"
FT                   /product="rickettsia 17 kDa surface antigen, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98019"
FT                   /db_xref="GOA:B6IRD3"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="InterPro:IPR016364"
FT                   /db_xref="InterPro:IPR032635"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRD3"
FT                   /protein_id="ACI98019.1"
FT                   /translation="MIRKVVLVAVTTAMLAGCTSTGGQKQGAGAVLGGLAGGLAGSQIG
FT                   GGSGRLWATGAGVLLGALIGSEVGASLDRADQLALERNTRTAWDRSTPLNQPIIWDNPD
FT                   NGNRVVVTPTREGRTQAGAYCREFQQRITVGGRSEEAYGQACQQPDGSWKIVS"
FT   gene            621578..622246
FT                   /gene="pdxH"
FT                   /locus_tag="RC1_0584"
FT   CDS_pept        621578..622246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxH"
FT                   /locus_tag="RC1_0584"
FT                   /product="pyridoxamine 5'-phosphate oxidase"
FT                   /EC_number="1.4.3.5"
FT                   /note="[synonyms] PNP"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98020"
FT                   /db_xref="GOA:B6IRD4"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRD4"
FT                   /protein_id="ACI98020.1"
FT                   /translation="MFPIVVGNSGATMTQVTAMNAVPSPLSPAEAPADPFLFFRDWLAE
FT                   AERTEPNDPTAMSLATVDADGRPSLRIVLLKGLDERGFVFYTNTESRKGFQLAARPVAA
FT                   LCFHWKSLRRQVRIEGAVERVTEAEADAYFASRPRGSRIGAWASQQSRPLESRAVLQHR
FT                   VAETEARYDGQEVPRPPHWSGYRVLPDDIEFWQDGEFRLHDRFRYRRSATGWTCQRLYP
FT                   "
FT   gene            622319..623284
FT                   /locus_tag="RC1_0585"
FT   CDS_pept        622319..623284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0585"
FT                   /product="cation efflux family protein"
FT                   /note="identified by match to protein family HMM PF03631
FT                   match to protein family HMM TIGR00765"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98021"
FT                   /db_xref="GOA:B6IRD5"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRD5"
FT                   /protein_id="ACI98021.1"
FT                   /translation="MNTDHMQDREGAARWRRRAAYASIAVALTLIAVKLATYLSTGSVS
FT                   ILSSLIDSSVDALASVVTLLGVAQALTPPDAAHRFGHGKAEPLAALAQSAFITGSAVFL
FT                   GYEAIGRLVDPRPVDSTGLGIAVMVFAIVMTAGLVTFQRWVIERTGSIAIDADSLHYRG
FT                   DLLMNLAVIAALVLTRVTGSGYWDPLFALGIAGFLVWNALRIAETALDVLMDRELPDDD
FT                   RARVVALVLAHPQARGLHDLRTRSTGVGQHIDFHLELDSDLTLAEAHDITDEIELRLRE
FT                   AFPSADFSIHQEPEGLDDDRLDNRIAEARAAARSGLLSGR"
FT   gene            623448..624278
FT                   /locus_tag="RC1_0586"
FT   CDS_pept        623448..624278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0586"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98022"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRD6"
FT                   /protein_id="ACI98022.1"
FT                   /translation="MDFRVTFWGVRGTFPCAYASHLGFGGNTSCVEVQAGDRTLLLDAG
FT                   SGLRAAGKHLRRDGIKHATMLVTHTHWDHITGFPFFEPAYCPDFSMDILGGHLQGVACI
FT                   SEALATCMESPLFPVPLETMRADLRFSWIQPGDVLDIDRGITIRTASMNHPGGAIGYRI
FT                   ECAGRSVCYVTDTEHVPGLMDASILRLIEGADMVIYDASYTDEEFEQRRGWGHSTWSEG
FT                   VKLCQEAGARRLCLFHHDPDHDDAAMTAIERAARERMPTAFAAREGTTLDLRRD"
FT   gene            624393..624938
FT                   /locus_tag="RC1_0587"
FT   CDS_pept        624393..624938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0587"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98023"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRD7"
FT                   /protein_id="ACI98023.1"
FT                   /translation="MSRTASIPPAAASLLILLLTAPAAAGQSAAPAPSGTAVPAAQEKA
FT                   AQELERQRAADRVETLTGSDAPVTAPDPGVGVTGGDWAAETVPPAPADGAAPQGPGTDA
FT                   AGVDTAGRAQDGPPLPDVPEAIGEEMTDQGIAGIDAPQPGSAGAGQGDAVRPSGNRPSE
FT                   GRPSEARRSGVPAGQDGG"
FT   gene            625122..626174
FT                   /locus_tag="RC1_0588"
FT   CDS_pept        625122..626174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0588"
FT                   /product="PRC1_-barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98024"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRD8"
FT                   /protein_id="ACI98024.1"
FT                   /translation="MRHRLLFGTALAVVIGASSLTQAQPGGTAPGTDRRPVGEPGREDT
FT                   LTLPPGGQPPAGLADTSVAERLQGASQRLAQAQQQLGQGGQNQEQLGQVRAALTQVRQT
FT                   LGDLSRHADTGRAMQAVEKAEQALAQGGGQQATQQIAQVQSELQLLQRAAVAADRPSGQ
FT                   DGTRKDQTADVQSSGAQQMSGPQSGSAQAGSAQSSNAQSSNAQAPGSAQGQPAGQSQQS
FT                   AAQGQSAGQPPSGPSGGSAGPAQPQQTLAQAEALLGKRVQVSDGSEIGYVEDLVIDRSS
FT                   GRVRGVVLTRGTEGMGGANILVPWEQASIDPQAGVLKLGMSEQEVMALPTFTYEQMEES
FT                   MVGLFGQQQD"
FT   gene            complement(626277..627455)
FT                   /gene="cobW"
FT                   /locus_tag="RC1_0589"
FT   CDS_pept        complement(626277..627455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobW"
FT                   /locus_tag="RC1_0589"
FT                   /product="cobalamin synthesis protein CobW, putative"
FT                   /note="identified by match to protein family HMM PF00226
FT                   match to protein family HMM PF01556"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98025"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRD9"
FT                   /protein_id="ACI98025.1"
FT                   /translation="MTDQQQPPSPPPRLPVSVLTGFLGSGKTTLLSRLIRDPAMARTAV
FT                   IINEFGEVGLDHLLVAKADENTVLMDSGCICCTIRSDLADTLRDLYMRQLRGEITGFDR
FT                   VVIETTGLADPAPILHTLMTDPLIASRFRLDGVVTTVDAVHGMGQLDAHEESLKQAAVA
FT                   DRLVLTKTDLAAPEKVARLKARLKAINPAAAVVDAQTGGALPVLLFDAGLYNPATKSLD
FT                   VQRWLKAEAYEPHGHDHGHDHHHHGHDHGHDHDDGHDHSHCDHAHGHCDHDHDHGHDHA
FT                   HDPNRHGDAIRSFCLTAEDRLSWEALVSFFETLAQLQGENILRVKGLLNVEESDRPIVV
FT                   HGVQHLFHPPVQLDAWPSDDHRTRIVFIVKDLSREVVETLFRACTGQGSAHT"
FT   gene            complement(627515..627985)
FT                   /gene="zur"
FT                   /locus_tag="RC1_0590"
FT   CDS_pept        complement(627515..627985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zur"
FT                   /locus_tag="RC1_0590"
FT                   /product="zinc uptake regulation protein"
FT                   /note="Alternate name identified by match to protein family
FT                   HMM PF05433"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98026"
FT                   /db_xref="GOA:B6IRE0"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRE0"
FT                   /protein_id="ACI98026.1"
FT                   /translation="MRSHSAHDHGVCIEEAMERARTLCAGRGARLTQLRERVLRLVWSS
FT                   HRPRGAYAVLDDLARQDGRAVAPLTVYRALDFLVEQGLVHRIESLNAYIGCTEPGQTHA
FT                   GQFLVCQCCGNAAELNDPEIARAVAEGARARGFTAVRQTVEVIGLCPACQGA"
FT   gene            628209..629021
FT                   /locus_tag="RC1_0591"
FT   CDS_pept        628209..629021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0591"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98027"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRE1"
FT                   /protein_id="ACI98027.1"
FT                   /translation="MRARFGAGFPAGLLLAVALMAATVAAGMTAAAATVPAAGRLAFSV
FT                   FRNGDSTMGWHRLDFHRDGDRLVVEKEIRFEVKVAFFTAYRYVHTNREVWQGDRLVALE
FT                   TSTDDDGRRHWVRGRATPEGFAVESSRGALLAPADVVPTSYWNIRTVGTTRLLDTQRGV
FT                   LMDVRVEPLGAEPVAAAGSVVEARHFRLHFLSNRPGATDFVDIWYDDADAWVKLAFRAK
FT                   GQDIVYRLDAPGALPQQPPAQPAVTRAADTPQADTPRPGKFQAAAPSL"
FT   gene            629023..630642
FT                   /locus_tag="RC1_0592"
FT   CDS_pept        629023..630642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0592"
FT                   /product="deoxyribodipyrimidine photolyase-like protein"
FT                   /note="identified by match to protein family HMM PF01545
FT                   match to protein family HMM TIGR01297"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98028"
FT                   /db_xref="GOA:B6IRE2"
FT                   /db_xref="InterPro:IPR007357"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRE2"
FT                   /protein_id="ACI98028.1"
FT                   /translation="MPGTLRFVLGDQLSRGISSLRGLDPAADTVLLAEVAAETEYVPHH
FT                   PKKIALILAAMRHFSAALRADGVRVDHVRLDDPGNSGSFRGELLRAVERHRPDRVVVTF
FT                   PGEWRVWTDMKGWEAAAGVPVEIRDDDRFFCPPRRFRAWAAGRRQLRMEFFYREMRRET
FT                   GLLLTPDGEPEGGAWNYDTDNRKPLPRGLEPPPRFDVRPDALTAEVLALVRARFAERFG
FT                   ELEPFRFAVTAAGAEAAFEHFVRHALRHFGDYQDAMAAGQDTLFHAVISPYLNIGLLDP
FT                   RAVCRRVEAEYRAGRVPLNAAEGFIRQILGWREYVRGLYWLRMPDYAETNALGAVRDLP
FT                   PFFWTGETPMTCLREVIGQTRREAYAHHIQRLMVTGNFALLAGLAPRQVEEWYLAVYAD
FT                   AFDWVELPNVHGMVLHADGGVMASKPYAASGKYIDRMSDYCGRCRFDVRRTTGADACPL
FT                   NFLYWTFLMDQRERLQGNPRMAMIYRTLDRMAPATRDAVRADAARFLAGLGSASGPPSD
FT                   PPSDPPSAAASPVQPSLLEKDA"
FT   gene            630639..631424
FT                   /locus_tag="RC1_0593"
FT   CDS_pept        630639..631424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0593"
FT                   /product="oxidoreductase, short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98029"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRE3"
FT                   /protein_id="ACI98029.1"
FT                   /translation="MNSPYTPRPGDGVAWVTGASSGIGEHVALRLAREGWTVVISARRA
FT                   AVLTAIADRAPKPGRIVPLALDVTDRDAVGRAVAEIRAQHGEIALAVLNAGTYQPDSAA
FT                   SLDAAAFRATHELNVMGTVHCLEAVLPAMIARRRGHLVVVSSVAGYRGLPRSLAYGSSK
FT                   AALINLTESLKMDVERFGLKTQLVNPGFIRTPLTDRNDFPMPFLMPVEDAAERMVTEMK
FT                   GDRFEITFPRRFTFLLQRLRCLPYPAYFALARRAMPKGG"
FT   gene            631429..631866
FT                   /locus_tag="RC1_0594"
FT   CDS_pept        631429..631866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0594"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98030"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRE4"
FT                   /protein_id="ACI98030.1"
FT                   /translation="MAEPVPVEAALDAYVRYFEALTPDTLDRLDRLAVPDIHFKDPFNE
FT                   FRSRDRLKLVFGRMFQRVDSPRFIVRDHAISGQTAYLRWTLTFRSRGPRPWSIEGMSEV
FT                   RFDHAGRAVSHVDHWDAAEQLYERLPVLGTVLRLIKARLAD"
FT   gene            631904..632782
FT                   /gene="panC"
FT                   /locus_tag="RC1_0595"
FT   CDS_pept        631904..632782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="RC1_0595"
FT                   /product="pantoate--beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="identified by match to protein family HMM PF05239"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98031"
FT                   /db_xref="GOA:B6IRE5"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRE5"
FT                   /protein_id="ACI98031.1"
FT                   /translation="MSQTPDHPPLDTVRSVSDLRARIALWRREGLRVALVPTMGALHDG
FT                   HLTLVRRARDLADRVVASVFVNPAQFGPNEDFARYPRDEAGDAAKLASAGCDLLFAPDV
FT                   AAMYPPGFATAVEVEALSRRWEGEFRPGHFRGVATVVTKLLLQALPDVACFGEKDYQQL
FT                   QVIRRLVADLDIPVRIEGVPTVREADGLALSSRNAYLTSAQRAVAAALNRTLRSVVARL
FT                   AAEPGAVAETESRARAALLEAGFDAVDYLAVVDAASLEPLLRLDRPARVICTARLGTTR
FT                   LLDNMDVPVPA"
FT   gene            complement(632786..633181)
FT                   /locus_tag="RC1_0596"
FT   CDS_pept        complement(632786..633181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0596"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98032"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRE6"
FT                   /protein_id="ACI98032.1"
FT                   /translation="MTLVLLLGIAGLVLAGALWLLSQPAQPSDDDILARFDAIDGFTVT
FT                   ERHAHDGSGLAADETRGRIAVLGKGRPQMVLLGPRDLGAWHYLPKDGAFEMELTSRRHP
FT                   QPFIVSFRRSATADEWIKILKKTAEGR"
FT   gene            complement(633231..633395)
FT                   /locus_tag="RC1_0597"
FT   CDS_pept        complement(633231..633395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0597"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98033"
FT                   /db_xref="GOA:B6IRE7"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRE7"
FT                   /protein_id="ACI98033.1"
FT                   /translation="MDVDGGVSGEVMWFLAMLLAVFAVAAIVIVVAQRRTRRTAVAAMP
FT                   GRAADERPR"
FT   gene            complement(633514..633933)
FT                   /gene="gloA"
FT                   /locus_tag="RC1_0598"
FT   CDS_pept        complement(633514..633933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gloA"
FT                   /locus_tag="RC1_0598"
FT                   /product="lactoylglutathione lyase"
FT                   /EC_number="4.4.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98034"
FT                   /db_xref="GOA:B6IRE8"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRE8"
FT                   /protein_id="ACI98034.1"
FT                   /translation="MKYLHTMVRVTDLEESLDFYCTKLGLKEVRRMENEKGRFTLVYLG
FT                   ADENPEAQVELTYNWDPEVYTGGRNFGHLAFAVDDIYATCQRLMDMGVTINRPPRDGYM
FT                   AFIRSPDNISVELLQKGGALEPREPWASMPNTGTW"
FT   gene            complement(634250..635074)
FT                   /locus_tag="RC1_0599"
FT   CDS_pept        complement(634250..635074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0599"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98035"
FT                   /db_xref="InterPro:IPR021255"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRE9"
FT                   /protein_id="ACI98035.1"
FT                   /translation="MFRPDPSSPAPSRPARGRRTAAAAALLTALLFPLPAALAAPQEFD
FT                   ARAFRIEDLIGDVTVTVATGTGRVGVTLDGPSDMVDRTSVILRNGEVVVDQNLDGVSRR
FT                   NVDHDDTVRIQVSVPAGSAVTIGNLIGEARIGDLDGPLTLALTSAAEVEAGRVARADLR
FT                   ISGAGAVTVGDVAGPLKLTISGAGAVTTGAVAGAVDVSISGAGHVDIAAVSGPVSIDMS
FT                   GMADVAVRGGHTPRLEASISGLGSLSFDGVADSRSVRNSGIASVRIRDDSGR"
FT   gene            complement(635086..635853)
FT                   /locus_tag="RC1_0600"
FT   CDS_pept        complement(635086..635853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0600"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00106
FT                   match to protein family HMM PF01370"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98036"
FT                   /db_xref="InterPro:IPR021255"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRF0"
FT                   /protein_id="ACI98036.1"
FT                   /translation="MLRSLLAATALAAVSFPALAFGPQDYTARGVTVDGVVGTLDVTVT
FT                   PGSGPVTVAISGPQARIDRVRVRQDGDRVVLEQDNSDRRTWRDSDRDLWIAVKVTLPAG
FT                   SGLSVEDFIGEGRVGDLRGPLAVEDMTSGTLTVGDVTTASLDVSGSGDITVGAISGDLA
FT                   VDINGSGKVKTGAAAGAVTLEIDGSGDIEIASVSGPVAAEINGSGDIALRGGRADPLSV
FT                   SISGSGDLTLDGTAGSQSIRQSGSGKVTITGRR"
FT   gene            complement(636020..638179)
FT                   /gene="ligA"
FT                   /locus_tag="RC1_0601"
FT   CDS_pept        complement(636020..638179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligA"
FT                   /locus_tag="RC1_0601"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98037"
FT                   /db_xref="GOA:B6IRF1"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6IRF1"
FT                   /protein_id="ACI98037.1"
FT                   /translation="MSDLSDTRHIPVETLTLDQAAAEHAALVREIAHHRALYYGKDAPE
FT                   IADSAYDALEHRLAGLEARFPELVTPDSPTQTVGAAPSAGFGKVRHRVPMLSLDNAFTA
FT                   EDVDGFVEQIARFLNLKEVDGLEFVAEPKIDGLSLSLRYENGALAQAATRGDGAEGEDV
FT                   TANVRTIREIPDRLPAGAPSVLEVRGEVYMVREEFFALNRRQAEAGEKVFANPRNAAAG
FT                   SLRQLDPSVTAKRPLCFFAYSWGDLSEPLGATQWEALQRLKALGFRVPAQSRLCRSKAE
FT                   LLDYYAGIGAGRAALPFDIDGVVYKVNRLDLQERLGFRTRTPRWATAHKFPAERAQTLL
FT                   RAITIQVGRTGALTPVAELEPVTVGGVVVSRATLHNADEIARKDIRVGDTVVVQRAGDV
FT                   IPQVVEVVTERRPADSAPFVFPDHCPECGSAAVREEDGAVSRCTGGLVCPAQAVERLRH
FT                   FVSRNAFDIEGLGIERIQLFYDQDRIRSPADIFTLERREAQRLDRLVAMTGFGRKSVEN
FT                   LFRAIDARRRIPLDRFIFALGIRQVGEATAKLLARTYRSVGPWTERMAAAAAERSANPD
FT                   EAKKPELVGEAYAELCAIEQIGMSVADDICAFFAEPHNRDALDALLKELEAVEDHVPPP
FT                   RADGSPVAGKTVVFTGTLETMGRSEAKARAEALGAKVAGSVSGKTDYVVVGADAGSKAA
FT                   KARELGLTILTEQEWLDLISQPGGV"
FT   gene            complement(638262..638798)
FT                   /locus_tag="RC1_0602"
FT   CDS_pept        complement(638262..638798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0602"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98038"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRF2"
FT                   /protein_id="ACI98038.1"
FT                   /translation="MAGSAGPEAAPLILTLAFDDRSFARFEALRRAHFPPERNLIPAHL
FT                   TLFHHLPGPQLPVILADLRRTCRDAAPFPLAVTGLRPLGRGVALTLAAPDLARLRERLA
FT                   ALWSEWLIPQDRQAHRPHVTIQNKVEPAAAKALLADLSAGFSPWTARAEGLLLWRYHGG
FT                   PWERLARLPFTARRS"
FT   gene            complement(638822..640492)
FT                   /gene="recN"
FT                   /locus_tag="RC1_0603"
FT   CDS_pept        complement(638822..640492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recN"
FT                   /locus_tag="RC1_0603"
FT                   /product="DNA repair protein RecN, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98039"
FT                   /db_xref="GOA:B6IRF3"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRF3"
FT                   /protein_id="ACI98039.1"
FT                   /translation="MLVTLSIRDVVLIDRLTLAFRPGLCVLTGETGAGKSILLDALGLA
FT                   LGARGDSALVRHGAEQAAVTAEFDLSGHPDHPALGILREQELEAEDTLVLRRTVSADGR
FT                   SRAFVNDQPVGVTLLRRLGETLVEVHGQFDTHGLLDPRTHLGLLDEYAGLGDAARATAG
FT                   AWRDWRQADQARQQAAEDAARARAEEEYLRHAVAELDSLDPREGEEAELAEKRVTLQHR
FT                   ERLIEAINGAHAELSGDRGAERGLAASLRLLARIADKAGGRLDPVIQVLDEAAAEVAEA
FT                   ARALQALSADIDLDGGSLETIEERLFALRAAARKHSVEVDGLAGLRAEMARRLALIEDQ
FT                   GDLLQRLAKQAEDARTRFAAAARELSAARAKAAGRLDRAVAAELAPLKLEKARFVTRVA
FT                   PTEEAAWGPHGIDDVSFTVATNPGAPPGPLAKIASGGELARFMLALKVVLAQLGTVPTL
FT                   VFDEVDTGIGGAVADAVGERLARLGRALQVLVVTHSPQVAARGGHHWQVRKKAAAGRTV
FT                   TEVAALDAAQRREEIARMLSGAEVTDAARAAADSLLAKA"
FT   gene            complement(640551..641375)
FT                   /locus_tag="RC1_0604"
FT   CDS_pept        complement(640551..641375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0604"
FT                   /product="tetratricopeptide repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98040"
FT                   /db_xref="GOA:B6IRF4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR017689"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRF4"
FT                   /protein_id="ACI98040.1"
FT                   /translation="MSLSIRFARLRPRLLAASASLLLLAACAGEKEVIPYIERPVEQIY
FT                   TEAANALDNENYLKAAALFDEVERQHPYSQWAVRAQLMAAYAHYEALRYDDAITTLDRF
FT                   ISLHPGNRNAAYAYYLKALCYYEQISDVRRDQSMTESALTALQDVARRFPATTYARDAN
FT                   LKLDLTRDHLAGKDMEVGRYYLVTGQYMAAIKRFRRVVDKYQTTSHVPEALHRLTEAYL
FT                   ALGIVDEAQASAALLGHNYPGSDWYQRTYTLMTDSRPAAERGFFSRAWDWMF"
FT   gene            complement(641612..642553)
FT                   /gene="lpxC"
FT                   /locus_tag="RC1_0605"
FT   CDS_pept        complement(641612..642553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxC"
FT                   /locus_tag="RC1_0605"
FT                   /product="UDP-3-0-acyl N-acetylglucosamine deacetylase"
FT                   /EC_number="3.5.1.-"
FT                   /note="Also clled UDP-3-O-3-hydroxymyristoyl
FT                   N-acetylglucosamine deacetylase.Gene symbol synonym envA;
FT                   identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98041"
FT                   /db_xref="GOA:B6IRF5"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRF5"
FT                   /protein_id="ACI98041.1"
FT                   /translation="MSRQTTLKAPINCTGTGLHSGQRVNMTLAPAPAGTGIVFRRTDLV
FT                   ARGATDEQATIPARWDQVVDTRLCTVVGNAYGAQVGTVEHLMSALRGCGIDNLRVDLDG
FT                   PEVPIMDGSAAPFVFLVECAGRAVQTAPRRHLRILREVRVEAGDKSVALMPAPVSSFRV
FT                   EIDFSTAAIRRQEGALRLGIGEDDRTFKAEVARARTFGFLHEVDMMRKAGLARGGSLEN
FT                   AVVIDGDRIVNEGGLRYGDEFVRHKILDAVGDLYMAGAPIIGHFHGVRPGHEMNNRLLR
FT                   ALFADVGAFRWEETAPARTLWTDEDEPLAAIA"
FT   gene            complement(643040..644728)
FT                   /pseudo
FT                   /gene="ftsZ"
FT                   /locus_tag="RC1_0606"
FT   CDS_pept        complement(643040..644728)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="RC1_0606"
FT                   /note="cell division protein FtsZ, pseudogene"
FT   gene            complement(644838..646121)
FT                   /gene="ftsA"
FT                   /locus_tag="RC1_0607"
FT   CDS_pept        complement(644838..646121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="RC1_0607"
FT                   /product="cell division protein FtsA, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98042"
FT                   /db_xref="GOA:B6IRF6"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRF6"
FT                   /protein_id="ACI98042.1"
FT                   /translation="MAFPGALNVRSRPKRVSRGGTIAALDVGSGKVVCFIAKVDDPGSI
FT                   RVVGIGHQVSRGVRAGAIVDMEQAETAIGTAVHAAETMAGEQIREVLVSLSGGQPESQT
FT                   ITVETAIAGQVVNDGDLKRALAQAHNLNVAPDAELIHSIPVGYTVDGSKGIREPRGMVG
FT                   ERLGVRLHAVTTAANPIRNLTTCIGRCHLGVEGFVLSPYASGLACLVEDEMDLGVTLID
FT                   MGGGTTSMSVFFDGKMIWCDSIPLGGGHVTNDIARGLTTPLAHAERLKTLYGSAIPTVS
FT                   DEREIIDVPQVGEEEHAQANHVPKSLLVGIIQPRLEEIFELARGRLEASGIGKLAGRRV
FT                   VLTGGASQLPGMRELAQQVLDKQVRTGRPLRIGGLAESVGGPAFSAAAGLLVYALQQQT
FT                   ELPALAPLVEQQPSGWLGRVGLWLRENL"
FT   gene            complement(646135..647061)
FT                   /gene="ftsQ"
FT                   /locus_tag="RC1_0608"
FT   CDS_pept        complement(646135..647061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="RC1_0608"
FT                   /product="cell division protein FtsQ"
FT                   /note="identified by match to protein family HMM PF00533
FT                   match to protein family HMM PF01653 match to protein family
FT                   HMM PF03119 match to protein family HMM PF03120 match to
FT                   protein family HMM TIGR00575"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98043"
FT                   /db_xref="GOA:B6IRF7"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRF7"
FT                   /protein_id="ACI98043.1"
FT                   /translation="MPRVSAAAYDTGRGSADSHRAKIAAAARRATMQAARRANRRRALP
FT                   RWALPSLRAGLKLSPVLLLAGFLAWVWADGRLPEMAGKASEGFVRTTAEAGLAVTEVLV
FT                   KGRAETDGAAVLAALGVGTGSPMLTFDPHAAQAALQALPWVAAATVERRLPGTIFVQLV
FT                   ERTPMALWQHEQKLYLVDADGVVLTDERLERWPDLPMLVGADAPKHGRELLALLSAEPL
FT                   IGARVEAAVLVGGRRWDLRLDNGVDVRLPEKEMAAALRQLATVQQTNRVLERDIVAVDL
FT                   RVPDRLVVQTSAQAAEQRREAQRQKKI"
FT   gene            complement(647049..647996)
FT                   /gene="ddlB"
FT                   /locus_tag="RC1_0609"
FT   CDS_pept        complement(647049..647996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddlB"
FT                   /locus_tag="RC1_0609"
FT                   /product="D-alanine--D-alanine ligase B"
FT                   /EC_number="6.3.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98044"
FT                   /db_xref="GOA:B6IRF8"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRF8"
FT                   /protein_id="ACI98044.1"
FT                   /translation="MGSGIMNQRRPTRVAVLMGGWSAERDVSLVSGRSVAAALEERGYA
FT                   VTAVDVQRDLPALLHALTPKPDVVFNALHGRGGEDGLIQGVLEYLGVPYTHSGVLASAL
FT                   AMNKEMTRRVLAAVGVPVPDGVTVTREQILAGHPIEPPYVVKPVDEGSSVGVRIVRPGQ
FT                   NQSVLEEGGWAYGERVLVERFIPGRELTVGVMGDRALAVTEIVPRSGFFDYAAKYTEGE
FT                   AVHVCPAQIPQDVQEEALRLALLAHRTLGCSGVSRSDFRWDDSQAGTGGLYFLETNTQP
FT                   GFTALSLLPEQAASQGIGFAELCAWIVEQARCHA"
FT   gene            648075..648233
FT                   /locus_tag="RC1_0611"
FT   CDS_pept        648075..648233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0611"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98045"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRF9"
FT                   /protein_id="ACI98045.1"
FT                   /translation="MVVIITTSMECGRTAESNRPDTAPAGAGAMTPRKVRRAAGKTRQD
FT                   FAAFVMA"
FT   gene            complement(648223..649176)
FT                   /gene="murB"
FT                   /locus_tag="RC1_0610"
FT   CDS_pept        complement(648223..649176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="RC1_0610"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase,
FT                   putative"
FT                   /EC_number="1.3.1.98"
FT                   /note="identified by match to protein family HMM PF02463
FT                   match to protein family HMM TIGR00634"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98046"
FT                   /db_xref="GOA:B6IRG0"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRG0"
FT                   /protein_id="ACI98046.1"
FT                   /translation="MTAAEPLPGPHLIDRLPRVRGRLTADAPLGPMTWFRVGGTADVLF
FT                   RPADADDLAGFLAGCPADVPVTVIGVASNLLVRDGGVPGVVIRLGGPFAEIAVEGDRLV
FT                   AGAGALDYNVALTAQHEGLAGLEFLSGIPGTIGGALRMNAGAYGRETADLVVTAEGIDR
FT                   AGRRLRFDRAGLHLGYRHCGVPEDVIFTGAVLQGTPGDKAAIATAMDAIQKARADSQPV
FT                   RARTGGSTFANPDPELSGGAKAWQLIDRAGCRGLQIGGAQVSEKHCNFLLNLGDATAAD
FT                   LEGLGEEVRRRVLETSGIELRWEIRRIGRPAREITP"
FT   gene            complement(649176..650624)
FT                   /gene="murC"
FT                   /locus_tag="RC1_0612"
FT   CDS_pept        complement(649176..650624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="RC1_0612"
FT                   /product="UDP-N-acetylmuramate--alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="identified by match to protein family HMM PF03331
FT                   match to protein family HMM TIGR00325"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98047"
FT                   /db_xref="GOA:B6IRG1"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6IRG1"
FT                   /protein_id="ACI98047.1"
FT                   /translation="MRAMPLSIGTIHFVGIGGIGMSGIAEVLHNLGYSVQGSDIADNYN
FT                   VARLRTLGIRVEIGHRAENLGEAAVVVISSAVRTDNPEVVAARAALVPVVRRAEMLAEL
FT                   MRLKWSVAVAGTHGKTTTTSMVAALLDGAGFDPTIINGGIINALGTNARLGSGDWMVVE
FT                   ADESDGTFTKLPATIAVVTNMDPEHLDFYGTFEKEREAFDRFVENIPFYGFAALCTDHP
FT                   EVQALVARADRRIVTYGFNPQADVRAVNVEGDHRGAFYDVQVSERVTGEARTIERVHLP
FT                   MYGLHNVQNSLAAIAVAINMGIADEQIRASFARFSGVKRRFTRTGESNGVVVIDDYGHH
FT                   PVEIQAVLKAARMAGSGRTIAVVQPHRYSRLSSLFEEFCTCFNDADAVIVADVYAAGEQ
FT                   PVEGASKEALVEGLRTHGHRNVQALPSPEALAGIVRELAQPGDMVVCLGAGSITGWANR
FT                   LPAELDALHGISGGTAPAAKAGGT"
FT   gene            complement(650717..651856)
FT                   /gene="murG"
FT                   /locus_tag="RC1_0613"
FT   CDS_pept        complement(650717..651856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="RC1_0613"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="identified by match to protein family HMM PF00091
FT                   match to protein family HMM PF03953 match to protein family
FT                   HMM TIGR00065"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98048"
FT                   /db_xref="GOA:B6IRG2"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6IRG2"
FT                   /protein_id="ACI98048.1"
FT                   /translation="MSMAPIVLAAGGTGGHLFPAEALARELLERGHRVVLVTDVRGTAF
FT                   GDALREVPVHRIRSATLGGGLLGKARTALELGIGTLQARRLLSRLEPAIVVGFGGYPSF
FT                   PAVYAAAGLRIPVAIHEQNAVMGRANRMLARRARLICTSFPEVQGMDNVDRARAVRTGN
FT                   PVRPAVLALRDRPYEAPLPGGSLDILVTGGSQGATVFGEIVPRAVAMLPEDLRLRLGIV
FT                   QQARAENLQAARDGYAALGVQATLAPFFRDLPERLARCHLMIGRAGASTVAELTVAGRP
FT                   SILVPYPHATDDHQTANARAVAAAGGAWIMPQPEFTAEALAARLTALLTDPAPLAPAAA
FT                   AAAAWGLPDAARRLADAVLGAAGLGNGRSTPDSQMRAAE"
FT   gene            complement(651853..652980)
FT                   /gene="ftsW"
FT                   /locus_tag="RC1_0614"
FT   CDS_pept        complement(651853..652980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="RC1_0614"
FT                   /product="cell division protein FtsW, putative"
FT                   /note="identified by match to protein family HMM PF02491
FT                   match to protein family HMM TIGR01174"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98049"
FT                   /db_xref="GOA:B6IRG3"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRG3"
FT                   /protein_id="ACI98049.1"
FT                   /translation="MSFTFARTDHSLLGRWWWTVDRWTLAAVVLIAAIGVVLIQAASPA
FT                   VAERIGLTTFHFIERHLMLLLPALGVMVGVSLLSPRGVLRLSVGLFLLSLIGIALTLVV
FT                   GVEIKGATRWLHLPGLSVQPSEFVKPAFAVVAAWLFALQRNREGFPGIPVVAGLFLVTV
FT                   AMLLMQPDLGQTFVITAVFAGQFFLAGLPVLLVVGLVVLGISGLVGAYFLFPHVQSRID
FT                   RFLDPASGDNYQVARAMEAFEKGGLWGTGPGQGSVKMSIPDAHADFIFAVAGEELGLLW
FT                   CLLIVGLFAFVVLRGFARAFNDQSLFVLLAASGLCMQFGLQSLINMGSSLHLMPTKGMT
FT                   LPFISYGGSSLIALGIGMGMLLALTRRRFGPGDVP"
FT   gene            complement(652977..654377)
FT                   /gene="murD"
FT                   /locus_tag="RC1_0615"
FT   CDS_pept        complement(652977..654377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="RC1_0615"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /note="identified by match to protein family HMM PF03799"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98050"
FT                   /db_xref="GOA:B6IRG4"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRG4"
FT                   /protein_id="ACI98050.1"
FT                   /translation="MIDLSFLAGQRIAVMGLARSGLAAAIALSRGGAEVLAWDDAEAGR
FT                   TAATAAGLPLTDLHHADLTGVTALVLSPGIPHTFPAPHPVAARVRAAGIPVIGDVELLR
FT                   RARPEATYLGITGTNGKSTTTALTGHILAAAGRRLQVGGNLGTPVLTFEPLDAGDVYVL
FT                   EMSSYQLELTPSLGFDAAALLNITPDHLDRHGGMDGYVAAKRLAFRPAPSPRPALPVAV
FT                   IGVDDAHCSAMADALEAEGGRRVVRISAERAVAGGVSAPDGVLVDDSEGRAVAVLDLRG
FT                   CPSLPGRHNWQNACAAYALARAAGVAPEAIASAIRSFAGLAHRQQAVATIDGVRFVNDS
FT                   KATNADAAAKALGCYDAIHWILGGKPKEGGLEGLDAFMPRVRHAFLIGAATEEFASWLA
FT                   ARGVPHTRCGTMETAVPTAFRSALAGGEPGAVVLLSPACASFDQYPNFEVRGDHFAKLV
FT                   QALTEAGR"
FT   gene            complement(654385..655470)
FT                   /gene="mraY"
FT                   /locus_tag="RC1_0616"
FT   CDS_pept        complement(654385..655470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="RC1_0616"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="identified by match to protein family HMM PF01820
FT                   match to protein family HMM PF02655 match to protein family
FT                   HMM PF07478 match to protein family HMM TIGR01205"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98051"
FT                   /db_xref="GOA:B6IRG5"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6IRG5"
FT                   /protein_id="ACI98051.1"
FT                   /translation="MLFNLLYPLADEFQIFNLFRYITFRTGGAMVTALLISFVIGPRVI
FT                   RWLKSVQGEGQPIRTDGPETHLKKKGTPTMGGLMILIAVIVSTLLWVDLANVYTWIVLL
FT                   VTVGFGLIGFGDDFLKLTKRNTKGLSGRLKLAWTIAIAGVAATWYIAVTPHPLDTGLAV
FT                   PFFKDLLVNLGWFFIPFAILVMVGASNAVNLTDGLDGLAIVPIMIAAATFGLIAYLSGN
FT                   AIFAGYLQIHHVPGTGELAVFCGALVGAGLGFLWFNAPPAMVFMGDTGSLSMGGALGAV
FT                   SVMTKHELVLAIVGGLFVLEAVSVMVQVASFKLTGKRVFRMAPIHHHFEKKGWSEPTVV
FT                   IRFWIIAAILALVGLSTLKLR"
FT   gene            complement(655478..656956)
FT                   /gene="murF"
FT                   /locus_tag="RC1_0617"
FT   CDS_pept        complement(655478..656956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="RC1_0617"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl-D-alanyl ligase"
FT                   /EC_number="6.3.2.10"
FT                   /note="Gene symbol synonym mra; identified by match to
FT                   protein family HMM PF01565 match to protein family HMM
FT                   PF02873 match to protein family HMM TIGR00179"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98052"
FT                   /db_xref="GOA:B6IRG6"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRG6"
FT                   /protein_id="ACI98052.1"
FT                   /translation="MKTHDGSDILWTAADAAAATNGRHPTGRTPGHWMATGVSIDSRTL
FT                   RPGDLFVALKGPNFDGHDYVGDALAHGAAAALVSRLPGNVPPEAPVLLVDDTLAALEDL
FT                   GRVARLNARGKVIAVTGSVGKTGTKEALKLCLDARGPTFATQGSLNNHWGVPLSLARFP
FT                   ADAHYGVFELGMNHAGEIGPLSRMVQPDVAIITTVEAVHLEFFASVEGIADAKAEIFEG
FT                   MTPAGTAILNRDNPHFARLVAAARTQGLTRIWSFGTQEGADAHLLECSLHATSSAVTAS
FT                   IRGERIQYCLSLPGRHHVLNSLAVLLAVSAAEGDVAAAARQLSQIAPIKGRGLRRRVAL
FT                   AKGSFTVIDESYNASPVSVAAAATVLGKADPGAGGRRIAVLGDMLELGAQAPSLHAGLA
FT                   DQFRRAGADLVFCCGPNMKFLFDRLPAALRGRHTEDSAALAPLVADAVRAGDVVMVKGS
FT                   AGSRMSRVVDALVALDHGDQAAEAPAAVAAGSAS"
FT   gene            complement(656970..658445)
FT                   /gene="murE"
FT                   /locus_tag="RC1_0618"
FT   CDS_pept        complement(656970..658445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="RC1_0618"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /EC_number="6.3.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98053"
FT                   /db_xref="GOA:B6IRG7"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRG7"
FT                   /protein_id="ACI98053.1"
FT                   /translation="MKKLSDIMASRTEIAVSALALERDPPITALTADSRKIVPGTLFAA
FT                   LPGTRHDGRDFIAQAVAAGASAVLAPKGTVLPPGCEHVALIEDLNPRRRLALLAAAFYG
FT                   AQPQRIAAVTGTNGKTSTAQFTRQIWSGLGHRSGAMGTLGLVADGFPNIETLTTPDPVE
FT                   LHRLLAELARGGVTHLAMEASSHGLDQFRLDGVLVTCAGFTNLTRDHLDYHRTMEAYFQ
FT                   AKATLFERVMPQGAVAVLNADTPQFEALAALCRSRKQTVIGYGERGRELALHSARPLPH
FT                   GQQVEIEVFGTRHSLELPLVGNFQLWNALCALGLVIGSGEDPAAATAQLARLEGVRGRL
FT                   DLVARLKNGAAVYVDYAHTPDGLETVLKALRPHTVGRLVAVFGAGGDRDPGKRPLMGEV
FT                   VARLADRAIVTDDNPRSEVPAVIRAAILAACPDATEIGDRAEAIEAAIAGLEQGDVLVV
FT                   CGKGHEQGQIVGTEVRPFDDAAVARAAVGRLNV"
FT   gene            complement(658485..660278)
FT                   /gene="ftsI"
FT                   /locus_tag="RC1_0619"
FT   CDS_pept        complement(658485..660278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsI"
FT                   /locus_tag="RC1_0619"
FT                   /product="peptidoglycan synthetase FtsI"
FT                   /note="Gene symbol synonym pbpB.Also called
FT                   penicillin-binding protein 3; identified by match to
FT                   protein family HMM PF01225 match to protein family HMM
FT                   PF02875 match to protein family HMM TIGR01082"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98054"
FT                   /db_xref="GOA:B6IRG8"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRG8"
FT                   /protein_id="ACI98054.1"
FT                   /translation="MTDAPLSLTGFDMTGLDRPHAPRTEPRVRWQPHGNPALEQGRHRL
FT                   VVTAAMFALAFGAVGLKLLDATVLSRGGEPQVARAAGAKAPTSRADIVDRNGVLLASSL
FT                   TTESLFADPKLVIDPKEAARRLTEVLDIKEQDVLAELQSDKRFVWIKRNLTPRQVYEVN
FT                   RLGIPGLAFQREERRIYPQGSLAAHVVGFSGVDNVGLMGIEQAFDRRLKENQEPLRLSI
FT                   DVRLQHILRREVQTAIDDFQAIGGAGMVMDVKTGELLAMVSLPDFDPHNPPPPQEQQDL
FT                   DPRFNRNTLGVYEMGSTFKIFNTALALESGRVKLRDMFDATRPIRIGRFTISDFHAENR
FT                   WMDVVDVFKHSSNIGSVRMAEQVGPVAQKEFMTKLGFARPASLELPEMGWPIIPNPWRD
FT                   VNMMTISFGHGMSVSPVHLVTAAAGVVNGGIMHPATLLKRDRDAEIPGTRIVSEQTSDT
FT                   LRKLMRIVVTEGTARMADAPGYLVGGKTGTAEKVKNGGYARKALISSFLGVFPMNDPKY
FT                   VVYVMVDEPKGNKKSFGYATGGWVGAPTGGRIVAQAGPLLGVRPQDAQSPEIIHALAIN
FT                   PVDPPAVAQVASVPAGSSGGR"
FT   gene            complement(660275..660691)
FT                   /gene="tonB"
FT                   /locus_tag="RC1_0620"
FT   CDS_pept        complement(660275..660691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tonB"
FT                   /locus_tag="RC1_0620"
FT                   /product="protein TonB, putative"
FT                   /note="identified by match to protein family HMM PF03033
FT                   match to protein family HMM PF04101 match to protein family
FT                   HMM TIGR01133"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98055"
FT                   /db_xref="GOA:B6IRG9"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRG9"
FT                   /protein_id="ACI98055.1"
FT                   /translation="MIGKSTIVWIALASLASVILYQTSYRVQEQAEKLSSLNRQIVAEQ
FT                   EAIQVLRAEWAYLNDPTRLEALVAQHLLLQPTRAEQIVSLDALPEKQPELLATVTVPVP
FT                   ARKPGRAAAPAHSPRRDAPRPDAPVVLATYGAPR"
FT   gene            complement(660688..661677)
FT                   /gene="mraW"
FT                   /locus_tag="RC1_0621"
FT   CDS_pept        complement(660688..661677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="RC1_0621"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01098
FT                   match to protein family HMM TIGR02614"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98056"
FT                   /db_xref="GOA:B6IRH0"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6IRH0"
FT                   /protein_id="ACI98056.1"
FT                   /translation="MTAGPTPGAVDAPSLHIPVLRDEVVDALAPRDGAVLVDGTFGAGG
FT                   YTAALLASAACTVWAIDRDPAAVARGHALAARHPGRLTVLDGTFGCMESLLAAHGITRV
FT                   DGIALDIGVSSPQIDDPSRGFSFRFDGPLDMRMGSHGTTAADIVNERDEAEIADIVWRY
FT                   GEERHSRRVARAIVARRREAPITRTLDLAEIVRSVVPKSKDGIDPATRTFQALRIAVND
FT                   ELGELERGLAAAERLLAPGGRLAVVTFHSLEDRVVKEFLRSRSAAAPAPSRHLPAPADA
FT                   PAPTFRLIARSGVTPAPAELAANPRARSARLRSAERTSAPARRLGDAA"
FT   gene            complement(661674..662165)
FT                   /gene="mraZ"
FT                   /locus_tag="RC1_0622"
FT   CDS_pept        complement(661674..662165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraZ"
FT                   /locus_tag="RC1_0622"
FT                   /product="cell division protein MraZ"
FT                   /note="identified by match to protein family HMM PF02875
FT                   match to protein family HMM TIGR01087"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98057"
FT                   /db_xref="GOA:B6IRH1"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRH1"
FT                   /protein_id="ACI98057.1"
FT                   /translation="MALFLSTYVNKVDKKGRVSVPAPFRTSLGHVTGGGPVELIVFRSL
FT                   QANALDACSIDFLEQLSLALDNPDMPEDLRDTIETTVFGGSVRLQIDPEGRIIIPEPYL
FT                   EFAGIGESISFVGRRKTFQLWDPAAFAAHEAQSRDVARANNISLSTVLARTSALARGAS
FT                   "
FT   gene            complement(663280..664044)
FT                   /locus_tag="RC1_0623"
FT   CDS_pept        complement(663280..664044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0623"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /note="identified by match to protein family HMM PF00953
FT                   match to protein family HMM TIGR00445"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98058"
FT                   /db_xref="GOA:B6IRH2"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRH2"
FT                   /protein_id="ACI98058.1"
FT                   /translation="MSGFRLIDLPSPNHGPRRPGAAIDMLVLHYTGMRTAEEALERLCD
FT                   PAAEVSAHYVIDEDGTLYRLVREDRRAWHAGLSFWRGERDVNSRSIGIELVNPGHAFGY
FT                   RPFPEAQMATLESLAADLVAHYRIPPLHVLGHSDVAPARKEDPGELFDWPRLARAGIGA
FT                   WPEPAAADDAPWTEAEVASLLAAVGYEPLPSPGTAWDGTAWDGTAGQVLTAFRRHWHPA
FT                   ALSGPLRPDAGDVCRLRALARIAAVAWTERNA"
FT   gene            complement(664041..664913)
FT                   /locus_tag="RC1_0624"
FT   CDS_pept        complement(664041..664913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0624"
FT                   /product="integral membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF01225
FT                   match to protein family HMM PF02875 match to protein family
FT                   HMM TIGR01143"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98059"
FT                   /db_xref="GOA:B6IRH3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRH3"
FT                   /protein_id="ACI98059.1"
FT                   /translation="MTPLHMLQALTVMAIWGFNFVVAKVAMTEFSPLLLMTLRFALVAA
FT                   ILLPFVKPPRGHWRQMALYSLVMGGLHFPLVFMGVQQVDASTASIAIQLQVPFASMFAA
FT                   IFFKDRLGWRRALGMAVAFAGVAVIAGVPDERTSVPHVLMIVGAALAFAFSNIQLKWLG
FT                   GIDWKTLNAYMALFAVPQLLALSLVFESGQMEQIRNADWLGLACLAYLALLATILAYAF
FT                   WYPLVRRFDVNQTVPFLLLVPVFGVGGGVLTLGEPVTWQLVVGGLLTLGGVGVIIVRRP
FT                   RLTPARSTT"
FT   gene            complement(664910..666721)
FT                   /gene="hfaC"
FT                   /locus_tag="RC1_0625"
FT   CDS_pept        complement(664910..666721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hfaC"
FT                   /locus_tag="RC1_0625"
FT                   /product="holdfast attachment protein C"
FT                   /note="ABC transporter ATP-binding protein identified by
FT                   match to protein family HMM PF01225 match to protein family
FT                   HMM PF02875 match to protein family HMM TIGR01085"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98060"
FT                   /db_xref="GOA:B6IRH4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRH4"
FT                   /protein_id="ACI98060.1"
FT                   /translation="MAATPPLVALRGAAIELGATTLFHDVDVGIGRGDKVCLVGRNGSG
FT                   KSTLMKCLAGLVVPDRGERFVQPGAKIAHLAQEPDFSAHPTVADFVGAGLDELAHYRVD
FT                   AVLEALDLPGDRACATLSGGESRRAALARALVGEPDVLLLDEPTNHLDIPTIEWLEREL
FT                   QSFRGGLLLISHDRAFLNALSRRTLWLDRGTMRETERGFAAFETWRDEVFAEEEAAAHK
FT                   LDQRIKAELKWMWEGGISARRTRNMGRVRRLQGMRQDRAERIRSRQVTMAVAEADLSGR
FT                   LVLEAERIGKEFTGPEGTRTIVRDFSTRILRGDRVGLIGPNGAGKTTLLKILTGEMEPD
FT                   SGNVRRGTNLEMVIFDQRRAQLAPEATVKQVLLPAGGDTIMVGGKPRHIASYLKDFLFD
FT                   PSMMDQPTRALSGGERNRLLLARLFARPSNLMVLDEPTNDLDMDTLDLLEEVLADYEGT
FT                   LLLVSHDRDFLDRLVTSTIAVEGDGDVQEYAGGYSDYLVQRRPAAPAAPPPAAKPAAPA
FT                   AAAPARAKTKLSFKEARELDELPGRIDALTARIGTLEAKLADPAFYTKDAAGFARATED
FT                   LSTAQAELAAAEDRWLELESLKEELGR"
FT   gene            complement(666733..667527)
FT                   /gene="djlA"
FT                   /locus_tag="RC1_0626"
FT   CDS_pept        complement(666733..667527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="djlA"
FT                   /locus_tag="RC1_0626"
FT                   /product="DnaJ-like protein DjlA, putative"
FT                   /note="PF00226 Has many homologs from the same family, many
FT                   of which are DnaJ-like protein djLA; SP:Q45885: DnaJ-like
FT                   protein djlA (Mucoidy activation protein mucZ); identified
FT                   by match to protein family HMM PF00905 match to protein
FT                   family HMM PF03717"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98061"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRH5"
FT                   /protein_id="ACI98061.1"
FT                   /translation="MSIWGKILGGAAGFAIGGPLGALLGAVAGHAVDELRSLDEPQGTD
FT                   DQGRPDQTKTIAFTVGVIVLSAKMAKADGVVHRKEVDAFKEVFSIPPEELRNVGRLFDI
FT                   AKRDSAGYQPYAQQLARMFHDRRAVLEDLLGGLFHIARADGTLHAAELTYLHAVARLFG
FT                   FSDAEYEQIRRIHGGAAAGIADPLDDPYAVLGVPRTADMSEIKTAYRRLVREHHPDRVM
FT                   AQGLPPEFVEIAHDKMAAINAAYDRIERDRAAARTPGEIATP"
FT   gene            667832..668386
FT                   /locus_tag="RC1_0627"
FT   CDS_pept        667832..668386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0627"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98062"
FT                   /db_xref="GOA:B6IRH6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRH6"
FT                   /protein_id="ACI98062.1"
FT                   /translation="MTVFRRILPAEIRSYRAHLLRLSMDDRRARFMGAVSDDAVDAHCR
FT                   RIDWSRAVIVAAFVRGEIRGATELRLEREGAQEGELAVSVEQDWQGQGIGTTLVRRVLT
FT                   IARNRGIRRLCVVCLPENRRMQRIATTLLGPCAFAYGEVSSHIELPPPTPITLAQEALD
FT                   RSTLPLSVMLDQWQGEPARAA"
FT   gene            668480..672079
FT                   /locus_tag="RC1_0628"
FT   CDS_pept        668480..672079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0628"
FT                   /product="5-oxoprolinase"
FT                   /EC_number="3.5.2.9"
FT                   /note="identified by match to protein family HMM PF01795
FT                   match to protein family HMM TIGR00006"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98063"
FT                   /db_xref="GOA:B6IRH7"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRH7"
FT                   /protein_id="ACI98063.1"
FT                   /translation="MTEGRWQFWIDRGGTFTDIVARRPDGGIVTHKLLSENPERYRDAA
FT                   VQGIRDLLGLAAGDPVPADRIAAVRMGTTVATNALLERKGEPTVLAVTAGFADQLRIGY
FT                   QARPRIFARRIELPEQLYTRVVEVPERVAARGEVLRPLDLTAVETGLRRAFADGFRACA
FT                   VVLMHGYRFPAHERAVGDLARRIGFPQVSLSHEVSPLMKLVGRGDTTVADAYLSPILRR
FT                   YVEQVAAELPGVPLYFMQSNGGLAEAAHFQGRDAILSGPAGGIVGAARTAAAEGFDRII
FT                   GFDMGGTSTDVSHVAGEYERSLETVVAGVRLRVPMLRINTVAAGGGSICRFDGSRFRVG
FT                   PESAGADPGPACYRRGGPLTVTDCNVMVGKLHPEFFPAVFGPGGDRPLDAAVVRDRFAA
FT                   LAREVAAATGRALVPEQIADGFLRIAVENMAQAIKQISVQRGYDVTRYALQCFGGAGGQ
FT                   HACLVADALGMRTVYVHPLAGVLSAYGIGLADLVALRDRAVEAVLGPDLMPSLDALVAD
FT                   LGRAATDDLLAQGVGIGAIVLHPRAHLKVQGTDTALELPFGPEAEMRAAFAALHRQRFG
FT                   FDPGDRPLVVELAGVEAVGRAGGEAVLPPPAGSAGKPVPLAAVGAWMAGEHRTVPVHDR
FT                   GALGAGAVLDGPAILREPTGTTVVEPGWRARVTAAGGLVLERVVPLPARVAVGTEADPV
FT                   MLEVFNNLFMSIAEQMGLALENTAHSVNIKERLDFSCAVFDRRGGLIANAPHIPVHLGS
FT                   MGDSVRAVIAARGDSLRPGDAVMLNNPYRGGTHLPDVTVVTPVFDTAGTELLFWVASRG
FT                   HHADIGGITPGSMPPDSRTLEEEGVLIDDFLLVEGGRLREAAVVALLTGGRWPARNPAQ
FT                   NLGDLRAQVAANARGAAELLKMVDLFGLETVRAYMDHVQRNAEEQVRRVIGVLQDGDFA
FT                   LEMDSGAVVRVSVRIDRTRRTARIDFTGTSPQQPGNFNAPAAITRAAVLYVFRTLVEDD
FT                   IPLNDGCLAPLEIVIPEGSMLNPRPPAAVVAGNVEVSQAVTDALYGALGALAGSQGTMN
FT                   NLTFGNDRHQYYETICGGAGAGPDFDGTDAVHTHMTNSRLTDPEVLEWRFPVLLEDFRI
FT                   RRGSGGAGRQHGGCGVVRRLRFLEPMTAAILSNHRRVPPAGLAGGGPGAVGRARVERRD
FT                   GTVEDLPGTARVEMRPGDVFVIETPGGGGFGAP"
FT   gene            672198..673175
FT                   /locus_tag="RC1_0629"
FT   CDS_pept        672198..673175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0629"
FT                   /product="Oxidoreductase molybdopterin binding domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF02381"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98064"
FT                   /db_xref="GOA:B6IRH8"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR022867"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRH8"
FT                   /protein_id="ACI98064.1"
FT                   /translation="MLLKRRRGWELPEREATPESVYLDRRRLLRLAGLGAIAAGTLSLA
FT                   GCGDAGAEAPADPSAGLYPVPRNPAFTLDRPLSPEGEVTTYTNFYEFGSHKTIWRQAQE
FT                   LPIRPWTVTIDGLVEKPMQVDIDTLLAAMPLEERLYRHRCVEAWAMAVPWSGFPLRSLV
FT                   EYARPLGSARHVELTTFGADVHAAPGLRQRWYPWPYREGLTLAEATNDLAFIATGLYGK
FT                   PLPRQNGAPLRLVVPWKYGFKSAKSIVRIRFTEERPGTFWNRVNAQEYGFWANVNPEVP
FT                   HPRWSQAKERMLGTDEMRPTLIYNGYGNEVAQIYSGLQGEALFM"
FT   gene            673294..673953
FT                   /locus_tag="RC1_0630"
FT   CDS_pept        673294..673953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0630"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98065"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRH9"
FT                   /protein_id="ACI98065.1"
FT                   /translation="MGSGIIAILQFGLFTFVASVAANIVLAVAGYLWAAVIEQTGGVQP
FT                   ARQRIARYSRLALGFQNRLEARKTAAAGSASSLFGAERQEKQLRSRLRELETAQHRFVR
FT                   VVGQELLPNRCYEAMAINSSVTHQVRRGERHPFYDSSWARAVPVHIWAQSEEEAAAEFE
FT                   RVFPKTVGFKILSIMPLAADGRPAARSMVPPPKGSDTRAADARAADARAAETGVAA"
FT   gene            673950..674525
FT                   /locus_tag="RC1_0631"
FT   CDS_pept        673950..674525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0631"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98066"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRI0"
FT                   /protein_id="ACI98066.1"
FT                   /translation="MTDFGLILGGMVVLLAAKPALDRARLSVRAARRTVAEVERRRRTL
FT                   SHQVRVLARESLHQRLTAGHDEEEVGEIQARIAGLQRRVQDLEEVDRRVLVLDERRGLS
FT                   ERGWIVLLRRDSTAAPPQEPAPVSRLWSEGRYLFCYATDPARARRKLTVRFPEEGGFQV
FT                   VEVFPHEGDLTEIPKIGAEGAAPLHGAA"
FT   gene            complement(674536..675006)
FT                   /locus_tag="RC1_0632"
FT   CDS_pept        complement(674536..675006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0632"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98067"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRI1"
FT                   /protein_id="ACI98067.1"
FT                   /translation="MDGHHPAEVFRPSETADFEVLYRHWLRLGDDRMPPPAALDLVDLP
FT                   FPLEDVIVLTVDRERDTFRFTRVGSRPLLWFRREVTGQTLAELSGHPFYGHFHAALDRC
FT                   LVGRGPHRTVSEVDIGSRRFRCSALLLPFARDGRTPDLLLIATRTTALGATH"
FT   gene            675628..678264
FT                   /locus_tag="RC1_0633"
FT   CDS_pept        675628..678264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0633"
FT                   /product="sensor histidine kinase"
FT                   /note="Contains PF02518, PF00072, and TIGR00229; identified
FT                   by match to protein family HMM PF00226"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98068"
FT                   /db_xref="GOA:B6IRI2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007891"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRI2"
FT                   /protein_id="ACI98068.1"
FT                   /translation="MACLLAFGAGTWVAARHDAGLDLIRSDADRAATIERTISAMREAL
FT                   RDLETGERGYLGSLDPSRLELARRGHETLDALAADLEASLDGRPGQQEQAAEIPVLTDR
FT                   QAAVFEAAAALARAGRLTDALATFDGEGDRSSIHAIHGRLDSLLADAHEHLRNRQTEAV
FT                   TYAELLVDWLSAGVALSGLGFAVAVAVLLTARRQGRELAAAQRRAAEAEERLRAALDAM
FT                   PDGFVVYDAEDRLVTWNDRFLERYPSLRGVPALKGMRFEDLLRIFIANREIGDPEAYDD
FT                   TERWIAERLAWRRSADGRAFERLTAHGHWLRVSEHPISTGGVLSLATDITAQKMREEEL
FT                   RRALEDVDEARREAELQAAEMVALAEELAAARTRADEARAESEAANRAKSDFVAVMSHE
FT                   VRTPLNALLGFADLLLQTPLTAEQREWVTLQREAGEALLTVVSDVLDFSKLEAGRLEVD
FT                   PHPFQLARLARSTSDLVRPTAEERGLALRVAVDPRLPEVVQGDAKRVRQVLLNLLNNAV
FT                   KFTERGHVALAVFPVADGRVRFEVLDTGIGIAPEQQERLFQEFVQADRATARRYGGTGL
FT                   GLAICRRLVDLMGGAIGVESAPGRGSLFWFELPLPADESSRPPPCAPEPVRSVDSARIL
FT                   LAEDVKANQALAVALLTKAGHRVTVVANGLDAVQAVAATPFDLVLMDVRMPRLGGLEAT
FT                   RRIRALGGPRGAIPVVALTAEAGAREQAACLEAGMDEVLTKPLQPALLLDAIARLAGRA
FT                   QAGEVPLAISPLPIVSAGTWRRLQHSVGRDELDSLVGDLVLDLPTWIGRLRGTSDPEGL
FT                   GDLAHELISVLGNFGLERAAAAAARLDSAIRGGTDLRPAAEALATELEQAAGELSLWLS
FT                   HSAGDPA"
FT   gene            complement(679349..680260)
FT                   /locus_tag="RC1_0634"
FT   CDS_pept        complement(679349..680260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0634"
FT                   /product="transcriptional regulator, LysR family protein"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98069"
FT                   /db_xref="GOA:B6IRI3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRI3"
FT                   /protein_id="ACI98069.1"
FT                   /translation="MDWDKLRVFHAVAEAGSFTHAGETLNLSQSAVSRQISALEESLHV
FT                   PLFHRHARGLILTEQGELLYRTAREVFAKLSMTEAMLSESKEHPKGPLKVTTTMAFGST
FT                   WLTPRVREFLSLYPDVQLSLLLDDTELDLSMREADIAIRMSAPRQPDLIQRHLMTVRVH
FT                   IYAHRAYAEKRGLPQSLDELDHHDIIAYPGETRAPVSNINWLLHVGDPPGGERQTVLRV
FT                   NSLYAMYRAVESGLGIASLPDYVVDGNPDIVRVLPDVSGPRIDAYFVYAEELRHSKRIA
FT                   VFRDFLVRKVQETFPASHAVGA"
FT   gene            complement(680661..681677)
FT                   /gene="trxB"
FT                   /locus_tag="RC1_0635"
FT   CDS_pept        complement(680661..681677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB"
FT                   /locus_tag="RC1_0635"
FT                   /product="thioredoxin-disulfide reductase"
FT                   /EC_number="1.8.1.9"
FT                   /note="identified by match to protein family HMM PF01968
FT                   match to protein family HMM PF02538 match to protein family
FT                   HMM PF05378"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98070"
FT                   /db_xref="GOA:B6IRI4"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRI4"
FT                   /protein_id="ACI98070.1"
FT                   /translation="MATHRTKVLIIGAGPAGYTAAIYTARANLEPLLVQGMQPGGQLTI
FT                   TTDVENYPGFEHAVQGPWLMEQMQKQAEHVGTRMIGDLIVDVDFSRRPFVCKGDSGDEY
FT                   VADAVIIATGAQARWLGVAGEQHYQGAGVSACATCDGFFFRGRPVAVIGGGNSAMEEAL
FT                   YLTHHASKVTLVHRRDSFRGERILQDRVLKNPKIEVVWNHVVDEILGEGGESFENPKRV
FT                   TGVRLKHAQTGETREIALEGVFVAIGHDPATRVFRGKVAMDDEGYILTAPDSTRTDVPG
FT                   VFAAGDVKDKVFRQAVTAAGMGCMAALEAEKWLATLEGSPADAAAEASRPDMIGAWE"
FT   gene            complement(681774..681893)
FT                   /locus_tag="RC1_0636"
FT   CDS_pept        complement(681774..681893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0636"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98071"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRI5"
FT                   /protein_id="ACI98071.1"
FT                   /translation="MPDRHPGRPAVWTGRGNRPAETVCHIPAPWSVRGTLPRY"
FT   gene            681942..684080
FT                   /gene="dsbD"
FT                   /locus_tag="RC1_0637"
FT   CDS_pept        681942..684080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbD"
FT                   /locus_tag="RC1_0637"
FT                   /product="thiol:disulfide interchange protein DsbD,
FT                   putative"
FT                   /note="Has no HMMs but some homologs With the
FT                   identification of thiolSome other homologs are identified
FT                   as: C-type cytochrome biogenesis protein i.g;
FT                   GB:AAY47612.1"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98072"
FT                   /db_xref="GOA:B6IRI6"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRI6"
FT                   /protein_id="ACI98072.1"
FT                   /translation="MPRLALLLPFVLLLALAVGLPTPAAANPVRTDHVEADLRAELPAA
FT                   VPGEPLWLAVTQRIRPGWHTYWKNPGDSGIATEVTWTLPPGWQAGPLVWPAPERFPVGP
FT                   LVNFGYKDEVHLLTRVDVPADAAPGGTVTIVAQADWLVCEDICIPESARLELTLPVAAG
FT                   PVAPTPERAALFAQARRSLPVPSPFPATFLAGETAHQLVLSTGDLAGAELADAFFFPEH
FT                   WSVTPAAAPQELRLDADGVRLVLPRSGALPAESVKGVLLLTERLEGREIRQALEIDAPI
FT                   EAVPASGSPAPGRAAADTAALGVGLALLLALAGGAILNLMPCVFPVLSIKVLALVSHAP
FT                   GRAPVHGAAYAAGVLATFAAVAGLLLALRAGGAQIGWGFQLQDPLVVAVLAYVMFLLGL
FT                   WLSGVYELGGGAQGLGQGLAARGGYAGSFFTGVLATVVATPCTAPFMGTAVGFALLQPW
FT                   PLALSVFLALGLGMALPFLLLTLSPALLRRMPRPGLWMERLKQALAFPLYATAVWLVWV
FT                   LSIQAGPDAVAWVLGGMVLVAFAAWLYGVTRSSGTGWRLGASVFGVLALAGAVAMARVP
FT                   ALAGPAVPPPPSGTAAAAGDSVPFDEAALAALRAEGRPVFVNFTAAWCITCLVNERTSL
FT                   SADAVKQAMAAKGVAYLKGDWTNRDAGIARVLEGFGRSGVPLYLLYRPGEAEPEVLPQI
FT                   LTPGLVLEALEALPDRAP"
FT   gene            684221..684895
FT                   /locus_tag="RC1_0638"
FT   CDS_pept        684221..684895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0638"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98073"
FT                   /db_xref="GOA:B6IRI7"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRI7"
FT                   /protein_id="ACI98073.1"
FT                   /translation="MTSPVSRRRFLSRTALAATALAATGGGGLLSVLLPRPARAAPVLG
FT                   KAAPDFSATDIAGRAVRLADLRGNTVVLEWTNHLCPFVMKHYGGGNMQALQRDYTGKGV
FT                   VWITVVSSAEGQQGHVTPAEAQRIVDEAKAAPTHKILDPKGTIGRAYAAKTTPHMFVID
FT                   PAGVLVYDGAIDDRPTARLEDLDGATSYVRAALDATLAGRPVAVPASQPYGCTIKYAKD
FT                   AV"
FT   gene            685000..687786
FT                   /locus_tag="RC1_0639"
FT   CDS_pept        685000..687786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0639"
FT                   /product="peptidase, M16 family, putative"
FT                   /EC_number="3.4.24.-"
FT                   /note="PF05193 PF00675: Insulinase (Peptidase family M16)"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98074"
FT                   /db_xref="GOA:B6IRI8"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRI8"
FT                   /protein_id="ACI98074.1"
FT                   /translation="MQRPLRLFLSTLAVGTILAAGWSPPAALAKSKDGPGTATAAPVSL
FT                   PFEKFTLGNGLRVIVHTDRKAPVVAVGIWYHVGSKDERPGRTGFAHLFEHLMFQGTENY
FT                   KGEWFQPFEEVGATDQNGTTWFDRTNYFQTVPTTALEMTLWLESDRMGHFIDSVDQAKL
FT                   DEQREVVKNEKRQGDNQPYGRTEYLTLAGLFPAGHPYSWSTIGSMEDLEAASLADVKDW
FT                   FRTWYGPDNAVLVLAGDIDAATARPLVEKYFGDIAAGPPLPRRAAAVPDRTTNTRDVLE
FT                   DRVPQPMMDRNWAVPGRNERDAALLMLASRVLGGGKTSRLFKTLVYDRQVATTASASMM
FT                   PLQLASIFSVTAMPRPGQSPAAVEAEVDKVVAEFLAKGPTEEELRNARTSLRARFVRGL
FT                   EKVGGFAGKATTLAEGELYHGDPAFYATWLDWIETATPADVTAAANRWLSKGWHQVDVV
FT                   PVPAYTTVAAGADRSALPKVESTPALTFPALETGTLANGIPVTLARRQGVPTVEVALQF
FT                   DAGYAADSAERPGVASFALDMMDEGTTSRSALRIADEMEGLGAQISGTSTVDTSVLRLS
FT                   ALSDRLGPSMQLFADVVRNPAFAPQEMERLRPRRLAAIQQEKAEPRLLALRVLPPALYG
FT                   ADHAYGKPFTGSGTEASVKAITVDDLKAFHAAWFRPDNVRIFAAGDVTLPALVEALNKA
FT                   FGDWKPGKAARPAKQIAEVKRQGTRVALIDRPDSPQTMIMAGRLAPSSTVENDTAIEMA
FT                   NDVFGGMFTSRVNMNLREAKGWSYGAFSFLSDARGQRPWIIMAPVQSDRTAEALSEIRR
FT                   ELTDYAGSRPADAAETARATRSAVRSLPGRFETNGAVLSQMLADARFDRPADHIEQYQK
FT                   SIAALGAKDLQAATRDFVSGDDLLWVVIGDRRKIEQGVRALNLGPVEIWDADGVRLE"
FT   gene            complement(688072..688941)
FT                   /locus_tag="RC1_0640"
FT   CDS_pept        complement(688072..688941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0640"
FT                   /product="enoyl-CoA hydratase"
FT                   /note="identified by match to protein family HMM PF00072
FT                   match to protein family HMM PF00512 match to protein family
FT                   HMM PF01627 match to protein family HMM PF02518 match to
FT                   protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98075"
FT                   /db_xref="GOA:B6IRI9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRI9"
FT                   /protein_id="ACI98075.1"
FT                   /translation="MADPDFETLRYAVADGIATVTLDRPDRLNAFTGTMMADLIAAFDR
FT                   ADADDTVRAVVVTGAGRAFCAGADLAEGAKTFDYAAQGRLAPDDGMRDSGGRVALRVFE
FT                   MKKPVIAAVNGPAVGIGATMLLPMDIRIASAEARFGFVFTRRGIVPEAASSWFLPRLVG
FT                   IAQALRWVLSGRVFDATEAQAGGLVSEVVPPERLLPRAYELAHEIADGTSAVSVALARQ
FT                   LLWRMLGADHPMEAHKVDSRLIQQTGRSPDAAEGVVSFLEKRPARFPLRPSADMPDAFP
FT                   WWEERPFT"
FT   gene            complement(689081..691597)
FT                   /locus_tag="RC1_0641"
FT   CDS_pept        complement(689081..691597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0641"
FT                   /product="ATP-dependent RNA helicase, DEAD"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98076"
FT                   /db_xref="GOA:B6IRJ0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR026362"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRJ0"
FT                   /protein_id="ACI98076.1"
FT                   /translation="MSDVPPFDGPDGAPDAADLLPPAISGWFRSRGWTPHAHQLALVQA
FT                   ARDGVDALLIAPTGGGKTLAGFLPSLIELAERPREGLHTLYISPLKALAVDIQRNLELP
FT                   LAALRLPVRAETRTGDTPEAKRQRQRAHPPHILLTTVESLALMLSYPEAPAIFGGLRRV
FT                   VVDELHALAGTKRGDLLALGLTRLSTLAPGLRRVGLSATVAHPAALAAWLSPTGRTDAA
FT                   PGDAAVRLVSGRSGARAEVEILRTEAPLPWAGHMALHALGEVYHRIREAGTTLVFVNTR
FT                   AQAELVFQELWRLNEDNLPIALHHGSLAAEQRRKVEAAMAAGRLRAVVATSSLDLGIDW
FT                   AAVDLVVQVGAPKGVSRLLQRIGRANHRLDAPSRALLVPANRFEVLECRAALEAIAEGT
FT                   LDGDPPRAGALDVLAQHITGTACAGPFDADRLYAEVVRAAPYADLSRDEFDDVFDFVAT
FT                   GGYALGTYERFRRLAETEDGRWAAASPLVARQYRLNVGTIVEATVLRVRLGRALLGEIE
FT                   EYFVNTLTPGDTFVFAGQLLKFLGVREMEVQVAKGGQGEPKVPAYAGGRLPLSTHLADR
FT                   VRDLLADPARWAALPGAVQEWLRLQRCRSVLPDRRSLLVETFPRAGKQFLVAYCFEGRN
FT                   AHQTLGMLLTRRMERAGLAPLGFVATDYVLATWSLRAPAAGDIPALFDEDMLGDDLEAW
FT                   MEESSMLKRTFRNVAVIAGLIERRHPGQEKSGRQVTFSSDLIYDVLRRHEPGHVLLRAT
FT                   RADAAAGLTDVRRLGDMLARVRGRIVHRDLDRISPLAVPVLLEIGREQVQGSALDDLLD
FT                   EAARELIAEAVPELLPRPDGQGRLAL"
FT   gene            691651..693111
FT                   /gene="mtnN"
FT                   /locus_tag="RC1_0642"
FT   CDS_pept        691651..693111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtnN"
FT                   /locus_tag="RC1_0642"
FT                   /product="Mta"
FT                   /EC_number="3.2.2.9"
FT                   /note="5'-methylthioadenosine
FT                   nucleosidaseS-adenosylhomocysteine nucleosidase identified
FT                   by match to protein family HMM PF00126 match to protein
FT                   family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98077"
FT                   /db_xref="GOA:B6IRJ1"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRJ1"
FT                   /protein_id="ACI98077.1"
FT                   /translation="MVHPERVREIGMTGLAELLAAVTAGDAAGAARIAGADPGLLAERG
FT                   PDGATPILLAAYRGARPVQEALRPLKPALDLYEAAALGDLDRVVALVEAEPSAIDRPAP
FT                   DGRTALGLAAFFGRQAVVDWLLARGADATPPAMGPTALPPLHAAAVGRHLAIARALLAH
FT                   GAAPDAPRHGGYTALHAAARNGHLELIALLLEHGADPHRAAADGATALSLARAAGHARA
FT                   VTLLEAGGGRSADAPFGLLCAIPEEIAHFGPHFVESEAETIGGFVFRRGLLDGRHAVVV
FT                   ECGIGKVNAAVVSTLLIERFGCRLLLFSGVAGGVDPALGIGDVVVGTRLVQHDYGALVR
FT                   GNLRVYQPGVTPVPGVADTHGYTLDPAVEATVRAALDGLELPPIPAEATGGAERTPRIT
FT                   FGTIATGDQFVNCESTRQRLHERFGAAAVEMEGAAVAQVAERFGVPCLVIRSLSDLAGA
FT                   ESHMDFYTFVAAAARCASLLLRRVASAL"
FT   gene            693222..693638
FT                   /locus_tag="RC1_0643"
FT   CDS_pept        693222..693638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0643"
FT                   /product="glyoxalase family protein"
FT                   /note="identified by match to protein family HMM PF00070
FT                   match to protein family HMM PF01134 match to protein family
FT                   HMM PF07992 match to protein family HMM TIGR01292"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98078"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRJ2"
FT                   /protein_id="ACI98078.1"
FT                   /translation="MSDTHMLKGVVPYLTVGDAQKAIAFYVHALDAHEVVRQTEPDGVR
FT                   VTHSVLLINGGTFFVSDDFPEHNGGQSRDPLTLAASPVTLHMNVPNVDTLVQRAVEHGA
FT                   TVLVPPQPVIWGSRFAKIRDPFGHVWTLVTPIPE"
FT   gene            complement(693690..693818)
FT                   /locus_tag="RC1_0644"
FT   CDS_pept        complement(693690..693818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0644"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2 putative"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98079"
FT                   /db_xref="GOA:B6IRJ3"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRJ3"
FT                   /protein_id="ACI98079.1"
FT                   /translation="MRRQNHRAVAATGGMDAAIGLVNGVLLSLPLWAAFLWFAAAF"
FT   gene            complement(693947..694909)
FT                   /locus_tag="RC1_0645"
FT   CDS_pept        complement(693947..694909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0645"
FT                   /product="Indigoidine synthase A like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98080"
FT                   /db_xref="GOA:B6IRJ4"
FT                   /db_xref="InterPro:IPR007342"
FT                   /db_xref="InterPro:IPR022830"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6IRJ4"
FT                   /protein_id="ACI98080.1"
FT                   /translation="MHDFLSIHPEVAAALKAGRPVVALESTLISHGLPAPANLETAQAI
FT                   EAAVRANGAVPATIAVLDGRIRVGLDAEDMQRLAAPGTAKVSRRDLPLVLAKGADGATT
FT                   VAATMIAADLAGIAVFATGGIGGVHRGVETTGDISADLEELATTSVAVVCAGAKAILDL
FT                   PRTLEYLETRGVPVVGFGTDAFPAFYHRDSGLPVDGRCDTPEDAARVLNAKWRLGLAGG
FT                   IVVAVPIPDEAALDAAQAEAAVQQAVAEAATGGVRGKALTPFLLHRLETLTGGASLTAN
FT                   RALLLNNAAVGARIAVAYARLKQETTLPKKPPPSKRPTY"
FT   gene            695190..696119
FT                   /locus_tag="RC1_0646"
FT   CDS_pept        695190..696119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0646"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98081"
FT                   /db_xref="InterPro:IPR026360"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRJ5"
FT                   /protein_id="ACI98081.1"
FT                   /translation="MRAVERAVVTHGHSDHARPGHARVLATPDTLAIMRARLGDQAGAA
FT                   QQPLPYGEPLRIGEVVLRLVPAGHVLGSAQVVLEWRGSRVVVSGDYKRRPDPTCLPFEP
FT                   VACDAFVTEATFGLPVFRHPPDADEVGRLLHSLALFPERAHVVGVYALGKCQRLIALLR
FT                   RAGYDRPVWLHGALIPMCELYRAHGVDLGDLRPVTGAAREDLRGQVVLAPPSAIQDKWS
FT                   RRLPDPVVACASGWMRVRQRARQRGVELPLVISDHADWDELTATLRDVDAPEVWVTHGR
FT                   EEALVHWAGAQGYRARALALIGFEDEDV"
FT   gene            696144..697748
FT                   /gene="lig"
FT                   /locus_tag="RC1_0647"
FT   CDS_pept        696144..697748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lig"
FT                   /locus_tag="RC1_0647"
FT                   /product="ATP dependent DNA ligase domain protein"
FT                   /EC_number="6.5.1.1"
FT                   /note="identified by match to protein family HMM PF00675
FT                   match to protein family HMM PF05193"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98082"
FT                   /db_xref="GOA:B6IRJ6"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR026333"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRJ6"
FT                   /protein_id="ACI98082.1"
FT                   /translation="MNRFAALIDALAFMPSRTGKVRLIADHFATTPDPERGWTLAALTG
FT                   ALTFAAAKPAAVRALVMERVDPELFGWSYDFVGDLAETVALIWPERPGTDSPPPTLSGV
FT                   VAALDRATRAEVPRLIEGWLDALDATGRWALLKLITGGLRVGVSARLAKTALAEWGAGN
FT                   GSDIGIDAVEEVWHGLRPPYAELFAWAEARAPRPDVSAAGGFRPLMLAHPLEEADIAAL
FT                   DPAAYRAEWKWDGIRVQLVGRTLGEGRLYSRTGDEITAGFPDVAARLGFDAVLDGELLV
FT                   VREGEVRPFNDLQQRLNRRQVTAKMLRDYPAWVRLYDLLVEGGEDLRGLPFDARRRRLE
FT                   DWVARVRPAGMDLSPLIAFTDWDGLAALRAGARENAIEGLMLKRGDSPYLAGRPKGPWF
FT                   KWKRGPLTLDCVMMYAQRGHGKRSSYYSDYTFGAWTGDPDGGGELVPVGKAYSGFTDEE
FT                   LGRLDRWVRANTVNRFGPVREVAPALVLEVAFDSVHPSGRHRSGLAMRFPRIARIRWDK
FT                   PAHEADRLETLRALVAG"
FT   gene            complement(697790..697972)
FT                   /locus_tag="RC1_0648"
FT   CDS_pept        complement(697790..697972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC1_0648"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:RC1_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACI98083"
FT                   /db_xref="InterPro:IPR017136"
FT                   /db_xref="UniProtKB/TrEMBL:B6IRJ7"
FT                   /protein_id="