(data stored in ACNUC7421 zone)

EMBL: CP000628

ID   CP000628; SV 1; circular; genomic DNA; STD; PRO; 4005130 BP.
XX
AC   CP000628;
XX
PR   Project:PRJNA13402;
XX
DT   30-JAN-2009 (Rel. 99, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Agrobacterium radiobacter K84 chromosome 1, complete sequence.
XX
KW   .
XX
OS   Agrobacterium radiobacter K84
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Rhizobiaceae;
OC   Rhizobium/Agrobacterium group; Agrobacterium;
OC   Agrobacterium tumefaciens complex.
XX
RN   [1]
RP   1-4005130
RX   DOI; 10.1128/JB.01779-08.
RX   PUBMED; 19251847.
RA   Slater S.C., Goldman B.S., Goodner B., Setubal J.C., Farrand S.K.,
RA   Nester E.W., Burr T.J., Banta L., Dickerman A.W., Paulsen I., Otten L.,
RA   Suen G., Welch R., Almeida N.F., Arnold F., Burton O.T., Du Z., Ewing A.,
RA   Godsy E., Heisel S., Houmiel K.L., Jhaveri J., Lu J., Miller N.M.,
RA   Norton S., Chen Q., Phoolcharoen W., Ohlin V., Ondrusek D., Pride N.,
RA   Stricklin S.L., Sun J., Wheeler C., Wilson L., Zhu H., Wood D.W.;
RT   "Genome sequences of three agrobacterium biovars help elucidate the
RT   evolution of multichromosome genomes in bacteria";
RL   J. Bacteriol. 191(8):2501-2511(2009).
XX
RN   [2]
RP   1-4005130
RG   Agrobacterium Consortium
RA   Setubal J., Wood D., Slater S., Nester E., Farrand S., Goldman B., Burr T.,
RA   Goodner B., Otten L., Dickerman A., Almeida N., Sun J., Jhaveri J.,
RA   Banta L., Houmiel K.;
RT   ;
RL   Submitted (14-MAR-2007) to the INSDC.
RL   Virginia Bioinformatics Institute, Virginia Tech, Washington Street, Box
RL   0477, Blacksburg, VA 24061, USA
XX
DR   MD5; 11077d61f8db15658afb701f774a1363.
DR   BioSample; SAMN02602977.
DR   EnsemblGenomes-Gn; Arad_5000.
DR   EnsemblGenomes-Gn; Arad_5001.
DR   EnsemblGenomes-Gn; Arad_5002.
DR   EnsemblGenomes-Gn; Arad_5003.
DR   EnsemblGenomes-Gn; Arad_5004.
DR   EnsemblGenomes-Gn; Arad_5005.
DR   EnsemblGenomes-Gn; Arad_5006.
DR   EnsemblGenomes-Gn; Arad_5007.
DR   EnsemblGenomes-Gn; Arad_5008.
DR   EnsemblGenomes-Gn; Arad_5009.
DR   EnsemblGenomes-Gn; Arad_5010.
DR   EnsemblGenomes-Gn; Arad_5011.
DR   EnsemblGenomes-Gn; Arad_5012.
DR   EnsemblGenomes-Gn; Arad_5013.
DR   EnsemblGenomes-Gn; Arad_5014.
DR   EnsemblGenomes-Gn; Arad_5015.
DR   EnsemblGenomes-Gn; Arad_5016.
DR   EnsemblGenomes-Gn; Arad_5017.
DR   EnsemblGenomes-Gn; Arad_5018.
DR   EnsemblGenomes-Gn; Arad_5019.
DR   EnsemblGenomes-Gn; Arad_5020.
DR   EnsemblGenomes-Gn; Arad_5021.
DR   EnsemblGenomes-Gn; Arad_5022.
DR   EnsemblGenomes-Gn; Arad_5023.
DR   EnsemblGenomes-Gn; Arad_5024.
DR   EnsemblGenomes-Gn; Arad_5025.
DR   EnsemblGenomes-Gn; Arad_5026.
DR   EnsemblGenomes-Gn; Arad_5027.
DR   EnsemblGenomes-Gn; Arad_5028.
DR   EnsemblGenomes-Gn; Arad_5029.
DR   EnsemblGenomes-Gn; Arad_5030.
DR   EnsemblGenomes-Gn; Arad_5031.
DR   EnsemblGenomes-Gn; Arad_5032.
DR   EnsemblGenomes-Gn; Arad_5033.
DR   EnsemblGenomes-Gn; Arad_5034.
DR   EnsemblGenomes-Gn; Arad_5035.
DR   EnsemblGenomes-Gn; Arad_5036.
DR   EnsemblGenomes-Gn; Arad_5037.
DR   EnsemblGenomes-Gn; Arad_5038.
DR   EnsemblGenomes-Gn; Arad_5039.
DR   EnsemblGenomes-Gn; Arad_5040.
DR   EnsemblGenomes-Gn; Arad_5041.
DR   EnsemblGenomes-Gn; Arad_5042.
DR   EnsemblGenomes-Gn; Arad_5043.
DR   EnsemblGenomes-Gn; Arad_5044.
DR   EnsemblGenomes-Gn; Arad_5045.
DR   EnsemblGenomes-Gn; Arad_5046.
DR   EnsemblGenomes-Gn; Arad_5047.
DR   EnsemblGenomes-Gn; Arad_5048.
DR   EnsemblGenomes-Gn; Arad_5049.
DR   EnsemblGenomes-Gn; Arad_5050.
DR   EnsemblGenomes-Gn; Arad_5100.
DR   EnsemblGenomes-Gn; Arad_5101.
DR   EnsemblGenomes-Gn; Arad_5102.
DR   EnsemblGenomes-Gn; Arad_5103.
DR   EnsemblGenomes-Gn; Arad_5104.
DR   EnsemblGenomes-Gn; Arad_5105.
DR   EnsemblGenomes-Gn; Arad_5106.
DR   EnsemblGenomes-Gn; Arad_5107.
DR   EnsemblGenomes-Gn; Arad_5108.
DR   EnsemblGenomes-Gn; Arad_5109.
DR   EnsemblGenomes-Gn; Arad_5110.
DR   EnsemblGenomes-Gn; Arad_5111.
DR   EnsemblGenomes-Gn; Arad_5112.
DR   EnsemblGenomes-Gn; Arad_5113.
DR   EnsemblGenomes-Gn; Arad_5114.
DR   EnsemblGenomes-Gn; Arad_5115.
DR   EnsemblGenomes-Gn; Arad_5116.
DR   EnsemblGenomes-Gn; EBG00001276689.
DR   EnsemblGenomes-Gn; EBG00001276692.
DR   EnsemblGenomes-Gn; EBG00001276694.
DR   EnsemblGenomes-Gn; EBG00001276695.
DR   EnsemblGenomes-Gn; EBG00001276696.
DR   EnsemblGenomes-Gn; EBG00001276698.
DR   EnsemblGenomes-Gn; EBG00001276699.
DR   EnsemblGenomes-Gn; EBG00001276700.
DR   EnsemblGenomes-Gn; EBG00001276702.
DR   EnsemblGenomes-Gn; EBG00001276704.
DR   EnsemblGenomes-Gn; EBG00001276706.
DR   EnsemblGenomes-Gn; EBG00001276708.
DR   EnsemblGenomes-Gn; EBG00001276710.
DR   EnsemblGenomes-Gn; EBG00001276712.
DR   EnsemblGenomes-Gn; EBG00001276714.
DR   EnsemblGenomes-Gn; EBG00001276716.
DR   EnsemblGenomes-Gn; EBG00001276718.
DR   EnsemblGenomes-Gn; EBG00001276720.
DR   EnsemblGenomes-Gn; EBG00001276722.
DR   EnsemblGenomes-Gn; EBG00001276724.
DR   EnsemblGenomes-Gn; EBG00001276726.
DR   EnsemblGenomes-Gn; EBG00001276728.
DR   EnsemblGenomes-Gn; EBG00001276730.
DR   EnsemblGenomes-Gn; EBG00001276732.
DR   EnsemblGenomes-Gn; EBG00001276734.
DR   EnsemblGenomes-Gn; EBG00001276736.
DR   EnsemblGenomes-Gn; EBG00001276738.
DR   EnsemblGenomes-Gn; EBG00001276740.
DR   EnsemblGenomes-Gn; EBG00001276742.
DR   EnsemblGenomes-Gn; EBG00001276744.
DR   EnsemblGenomes-Gn; EBG00001276746.
DR   EnsemblGenomes-Gn; EBG00001276748.
DR   EnsemblGenomes-Gn; EBG00001276750.
DR   EnsemblGenomes-Gn; EBG00001276752.
DR   EnsemblGenomes-Gn; EBG00001276754.
DR   EnsemblGenomes-Gn; EBG00001276756.
DR   EnsemblGenomes-Gn; EBG00001276758.
DR   EnsemblGenomes-Gn; EBG00001276760.
DR   EnsemblGenomes-Gn; EBG00001276762.
DR   EnsemblGenomes-Gn; EBG00001276764.
DR   EnsemblGenomes-Gn; EBG00001276766.
DR   EnsemblGenomes-Gn; EBG00001276768.
DR   EnsemblGenomes-Gn; EBG00001276770.
DR   EnsemblGenomes-Gn; EBG00001276772.
DR   EnsemblGenomes-Gn; EBG00001276774.
DR   EnsemblGenomes-Gn; EBG00001276776.
DR   EnsemblGenomes-Gn; EBG00001276777.
DR   EnsemblGenomes-Gn; EBG00001276778.
DR   EnsemblGenomes-Gn; EBG00001276779.
DR   EnsemblGenomes-Gn; EBG00001276780.
DR   EnsemblGenomes-Gn; EBG00001276781.
DR   EnsemblGenomes-Gn; EBG00001276782.
DR   EnsemblGenomes-Gn; EBG00001276783.
DR   EnsemblGenomes-Gn; EBG00001276784.
DR   EnsemblGenomes-Gn; EBG00001276785.
DR   EnsemblGenomes-Gn; EBG00001276786.
DR   EnsemblGenomes-Gn; EBG00001276787.
DR   EnsemblGenomes-Gn; EBG00001276788.
DR   EnsemblGenomes-Gn; EBG00001276789.
DR   EnsemblGenomes-Gn; EBG00001276790.
DR   EnsemblGenomes-Gn; EBG00001276791.
DR   EnsemblGenomes-Gn; EBG00001276792.
DR   EnsemblGenomes-Gn; EBG00001276793.
DR   EnsemblGenomes-Gn; EBG00001276794.
DR   EnsemblGenomes-Gn; EBG00001276795.
DR   EnsemblGenomes-Gn; EBG00001276796.
DR   EnsemblGenomes-Gn; EBG00001276797.
DR   EnsemblGenomes-Gn; EBG00001276798.
DR   EnsemblGenomes-Gn; EBG00001276799.
DR   EnsemblGenomes-Gn; EBG00001276800.
DR   EnsemblGenomes-Gn; EBG00001276801.
DR   EnsemblGenomes-Gn; EBG00001276802.
DR   EnsemblGenomes-Gn; EBG00001276803.
DR   EnsemblGenomes-Gn; EBG00001276804.
DR   EnsemblGenomes-Gn; EBG00001276805.
DR   EnsemblGenomes-Gn; EBG00001276806.
DR   EnsemblGenomes-Gn; EBG00001276807.
DR   EnsemblGenomes-Gn; EBG00001276808.
DR   EnsemblGenomes-Gn; EBG00001276809.
DR   EnsemblGenomes-Gn; EBG00001276810.
DR   EnsemblGenomes-Gn; EBG00001276811.
DR   EnsemblGenomes-Gn; EBG00001276812.
DR   EnsemblGenomes-Gn; EBG00001276813.
DR   EnsemblGenomes-Gn; EBG00001276814.
DR   EnsemblGenomes-Gn; EBG00001276815.
DR   EnsemblGenomes-Gn; EBG00001276816.
DR   EnsemblGenomes-Gn; EBG00001276817.
DR   EnsemblGenomes-Gn; EBG00001276818.
DR   EnsemblGenomes-Tr; Arad_5000-1.
DR   EnsemblGenomes-Tr; Arad_5001-1.
DR   EnsemblGenomes-Tr; Arad_5002-1.
DR   EnsemblGenomes-Tr; Arad_5003-1.
DR   EnsemblGenomes-Tr; Arad_5004-1.
DR   EnsemblGenomes-Tr; Arad_5005-1.
DR   EnsemblGenomes-Tr; Arad_5006-1.
DR   EnsemblGenomes-Tr; Arad_5007-1.
DR   EnsemblGenomes-Tr; Arad_5008-1.
DR   EnsemblGenomes-Tr; Arad_5009-1.
DR   EnsemblGenomes-Tr; Arad_5010-1.
DR   EnsemblGenomes-Tr; Arad_5011-1.
DR   EnsemblGenomes-Tr; Arad_5012-1.
DR   EnsemblGenomes-Tr; Arad_5013-1.
DR   EnsemblGenomes-Tr; Arad_5014-1.
DR   EnsemblGenomes-Tr; Arad_5015-1.
DR   EnsemblGenomes-Tr; Arad_5016-1.
DR   EnsemblGenomes-Tr; Arad_5017-1.
DR   EnsemblGenomes-Tr; Arad_5018-1.
DR   EnsemblGenomes-Tr; Arad_5019-1.
DR   EnsemblGenomes-Tr; Arad_5020-1.
DR   EnsemblGenomes-Tr; Arad_5021-1.
DR   EnsemblGenomes-Tr; Arad_5022-1.
DR   EnsemblGenomes-Tr; Arad_5023-1.
DR   EnsemblGenomes-Tr; Arad_5024-1.
DR   EnsemblGenomes-Tr; Arad_5025-1.
DR   EnsemblGenomes-Tr; Arad_5026-1.
DR   EnsemblGenomes-Tr; Arad_5027-1.
DR   EnsemblGenomes-Tr; Arad_5028-1.
DR   EnsemblGenomes-Tr; Arad_5029-1.
DR   EnsemblGenomes-Tr; Arad_5030-1.
DR   EnsemblGenomes-Tr; Arad_5031-1.
DR   EnsemblGenomes-Tr; Arad_5032-1.
DR   EnsemblGenomes-Tr; Arad_5033-1.
DR   EnsemblGenomes-Tr; Arad_5034-1.
DR   EnsemblGenomes-Tr; Arad_5035-1.
DR   EnsemblGenomes-Tr; Arad_5036-1.
DR   EnsemblGenomes-Tr; Arad_5037-1.
DR   EnsemblGenomes-Tr; Arad_5038-1.
DR   EnsemblGenomes-Tr; Arad_5039-1.
DR   EnsemblGenomes-Tr; Arad_5040-1.
DR   EnsemblGenomes-Tr; Arad_5041-1.
DR   EnsemblGenomes-Tr; Arad_5042-1.
DR   EnsemblGenomes-Tr; Arad_5043-1.
DR   EnsemblGenomes-Tr; Arad_5044-1.
DR   EnsemblGenomes-Tr; Arad_5045-1.
DR   EnsemblGenomes-Tr; Arad_5046-1.
DR   EnsemblGenomes-Tr; Arad_5047-1.
DR   EnsemblGenomes-Tr; Arad_5048-1.
DR   EnsemblGenomes-Tr; Arad_5049-1.
DR   EnsemblGenomes-Tr; Arad_5050-1.
DR   EnsemblGenomes-Tr; Arad_5100-1.
DR   EnsemblGenomes-Tr; Arad_5101-1.
DR   EnsemblGenomes-Tr; Arad_5102-1.
DR   EnsemblGenomes-Tr; Arad_5103-1.
DR   EnsemblGenomes-Tr; Arad_5104-1.
DR   EnsemblGenomes-Tr; Arad_5105-1.
DR   EnsemblGenomes-Tr; Arad_5106-1.
DR   EnsemblGenomes-Tr; Arad_5107-1.
DR   EnsemblGenomes-Tr; Arad_5108-1.
DR   EnsemblGenomes-Tr; Arad_5109-1.
DR   EnsemblGenomes-Tr; Arad_5110-1.
DR   EnsemblGenomes-Tr; Arad_5111-1.
DR   EnsemblGenomes-Tr; Arad_5112-1.
DR   EnsemblGenomes-Tr; Arad_5113-1.
DR   EnsemblGenomes-Tr; Arad_5114-1.
DR   EnsemblGenomes-Tr; Arad_5115-1.
DR   EnsemblGenomes-Tr; Arad_5116-1.
DR   EnsemblGenomes-Tr; EBT00001808787.
DR   EnsemblGenomes-Tr; EBT00001808788.
DR   EnsemblGenomes-Tr; EBT00001808789.
DR   EnsemblGenomes-Tr; EBT00001808790.
DR   EnsemblGenomes-Tr; EBT00001808791.
DR   EnsemblGenomes-Tr; EBT00001808792.
DR   EnsemblGenomes-Tr; EBT00001808793.
DR   EnsemblGenomes-Tr; EBT00001808794.
DR   EnsemblGenomes-Tr; EBT00001808795.
DR   EnsemblGenomes-Tr; EBT00001808796.
DR   EnsemblGenomes-Tr; EBT00001808797.
DR   EnsemblGenomes-Tr; EBT00001808798.
DR   EnsemblGenomes-Tr; EBT00001808799.
DR   EnsemblGenomes-Tr; EBT00001808800.
DR   EnsemblGenomes-Tr; EBT00001808801.
DR   EnsemblGenomes-Tr; EBT00001808802.
DR   EnsemblGenomes-Tr; EBT00001808803.
DR   EnsemblGenomes-Tr; EBT00001808804.
DR   EnsemblGenomes-Tr; EBT00001808805.
DR   EnsemblGenomes-Tr; EBT00001808806.
DR   EnsemblGenomes-Tr; EBT00001808807.
DR   EnsemblGenomes-Tr; EBT00001808808.
DR   EnsemblGenomes-Tr; EBT00001808809.
DR   EnsemblGenomes-Tr; EBT00001808810.
DR   EnsemblGenomes-Tr; EBT00001808811.
DR   EnsemblGenomes-Tr; EBT00001808812.
DR   EnsemblGenomes-Tr; EBT00001808813.
DR   EnsemblGenomes-Tr; EBT00001808814.
DR   EnsemblGenomes-Tr; EBT00001808815.
DR   EnsemblGenomes-Tr; EBT00001808816.
DR   EnsemblGenomes-Tr; EBT00001808817.
DR   EnsemblGenomes-Tr; EBT00001808818.
DR   EnsemblGenomes-Tr; EBT00001808819.
DR   EnsemblGenomes-Tr; EBT00001808820.
DR   EnsemblGenomes-Tr; EBT00001808821.
DR   EnsemblGenomes-Tr; EBT00001808822.
DR   EnsemblGenomes-Tr; EBT00001808823.
DR   EnsemblGenomes-Tr; EBT00001808824.
DR   EnsemblGenomes-Tr; EBT00001808825.
DR   EnsemblGenomes-Tr; EBT00001808826.
DR   EnsemblGenomes-Tr; EBT00001808827.
DR   EnsemblGenomes-Tr; EBT00001808828.
DR   EnsemblGenomes-Tr; EBT00001808829.
DR   EnsemblGenomes-Tr; EBT00001808830.
DR   EnsemblGenomes-Tr; EBT00001808831.
DR   EnsemblGenomes-Tr; EBT00001808832.
DR   EnsemblGenomes-Tr; EBT00001808833.
DR   EnsemblGenomes-Tr; EBT00001808834.
DR   EnsemblGenomes-Tr; EBT00001808835.
DR   EnsemblGenomes-Tr; EBT00001808836.
DR   EnsemblGenomes-Tr; EBT00001808837.
DR   EnsemblGenomes-Tr; EBT00001808838.
DR   EnsemblGenomes-Tr; EBT00001808839.
DR   EnsemblGenomes-Tr; EBT00001808840.
DR   EnsemblGenomes-Tr; EBT00001808841.
DR   EnsemblGenomes-Tr; EBT00001808842.
DR   EnsemblGenomes-Tr; EBT00001808843.
DR   EnsemblGenomes-Tr; EBT00001808844.
DR   EnsemblGenomes-Tr; EBT00001808845.
DR   EnsemblGenomes-Tr; EBT00001808846.
DR   EnsemblGenomes-Tr; EBT00001808847.
DR   EnsemblGenomes-Tr; EBT00001808848.
DR   EnsemblGenomes-Tr; EBT00001808849.
DR   EnsemblGenomes-Tr; EBT00001808850.
DR   EnsemblGenomes-Tr; EBT00001808851.
DR   EnsemblGenomes-Tr; EBT00001808852.
DR   EnsemblGenomes-Tr; EBT00001808853.
DR   EnsemblGenomes-Tr; EBT00001808854.
DR   EnsemblGenomes-Tr; EBT00001808855.
DR   EnsemblGenomes-Tr; EBT00001808856.
DR   EnsemblGenomes-Tr; EBT00001808857.
DR   EnsemblGenomes-Tr; EBT00001808858.
DR   EnsemblGenomes-Tr; EBT00001808859.
DR   EnsemblGenomes-Tr; EBT00001808860.
DR   EnsemblGenomes-Tr; EBT00001808861.
DR   EnsemblGenomes-Tr; EBT00001808862.
DR   EnsemblGenomes-Tr; EBT00001808863.
DR   EnsemblGenomes-Tr; EBT00001808864.
DR   EnsemblGenomes-Tr; EBT00001808865.
DR   EnsemblGenomes-Tr; EBT00001808866.
DR   EnsemblGenomes-Tr; EBT00001808867.
DR   EnsemblGenomes-Tr; EBT00001808868.
DR   EnsemblGenomes-Tr; EBT00001808869.
DR   EnsemblGenomes-Tr; EBT00001808870.
DR   EnsemblGenomes-Tr; EBT00001808871.
DR   EnsemblGenomes-Tr; EBT00001808872.
DR   EnsemblGenomes-Tr; EBT00001808873.
DR   EnsemblGenomes-Tr; EBT00001808874.
DR   EuropePMC; PMC2668409; 19251847.
DR   EuropePMC; PMC3133165; 21398532.
DR   EuropePMC; PMC3301998; 22419837.
DR   EuropePMC; PMC3957732; 24600043.
DR   EuropePMC; PMC4054136; 24727275.
DR   EuropePMC; PMC5739047; 29220487.
DR   EuropePMC; PMC5998023; 29899540.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00517; serC.
DR   RFAM; RF00518; speF.
DR   RFAM; RF00519; suhB.
DR   RFAM; RF00520; ybhL.
DR   RFAM; RF00521; SAM_alpha.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01793; ffh.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000628.
DR   SILVA-SSU; CP000628.
DR   StrainInfo; 114617; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4005130
FT                   /organism="Agrobacterium radiobacter K84"
FT                   /chromosome="1"
FT                   /strain="K84"
FT                   /isolate="ATCC BAA-868"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:311403"
FT                   /culture_collection="ATCC:BAA-868"
FT   gene            190..1023
FT                   /locus_tag="Arad_0001"
FT   CDS_pept        190..1023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0001"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24806"
FT                   /db_xref="GOA:B9JG22"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026565"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG22"
FT                   /protein_id="ACM24806.1"
FT                   /translation="MESSVENRTSFFHLHLISDSTGETLISAGRAASVQFHASQPIEHV
FT                   YPLIRNRKQLLPVLEAIDHSPGIVLYTIVDRELADFIDERCREMGVPCVNVLEPVMNVF
FT                   QTYLGTASRRRVGAQHVMNADYFARIEALNFTMDHDDGQMQDDYNDADVVIIGISRTSK
FT                   TPTSIYLANRGIKTANIPIIAGVPLPESLIQATRPLIVGLVATTDRISQVRENRILGAT
FT                   TGFDRGGYTDRATISEELKYARSLCARHNWPIIDVTRRSIEETAAAIVALRPKLR"
FT   gene            1062..1661
FT                   /gene="maf"
FT                   /locus_tag="Arad_4980"
FT   CDS_pept        1062..1661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maf"
FT                   /locus_tag="Arad_4980"
FT                   /product="septum formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_4980"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28537"
FT                   /db_xref="GOA:B9JG23"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG23"
FT                   /protein_id="ACM28537.1"
FT                   /translation="MTMPLILASSSPFRRMLMENAGMHFQAIAADIDERAIEAPLERDG
FT                   AGPDAVALVLAKAKAKEVSDRFPGSLVIGSDQTMSLGSQVFHKPKTMGEAESHLQSLSA
FT                   KTHRLNSGIALALNGDIVWEHVSHAELTMRDLSADFIHRHLTRVGEKALSSVGAYQLEG
FT                   EGIQLFSKIDGDYFTILGLPMLPLLQKLRELGAIDG"
FT   gene            1654..2514
FT                   /gene="aroEch1"
FT                   /locus_tag="Arad_0002"
FT   CDS_pept        1654..2514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroEch1"
FT                   /locus_tag="Arad_0002"
FT                   /product="shikimate 5-dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24807"
FT                   /db_xref="GOA:B9JG24"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9JG24"
FT                   /protein_id="ACM24807.1"
FT                   /translation="MGDSRETHGLNAFVTGYPVKHSRSPLIHGYWLRTLNLAGSYRAVE
FT                   VTPDDFPAFIAALKDRSSGFVGGNVTIPHKEIAFKLADRPDELSEELGASNTLWLEDGL
FT                   LHATNTDGRGFTANLDECHPGWDRTDRAVILGAGGASRAVIQAVRDRGVNEIHVVNRTV
FT                   ERAQELSDRFGAQVHAHPMAALGEVMRSAGLFVNTTSLGMENEVAPTIDFSPLAENAVV
FT                   TDIVYVPLKTPLLAQAEEQGFATVDGLGMLLHQAAPGFETWFGKRPVVDEVLRALIIAD
FT                   MDKHR"
FT   gene            2511..3128
FT                   /gene="coaE"
FT                   /locus_tag="Arad_0003"
FT   CDS_pept        2511..3128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="Arad_0003"
FT                   /product="dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24808"
FT                   /db_xref="GOA:B9JG25"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG25"
FT                   /protein_id="ACM24808.1"
FT                   /translation="MIRVGLTGSIGMGKSTSGKLFAEAGIPVNDADAVVHDLYRGEAVP
FT                   LIETAFPGTTKDGTVDRQELGRQLGLDPSGFKRLEAIVHPLVRERERIFLDHQLTAGAD
FT                   IVVLDIPLLFETGADKRVDRIVVVSCDPQLQRERVLARPGMTEERFNMILSRQTPDAEK
FT                   RARADYIIDTSHSIDTTREQIRDIIADLRRQSTDGGPTGGEP"
FT   gene            3130..3840
FT                   /gene="dnaQ"
FT                   /locus_tag="Arad_0004"
FT   CDS_pept        3130..3840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="Arad_0004"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24809"
FT                   /db_xref="GOA:B9JG26"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG26"
FT                   /protein_id="ACM24809.1"
FT                   /translation="MREIIFDTETTGLDNKADRIIEIGGIELFNHFPTGKTLHLYINPG
FT                   DRKVHPDALAVHGITDESLKDKPPFADVADEILAFFEGAKWIAHNATFDMGFVNAEFNR
FT                   LGRPPILPDMVIDTLAMARRKHPMGPNSLDALCRRYGIDNSHRTRHGALLDSELLAEVY
FT                   IEMIGGRQTALGLGSSNGSSARSRQNNDVEEVVVEILARPQPLPGRVSETEEAAHAALV
FT                   AKLGEKGIWSKYRA"
FT   gene            complement(3867..4499)
FT                   /locus_tag="Arad_0005"
FT   CDS_pept        complement(3867..4499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0005"
FT                   /product="amino acid efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24810"
FT                   /db_xref="GOA:B9JG27"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG27"
FT                   /protein_id="ACM24810.1"
FT                   /translation="MPDLSILALFAAAALVLTATPGPDMLLIASRSVSQGRAAGFLTYA
FT                   GIALGTYCHALAAALGLSQLFMTVPIAYEIVRWAGCAYLLYLAYKTIRSEGSSFSPTSM
FT                   LKRLSNKRIFAEGLATNLLNPKMVLFVLALFPQFVSPQGGSMIGQMLLLATILNGIGFF
FT                   VNGSVILVGSHIRARLAGFSRFPKLPQYLLATVFAGLACRLALGART"
FT   gene            complement(4645..5124)
FT                   /gene="secB"
FT                   /locus_tag="Arad_0006"
FT   CDS_pept        complement(4645..5124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="Arad_0006"
FT                   /product="protein-export translocase chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24811"
FT                   /db_xref="GOA:B9JG28"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG28"
FT                   /protein_id="ACM24811.1"
FT                   /translation="MANETSNGAASPSLTILAQYTKDLSFENPGAPRSLQARENAPDIN
FT                   INVNVNANPLSDSDFDVVLTLNADAKDGDRVLFHTELVYGGVFRVTGFPQEHMLPLLFI
FT                   ECPRLLFPFARQIIADITRNGGFPPLMIDPIDFAQMFTQRMAEEQARAQVSSVPN"
FT   gene            complement(5220..5756)
FT                   /gene="fxsA"
FT                   /locus_tag="Arad_0007"
FT   CDS_pept        complement(5220..5756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fxsA"
FT                   /locus_tag="Arad_0007"
FT                   /product="FxsA cytoplasmic membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24812"
FT                   /db_xref="GOA:B9JG29"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG29"
FT                   /protein_id="ACM24812.1"
FT                   /translation="MRLSLVPIFVFLMPLAEIAGFIVVGKMLGVWATLALVILSAVLGA
FT                   ALLRIQGIGILQRISAESRNGGDPGREMVHGAMIVIAAFFLMLPGFISDIIGLLLFIPA
FT                   VRELAWKVLRKRIVVLGSTRAFRRGPGQGSGPNTAPGPQPRPSGSGRVVDLDETDFHRE
FT                   PDRNSPWSDRKRLEE"
FT   gene            5953..6654
FT                   /locus_tag="Arad_0009"
FT   CDS_pept        5953..6654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0009"
FT                   /product="translocase transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24813"
FT                   /db_xref="GOA:B9JG30"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR016985"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR039544"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG30"
FT                   /protein_id="ACM24813.1"
FT                   /translation="MGANDFVTIFFLVAAVLIFFQLRSVLGRRTGNEKPPRDLYGSPDQ
FT                   ATGPNAPDAGKVVTLPRRDATEDEDRFAAIDAFTPAGTPLNDSLRELNKADPSFSPKEF
FT                   VNGARMAYEMIVMAFADGDRNALKGLLSREVYEGFDAAITDRETKGEKVKSTFVGIDKA
FT                   DIVSAEMKDTEATVTMRIVSQMISATYDKAGTLIDGDAETVAEISDVWTFARDSRSRDP
FT                   NWKLVATESEQ"
FT   gene            6651..7769
FT                   /locus_tag="Arad_0011"
FT   CDS_pept        6651..7769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0011"
FT                   /product="lytic murein transglycosylase A protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24814"
FT                   /db_xref="GOA:B9JG31"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG31"
FT                   /protein_id="ACM24814.1"
FT                   /translation="MTTASKDFRLEPATFADLKGWGDDDPSSLFRAMRDCRTHVRDVKP
FT                   YRTGAAGLTADDLLTLLDDAEGYEPRDAAKARAFFEERCQPFFIRRGDGGRGFVTAFFE
FT                   PEITVSATPDEIYRYPFYRRPDDLVDLDDANRPSGLDPSYMFGKLKDGAISAYPDRGEI
FT                   DRGYLEGGGLEIAWAKSKVDVFFVHVQGAARLRYPDGRMGRITYAAKAGHPFSAVGRLL
FT                   IERGLLDRATISMQTIRDWLYAHPQEVDEVLWHNRSYIFFREADVSDPALGPIAAAKVP
FT                   LVAGRSLAVDRLIHTFGFPFFIQSESLTHLDAGQPFGRLMLALDTGSAIVGPARGDIFT
FT                   GSGYDAGELAGTVRNDADFYILVPKAAAQRFG"
FT   gene            7769..8368
FT                   /locus_tag="Arad_0012"
FT   CDS_pept        7769..8368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0012"
FT                   /product="DNA repair protein, smr/mutS family"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24815"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG32"
FT                   /protein_id="ACM24815.1"
FT                   /translation="MAPERRSPEGKSKERKLSTDERVLWGKVAKSTRPMPGRQADMESF
FT                   DEVLAAEAKAEETARAEKARVAPAPADPQISPAPVKQPSGTHHPLERPVKRKIAKGRLA
FT                   LEARIDLHGLIQSEAHVMLLDFLFRAHERGLRHVLVITGKGSSMGSDGALKRAVPLWFS
FT                   KPEFRFLISSYETAAQHHGGDGALYIRLSRPKGDRP"
FT   gene            8365..8730
FT                   /locus_tag="Arad_0013"
FT   CDS_pept        8365..8730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0013"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24816"
FT                   /db_xref="GOA:B9JG33"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG33"
FT                   /protein_id="ACM24816.1"
FT                   /translation="MTPFGEAVRKLRARKGVSQKEMAAALNVTPAYLSALEHGKRGTPT
FT                   FDLLQRIAGYFNIIWDEAEELFLLARFSDPRVVVDTSGLAPEYTAFVNRLADRIRNLDT
FT                   TTIKELSLVLENAGKRG"
FT   gene            8879..11314
FT                   /gene="gyrB"
FT                   /locus_tag="Arad_0014"
FT   CDS_pept        8879..11314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="Arad_0014"
FT                   /product="DNA gyrase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24817"
FT                   /db_xref="GOA:B9JG34"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG34"
FT                   /protein_id="ACM24817.1"
FT                   /translation="MTDISVTENDGNAEYGADSIKVLKGLDAVRKRPGMYIGDTDDGSG
FT                   LHHMVYEVVDNAIDEALGGYADLVTVTLNPDGSVTVTDNGRGIPTDIHTGEGISAAEVI
FT                   MTQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSVWLKLKIRRQGKINEMSFTHGVADAP
FT                   LKVTGDAGSETGTEVSFMPSSETFTMTEFDYSTLEHRLRELAFLNSGVRILLTDKRHSD
FT                   VRQEEMLYDGGLEAFVKYLDRAKKPLVDKPVSIRSEKDGITVEVAMWWNESYHENVLCF
FT                   TNNIPQRDGGTHMAGFRGALTRQITSYGESSGITKREKVTLTGDDCREGLTAVLSVKVP
FT                   DPKFSSQTKDKLVSSEVRPVVESLVNEALGTWLEEHPADAKVLVGKVVEAAAAREAARK
FT                   ARELTRRKGALDIASLPGKLADCSERDPAKSEVFLVEGDSAGGSAKQGRSRENQAILPL
FT                   RGKILNVERARFDKMLSSQEIGTLITALGTGIGKDEFNADKLRYHKIIIMTDADVDGAH
FT                   IRTLLLTFFFRQMPDLIERGHLYIAQPPLYKVTRGKSVQYVKDEKAFEEYLIGQGLDDA
FT                   SLKLGTGEVRAGEDLRELIFDALRLRTLLGNLHSRYNRAVVEQAAIAGALNAELVSDPA
FT                   RAEGLVNDVARRLDIIAEETERGWTGAVTSEGGLRFERMVRGVKEVVVLDMALIGSQDA
FT                   RLIDQVGSRLKDVYDQPPKLARRDGETEISGPGMLLETVFAAGRKGLTMQRYKGLGEMN
FT                   AEQLWETTLDPNARSLLQVRVPDATDADGLFARLMGDEVEPRREFIQDNALNVANLDI"
FT   gene            complement(11383..11982)
FT                   /locus_tag="Arad_0015"
FT   CDS_pept        complement(11383..11982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0015"
FT                   /product="oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24818"
FT                   /db_xref="GOA:B9JG35"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG35"
FT                   /protein_id="ACM24818.1"
FT                   /translation="MTSSNNRESQYPIDKLFLDRWSPRAYSNETMPEADLLTILEAAHW
FT                   APSASNLQPWRFVYALRGSENWDKFLSLLIEFNQGWAKSASALLFVVSRTHGGELGSAE
FT                   QKPNYSHTFDAGTAWGFLAIQAHLAGYEAHGMGGFHVEKSYEVLGIPEGFRVEAAVAIG
FT                   KIGDKNQLPEKLRERETPNDRKPLSEVAFNGTFIAK"
FT   gene            complement(12064..12363)
FT                   /locus_tag="Arad_0016"
FT   CDS_pept        complement(12064..12363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0016"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24819"
FT                   /db_xref="InterPro:IPR014543"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG36"
FT                   /protein_id="ACM24819.1"
FT                   /translation="MPTSVSSVKTDHASRYLQQLCKHWSHKFTIEFNETAGKVPFNPET
FT                   SLELAADASSLLMTLHVENPQDLDRMQNVVADHLKRFAFREELDVVWTADTSKV"
FT   gene            12569..13987
FT                   /locus_tag="Arad_0017"
FT   CDS_pept        12569..13987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0017"
FT                   /product="pyridoxal-dependent amino acid decarboxylase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24820"
FT                   /db_xref="GOA:B9JG37"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR010977"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR021115"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG37"
FT                   /protein_id="ACM24820.1"
FT                   /translation="MDWEEFRRWSEKAADWGADYRASLRERPVRAQTAPGEIAAHIADS
FT                   PPESGESMEDIFKDFEDILVPGMTHWQHPRFFAYFPANAAPVSVVAEYLVSAIAAQCML
FT                   WQTSPSATELETKVVDWLRQALGLPDSFTGVIQDSASTATLAAVLVMREKALDWQGNKQ
FT                   GLTANKTVRIYSTDQVHTSIDRAIWISGIGADNLVRIPSSGPNSAMDPQALAAAIERDR
FT                   AAGLLPAGVIACVGGTSIGACDDIAAVVEVAHAHGLYVHVDAAWAGSAMICPEFRTLWQ
FT                   GVEQADSIVFNPHKWLGAQFDCSVQFIREPESLVRTLAIHPEFLRTHGHDGITNYSEWS
FT                   VPLGRRFRALKLWFLLRYHGLEGLRTMIRNHVAWSQNLAQRLAVEPDFQIVSQPFLSLF
FT                   SFDHKAPGGVDQESHTQRLIAAINNDGRIYLTQTRVAGRLVIRFQAGQFETTADDIDVA
FT                   FATIVEIARSLSST"
FT   gene            14117..14959
FT                   /locus_tag="Arad_0018"
FT   CDS_pept        14117..14959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0018"
FT                   /product="2-hydroxyhepta-2,4-diene-1,7-dioate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24821"
FT                   /db_xref="GOA:B9JG38"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG38"
FT                   /protein_id="ACM24821.1"
FT                   /translation="MKLLRVGPAGKEKPALLDSDGKIRDLSAHVADIGGEAISPAGLAK
FT                   IAALDPKSLPELAEGRLGACVAGTGKFICIGLNFSDHAAETGATVPPEPIIFMKATSAI
FT                   VGPNDNVLIPRGSQKTDWEVELGVVIGKTAKYVSEADALDYVAGYCVSHDVSERAFQTE
FT                   RSGQWTKGKSCDTFGPIGPWLVTKDEVADPQNLGMWLKVNGKTMQDGSTKTMVYGVAYL
FT                   VSYLSQFMSLHPGDVISTGTPPGVGMGMKPPQFLKAGDVVELGMEGLGSQRQTFLADA"
FT   gene            15247..16524
FT                   /locus_tag="Arad_0020"
FT   CDS_pept        15247..16524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0020"
FT                   /product="intracellular PHB depolymerase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24822"
FT                   /db_xref="InterPro:IPR009656"
FT                   /db_xref="InterPro:IPR010915"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG39"
FT                   /protein_id="ACM24822.1"
FT                   /translation="MFYQFYELNHAALAPFRAAADMMRLAYANPLNPLSHTVLGRTMTA
FT                   SLEMFERTTRRYGKPEFGLPETQIDGKPVSVHEKVVWKKPFCNLIHFERSLPAGHGSDP
FT                   RILIVAPMSGHYATLLRGTVEALLPSADIYITDWIDARMVPMTEGTFDLEDYIDYVIEM
FT                   LHHLGPDTHVVAVCQPSVPVLAAAAVMEAAGDPLSPASMTLMGGPIDTRINPTAVNQLA
FT                   KDKPLEWFADNVVMNVPWPQPGFMRPVYPGFLQLSGFMSMNLDRHMIAHKDFFMHLVKN
FT                   DGEPAEKHRDFYDEYLAVMDLTAEFYLQTVDEVFIKHALPKGELLHRGQRVDPAAIRNV
FT                   ALLTVEGENDDISGVGQTGAAQTICTNIPDDMRMHYLQPDVGHYGVFNGSRFRREIAPR
FT                   IIAFAHEHARSGKPVVKRVIKGGKTA"
FT   gene            16683..17129
FT                   /locus_tag="Arad_0021"
FT   CDS_pept        16683..17129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0021"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24823"
FT                   /db_xref="GOA:B9JG40"
FT                   /db_xref="InterPro:IPR021273"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG40"
FT                   /protein_id="ACM24823.1"
FT                   /translation="MNQSALLRPDWTPATIALMVLGFVVFWPLGLAMLAYILFGERLRD
FT                   FKRDVNEKADGVFSGFSGCGRHRGRHRAHFTTGNVAFDDWRRAELERLEEERRKLDEMR
FT                   ADFDTYVRELRRAKDQDEFDRFMRDRNNVKRNDDNGPAPEFQTP"
FT   gene            17220..17981
FT                   /locus_tag="Arad_0022"
FT   CDS_pept        17220..17981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0022"
FT                   /product="zinc metallopeptidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24824"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG41"
FT                   /protein_id="ACM24824.1"
FT                   /translation="MFPLLSRSRRSAPQPPAPETRTLEVAGRLMPLTIRQNERATRITL
FT                   RIEPGGRALKMTIPRGLAAREVNAFLDRHQGWLLTKLAKFSTESSLRSGGEILLRGIRH
FT                   RIEHTGTLRGLTEAIVIDGVPVLRVSGMPEHAGRRIATFLKKEARADLERLVKLHAGAI
FT                   RAPVSSISMKDTRSRWGSCSSEGNLSFSWRIVMAPPLVIDYLAAHEVAHLREMNHGPRF
FT                   WALCRKLCPEMDEAKAWLKRHGSHLHAIDFD"
FT   gene            18072..18740
FT                   /gene="trpF"
FT                   /locus_tag="Arad_0024"
FT   CDS_pept        18072..18740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpF"
FT                   /locus_tag="Arad_0024"
FT                   /product="n-5'-phosphoribosylanthranilate isomerase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24825"
FT                   /db_xref="GOA:B9JG42"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9JG42"
FT                   /protein_id="ACM24825.1"
FT                   /translation="MNPDIKICGLKTPEAMDRALERGATHVGFIFFEKSPRYIEPDLAG
FT                   KLAERARGKAKIVAVTVNPTNDDLDEIISLVRPDILQLHGNESPERVLTIKAVYNLPVM
FT                   KAMSVRDADDLKRVEAYIGIADRFLFDAKPPAGSELPGGNGVSFDWSLMSWLDDRVDYM
FT                   LSGGVNKDNFAQALASTRATGIDLSSGVESAPGVKDPKKIDEFFDAVAEACLPEPAAGS
FT                   "
FT   gene            18743..19957
FT                   /gene="trpB"
FT                   /locus_tag="Arad_0026"
FT   CDS_pept        18743..19957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpB"
FT                   /locus_tag="Arad_0026"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24826"
FT                   /db_xref="GOA:B9JG43"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9JG43"
FT                   /protein_id="ACM24826.1"
FT                   /translation="MNQTPKLNSFRAGPDEDGRFGIYGGRFVAETLMPLILDLQEEWEK
FT                   AKNDPAFQAELKSLGTHYIGRPSPLYFAERLTAELGGAKIYFKREELNHTGSHKINNCI
FT                   GQILLAKRMGKTRIIAETGAGQHGVASATVAARFGLPCVVYMGATDVERQAPNVFRMKL
FT                   LGAEVIPVTAGSGTLKDAMNEALRDWVTNVDDTYYLIGTAAGPHPYPEMVRDFQAVIGT
FT                   EAKQQMLEAEGRLPDLVIAAVGGGSNAIGIFHPFLDDESVKIVGVEAGGKGLQGDEHCA
FT                   SITAGSPGVLHGNRTYLLQDGDGQIKEGHSISAGLDYPGIGPEHSWLNDIGRAEYVPIM
FT                   DHEALEAFQTLTRLEGIIPALEPSHALAEVIKRAPKMGKDEIILMNLSGRGDKDIFTVA
FT                   KILGM"
FT   gene            19968..20807
FT                   /gene="trpf"
FT                   /locus_tag="Arad_0028"
FT   CDS_pept        19968..20807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpf"
FT                   /locus_tag="Arad_0028"
FT                   /product="tryptophan synthase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24827"
FT                   /db_xref="GOA:B9JG44"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9JG44"
FT                   /protein_id="ACM24827.1"
FT                   /translation="MTARMDKRFAALKAEGRPALVTYFMGGDPDYDTSLGIMKALPEAG
FT                   ADVIELGMPFSDPMADGPAIQLAGQRALKAGQTLKKTLQLAADFRKTDGDTPIVLMGYY
FT                   NPIYIYGVETFLDDAIAAGIDGLIVVDLPPEMDDELCIPAIRKGINFIRLATPTTDEKR
FT                   LPAVLKNTSGFVYYVSMNGITGSALPDPSLVSGAVKRIKQHTDLPVCVGFGVKTAEHAK
FT                   LIGASADGVVVGTAIVNQIATSLTKDGKAGADTIQAVATLVRGLSTGTRSARLVAAE"
FT   gene            20917..21828
FT                   /locus_tag="Arad_0030"
FT   CDS_pept        20917..21828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0030"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24828"
FT                   /db_xref="GOA:B9JG45"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9JG45"
FT                   /protein_id="ACM24828.1"
FT                   /translation="MNWITNYVRPRINSMLGRREVPENLWIKCPETGEMVFHKDLEDNK
FT                   WVIPASGFHMKMPAKARLADLFDKGEYEALQQPKVAQDPLKFRDSKKYTDRLKDSRVKT
FT                   DQEDTIVAGVGKVRGLKLVAVVHEFNFMGGSLGIAAGEAIVKAFERAIAEKCPLVMFPA
FT                   SGGARMQEGILSLMQLPRTTVAVDMLKEAGQPYIVVLTNPTTGGVTASYAMLGDVHLAE
FT                   PGAEICFAGKRVIEQTIREKLPEGFQTSEYLLEHGMVDMVVKRHDIPDTLATLLKILTK
FT                   APANDVSAKSLNGAAAPLVANG"
FT   gene            21919..23214
FT                   /gene="folC"
FT                   /locus_tag="Arad_0031"
FT   CDS_pept        21919..23214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /locus_tag="Arad_0031"
FT                   /product="folylpolyglutamate synthase/dihydrofolate syntase
FT                   bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24829"
FT                   /db_xref="GOA:B9JG46"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG46"
FT                   /protein_id="ACM24829.1"
FT                   /translation="MGLHPKGYDLSLDRITRLLDILGNPQNKLPPVIHVAGTNGKGSVT
FT                   AFCRALLEAGGYSVHVHTSPHLVNWHERYRIGVKGGRGELVADAVFAEVLRRIADANGG
FT                   EKITVFEILTAATFTLFAEHPADAAVIEVGLGGRFDATNVISEPAVSVIMPISLDHQPY
FT                   LGDRVELIAAEKAGIMKAGRPVVIGHQDYDAALDVLISTAERLRCPTAVFGQDFSAHEE
FT                   YGRLVYQDEFGLGDLPLPRLPGRHQYANAAAAIRAVKAAGFTVTEAMMEKAMISVEWPG
FT                   RLQRLTEGELLPHAPEGAEIWVDGGHNPGAGEVIAEAMASFEERQPRPLFLIIGMINTK
FT                   DPVGYFKAFTGLAEKVYCVPIRGSEAMIDPVILANSAYDAGLVAEPMSTVRQALDEIRE
FT                   LAVPNMPAPRILIGGSLYLVGDVLADNGTPPK"
FT   gene            complement(23278..23604)
FT                   /gene="trxA"
FT                   /locus_tag="Arad_0033"
FT   CDS_pept        complement(23278..23604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="Arad_0033"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24830"
FT                   /db_xref="GOA:B9JG47"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG47"
FT                   /protein_id="ACM24830.1"
FT                   /translation="MATVKVDNANFASEVLQSAEPVIVDFWAEWCGPCKMIAPSLEELS
FT                   EQFEGKVKVAKLNIDENPELAAQFGVRSIPTLAMFKAGEVADIKVGAAPKSALESWIKG
FT                   AAAA"
FT   gene            complement(23680..27246)
FT                   /gene="addA"
FT                   /locus_tag="Arad_0034"
FT   CDS_pept        complement(23680..27246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="addA"
FT                   /locus_tag="Arad_0034"
FT                   /product="double-strand break repair helicase AddA"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24831"
FT                   /db_xref="GOA:B9JG48"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014151"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG48"
FT                   /protein_id="ACM24831.1"
FT                   /translation="MSDLPANELAALPESDDAGAWIGWTTVQQSIASDPERSAWVSANA
FT                   GSGKTHVLTQRVIRLLLAGARPSAILCLTYTKAAASEMSNRVFDRLAAWATLSDEELKA
FT                   RIAEIEGAEPDLFKLAEARRLFAKALETPGGLKIQTIHAFCEALLHQFPLEANVAGHFS
FT                   VLDDRAAATLLDDARRSLLAATTPQRDAELAEAFSYVLDLGDESGLETLLGDIVAKRNA
FT                   IRRFTTDAERKGGIDAALLARLGLSAGDTEAGIAEQYWPLPGLSGATLELYLTLADQKG
FT                   GAKAQEVAYALRLAKRETHPVARAEILEKVMLTGKGEPKSDSQFFVKAMLADAPALAEA
FT                   VAAARAHVVTCRDRLKLMRMYRATRAALVLADRLNRDYEELKKRRSQLDFEDLITRTAD
FT                   LLTKKDVGPWIHYKLDQGIDHILVDEAQDTSPIQWSVIQSLAEDFFSGESARQTLRTIF
FT                   AVGDEKQSIYSFQGARPERFSEESDRTRRRVATSGQQFSSIRLPLSFRSTADVLAAVDH
FT                   VFTAPENARGLSAVDEPVVHRSSRIGHPGAVDLWEMIAPEPAAKEEDWTAPFDSTPESA
FT                   PAAILARRMAQTIGNLIGRETIIEKGKARFIEAGDILVLVRKRDSFVNALTRALKRRNN
FT                   IPVAGADRLVLTSHIAIQDLLALGRFLLLPEDDLSLSALLKSPLFDLGEDDVFAVAALR
FT                   GSDESVWNHLQKFADDGNERFRHAVDRLKTFLALSKSLSVHDFYARVLGSFGGRRQFLA
FT                   RLGTEVSDILDEFLTFTLDHETSGLPGLQSFVSTLELEAPTVKREQDKGRNEVRIMTVH
FT                   ASKGLEAPIVFLVDGGGKAFTHTHLPKMRLIETGKQDIPLPVWVPVSALANSLTQADTA
FT                   RLQSLTEEEYRRLLYVGMTRAADRLIICGYRGIRENADTWHAMISAALRQDGERCTPVS
FT                   FSGPDGEWQGLSWRVSQVERSFERMEQAETTVDRGALPAGLSRPLPPQRNLPRPLSPSG
FT                   AGTVIDDEADNLLVTSPLFTEKAKSDRSLEKGRFIHRMLQTLPEIASADRAEAARRYAE
FT                   RAARFWPQAERDALIGSVMALLSHPELQGVFSAHAQAEVSIMGTLTLDDQAYAVSGRID
FT                   RLTVLDDRVVILDYKTNRVPPRSAEQIPFAHRAQLAIYREILSPLYPGKRIDCVLVYTE
FT                   NASIHTLSGEALALTLAELKTK"
FT   gene            complement(27239..30430)
FT                   /gene="addB"
FT                   /locus_tag="Arad_0035"
FT   CDS_pept        complement(27239..30430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="addB"
FT                   /locus_tag="Arad_0035"
FT                   /product="double-strand break repair protein AddB"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24832"
FT                   /db_xref="GOA:B9JG49"
FT                   /db_xref="InterPro:IPR014153"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG49"
FT                   /protein_id="ACM24832.1"
FT                   /translation="MTGGHRKRILTIPAGLPFLKTLASALCDGRLTEHFRHDPSDPLSL
FT                   AKVTIFLPTRRAARVLRSEFVDLLGGRSAILPVIRPLGETDDDSGYFEEALPATADLAQ
FT                   PLANTARLLELARLILAWRNKLPQIVRDIHSDSPLVAPASPADAIWLARNLAELIDSIE
FT                   TEDRDWAALGDLSTEDHALWWQLTAEFLQIASAFWPARLEELGKSSPARHRNAILRAEA
FT                   QRIAIMQHAGPIIIAGSTGSVPATAELIAAVASLPQGVIVLPGLDLSMPEEDWQLVAPE
FT                   TGIGERVDPTTRSHSQYGLSLLLKRLHTPRSEVETVAEATEDMQMRAEVLSRALAPAKA
FT                   TSGWGAWQQTLAPDAISNAFADVALIEAANEREEATAIAIALRLALEKPGQDGGESQAA
FT                   LITPDRNLARRVTAELARFGITADDSAGTPLTATPQGALLQLLLEATLRPGDPVAIVSL
FT                   LKHPLARFGLPQDALQLGVDALEILALRGGIADVDIGALEPLLDRQLAEQAKNRHTPQW
FT                   RKSLAPEAVDRARELARQVSGACEPLASALSQQSSDGLPTLSEWAERTGRALEAVAIDE
FT                   RGSLAALWSGEAGDTLASLLKEIIDTDGQLEADGPQWIDIMAALCAGQAVKPRALSHPR
FT                   LFIFGTLEARLQSVDTLILGGLNEGSWPGQTANNPFISRTMKTEIGLEPPERRIGQLAH
FT                   DFEMANGTRDLIYSRALRQGSTPTVASRWLQRLIALGGKAFTSELKARGDQYRHWAGMI
FT                   DQGENQAPAQRPAPRPPAELQPKSYSFSEVGRLRRDPYAIYARRVLRLDPIDPFNRDPG
FT                   PAERGTLYHKIIDRFIREGHIAGTPDASLAMDHILTELFDAEQLPVHIDSVWRPRFREV
FT                   ARAFIIWEAERRPEIRKTATEVPAGVQIEPIGIRLTGVADRIDFKGGKAADIIDYKTGY
FT                   NPSPAQARTLLDPQLALEAYALKAGAFRDIDALVPENLLYVRLRPGDRFKVDQVNNELS
FT                   SRGGKTETKSALDLAQESMDQLVKFVSLLQSGEKGFSSRLIPAQQFEYGGDYDHLARVS
FT                   EWSTAETEQEGGGDE"
FT   gene            complement(30435..31166)
FT                   /locus_tag="Arad_0036"
FT   CDS_pept        complement(30435..31166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0036"
FT                   /product="nucleotidyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24833"
FT                   /db_xref="GOA:B9JG50"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG50"
FT                   /protein_id="ACM24833.1"
FT                   /translation="MTIRQAMVLAAGLGTRMRPITDTIPKPLVKIAGKPMIDYALDALA
FT                   EAGVEQVVVNVHHHADQMEMHLRNYRGLEILISDERDALMNNGGGLAKGLKLLGRDPVF
FT                   VMNSDLFWIGETRGRPTNLQRLAGFFDAERMDMAMLCVALEKTTGHNGKNDFGLAEDGR
FT                   LSRYRDVAQNGVVYAGTLVMTPAVLDDAPDDAFNVNTYYDKSIAAGRLYGTMLDGHWLT
FT                   VGTPEAVGEAEETIRTFRAFV"
FT   gene            complement(31243..32754)
FT                   /locus_tag="Arad_0037"
FT   CDS_pept        complement(31243..32754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0037"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24834"
FT                   /db_xref="GOA:B9JG51"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012180"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG51"
FT                   /protein_id="ACM24834.1"
FT                   /translation="MTAANTSISLFLADDAATTRLGEDLALALKVGDCVALSGDLGAGK
FT                   SSLARALLRALADDADLDVPSPTFTLVQSYELRIPVSHFDLYRLGDPSELAELGFDEAL
FT                   QTGICLVEWPEMAESELPKERIDLKLEHEAEGRRATIVAPAKQSARIQRVLAIRAFLDA
FT                   NGYAGAERRFLTGDASLRAYESIYPQGGGNQVILMDWPRLPEGPAVLDGKPYPKVAHLA
FT                   EDAYPFVAIANELRKNGFAAPEIFAVDYDQGILLIEDLGSEGVLDEEGRPIAERYRAGV
FT                   ACLAHLHGLAIPRDIPVTPGHIHHVPDFDRTAMKMEARLLIDWHLPWKRGTPASDEARA
FT                   DYLAIWDALIDQLDGAEKSLLLRDFHSPNIIWRAKEKGIQRVGLIDFQDAMIGPTAYDL
FT                   ASIVQDARVTIERPLHDRLMDDYLSLRRAQGNFDEAGFLKSWAIMSAQRNCKLAGLWVR
FT                   LLQRDGKPGYLKHMPRTLSYLAIAFEHEALAPLRDWCAKAGIGEA"
FT   gene            complement(32751..35225)
FT                   /locus_tag="Arad_0038"
FT   CDS_pept        complement(32751..35225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0038"
FT                   /product="two-component sensor histidine kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24835"
FT                   /db_xref="GOA:B9JG52"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG52"
FT                   /protein_id="ACM24835.1"
FT                   /translation="MRPLASLARLLRLSVFGGIATGLAGPVLAQTSAASPAVVRLFTSS
FT                   EMAVFSVIIGVISAALLSTVWMVRQRGNLESESREIRTALSDANQRISQYQALIADKNR
FT                   RIIIWDGQNARPELLGQLPVETGAPQDNEFLAFGRWMKSWSAGELEKAIDKLRGSGQSF
FT                   DIVVETNREEILEAQGRISGGRAFVRFIALNNLRAELAELKIERERLMTSISAFQNLLD
FT                   AIDLPVWQRDADGQLTWVNHAYGEAVEAVSPDEALREGREFLTTVARERIRASATPESP
FT                   FHDKISTVVHGNRTFFDVIDVKLPNGSAGMAIDVSETETVRAELERTLKSHAETLDHLA
FT                   TPVAIFDGDRRLQFYNQAFVQLWELDIAFLEKKPDNSELLDRLRSAKKLPEQLNWKTWK
FT                   DGVLSVYRALDTQSDLWHLPNGQILRVFATAHPQGGATWVFENLTEQVDLETRYNTLVV
FT                   VQGETIDHLSEGVAVFGPDGRIRLSNPAFRILWNITEIQAKPGTHIQTLAEACAPSYDR
FT                   PDGWKRFAEQITSFDDERPSSQGTLELYSNLVLDYAVIPLPNAQTMLTFVNKTDSVRAE
FT                   RALTEKNEALLKADELKNDFVQHVSYELRSPLTNIIGFTDLLKTPGIGSLNDRQAEYID
FT                   HISTSSAVLLTLVNDILDLATVDAGIMRLNYSEIALDDLLDEVSMQIADRLQESGVTLE
FT                   ITVPAHLGSVVADQQRLKQILLKLLTNAANFAPEGSTIALKCGRDGTDFVFSVADKGPG
FT                   ISEEIMRTVFNRFASSGKGGKRSGAGLGLSIVESFVSLHDGQVSIESQPGKGTTVNCRI
FT                   PSAESPHSVAAE"
FT   gene            complement(35545..36945)
FT                   /gene="ahcY"
FT                   /locus_tag="Arad_0039"
FT   CDS_pept        complement(35545..36945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahcY"
FT                   /locus_tag="Arad_0039"
FT                   /product="adenosylhomocysteinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24836"
FT                   /db_xref="GOA:B9JG53"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9JG53"
FT                   /protein_id="ACM24836.1"
FT                   /translation="MSTENDYIVADIGLADFGRKEITIAETEMPGLMACRAEFGETKPL
FT                   KGARITGSLHMTIQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAIAASGVPVYAIKG
FT                   ESLEDYWIYTDKIFQWADGGFSNMILDDGGDATMYILLGARAEAGEDVLSDPHSEEEEI
FT                   LFAQIKKRLKASPGWFTKQRDAIKGVTEETTTGVNRLYQLSQKGLLPFPAINVNDSVTK
FT                   SKFDNKYGCKESLVDGIRRATDVMMAGKVAVVCGYGDVGKGSAASLSGAGARVKVTEVD
FT                   PICALQAAMDGYEVVLLEDVVSSADIFISTTGNKDVIRIDHMRAMKDMAIVGNIGHFDN
FT                   EIQVAALRNLKWTNVKPQVDLIEFAKGNRIILLSEGRLLNLGNATGHPSFVMSASFTNQ
FT                   TLAQIELFTKPGQYQNQVYVLPKHLDEKVARLHLGKLGVKLTELSGEQAAYIGVTPQGP
FT                   FKSDHYRY"
FT   gene            complement(37133..37408)
FT                   /locus_tag="Arad_0041"
FT   CDS_pept        complement(37133..37408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0041"
FT                   /product="phosphocarrier protein HPr protein (component of
FT                   the phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system)"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24837"
FT                   /db_xref="GOA:B9JG54"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG54"
FT                   /protein_id="ACM24837.1"
FT                   /translation="MTALSRELLIINKRGLHARASAKFVQTVEAYDATITVSKDGTTVG
FT                   GNSIMGLMMLAASPGCSVLVTASGKQATEALEALDKLVADKFGEEM"
FT   gene            complement(37428..37829)
FT                   /locus_tag="Arad_0042"
FT   CDS_pept        complement(37428..37829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0042"
FT                   /product="protein-N(pi)-phosphohistidine-sugar
FT                   phosphotransferase protein (component of the
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system)"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24838"
FT                   /db_xref="GOA:B9JG55"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG55"
FT                   /protein_id="ACM24838.1"
FT                   /translation="MIGLVLVTHGKLAEEFRHAVEHVVGPQKFIETVSIGPEDDMDKRR
FT                   QDILQAVTGADDGHGVIILTDMFGGTPSNLAISVMNSGHTEVIAGVNLPMLIKLAGVRG
FT                   DNNMERALVEASEAGRKYINVASRVLSGK"
FT   gene            complement(37982..38434)
FT                   /locus_tag="Arad_0044"
FT   CDS_pept        complement(37982..38434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0044"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24839"
FT                   /db_xref="GOA:B9JG56"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG56"
FT                   /protein_id="ACM24839.1"
FT                   /translation="MSTEATNVHATAIVVGKTGLLFLGASGSGKSSLAFSCLAAAKPLG
FT                   LAAALVADDQVFITRRDGAVIAECPPSIAGLMEIRYTGIVRLPHVSKAEMHFAICPVDP
FT                   ATAERLPPEDEQIDVTGSIRLPLIRLSVTSVNPLAAIMAKIAVDLD"
FT   gene            complement(38431..40275)
FT                   /gene="chvG"
FT                   /locus_tag="Arad_0045"
FT   CDS_pept        complement(38431..40275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chvG"
FT                   /locus_tag="Arad_0045"
FT                   /product="two-component sensor histidine kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24840"
FT                   /db_xref="GOA:B9JG57"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR025908"
FT                   /db_xref="InterPro:IPR025919"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG57"
FT                   /protein_id="ACM24840.1"
FT                   /translation="MRTGSTIPFFERAVGLAQLVQHRDRDIDDAETPSGARIARRRWTH
FT                   PFTLIRRIFGNAVFSSLTRRILFFNLAALVVLVGGILYLNQFREGLIDARVESLLTQGE
FT                   IIAGAVSASASVDTNSITIDPQKLLELQAGQSITPVPNDEDLEFPIDPEKVAPVLTRLI
FT                   SPTRTRARIFDADANLLLDSRHLYSRGQVLRYDLPPVDDEKQSWSDWFSGLLNKMLQPG
FT                   NLPVYKEAPGGDGSIYPEVMNALTGVRGAVVRTTEKGELIVSVAVPIQRFRAVLGVLLL
FT                   STQAGDIDKIVHAERLAIMRVFGVATLVNVVLSLLLSSTIANPLRRLSAAAIRVRRGGA
FT                   KEREEIPDFSARQDEIGNLSIALRDMTSALYDRIDAIESFAADVSHELKNPLTSLRSAV
FT                   ETLPLAKSDDSKKRLMDVIQHDVRRLDRLISDISDASRLDAELARSDEKSLDLEVLLRD
FT                   MIDISRQVGHSKKAVEIEYIVDRKPGTKTKFTANGHDLRIGQIITNLVENARSFVAKDT
FT                   GKITVRLTRTRTRCVIYIEDNGPGIQAENIDRIFERFYTDRPEVEDFGQNSGLGLSISR
FT                   QIAEAHGGSLRAENIVDSDGTTLLGARFILSLPAETPA"
FT   gene            complement(40424..41173)
FT                   /gene="chvI"
FT                   /locus_tag="Arad_0046"
FT   CDS_pept        complement(40424..41173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chvI"
FT                   /locus_tag="Arad_0046"
FT                   /product="two-component response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24841"
FT                   /db_xref="GOA:B9JG58"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG58"
FT                   /protein_id="ACM24841.1"
FT                   /translation="MTETNTMLTIALVDDDRNILTSVSIALEAEGYKVETYTDGASALD
FT                   GLLARPPQLAIFDIKMPRMDGMELLRRLRQKSDIPVIFLTSKDEEIDELFGLKMGADDF
FT                   ITKPFSQRLLVERVKAVLRRASAREAANNAGGNAAPKPGVTQQARSLERGQLVMDQERH
FT                   TCTWKGEPVTLTVTEFLILHSLAQRPGVVKSRDALMDAAYDEQVYVDDRTIDSHIKRLR
FT                   KKFKMVDLDFDMIETLYGVGYRFREAA"
FT   gene            41505..43115
FT                   /gene="pckA"
FT                   /locus_tag="Arad_0047"
FT   CDS_pept        41505..43115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pckA"
FT                   /locus_tag="Arad_0047"
FT                   /product="phosphoenolpyruvate carboxykinase (ATP)"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24842"
FT                   /db_xref="GOA:B9JG59"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9JG59"
FT                   /protein_id="ACM24842.1"
FT                   /translation="MEQFGVRNPAIELDSIGLGAAASVRYNLLESHLYEEAIRRREADL
FT                   TAHGALRALTGQHTGRSPKDKFVVRNAVTEDQIWWDNNKPMSPEHFALLHKDMLAHVHG
FT                   KDLFVQDLIGGADHDYALPTRVVTEFAWHSLFIRNLLIRPERSALESFAPKLTIIDLPS
FT                   FRADPERHGCRTETVIACDLVNGIVLIGGTSYAGEMKKSVFTVLNYLLPERGVMPMHCS
FT                   ANVGPEGDAAIFFGLSGTGKTTLSADPTRTLIGDDEHGWGENGIFNFEGGCYAKTIRLS
FT                   AEAEPEIYETTRRFGTVLENVVLDEHGVPDLDDGSLTENTRSAYPLDFIPNASESGMTG
FT                   HPETIIMLTADAFGVMPPIARLTPEQAMYHFLSGYTAKVAGTEKGVVEPEATFSTCFGA
FT                   PFMPRHPTEYGNLLKELIARHGAGCWLVNTGWTGGAYGTGRRMPIKATRALLAAALKGD
FT                   LDKAEFRIDPNFGFAVPVAVEGVDSAILDPRSTWADGQAYDAQAAKLVQMFVSNFAKFE
FT                   DHVDGNVRDAAPGLRAAAE"
FT   gene            43238..43672
FT                   /locus_tag="Arad_0049"
FT   CDS_pept        43238..43672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0049"
FT                   /product="peptide chain release factor protein
FT                   (peptidyl-tRNA hydrolase protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24843"
FT                   /db_xref="GOA:B9JG60"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG60"
FT                   /protein_id="ACM24843.1"
FT                   /translation="MASDALYINDRITIAGWELTEQFVLAGGPGGQNVNKVATAVQLFF
FT                   GIVNSPSLNDRVKANAVRLAGRRVSKDGVLMIEASRFRSQDRNREDARERLKELILEAA
FT                   APPPPPRKKTKPTKGSIERRLKEKSGRSEVKKMRGKPGGD"
FT   gene            44025..44570
FT                   /gene="alkB"
FT                   /locus_tag="Arad_0050"
FT   CDS_pept        44025..44570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alkB"
FT                   /locus_tag="Arad_0050"
FT                   /product="alkylated DNA repair protein AlkB"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24844"
FT                   /db_xref="GOA:B9JG61"
FT                   /db_xref="InterPro:IPR004574"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG61"
FT                   /protein_id="ACM24844.1"
FT                   /translation="MVEAIRNVVAEAPLYTPAMPGTGKEMSVRMTNCGSLGWVTDKQHG
FT                   YRYQPTHPVTGRPWPAIPPQLLELWANIAGYEKPPEACLVNFYNDDARMGLHQDRDEQD
FT                   LAAPVLSISLGNTCLFRVGGLNRNDRTLSFKLSSGDIVVLGGEGRLCFHGVDRIHPATS
FT                   TLLKSGGRINLTLRRVTS"
FT   gene            44843..45823
FT                   /locus_tag="Arad_0051"
FT   CDS_pept        44843..45823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0051"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24845"
FT                   /db_xref="GOA:B9JG62"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG62"
FT                   /protein_id="ACM24845.1"
FT                   /translation="MLLSPLLPNQEWSYPPSMLLIGIPFAGLPIFAAYLFWTLGTLFLL
FT                   FLATKSLDLTWWARMLIIVSPAAVMDAIFGQNGALTTALLLSGLLLAPGRPIIAGILFG
FT                   LLTVKPQLGILVPFCLLASGNYRAILSAGVTTLLLVIATGLLFGFDVWRLFLTETRPLM
FT                   TAILEAPYPQGYQVNAMTFFMLARSLGLGLAASYSFQAVFSVAAIAATLWLWRGRTTVD
FT                   HPTKVCLTVVLTLVAMPYGYSYDTIPISVAIAYFFFNYRSSLVFLGIAWLYPLFNHQVA
FT                   GQLVSLGVLIPAGLAAWMLTHILRDGRSRGMETTFAAEEPRLTAS"
FT   gene            complement(45810..46805)
FT                   /gene="coaA"
FT                   /locus_tag="Arad_0052"
FT   CDS_pept        complement(45810..46805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaA"
FT                   /locus_tag="Arad_0052"
FT                   /product="pantothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24846"
FT                   /db_xref="GOA:B9JG63"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9JG63"
FT                   /protein_id="ACM24846.1"
FT                   /translation="MTIATKTPTTPETLDIFQAKAYSPYYFFSTEEWAKFRADTPLTLT
FT                   ADEVTRLRSMGDPIDLDEVRRIYLSLSRLLSSHVESSQILFEQRNRFLSLNGVAKTPFV
FT                   IGIAGSVAVGKSTTARILKELLRRWPSSPKVDLITTDGFLYPNAELQRRNLMQRKGFPE
FT                   SYDTAALLRFLSAIKAGQPDVKAPCYSHLVYDVLPSEYKTVDRPDILIFEGINVLQSRH
FT                   LPADGKIVPMVSDFFDFSIYIDADEDLIHNWYVTRFMRLRETAFRDPHSFFHRYASITE
FT                   EEALGIAEGLWKNINLKNLRQNILPTRPRADLILRKGKNHLIEQVALRKL"
FT   gene            complement(46812..47126)
FT                   /gene="hisE"
FT                   /locus_tag="Arad_0053"
FT   CDS_pept        complement(46812..47126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisE"
FT                   /locus_tag="Arad_0053"
FT                   /product="phosphoribosyl-ATP pyrophosphohydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24847"
FT                   /db_xref="GOA:B9JG64"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9JG64"
FT                   /protein_id="ACM24847.1"
FT                   /translation="MSGFTLSDLERIVDERSKAPPEESWTAKLCAAGQPKAAKKLGEEA
FT                   IEAVMAAVTGDRDNLTYEAADLLYHLMVVLKIAGIPLQNVMGELERRTAQSGLQEKASR
FT                   "
FT   gene            complement(47142..47930)
FT                   /gene="hisF"
FT                   /locus_tag="Arad_0055"
FT   CDS_pept        complement(47142..47930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="Arad_0055"
FT                   /product="imidazoleglycerol phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24848"
FT                   /db_xref="GOA:B9JG65"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG65"
FT                   /protein_id="ACM24848.1"
FT                   /translation="MTLKARVIPCLDVKDGRVVKGVNFLNLVDAGDPVEAAKAYDAAGA
FT                   DELCFLDITASSDNRETIFDVVARTAEQCFMPVTVGGGVRAIADIRKLLLCGADKVSIN
FT                   SAAVNNPDFVAEAADKFGNQCIVVSIDAKRRRTEALGGDNQSAWEIYTHGGRNATGIDA
FT                   IDFARRMVERGAGELLVTSMDRDGTKVGYDLELTRAIADAVRVPVIASGGVGDLDDLVA
FT                   GIKEGHATAVLAASIFHFGTYSVGEAKRYMSEHGIAMRLD"
FT   gene            complement(47927..48676)
FT                   /gene="hisA"
FT                   /locus_tag="Arad_0056"
FT   CDS_pept        complement(47927..48676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisA"
FT                   /locus_tag="Arad_0056"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24849"
FT                   /db_xref="GOA:B9JG66"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9JG66"
FT                   /protein_id="ACM24849.1"
FT                   /translation="MILFPAIDLKDGQCVRLKLGDMNQATVYNPDPGAQAKAFEDQGFE
FT                   WLHVVDLNGAFAGETVNGAAVDAILKATKNPVQLGGGIRTLDHIENWLARGLTRVILGT
FT                   VAVRDPALVIEACKRFPGHVAVGIDAKGGKVAVEGWAEASELGIIELAKKFEGAGVAAI
FT                   IYTDIDRDGILTGINWASTLELADAVSIPVIASGGLASMDDIRRMVEPDARKLEGAISG
FT                   RALYDGRIDPQEALALIKAAKAKEIAQ"
FT   gene            complement(48761..49411)
FT                   /gene="hisH"
FT                   /locus_tag="Arad_0057"
FT   CDS_pept        complement(48761..49411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /locus_tag="Arad_0057"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24850"
FT                   /db_xref="GOA:B9JG67"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG67"
FT                   /protein_id="ACM24850.1"
FT                   /translation="MRVAIIDYGSGNLRSATKAFERAAREAGIDAEIDLTDDAERVASA
FT                   DRIVLPGVGAYADCRRGLGAVSGMAEAVIDVVEHKARPFLGICVGMQLMSSRGLEKTIT
FT                   QGFGWIKGDVKEMTPSDPSLKIPQIGWNTLDLRHPHALFDGIPTGPDGLHAYFVHSYHL
FT                   AADHADDVIATTGYGGAMTAFVGRDNMAGSQFHPEKSQKLGLALIANFLRWKP"
FT   gene            complement(49414..49899)
FT                   /locus_tag="Arad_0059"
FT   CDS_pept        complement(49414..49899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0059"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24851"
FT                   /db_xref="GOA:B9JG68"
FT                   /db_xref="InterPro:IPR024399"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG68"
FT                   /protein_id="ACM24851.1"
FT                   /translation="MASYLILTPPGGPDGNLDKTRFIRDGFSWWAFLFPTLWMIYHRLW
FT                   LHAAAAFLLQGIALELIRRPGFFAAGIAILIGVRILAALEGPNAVYRRLADGGWRTEGL
FT                   VSAQNLAMAEEIHFSGIEPKAQENIRANNWDIPSYPNNNNSGHGGSTFGLPGYDGGR"
FT   gene            complement(49925..50545)
FT                   /gene="hisB"
FT                   /locus_tag="Arad_0060"
FT   CDS_pept        complement(49925..50545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisB"
FT                   /locus_tag="Arad_0060"
FT                   /product="imidazoleglycerol-phosphate dehydratase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24852"
FT                   /db_xref="GOA:B9JG69"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG69"
FT                   /protein_id="ACM24852.1"
FT                   /translation="MEQPMAETVASRTASVSRKTNETSVSVSVNIDGSGKSTISTGVGF
FT                   FDHMLEQLSRHSLIDMEIDTKGDLHVDDHHAVEDTGIAIGQAIAKALGDRRGITRYASI
FT                   DLAMDETMTKAAVDLSGRPFLVWNVAFSAPKIGTFDTELVREFFQALAQNAGITLHILN
FT                   HYGANNHHIAETCFKAVARVLRTATEIDPRQAGRVPSTKGTLA"
FT   gene            50747..51274
FT                   /gene="hslV"
FT                   /locus_tag="Arad_0061"
FT   CDS_pept        50747..51274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslV"
FT                   /locus_tag="Arad_0061"
FT                   /product="heat shock protease HslVU"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24853"
FT                   /db_xref="GOA:B9JG70"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9JG70"
FT                   /protein_id="ACM24853.1"
FT                   /translation="MTTIVTIRKGGKVVMAGDGQVSLGQTVMKGNARKVRRIGKGDVIA
FT                   GFAGATADAFTLLERLEKKLEQYPGQLMRAAVELAKDWRTDKYLRNLEAMMLVADKSVT
FT                   LAITGNGDVLEPEHGALAIGSGGNYALAAARALMDTDKSAEDVARRALDIAADICVYTN
FT                   HNVVIETLDAEA"
FT   gene            51319..52629
FT                   /gene="hslU"
FT                   /locus_tag="Arad_0063"
FT   CDS_pept        51319..52629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="Arad_0063"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24854"
FT                   /db_xref="GOA:B9JG71"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9JG71"
FT                   /protein_id="ACM24854.1"
FT                   /translation="MTTFSPREIVSELDRYIVGQHEAKRAVAIALRNRWRRQQLEPDLR
FT                   DEVMPKNILMIGPTGVGKTEISRRLAKLAGAPFIKVEATKFTEVGYVGRDVEQIIRDLV
FT                   EVGIGLVREKKRAEVQAKAHMSAEERVLDALVGATASPATRDSFRKKLRDGQLDDKEID
FT                   IEVADTGSGMPGGFEIPGMPGANIGVLNLSEMFGKAMGGRTKKVRTTVKDSYKELVRDE
FT                   SDKLIDNEAIQREAVRSAEDDGIVFLDEIDKIAARDGGMGAGVSREGVQRDLLPLVEGT
FT                   TVSTKYGPVKTDHILFIASGAFHVSKPSDLLPELQGRLPIRVELRPLTKEDFRRILTEP
FT                   EASLIRQYKALMETEDLKLDFTDDAIDALADVAVHLNSTVENIGARRLQTVMERVLDEI
FT                   SYNASDRAGVSVTIDAAYVREHVGDLANNTDLSRFIL"
FT   gene            52799..53752
FT                   /locus_tag="Arad_0065"
FT   CDS_pept        52799..53752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0065"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24855"
FT                   /db_xref="InterPro:IPR009842"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG72"
FT                   /protein_id="ACM24855.1"
FT                   /translation="MRRILIPLLLALVSLSWIPAYADAATMVPPGNRNAEQPAIPGASV
FT                   RRTRGTNSTFDRKYQKVRELLATDSRLMSKIKSTARAYGIDPIHIIGALVGEHTYNVDA
FT                   YDGLQSYYVKAASYAGQSFRFAYSGENIDDFVARPQFDVCKSKRDSYSLWTCREDVWDS
FT                   AFRGKKVDGKSFPDNRFSAVFFQPFYAGQTFGLGQINPLTALELSDLVSSTSGIAKLDE
FT                   KDASGVYKAIMDPDLSLAFVAGSIRKSIDDYRSIAGMDISGNPGLTATLYNVGNSRQRA
FT                   AALAARNRGASQPVWPEENYYGWLINDKLDDLKSLL"
FT   gene            53800..55194
FT                   /locus_tag="Arad_0067"
FT   CDS_pept        53800..55194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0067"
FT                   /product="cytochrome p450 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24856"
FT                   /db_xref="GOA:B9JG73"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG73"
FT                   /protein_id="ACM24856.1"
FT                   /translation="MDMIPEAFSPPAPIPRTVPPSRLTIIRTILRNPLELWGEPSYTLP
FT                   WIMTRFIRERTLIVNDPGLIKHVLVDNAANYRMSDIRQLILRPILRDGLLTAEGPVWKR
FT                   SRKAVAPVFTPRHAQGFAGQMLSQSEDYVRKYEDVGSEGEVFDIAVDMTELTFAILAET
FT                   LFSGEIVTEGASFADDVNQLLHRMGRVDPMDLLRAPSWVPRVTRIGGQKVLDKFRGIVR
FT                   DTMNLRLDKMRKDRASAPDDFLTLLLEKTGPDGLTMEEIEDNILTFIGAGHETTARALA
FT                   WTLYCVANCPHIREAMETEIDRVLATGVEPVAWLDLMPNVRASFEEAMRLYPPAPSINR
FT                   ASIADDEWTSPSGERVEIPAGVTVLIMPWTLHRHALYWDKPRAFMPERFLPENRGKINR
FT                   FQYLPFGAGPRVCIGATFALQEAVIALAVMMHRFRFDLTDETNPWPVQKLTTQPQGGLP
FT                   MRVTRR"
FT   gene            55282..57285
FT                   /locus_tag="Arad_0070"
FT   CDS_pept        55282..57285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0070"
FT                   /product="N-methylhydantoinase
FT                   (ATP-hydrolyzing)/5-oxoprolinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24857"
FT                   /db_xref="GOA:B9JG74"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG74"
FT                   /protein_id="ACM24857.1"
FT                   /translation="MTSHFLLGIDTGGTYTDAVLFHEIDGIVAKAKSLTTRHDLAVGIA
FT                   GAVDTVIAKAGVPVSAIGLVSLSTTLATNALVEGQGGRAGLVMIGFGPDDLKRDGLVDA
FT                   LGSDPVLFLPGGHNVDGNESPLDLTALEEALPELSKNVSSFAIAGYFAVRNPAHEIRVR
FT                   DAIRELSHLPVTCSHELSSKLGGPRRALTTLLNARLVSMIDRLVGACEGFLAARGISAP
FT                   MMVVRGDGALISAAEAKLRPIETILSGPAASLVGARYLTGLDNAVVSDIGGTTTDVAVM
FT                   EAGRPRLDADGAVVGGYRTMVEAVAMRTYGLGGDSEVKINDRGLVAGFELGPRRLLPLS
FT                   LVAHTHSESIIAVLEQQLRAPHLGRNAGRFAVRTGVPDHLASGLTPLEQALFDKIGAAP
FT                   LALDQLLTSTSQKATLDRLVARGLVHLSGLTPSDAMHVLGRQSQWNGEAARLGLALAMR
FT                   MKDGSGRPIAASVEELAQKIVDRLTRQSADVILAACLAEDGVADLDPAKSISIDRALRR
FT                   APGIARFAVSLDRPLVGLGASAPVYYPAIAAMLASESAIPADSDVANAIGAVVGQVRTS
FT                   ATVFVTMPEDGIYVLNGAGETLRFTDEKKSFSMARARAIAVAMAQARLNGAVDPVIAVD
FT                   EQVDAPEVEGNRKLIEARFIATASGRPRIAVD"
FT   gene            57405..59573
FT                   /gene="glcB"
FT                   /locus_tag="Arad_0071"
FT   CDS_pept        57405..59573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcB"
FT                   /locus_tag="Arad_0071"
FT                   /product="malate synthase G"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24858"
FT                   /db_xref="GOA:B9JG75"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006253"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR023310"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9JG75"
FT                   /protein_id="ACM24858.1"
FT                   /translation="MSRIEKNGLQIEPVLYDFLVKEALPGSGVDADTFFAGFSAIVHDL
FT                   APKNRELLAKRDRMQAAIDDWYRKNGAPVDLAAYEAFLREIGYIIPEGPAFTVSTANVD
FT                   TEIASIAGPQLVVPVMNARYALNAANARWGSLYDALYGTDAIPETDGAEKGKGYNPKRG
FT                   EKVIAWVRDFLDAAVPLSDASWKDVAGFAVKGGVLAIATKSGTVALTDERHFAGYLGDV
FT                   AAPSHILLKNNGIHIEIVLDPSTDIGKVDPAHISDVRLESAITTIMDCEDSIAAVDAED
FT                   KAEVYRNWLGLMKGDLTEEVAKGGKTFTRRLNPDVTYTAPDGASFELHCRSLMLIRNVG
FT                   HLMTNPAILDRDGNEVPEGIMDAMITGLIALYDVGPKGRRKNSRAGSMYVVKPKMHGPE
FT                   EVAFAVEIFSRVEDVLGMPRNTIKMGIMDEERRTTVNLKEAIRAASERVVFINTGFLDR
FT                   TGDEIHTSMEAGPMIRKGDMKQAAWIAAYENWNVDIGLECGLSGHAQIGKGMWAMPDLM
FT                   AAMLEQKIAHPKAGANTAWVPSPTAATLHATHYHKVNVANVQQTLKSRVRAKLSDILSV
FT                   PVASRPNWTPEEIQHEIDNNCQGILGYVVRWVDQGVGCSKVPDINNIGLMEDRATLRIS
FT                   AQHMANWLHHKVITEAQIVETMKRMATVVDQQNAGDPLYIAMAGNFDGSVAFQAALELV
FT                   LKGREQPNGYTEPVLHRRRIELKAKQAV"
FT   gene            complement(59656..60330)
FT                   /locus_tag="Arad_0072"
FT   CDS_pept        complement(59656..60330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0072"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24859"
FT                   /db_xref="GOA:B9JG76"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG76"
FT                   /protein_id="ACM24859.1"
FT                   /translation="MLTRNAITALGLVATLAMAGYATTAAATPTATANSATETVKSFDG
FT                   DYGVISDNGYQLPAIPIQKVKPQFRRQIVAYQSNEAEGTIIVNTRERHLYYILGNGEAM
FT                   RYGIGVGKQGFSWSGTAYVAWKQEWPTWHPPKEMAVRRPEIAKYVDGGMNPGLSNPLGA
FT                   RAMYLYNEKGQDTLFRLHGTPEWASIGTAASSGCIRLINQDVIDLYSRVLPGHSTKVVV
FT                   IQ"
FT   gene            60511..60999
FT                   /locus_tag="Arad_0073"
FT   CDS_pept        60511..60999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0073"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24860"
FT                   /db_xref="GOA:B9JG77"
FT                   /db_xref="InterPro:IPR009394"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG77"
FT                   /protein_id="ACM24860.1"
FT                   /translation="MTILNVYNNNPLIDGRQSERAMLVRRGVQLLLHEMRHAILPELPL
FT                   ASGRRADLITLSEKGEIWIIEIKTSIEDFRVDRKWPDYRQHCDRLFFATHKDVPLDIFP
FT                   EDCGLFLSDGYGAHMIREAPEHRLAPATRKSVTLNFSRAAAQRLLLAEWATGKDFSPE"
FT   gene            complement(61003..61590)
FT                   /gene="actR"
FT                   /locus_tag="Arad_0074"
FT   CDS_pept        complement(61003..61590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="actR"
FT                   /locus_tag="Arad_0074"
FT                   /product="two-component response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24861"
FT                   /db_xref="GOA:B9JG78"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG78"
FT                   /protein_id="ACM24861.1"
FT                   /translation="MTDKELADPHAGAKDIADHIGPDATLLIVDDDGPFLRRLARAMET
FT                   RGFTVETAESVAEGVAKSKVTPPKYAVVDLRLGDGTGLEVIEAIRQRRDDTHIVVLTGY
FT                   GNIATAVTAVKLGALDYLAKPADADDVYAALTQRPGEKAEVPENPMSADRVRWEHIQRV
FT                   YEMCERNVSETARRLNMHRRTLQRILAKRAPK"
FT   gene            complement(61666..63003)
FT                   /gene="actS"
FT                   /locus_tag="Arad_0075"
FT   CDS_pept        complement(61666..63003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="actS"
FT                   /locus_tag="Arad_0075"
FT                   /product="two-component sensor histidine kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24862"
FT                   /db_xref="GOA:B9JG79"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG79"
FT                   /protein_id="ACM24862.1"
FT                   /translation="MASFFRGLDKIAIADAKLQDDYHTSRRLRLQTLVRLRWLAVGGQT
FT                   ATVMIVAFWLKFPMPLLACCVLIACLAWINFFLTLRYPPTHRLEPPAAFALLGLDLLQL
FT                   CGLLVITGGLANPFSALVCVPVIISFASQPIRYSMVLIVLAMICITGLAFSPFPLPWYG
FT                   GVEVNVHSVMQLGVWCSIASTMAFAAFYAYRVSMEASQLADALAATELVLQREKHLSQL
FT                   DGLAAAAAHELGTPLATISVVAKEMERELKEDDRFREDVALLRSQSERCRDILRRLTTL
FT                   SAEDEAHMRRLTLSSMMEEVIAPHREFGIKLELIEKSPRAGEPVLNRNAGIMYGLGNLI
FT                   ENAVDYARKTVTVTVEYDPALLIIIIEDDGNGYAPDILTRIGEPYVTTRQRDDTAGGLG
FT                   LGLFIAKTLLERSGAAISFGNRDPETPGARIRVEWPRVLIDSNSTK"
FT   gene            complement(63006..65474)
FT                   /gene="hrpB"
FT                   /locus_tag="Arad_0076"
FT   CDS_pept        complement(63006..65474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrpB"
FT                   /locus_tag="Arad_0076"
FT                   /product="ATP-dependent helicase HrpB"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24863"
FT                   /db_xref="GOA:B9JG80"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG80"
FT                   /protein_id="ACM24863.1"
FT                   /translation="MTPPLPELPVSHVLADIGTALGRERRAVLSAPPGAGKTTLVPLYL
FT                   LGQSWRGDGKIILLEPRRLAARAAAARMASLLGEEVGGTVGYRMRLDNRISAKTRIEVV
FT                   TEGVFARMILDDPELAGVSTVIFDEFHERSLDADFGLALALDVQSALREDLRILVMSAT
FT                   LDVERVAVLLNHPPVIESMGRGFPIDIRHQDRPAGERIEDTVTRAILDAHATEQGSILA
FT                   FLPGQAEITRTVERLENRLPSETVIAPLYGNLGQKEQDAAIRPAPKGTRKVVLATSIAE
FT                   TSITIDGVRIIIDSGLQRLPVFEASTGITRLETVRVSRASADQRAGRAGRTEPGTAIRL
FT                   WHPGQTAALPAFTPPQILSSDLSGLALDLAHWGVQDPATLAFVDQPPATTLSEARVLLR
FT                   QLGALDAENGLTTRGKLMRDLALPPRLSAMVISAAEFGQAREAAMLAVLLTEQGLGGAS
FT                   VDLEERLRRFKTEKGERAEAARRLAGRLAMAAGGGKTTTAGAPILAGSLLLHAFPDRIA
FT                   LQRGGRGRFVMANGRGAELPETERLAGSQMLVIADLTGRAAQARILAASEISRGDVEEH
FT                   LPGEIRTEDQSVFDKASRQVRARRVTRLGAIIFEETPLPRPSGEKAARALAEGIRELGI
FT                   GVLPFSKDANQLRDRIDFLHRTIGEPWPDVSDDALLLRLEDWFTPFQTDARGLSDISLG
FT                   GLSNGLMSLVPHELQRDLGRMAPTHFEAPTGQRHPIQYEGEEPLLTIRVQELFGLKQHP
FT                   TIGGGRLPLVLELTSPAHRPIQTTRDLPGFWAGSWKDVRADMRGRYPRHPWPEDPAEAS
FT                   PTTRTKPRGT"
FT   gene            complement(65480..66430)
FT                   /gene="ocdch1"
FT                   /locus_tag="Arad_0078"
FT   CDS_pept        complement(65480..66430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ocdch1"
FT                   /locus_tag="Arad_0078"
FT                   /product="ornithine cyclodeaminase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24864"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG81"
FT                   /protein_id="ACM24864.1"
FT                   /translation="MLVLNEEQTRTALAWPALIEAIASMFTGDCVMPVRHHHDMEVPGE
FT                   SEATLLLMPAWLPGQYMGVKMVSVFPDNATRALPAIFGTYLLSSGKTGEMLAVIDGGEL
FT                   TARRTAATSALAARYLARTDAEKLLVCGSGRLSLNLIQAHAEGRSLKRIGIWGRDHDKA
FT                   ADIAGQARALGLDVIAVTDLESAARSADIISCGTLSSTPLIKGEWLKPGAHLDLVGGFK
FT                   PDMRETDDAAIRRAEVFVDTRAGAMKEAGDIVQPLKSGVLTEDAIRAELSELVRETKSG
FT                   RANDADITLFKSVGAALEDLAGAILAYEYARGRQA"
FT   gene            67149..68657
FT                   /locus_tag="Arad_5100"
FT   rRNA            67149..68657
FT                   /locus_tag="Arad_5100"
FT                   /product="16S ribosomal RNA (operon 1)"
FT   gene            68938..69011
FT                   /locus_tag="Arad_5000"
FT   tRNA            68938..69011
FT                   /locus_tag="Arad_5000"
FT                   /product="tRNA-Ile"
FT   gene            69141..69213
FT                   /locus_tag="Arad_5001"
FT   tRNA            69141..69213
FT                   /locus_tag="Arad_5001"
FT                   /product="tRNA-Ala"
FT   gene            69939..72560
FT                   /locus_tag="Arad_5101"
FT   rRNA            69939..72560
FT                   /locus_tag="Arad_5101"
FT                   /product="23S ribosomal RNA (operon 1)"
FT   gene            72693..72811
FT                   /locus_tag="Arad_5102"
FT   rRNA            72693..72811
FT                   /locus_tag="Arad_5102"
FT                   /product="5S ribosomal RNA (operon 1)"
FT   gene            72955..73028
FT                   /locus_tag="Arad_5002"
FT   tRNA            72955..73028
FT                   /locus_tag="Arad_5002"
FT                   /product="tRNA-Met"
FT   gene            complement(73222..73560)
FT                   /pseudo
FT                   /locus_tag="Arad_0080"
FT                   /note="recombinase fragment; Incomplete gene (pseudogene)"
FT   gene            74072..74647
FT                   /locus_tag="Arad_0081"
FT   CDS_pept        74072..74647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0081"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24865"
FT                   /db_xref="InterPro:IPR025159"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG82"
FT                   /protein_id="ACM24865.1"
FT                   /translation="MTARGIARLVELRDAGVTAATMSRMERDGEVLRLARGLYQLSDAP
FT                   LDANHSLAEAAKRLPKGVVCLVSALAFHGLTDQLPKQVWLAIGRKDWAPKPDSTPIRIV
FT                   RFTDRLLNESVETHVVEGVPVKVFGIVKTIADCFRYRNKIGLSVAIEGLQEVLRQRKAT
FT                   PGEIARQAERGGVATVIRPYIEALTANG"
FT   gene            74640..75245
FT                   /locus_tag="Arad_0082"
FT   CDS_pept        74640..75245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0082"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24866"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG83"
FT                   /protein_id="ACM24866.1"
FT                   /translation="MAKEIKNIGASVRARLLQLAKASGQSFDLVLTRFALERLLFRLSR
FT                   SSHADRFVLKGAMLMMSWFDDPHRGTRDLDLLGFGDPSAELMLATFREILAQDASDGVE
FT                   FDADALRVDRIREELEYGGLRLRTTASISGARISLTIDIGFGDALEPGTEELDYPSMLD
FT                   FPMPRLRGYARETVIAEKFQAMVALGRANTRMKDFYDI"
FT   gene            complement(75885..77279)
FT                   /locus_tag="Arad_0084"
FT   CDS_pept        complement(75885..77279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24867"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG84"
FT                   /protein_id="ACM24867.1"
FT                   /translation="MSSEAHVVGKIALVCFLLFGPSAIAGQWETIATMPGLEYLPESAH
FT                   RIGDRVYLIHRNTPREGAANFVIADDLDCQNQALRISWANGSLGKVTGRYYNNGKSQDR
FT                   YASVDFKAADTDQVFYDWACKLPLQPERLVNVRTEQEGALTQVDISSVKRIGAVATLWM
FT                   RHDYPTINFDPPYNAPFDSKREFVRLNCDTSRYSTLVGYDFMPDGTVTDGMIAPEEDTA
FT                   LTPSDSYAAAKEIACNTSMDLKSFAGIGGITSRPKPPLPPKRGIEDVAIPTEIAKTVAR
FT                   LLSILPDEPVVSEAKITQTSKSSLVQTSKQVIVVIKPKKDGTTRVQEIYDRGVSVDREV
FT                   LGPVQLKSKMNSNMAEPSDVTLTTSLTVNSGTWAAGQELSFEIEMPATAGPKKFEMSCK
FT                   IGEPIEANTIHRSLAGHAWPLECDRKGDSKMRGYYVGQLRYFFVAHSESSLGRSDSTID
FT                   GIEIGR"
FT   gene            77740..78315
FT                   /locus_tag="Arad_0087"
FT   CDS_pept        77740..78315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24868"
FT                   /db_xref="InterPro:IPR008008"
FT                   /db_xref="UniProtKB/TrEMBL:B9JG85"
FT                   /protein_id="ACM24868.1"
FT                   /translation="MSLLQRRRDGVVRARGPSEAGLPVFRCLACDVHFRRTTGTPPSGL
FT                   KFRKLELFVRLLSQQRPITDAAEMIDVKVVTVIRWVKRMRQWIPELDPSGYWEARVRLG
FT                   RHDALSRLCFGHRRAEMPLRQLRPILSPIGGPARGRGDLRRRAPRGEAPAVVTTETAGS
FT                   IAIANRRRRLRLIMSISEGECCRINTPP"
FT   gene            78501..79181
FT                   /locus_tag="Arad_0088"
FT   CDS_pept        78501..79181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0088"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24869"
FT                   /db_xref="InterPro:IPR010642"
FT                   /db_xref="InterPro:IPR038696"
FT                   /db_xref="UniProtKB/TrEMBL:B9JE39"
FT                   /protein_id="ACM24869.1"
FT                   /translation="MTFATLANAFSVKTLASAVFISSTLYASFGLAQEQPAAPANAGTQ
FT                   QSQQSPAATAAGQTQPAPQARVQKFDDWYYRCIDGKAADGSAATHCEVAQIATVKQGDQ
FT                   DVNVLTLAIAKADAPAAPDKKTAKQPASDLVLTALVPLNMYLPAGLSIDAADKPVVQLA
FT                   YRNCNQAGCWSQQKLDTKTISALAKAADGVGHVQMMNGQKVNIKFSLKGLSAALDALQK
FT                   SASN"
FT   gene            79201..80952
FT                   /locus_tag="Arad_0089"
FT   CDS_pept        79201..80952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0089"
FT                   /product="Hemolysin activation/secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24870"
FT                   /db_xref="GOA:B9JGM1"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR027282"
FT                   /db_xref="InterPro:IPR035251"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGM1"
FT                   /protein_id="ACM24870.1"
FT                   /translation="MTSARRPAAPRHNLGLTASALLAVIFAISPAAAQTPNDDFARRQA
FT                   QEAEQQRLETLGRMTPKPAQTEAQQPAASGGQKAGPCFAITHVEVEGVKQFSATAIDTV
FT                   TAPYANRCVGVGEINSLLRDLTHLYLNKGFVTSRVYVPAQDIAGTKVLRLVAVEGTLSD
FT                   IYINGKPAPGSGMLATAFPGMKGHITNLRDIEQGLDQINRLSSNNAKTAMLPGKTDGTS
FT                   ILNIENKPDHPWHLSFGNSNLGQEQTGYSKSSASVGYDNLFGINDQWNFSYEHSGPDYP
FT                   WRNDGVGKSNSYSGNVSVPYGYWTLSLNGSWYGYDSSVPGNFGTLQTSGDSKQVGIGAD
FT                   RVIFRDKDSITTLNTGLTYKETNNFLLGSKIEVGSRKYTAGDLGISHSRRMLGGLWVFD
FT                   LSYSQGLNLFDAVAPGDAGAGDADPRFSKFSGTITVTRPFEVSEQRFEINSIVTGQYSP
FT                   DNLFGAEQISLGGYSSVRGTRETMLYGNNGFFVRNDLVWRTQPFADNAELAKIFGEFRP
FT                   YVGLDYGRIARQARYRIDGGDMLGWTAGAKLAGGHVNFDIGYSDIFGGTTDRRDAGLLF
FT                   VSTSVRW"
FT   gene            81107..91060
FT                   /locus_tag="Arad_0092"
FT   CDS_pept        81107..91060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0092"
FT                   /product="Filamentous hemagglutinin"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24871"
FT                   /db_xref="GOA:B9JGM2"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR025157"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGM2"
FT                   /protein_id="ACM24871.1"
FT                   /translation="MADIKRYNSKVPTSSRPVLALAREFTAILLSGLLVFQPMLANAQA
FT                   VSASTAAPTANQPGVGTAPNGVPLIDIVTPNGAGLSHNKFSDFNVGTPGLILNNFKGEV
FT                   GTSNLGGATPGNPNLNSSSPASVILNEVTGGNRSALNGPTEVFGSRADVIIANPNGLTC
FT                   SGCGFINTPHATLTTGVPNIGADGSLTGFTVNGGDVTFEGAGANLAAAPGAVDLFDVVA
FT                   RNIHVNAPIYGKTLRLTGGASQYNYATGEATALTATSGTPEYAIDGSALGAMQADRIKV
FT                   VVTEKGAGVKMSGDMAANAGELSLSADGKISIGNASGSQGVTITSKRQVTAAKVTSKQK
FT                   VVVQADQGITLQSVAADSDIVLASGTGLLSVSGDVNSGTTVQMSSGGGIAAGSVTAGNG
FT                   AATLSATSGNIAIAGAANSTGDLNLTATAGSISAGSLLSNQNIALSAGLDIAVAGNVLA
FT                   QGNVSATGRSIATGMAVSGINVAATSADPNGNVVLGSAGNLSLTATGGNVTTGNLLSAG
FT                   SLSTSATGNMTAGNIQTTGNFTATAASLTSSNITSHGLLTVNAATNVSGQILGSSNVLI
FT                   SGAAIQAGAIVSGVDFAATQAASGSLVLGSAGDMTLAASGGLSANTLLAAGTISASAAD
FT                   LSVGNVTGHQAIILSGSSSLTATGQVLGAGDVSLSGGSISLNQVISGLDFAATEANGGN
FT                   ITLGTAGDLTLQASGNLSATALLAAGTIMATAADLSLGSVTGHSDIALSGSNSLTVTNQ
FT                   ILGANDISLSGGAVSTSQVVTGVDFAAMAQSSTGAIIIGSTGDLTVNATSATAGPLLVA
FT                   RDLNVTAGSFTASNVTGHGDVTVNAASDISGTLLAAGNVAITGSSITARGLVSGVDFTA
FT                   TNQSADGSVVLGSSGALTLKATAGNLNAANLLAAGNIVAIASGSIGNSVASNAVAHQNL
FT                   TMTAGGSIALAGQSMAAGNINLQGQLITAASLVSGVDFAATRASTNGALMLAQGNAQSG
FT                   TMTLTASNGDITASNALLSGGNFSATTSGDISYALLQSLANASLTAPGTISYTNNSNVT
FT                   GNLTIDTGTIDLSGTRGAKLAVGGTLAVTATSANLTGSSLILGGLALNLSGQADLTGAQ
FT                   VNTVTNAGGSGDIAITAAGLTASDTTTLLAAHDLTLTLPTLTNSGQLAAGNNLTINTSG
FT                   DLINTSTGLLYAGNDASLLVAGTLTNDQGAILAGDDLTIAGSTLTQRNQATTNISGLIQ
FT                   AGGDMSILTSNLTNKRSTTPTWTTGVLVSSGGVVGTFVLNPDVAGKPFAYLETSDQNMF
FT                   QLYPGIDPPAWQDYQPLLWSEATLADGTSYHAWTWTSANGPTEVRPIYDWILARVPKDG
FT                   NGTPVLDANNPSRYFIVDQVIRGGSDASTTYTWDPTSNLSQSVYEDQFTTALTPEAVIR
FT                   AGGNLTVDATNLTNSYSRIEAGGDATLKGSTFTNEGVVLNRTTTLTCNAQSACTAYNAD
FT                   GTADPSRDIANGTSIVSGTTVIGGAAGIVKAAGSLNLNYAMVNNTSAAGSVAGQATVTS
FT                   PATSSDPLSALNGMTAGGALFTVNSALSNVAGNGALAAGGGLTAALGNLTQISAANVAQ
FT                   LAALAKPQSGGVGGTVPGQAFIFETRAAFLDVSKFYGSSYFINRAGYNPETGIPFLGDA
FT                   YFDNQLVDTQLRQLVGDGLGNGSFIPGNSAIEQMKTLLDNGAAYAEANGLAFGQAPTPE
FT                   QVANLKQSMVIYQAQTVNGVQVLAPVVYLSAADRAKAGSGAGAMIAGNTVDLNVGDLNN
FT                   SGAVAAAGGLNIAASSIKSTGSFYAGGNANLTASNGITLAAQTMTIGGQNLVNPNAGVS
FT                   AGGNIQLAANNSDLNLQGASVKAGGSAQLSGNNVNLAAVKVDNGGQQNATGARVNAGGN
FT                   LAIAGNNDANIIGSSAKAGGDLSVKATNGAVNIVSTDVARKTNDGYTKTTGTDQQASQL
FT                   SAGGNLEVNGNTGVLISGSDLSAKGDVGLTSNGDINVTTSQNQSNSTFGKGSSSSLTHN
FT                   GSTITAGGDLVAKSNNDINIIGSTITADGTLGLQAKNNVTIAEATDSATLDVKSSSKKS
FT                   GFFGSTKENASGHLENTTAEGSTISGKDGITIISGGDTTVSASKVTAGDATHTSDLNIQ
FT                   TGGNLIVTAGKDTETEHDSAKRKGFLRSGSSSYDGYKETTVGSELSASGDVNLDAGKAA
FT                   AIVGSKVNADGSLNISGESVSIIGAQENHQSDSQRKDSGLFVGSGGGFISLVGKNEKQG
FT                   AQSSTDNIGSTLSAGQDVNLTARATDLNIMGSSVTADRDINLSAARDVNVTPGAESASQ
FT                   SEQQKKSGFGIAFSAGGGGFSLGIGAQSTKDSTAQQSDTNAMSALTAGRDLNISAGHDV
FT                   NLQATSASAERDVNLFAGNDINLLSANDVTNYQEAHEKSFAGVTLTVSSQVGKAAQSIM
FT                   NSAERLSDSGGVNAVTNTAIAGLGFYQAYKDLQGVYDQYQKSGDIGVNVSLTVGANHQE
FT                   NSWSSSSSTPVVTDIRAGRSISMEAENGSITSDGAQILAGYDKNGIPTISGDPLTGDIF
FT                   LSAKNGDINLNAATGTSDSASANKSWSAGIGVGATFGGGGKGMADLGLVANAGYGKGSA
FT                   DTSGVSHTNTHVNGTGDITIITNDLALRGATITGNSVTADVKNLTIESQVDTAKAKADQ
FT                   LSLSASTGFGSTSVSGVTQKAKGDAALVVEQSGIHAGAGGLDINVSGHTSLVGGLITSE
FT                   ASTERNNFSTGTLTVADIDTHSTWKADTYGVSIGTSGIMPTPPVKASENKTGQALSAIG
FT                   SNIGITITDPAHQTRDISAIRRDTDNTNTSLPGLPDLQNILREQYKTQADLQAAQATMA
FT                   GLVGDIATELYKQARDHDDQAGMDYWKEGGVGRATLHAIGAGVLGGVNGWEGALKGALG
FT                   GASSSLLSPAIADLVNGMLKGTEYEGTQAGQQLAASIGQSLAAGLGGIVGGGEGASYSA
FT                   AQYQYNYLKHAEIELGDQLRAQCKTDQKACDRLDQLQQIDQARDDQLETCKGSETAACI
FT                   NARLEVRQAAAEMFDAIANGTGPVSLLDQFMMMRTLSQATAYFDATDPNQSSLTAAQWQ
FT                   TLRSKDISAAVGVLADAFRTGDFEGMSFAYRALAANKTLPALLIALDITGGLGSGSSGT
FT                   TSGNLTTAYRTLTASDGTTVLVPEGYRPLLSTMGATASDVGGLPAGFARVVDDQGNIVI
FT                   AGSNGAIYSDVAAAQKAATTASRIGFNDLATFRVQLGLPPAGTAADKSTLAVIEINGQK
FT                   IYGVNAHGQPVSGVNAISSTHAEIDALNQIKQQGIDVSGQNLTLYVDRTPCAACGTNGG
FT                   IRSMVEQLGLKQLTVVGPDGPMIVTPR"
FT   gene            91918..92610
FT                   /locus_tag="Arad_0094"
FT   CDS_pept        91918..92610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24872"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGM3"
FT                   /protein_id="ACM24872.1"
FT                   /translation="MRAKLFAAVALGLITTLLAGCAGGGAPGKVAAEHSAAISQIASKK
FT                   SQKGALLLIRIVDANLMGDQYCSGHIRLRRIDNGKPDKNSAFEDIYSADRWLLPDEKKP
FT                   KDMQATFLYRVANAASYARSFRPIAPGRYAITYADCQYGISQFSNGVKIEAGGDHDFLF
FT                   NYVSPLGGASTITVGAGQIIDAGYIRLTGRRSDPTVVSSEASAAEREVMQEVLPEIYTS
FT                   IRFTKFGS"
FT   gene            92600..93358
FT                   /pseudo
FT                   /locus_tag="Arad_0095"
FT                   /note="filamentous haemagglutinin protein fragment;
FT                   Incomplete gene (pseudogene)"
FT   gene            93510..94304
FT                   /locus_tag="Arad_0096"
FT   CDS_pept        93510..94304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0096"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24873"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGM4"
FT                   /protein_id="ACM24873.1"
FT                   /translation="MSLLQACLDQGAYTCTTEQNKWLAAYKTWRDADSAADRNDPNYEQ
FT                   MLENYRNLAAAGLVAKELGKTQEYGEVYQMTKGFELGAVSGAVAALGTISLIAGQEAVS
FT                   TVVAVCGRSSAYYATYLNMALHDVVATTAEFGGSPTAATLLGTALAEARVAVTNGTVTN
FT                   TGLVLFNKSTAGDALNDPALLKRIADAVSRQGKTLEIGETGSDLYNYYKALGAQGSTMM
FT                   LEDGKISIGISADAGPSALFEELVHYGQYRSGQVDLWTAQYG"
FT   gene            94792..94992
FT                   /locus_tag="Arad_4981"
FT   CDS_pept        94792..94992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_4981"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_4981"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28538"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGM5"
FT                   /protein_id="ACM28538.1"
FT                   /translation="MTINANTASVARCRFIGHEVIRYAREVTFRSPIVTDKYNGFQSTS
FT                   TMTILIDRFGNLVTAIPGRVQ"
FT   gene            94989..95366
FT                   /locus_tag="Arad_4982"
FT   CDS_pept        94989..95366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_4982"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_4982"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28539"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGM6"
FT                   /protein_id="ACM28539.1"
FT                   /translation="MRLIGSDIEAKYRSELIHSSHLLFSGRGNRRLLASINRAFSDMES
FT                   AFVLDWVPEQGEDIFTVLVNDNKVAVFELARSSNELADACDVRTVEAYRRGLRKHRAIK
FT                   LAVALDLLSNCYSRRRDLSSS"
FT   gene            96023..96688
FT                   /locus_tag="Arad_4986"
FT   CDS_pept        96023..96688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_4986"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_4986"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28543"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGM7"
FT                   /protein_id="ACM28543.1"
FT                   /translation="MRLKTVGVWFVVGLLAGCAGTPDPVKVAAQQHEGSAQIFANQKKK
FT                   GSLLLVRMVDSPFLGDVDCDGYITLRRINAGKPDETEPPLSVGSAPSYRLQNPNKLSLG
FT                   QLFSATVQKYERWFVPVAPGRYAITYASCHYGNTTIEAGGDNDGLFGRTFSYVRPFGGE
FT                   STITIGQGQIVDAGYIRLAGTRSDPRVVGSEATPAERDLMKSVMPDVYPSITFTKFGL"
FT   gene            96853..97116
FT                   /locus_tag="Arad_0097"
FT   CDS_pept        96853..97116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0097"
FT                   /product="transposase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24874"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGM8"
FT                   /protein_id="ACM24874.1"
FT                   /translation="MPVTGHDDELRSSDSKTEATCSDLRKFDSAGNALRRQADVLPGGY
FT                   FHVVFTLPQQIAAITFQNKSTVLHHPVTRRRRDIGQDCRRSQ"
FT   gene            complement(97269..98153)
FT                   /locus_tag="Arad_0098"
FT   CDS_pept        complement(97269..98153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0098"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24875"
FT                   /db_xref="GOA:B9JGM9"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGM9"
FT                   /protein_id="ACM24875.1"
FT                   /translation="MKHQTQSDDAPKDYEELIRLIHERHAQMSKTYQRISVYLTQNPNE
FT                   VAVQSVNTIAERCGMHASSFVRFAQALGYKGFKELQLLFQRRLTTAAPGFEARVRALGD
FT                   ELQNREDRSEYGFLHDLVVRDIASLQELLERISAEDLAIAADAIEGAETVYLIGQLRSS
FT                   PVVDLLRYILTMLGKRCILLDPGGGLATHMARTMRMEDVLIAVSFRFYATEVVNIVEEA
FT                   AKSGVPIVAISDSTLSPLAKSAKVLFAVPEHDYTFSRSLAAPMCLAQALTVAVAARVQQ
FT                   NETAPRIPTVTGT"
FT   gene            complement(98316..99440)
FT                   /locus_tag="Arad_0099"
FT   CDS_pept        complement(98316..99440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0099"
FT                   /product="oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24876"
FT                   /db_xref="GOA:B9JGN0"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGN0"
FT                   /protein_id="ACM24876.1"
FT                   /translation="MYEKPLLRIGLIGTGFMGKAHVFGFASAQKVFDLPYRLEMHTVAD
FT                   ITKEAAARAAADFGFVHASADWRTLVSNPEIDLIDITAPNALHKEMALAAIAAGKHVYC
FT                   EKPLAPLSADAREMAAAAKAKGVKTQVGFNYLCNPMLRLAREMIAAGELGEIHGYRGLH
FT                   AEDYMADVSSPFTFRHDPEGGGALADIGSHALATAEFLLGPISEVMGDCITMIGERPDG
FT                   RGGTRKVEVDDVARAFVRFANGAQGSIEGNWIATGRKMQHDFEVYGTKGALAFTQERFN
FT                   ELHFYSNADPAGRRGFRRIEAAPDHPPYGHFCVAPGHQLGFNDLKAIEIEGYMRAIAGE
FT                   IPEPFGFAAGSRVQQLVETIQRSSSTRQWMSVLA"
FT   gene            complement(99433..100401)
FT                   /gene="serA"
FT                   /locus_tag="Arad_0100"
FT   CDS_pept        complement(99433..100401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serA"
FT                   /locus_tag="Arad_0100"
FT                   /product="D-3-phosphoglycerate dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24877"
FT                   /db_xref="GOA:B9JGN1"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGN1"
FT                   /protein_id="ACM24877.1"
FT                   /translation="MPHLLAAGKLHPSGEALLRDLKTRGFTVDYVEEVSEPSYAPLIAK
FT                   ADALVIRTQPLSAATIAQAERLKVVSRHGVGYDSVDLPALNRRGIALTIVGDVNSVSVA
FT                   EHAMMQLLAGAKRVLLADRAVREPGQWGWRNRLEQQEISGKNLLIIGYGRIGRHLARMA
FT                   SGFGMQIRAYDPFLEKVGWPEGPVRPVPLDEGLAWADCISVHIPKADSPAIGAVEIARM
FT                   KRGVILVNTARGGVVCEQALADALASGQVGAAGVDVFDDEPPSTDSPLFSHPNAILSPH
FT                   IAGLTAECGERMAIAAIENAVNFLVGTIDPQLVVNPDFAHV"
FT   gene            complement(100401..101207)
FT                   /locus_tag="Arad_0101"
FT   CDS_pept        complement(100401..101207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0101"
FT                   /product="hydroxyacid aldolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24878"
FT                   /db_xref="GOA:B9JGN2"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGN2"
FT                   /protein_id="ACM24878.1"
FT                   /translation="MFINRLKQQWSEGRPAINGWLSIGNAFTAEIMAAQGYDSVTIDIQ
FT                   HGALDYSSVLPMFQAMRASGVTPMARVPWREPGIIMKALDAGAQGIICPMVNSAEEAAE
FT                   FVSYLRYPPHGQRSFGPTRAAFAYGSYGLAANGEVLALAMIETQQGVDNLDAIAATPGL
FT                   DGIYVGPADLTLGTQEGRLPPGFDREEPEMIDLIKRILAACKANGIRACLHCGTPDYAA
FT                   RAIGWGFDLTTVSGDSRLLAAAAAASVKTWRDLTDSAPAEATKGAY"
FT   gene            complement(101217..102647)
FT                   /gene="gabDch"
FT                   /locus_tag="Arad_0102"
FT   CDS_pept        complement(101217..102647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabDch"
FT                   /locus_tag="Arad_0102"
FT                   /product="succinate-semialdehyde dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24879"
FT                   /db_xref="GOA:B9JGN3"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGN3"
FT                   /protein_id="ACM24879.1"
FT                   /translation="MYAQFGLFINGRWAAGTVTGEVVSPVTEKALGAVPLATVEDTRSA
FT                   LDAAAAALSKLRAMGGFARADALHKAADEMVRRADEAARMISAETGKPLAQAGREWGLA
FT                   CDQFRWFAEEARRIYGRIIDSRVPGGRFEVSREPVGIVGAFTAWNFPAALPARKLAPAL
FT                   AAGCPVVLRPSSQTPGVAMVMVDCLRAANLPDGAVNLVVGSTGNTYGPIMADSRVRKVS
FT                   LTGSTRVGQQMIRDAADTVKKVSMELGGNAPLIVYDDADLQTALDLTVPTKFANCGQVC
FT                   VTPDRIFVHDSLHDAFVDGFVTRTAKIKLGDGLDPETGMGPLINAGRLQEIDAIVQDAV
FT                   RAGATIAHGGKRPAHLNSGFFFEPTILVGVTDDMKVFSEENFGPIAAITRFSTEDEALT
FT                   RANASEMGLSAYAFTRSPDRARRTVAALKSGMVGINSFALAASEAPFGGTNHSGMGREG
FT                   GIEGIDDYLDTKLAQIVF"
FT   gene            complement(102651..103658)
FT                   /gene="idhA"
FT                   /locus_tag="Arad_0103"
FT   CDS_pept        complement(102651..103658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="idhA"
FT                   /locus_tag="Arad_0103"
FT                   /product="myo-inositol 2-dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24880"
FT                   /db_xref="GOA:B9JGN4"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR030827"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGN4"
FT                   /protein_id="ACM24880.1"
FT                   /translation="MLRIAVLGVGRIGRMHAENIAAHPRATLAGVFDVHMPAAVDISEK
FT                   LGVPRFDSADAVFASTDVDAVLIATSTATHADLIEQAVAARKPALCEKPIDLSLDRVNA
FT                   CATRIAGSNVPVMLGFVRRFDAGHSALRQAVKTGKIGDLHQVVITSRDPGMAPDAYIEV
FT                   SGGIFRDMTIHDFDLARFILDEKVAEVSATGSRLVDPGLMERCNDYDTVTVVLKTASGK
FT                   QAIINNSRRAVYGYDQRVEAFGSGGMAISENHTLNNLRLYTDSHTDQGAPLMNFFIERY
FT                   GDAFAAEIGAFVDAIEQNRPPAVNFEDGRQALILAEAAIRSIAEGRTVNTSEIG"
FT   gene            103762..105633
FT                   /gene="iolD"
FT                   /locus_tag="Arad_0105"
FT   CDS_pept        103762..105633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iolD"
FT                   /locus_tag="Arad_0105"
FT                   /product="myo-inositol catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24881"
FT                   /db_xref="GOA:B9JGN5"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR030817"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGN5"
FT                   /protein_id="ACM24881.1"
FT                   /translation="MTRKTVRLTMAQALVRYLCNQFTDIEGERVPLFAGVFAIFGHGNV
FT                   TCLSEALETVQDRLPTWRGQNEQSMALAAIGFAKAKRRRQIMVAASSIGPGALNMVTAA
FT                   GVAMANRLPVLLLAGDTYASRLPDPVLQQVEHFGDPTITANDAFKSVVRYWDRIVLPEQ
FT                   ILQSLPQAVATMLDPADCGPAFIGLAQDTQEVAFDYPEVFFEPKVWKIPRPRPDRDTVI
FT                   AAAELLKTAKRPLIISGGGVRYSLAEEKVAEFAAKRGIPVVETIAGKGALTHDHPVHAG
FT                   PIGIVGSTSANALAKDADVILAIGTRLQDFTTGSWTAFSQDAQFISINAARFDAVKHRS
FT                   LSVVGDALEAVAELDVALGDYKAAAGLMPRAKALFAEWDKLLDEHQFLTNAPVPSYAQV
FT                   VGVLNKVARPEDTLIAAAGGTPGEVVKGWRVKNPNTFDCEFGFSCMGYEIPAGWGCAMA
FT                   QEGPGGTGGTPIVMIGDGTYMMMNSDIYSAALTGHRLIVVVCDNGGFAVINRLQQAKGV
FT                   PGFNNLLTDSRVQNRENPLHVDFVKHAEAMGAKARKAESLADLEDAMKWAQGNDGVTVI
FT                   SIVSDAWKWVPGDADWDVGVPAVSTFETVRAARAAQEKIREAQRLGV"
FT   gene            105635..106528
FT                   /gene="iolE"
FT                   /locus_tag="Arad_0106"
FT   CDS_pept        105635..106528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iolE"
FT                   /locus_tag="Arad_0106"
FT                   /product="myo-inositol catabolism protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24882"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR030823"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGN6"
FT                   /protein_id="ACM24882.1"
FT                   /translation="MKARLGIAPIAWWNDDLAELSDDVSLEECLRQASEAGFTGMETGR
FT                   RFPMDMKELGPILSRYGISVCGGWFSGLLLDGDLEAEKDRIAQQMQFFIAAKAPCIVYG
FT                   ETARSIQGLRSAPLATKPKLSETEMVAYGRKVSDFADWCARQGMPIAYHHHMAAAVETE
FT                   AELDLLMEHSSVPLLFDAGHMAFAGGEVMRVIDNHHARITHVHTKDIRRAVVDGLDRSR
FT                   ESFLDAVINGAFTVPGDGSLDFEAIVKALAAKGYEGWFVVEAEQDPVKNPPLEMARKGH
FT                   KELLRVMDAAGYEVVK"
FT   gene            106525..107340
FT                   /locus_tag="Arad_0107"
FT   CDS_pept        106525..107340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0107"
FT                   /product="oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24883"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGN7"
FT                   /protein_id="ACM24883.1"
FT                   /translation="MNRIDGKIAVITGGTQGLGAAIARIFAQAGAAGLVIVGRDGAKGA
FT                   KVADQIVAEHGTPVLVVAADLGEISDVRRVLAETDERFGRVDILVNAAALTDRGNLLNT
FT                   TPDLFDRIFAVNVRAPFFLMQDAVQIMIREGIEGTIVNIGSASEHAGQPFIAPYCASKG
FT                   ALATLTRNSGFALMRNRIRVNQLDIGWMNSDHERALQAAETGDPQAIDRAAAQLPFGRL
FT                   LDPAEVALAVLWSASGDSGMMTGSVIHYDQSVWGGYDGQAPAPAKRLGE"
FT   gene            107344..108405
FT                   /locus_tag="Arad_0108"
FT   CDS_pept        107344..108405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0108"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24884"
FT                   /db_xref="InterPro:IPR011418"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGN8"
FT                   /protein_id="ACM24884.1"
FT                   /translation="MRTIKGPGVFLAQFAADDAPYNSLPSLAKWAADKGFKGVQIPTWD
FT                   TRLIDMKKAATSDAYCDELKGMLADHGLEITEFASHITGQLVAVHPAHDTIMDSFAPEH
FT                   VRSNPAGRRAWAEEQLRFAARASQRLGIDRHVTFSGALLWPYLYPYPQWPEGLVGEGFE
FT                   ELAKRWTPILNDFDAHGVDVCYEIHPCEDLHDGHSWEMFLDKVGEHPRANLMYDPSHFV
FT                   LQALDYLAFIDHYHERIRTFHVKDAEFRPDGKSGAYGGYQPWSKRAGRFRSPGDGQVDF
FT                   GAIFTKLTTYGFDGWAVLEWECFVKNPEDGAAEGARFIADHIIRVSDRAFDDFVKSGAN
FT                   RSANRAMLGLGEK"
FT   gene            108432..109565
FT                   /locus_tag="Arad_0109"
FT   CDS_pept        108432..109565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0109"
FT                   /product="oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24885"
FT                   /db_xref="GOA:B9JGN9"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGN9"
FT                   /protein_id="ACM24885.1"
FT                   /translation="MVGGGQGAYIGNIHRLASRLDGQWQLVAGAFDVDPERGREFAIGQ
FT                   GLDPSRSYGSYQDLISGEVGRADRVDAVAICTPNFTHYPIAKALIEAGFDVICEKPLTA
FT                   TFEDAVALEKLARESGRFVGVTYTYSGYPMVHEARVRVARGEIGAVRSVQVEYPLEWMA
FT                   TAIEQKGNAQAAWRTDPKKNGRGGSIGDIGTHAYHLAGFVTGLKLDSLTADLATFVEGR
FT                   ALDDNAHVMMRYQGGARGLLWSSQVALGNSNGVRLRVFGSSGSFQWFQEQPNELIYAPL
FT                   EGRVQIIKRGADDLSEDAKVRSRTPPGHPEGYLEAFANLYAGFAEAIRAQKENREPGAV
FT                   GRNVPLAYDGLKGVAFVEAVVDSAEATIQPWIRPVAV"
FT   gene            complement(109627..110685)
FT                   /locus_tag="Arad_0110"
FT   CDS_pept        complement(109627..110685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0110"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24886"
FT                   /db_xref="GOA:B9JGP0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGP0"
FT                   /protein_id="ACM24886.1"
FT                   /translation="MMAITSLLEIVLRKRSSNGTWKGPTVHEIAHLAGVGVATVDRVLN
FT                   NRSGVRDKTRARILAVLEKLRNENSDRDVPLLIRLFCESGETFNAAMASAVTDVNRTLP
FT                   GIKVEGAYVTTSELDPIAFARSIEQEGSDADGVVVVAREHPAVNRAIRKLRTAGIPVVC
FT                   LTTDLPSSRRSAFVGNDQYAAGSVAALLIGNALPKERNSILIVMSVPFRCQQEREMGFR
FT                   RVLRSDFPHLRIEERVISDERPENTCEQLLRYFEANGHPAAIYNVAGANRGVAKALEHI
FT                   GKAQETVFVGHELSNHSRALLESGSMDYVISHDFAGELTSAARWIRDNLNGVSTEPPHS
FT                   QILLHTRYNCGL"
FT   gene            110853..111884
FT                   /locus_tag="Arad_0112"
FT   CDS_pept        110853..111884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0112"
FT                   /product="sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24887"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGP1"
FT                   /protein_id="ACM24887.1"
FT                   /translation="MKLKKLMMLSSLLVATALSSASSAQESGKQYRFVMVSHIGSNDPN
FT                   MNWLTTSLKEFEKRYPNVKTEYISTNNYSVQEHVRLLEQAIATHPDGIAVPIVSSDAFE
FT                   GPLRKAIEEGIPVVAFNIPDSRPVGERIPYLTYVGGDEYLTGKKLGEYAIEQAKEGKVP
FT                   MPKHVVCASHDSAHQGLKARCKGMQDAMATVGAKFDELFIGAEPATARNTLQSFLQANP
FT                   DTNYIFTVAGWSAPWAWGVANDMKLDPDVDDKGMTILTVDEGPVSIEGVRAGHILATNS
FT                   QGFWLQGYAPMEWLFWNKEFGYAPQSDILTGPIIIDKDNADQWAKQVRGVFGDKAYNEQ
FT                   NTW"
FT   gene            111984..112940
FT                   /locus_tag="Arad_0113"
FT   CDS_pept        111984..112940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0113"
FT                   /product="sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24888"
FT                   /db_xref="GOA:B9JGP2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGP2"
FT                   /protein_id="ACM24888.1"
FT                   /translation="MKHLLRNQGLGAIVGVVVMFAVFTVIDFSGWWTVQTVSNVTQFTA
FT                   ILAFVAMGQALIIITREIDLSVGSVYGLTGVAFITMEPALGVPGSLVLALVIAAAAGLV
FT                   QGIAVVKGQLPSMIVTLGGLFTARGIIYVWTGGSVHNFSPDARSHPLTLLLGGSLFGVE
FT                   AAIYWLILVAAVLALVLWLTPFGNRLLATGGSRESAESRGVQTDRIKIATFILCSLLAG
FT                   FAGILTLCNQPQTHVTLGENMELEAIAAAVIGGCLLTGGRGSILGTILGALIVVSLRYE
FT                   LIALGAPSSWYITFVGAVLIIAIIFNQKLARFLGHSV"
FT   gene            113734..114708
FT                   /locus_tag="Arad_0115"
FT   CDS_pept        113734..114708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0115"
FT                   /product="ribose ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24889"
FT                   /db_xref="GOA:B9JGP3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGP3"
FT                   /protein_id="ACM24889.1"
FT                   /translation="MALSAAKPLIRRHSELGIFLIGLVLVVIFSATSDGNWANLYNIGT
FT                   ILQVTATLGLMSLGVALVIGTGEIDISVGSTFGMGALAYLWLAARVDPSVAVMAAILVG
FT                   SAIGLINGLLVTRTGTPSLIITLGTLMIFRGIAIALTEGFSFSIPYAARKGWTYVVLGG
FT                   GDFLNFNTAFYWLIVVLVVLWVMLKAMPFGNRLLAVGGSAESAHSRGVRVDRIKLSAFV
FT                   LCGMLAAFGGALEAGKLGFADGSMGRLMELQAIASCVLGGCLLAGGRISLIGALMGAFV
FT                   LSSIQSYLVVMGVQPQWFILILGMIVVLAAYGDRSLRQWALKK"
FT   gene            114719..115726
FT                   /locus_tag="Arad_0116"
FT   CDS_pept        114719..115726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0116"
FT                   /product="myo-inositol 2-dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24890"
FT                   /db_xref="GOA:B9JGP4"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGP4"
FT                   /protein_id="ACM24890.1"
FT                   /translation="MSVRIAIIGAGIMGADHARIVAEDLPGATLQVVCDAAPERARKIA
FT                   EEFGAADVSIDPVGTIGRGDVDAILIASPDETHAPLSLAAIEAGKPALCEKPLSQSAKE
FT                   CLVVIEAEVSRGRQFVQLGFMRRFDPSYRDMKAGLDDGALGHAIMMHNFHRNVEAPANF
FT                   TGQMAITNSAPHELDVARFVLGADYTAISVFQPAGINASRTGAPVFMVLETDKGQLVNI
FT                   EINNNAAYGYDVRGELVGEKGSIFLNAPVYIRQNGQLMAYERYATDWRPRFAEAYRLQN
FT                   KAFLNFVRTGVFPVIASDAWDGYCASLAAEAGVEALRKGGRVTIAKMDKPSLYH"
FT   gene            115744..116703
FT                   /locus_tag="Arad_0117"
FT   CDS_pept        115744..116703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0117"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24891"
FT                   /db_xref="InterPro:IPR011418"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGP5"
FT                   /protein_id="ACM24891.1"
FT                   /translation="MKLGFVSDSLGGMSFEALLDNAARLGVSGVEVNTGGWSTAPHFDL
FT                   QSMKASADSRRDFAKAFENRGLEIIALNANGNPLHPTQPEQGECLKDTIRIAGDMGIKT
FT                   VCAMSGLPAGREGDLMPNWVVSSWPPETQAILRYQWEEKLLPFWTEIAALARENGVARI
FT                   ALELHGNQYVYNVPSLLKLRAAVGPVIGANLDPSHLFWMGADPLVAALALGEAVHHVHA
FT                   KDTMLNGPVQATTSLLENGSLMDIPARSWSYITLGFGHGEEWWRQFCYHLKMAGYDGWL
FT                   SVEHEDVLLNSLEGLEKSIALLKGVMPVAASDFVPQAI"
FT   gene            complement(117010..117216)
FT                   /locus_tag="Arad_0119"
FT   CDS_pept        complement(117010..117216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24892"
FT                   /db_xref="GOA:B9JGP6"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGP6"
FT                   /protein_id="ACM24892.1"
FT                   /translation="MGQSPCLGIKTRKIKAPARRLANRSATLGQTINLVSGVAIVWTLG
FT                   DERSVALSMAPKAVTTPITMAVP"
FT   gene            117331..118596
FT                   /locus_tag="Arad_0120"
FT   CDS_pept        117331..118596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0120"
FT                   /product="amine oxidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24893"
FT                   /db_xref="GOA:B9JGP7"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGP7"
FT                   /protein_id="ACM24893.1"
FT                   /translation="MSGETLAGGSVDVAIIGAGAAGVGAARRLQALRPDLSLVLLEASD
FT                   RIGGRARTVHPADLGGLALDLGCGWLHGARTNAWTGIAEEIGLTVDRTPAPWSDGGLQL
FT                   QRDDSDAKAARIAANTFLERIYTYEGEEDAPLSALLAAGNPWNGYIHALGTFLTGAELD
FT                   RSSAIDQSRYDPGPGPDWRVQQGYGTLVATYAAPLPVHTEAEVRRIDHSAADYVVLSTA
FT                   RGDLRAKAVVIAVSTNILAAEKIAFWPPLPGKIEAASQLPLGLANKLFLQVRTPEAFPA
FT                   DAHILGSYHSGRTGSYQLKPFGAPVIETYFAGDLAHDLEREGIGAAFDFSVEQLKRFFG
FT                   SSVEDMLSPAVMSAWASEPFVGGSYSYAVPGASDQRQVLAAPHDQRLFFAGEACSVTRY
FT                   STAHGAYETGFAAAEAIAKTLV"
FT   gene            118789..119322
FT                   /gene="ada"
FT                   /locus_tag="Arad_0121"
FT   CDS_pept        118789..119322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ada"
FT                   /locus_tag="Arad_0121"
FT                   /product="methylated-DNA-(protein)-cysteine
FT                   S-methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24894"
FT                   /db_xref="GOA:B9JGP8"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGP8"
FT                   /protein_id="ACM24894.1"
FT                   /translation="MAKTVHDARQEHVFKLMTSPVGELKLVASHKGLAAILWDNDRPGR
FT                   VPLTIVAEDEDHPVLVETERQLRQYFGGERRVFDLLVDFSGTAFQKKVWQALLTIPFGE
FT                   TRSYTQIAGQIGAPKAIRAVGAANGRNPISIIAPCHRVIGAAGDLRGFAGGLERKTYLL
FT                   GFEGSETKAFDFAA"
FT   gene            complement(119422..121425)
FT                   /locus_tag="Arad_0123"
FT   CDS_pept        complement(119422..121425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0123"
FT                   /product="oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24895"
FT                   /db_xref="GOA:B9JGP9"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGP9"
FT                   /protein_id="ACM24895.1"
FT                   /translation="MSTDAPIRWGIIGPGTIAKTFADGVAHSRGGKLVAIASRNPDKPG
FT                   LGDNFPGARIVNGYEALLADKDVDAIYIATPHTGHAEWAIKAIRAGKHVLVEKPIALSA
FT                   YDAEAIYYEATKAGVFAGEAFMYRVHPQTAKLIELVKSGVIGDIRIIRSSFGFNMGSVR
FT                   PEHRLFANETAGGGILDVGGYPVSMARLIAGAADGKPFLDPDKVSGVAHLGQTGVDEWA
FT                   SAVLKFPNNIIAEVSCSIMANQDNTLRIIGSEGRIEVKDFWFASGHKGGVGKIELIKGG
FT                   ETQVIEVKEDRWLYSFEVDAAGDAIRAGAKEFAYPGIGWADSIGNLRVLDQWRATIGLE
FT                   YEVEKATRRTTNIVGAPVTKGNSVPKRSIPGIAKPASIVTLGFEFFPNFAAASLTLDAF
FT                   YEAGGNAFDTAYVYGGGKTESIFGDWHTSRKVPREEIVLIGKGAHSPLCYPDMIGKQLD
FT                   LSLNRLKTDYVDIYFMHRDNTAVPVGEFVDAMDAEVRAGRIRGIFGGSNWTRARFDEAI
FT                   AYAEKNGKTAPAALSNNFSLAEMLDPIWAGCVAASDDDWKSWLNAKQIPNFAWSSQGRG
FT                   FFTDRAGRDKQSDEELVRVWYSDRNFGRRDRAIELAQKLGRNPIHIALAYVVAQPFPVI
FT                   PLIGPRTIAELEDSLSALDIKLTPEQVKWLEG"
FT   gene            complement(121481..122569)
FT                   /locus_tag="Arad_0124"
FT   CDS_pept        complement(121481..122569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0124"
FT                   /product="sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24896"
FT                   /db_xref="GOA:B9JGQ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGQ0"
FT                   /protein_id="ACM24896.1"
FT                   /translation="MAELSLTNIVKRYGSLEIIHGANLEVKDGEFVVFVGPSGCGKSTL
FT                   LRMIAGLEDITSGELSIGGRVVNDVEPADRGIAMVFQSYALYPHLTVEQNLNFGLRMNG
FT                   NPKADTDRRVKQASEILQITELMQRRPKQLSGGQRQRVAIGRAIVREPQIFLFDEPLSN
FT                   LDAELRVQMRVEISRLHKKLGTTMIYVTHDQTEAMTLADKIVVLRGGNIEQIGAPLDLY
FT                   DDPVNQFVAGFVGSPKMNFLLAEVVDNQPGRIAVVLRNQRNVRLSLPTTTARVEIGEQV
FT                   TLGVRPEHFLEAGRGDVDMTVDIDVAEHLGNTSYIYANVADGEQIVIEREESRNASNRD
FT                   TLTVALSAAKTFLFDSAGNRLR"
FT   gene            complement(122586..123422)
FT                   /locus_tag="Arad_0126"
FT   CDS_pept        complement(122586..123422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0126"
FT                   /product="sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24897"
FT                   /db_xref="GOA:B9JGQ1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGQ1"
FT                   /protein_id="ACM24897.1"
FT                   /translation="MKSKSKSTLMRSIALHALLVPLALIWLFPLWMMFIFSTMPDEGIF
FT                   SPSIVLTPSTSFLDNVHNLQADTNFFGALTISIVVAIVYTILSVFLTSMAGWALARYRF
FT                   LGQSVVIGIILGTITLPYSVVIIPQFIMVARNFGLANTWVALIVPPLFNSLGVLFMRQA
FT                   FSMMPAELFDAARVEGVKEWQIFLRIALPLARPTMAALAIILFLASWNNYLWPLLINSR
FT                   PGMMTAPVALGTLIGLTKVSWGGIMAGAVMLTAPILIIFVLLQRHFIAGIAAGAIK"
FT   gene            complement(123419..124279)
FT                   /locus_tag="Arad_0127"
FT   CDS_pept        complement(123419..124279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0127"
FT                   /product="sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24898"
FT                   /db_xref="GOA:B9JGQ2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGQ2"
FT                   /protein_id="ACM24898.1"
FT                   /translation="MRLRNRSAYAFLAPYLLVFATFWIWPIINSFLISFQNTRVNPWIF
FT                   SATVNWGRLFGDPAFYNALTNTLIILVIQVPVMISLATVMAVLLNSPLLKARGLFRFAF
FT                   FAPVVVGEVAYAAVFRLMFNLDFGIINKLLSGVGIAPVSWFANSHAAMLLIIIAVTWRW
FT                   AGYNAIIILSGLQSIPEDVYEAATLDRVGPIQQFIHITLPLLKPIILFCVVLSVIGTMQ
FT                   LFTEPYLITNRGGPGGATETLGLLLYRQGFQSTNFGYASAIAYTMAALAVAISLLNLWV
FT                   GREQK"
FT   gene            complement(124392..125666)
FT                   /locus_tag="Arad_0129"
FT   CDS_pept        complement(124392..125666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0129"
FT                   /product="sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24899"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGQ3"
FT                   /protein_id="ACM24899.1"
FT                   /translation="MRLKLLGATTLAAMLASGSAFAEQTTITVWSWNVAASALKSTLEG
FT                   FNKKYPDIKVDVQDIGNPQVFDKMLPACAAGGDGLPDIMSIENHKASIFWNRFPDCLTD
FT                   LTKLGYTDELKKQFPDFKRAELEVGDAAYAMPWDSGPVAVFYRRDLYEKAGVDPATIKT
FT                   WDDFIAAGKKISAANPGVIMAQADLNGDSEWFRMLANEQGCGYFSDDSQSIAVSQPGCI
FT                   KALDKVKEIKDAGLLSAANWDEKIQSNNAGKVASQLYGGWYEGTIRSTSPDLAGKWGVY
FT                   PMPSMTADGQHAANLGGSSLAIASSSKNKEAAWKFLEYTLGTNEGQVTMLKSFGLVPSL
FT                   LTAVKDPFVNEPLPYWGGQKVWADILSTLPKIRPSPGTQYFSDADAIIKAVQTKYLAGG
FT                   YPDGKAALDDAAQQIASATGLPIAK"
FT   gene            125759..126697
FT                   /locus_tag="Arad_0130"
FT   CDS_pept        125759..126697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0130"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24900"
FT                   /db_xref="GOA:B9JGQ4"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGQ4"
FT                   /protein_id="ACM24900.1"
FT                   /translation="MAKSKVGDRAVYQPGASSIEGLPTTLQMFHTHPPLMAKPHWHAQV
FT                   EINYIMRGTVHYRMNDHEVQLQAGDICLFWGGQPHQMDDSSEDSIYAGAHLPLVHFFRM
FT                   RLPLDISGRLMRGQILVTSATDAADNENFARWHRYAVSGDPAKAGHAVAELLLRLERIA
FT                   FEPYLMLPEKREPEMGGQVHPQSSRSLARMCDFIAGNFLHDIDTVDIAKAADLHPKYAM
FT                   NLFKKCTGMTLSKYVNLLRLSRAQAMLMRDGANVLQVAMDSGFGSISAFNKSFRHIAGM
FT                   TPSDFRRDMRVLTAMNVEAVRPPMRRPAPQF"
FT   gene            126767..127537
FT                   /locus_tag="Arad_0132"
FT   CDS_pept        126767..127537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0132"
FT                   /product="hydroxypyruvate isomerase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24901"
FT                   /db_xref="GOA:B9JGQ5"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR026040"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGQ5"
FT                   /protein_id="ACM24901.1"
FT                   /translation="MRQFSACIEWLFAREGDDFADRIRLAHAAGLNAVEFWRWANKDLD
FT                   AIASAISETGIAVAGIVAEPMIALTNPANKEAWLEGLRASVGVAQRLGAPVLIAQAGDD
FT                   LPEFSRVEQRAALVSALRAGADILKGSGVRLGLEPLNTLVDHAGYYLSSTVEGLDIVDE
FT                   VGRPEVGIVYDIYHSAVMGERTEDAIGRRVDRIVHVHVADHPGRNNPGTGEIDLADRLN
FT                   WLFAHGYEGRVGLEYRPKTRDAEAIQAVVKLLSA"
FT   gene            complement(127541..128428)
FT                   /pseudo
FT                   /gene="crp487"
FT                   /locus_tag="Arad_0133"
FT                   /note="copper resistance protein; Absence of stop
FT                   (pseudogene)"
FT   gene            complement(128425..128712)
FT                   /locus_tag="Arad_0134"
FT   CDS_pept        complement(128425..128712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0134"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24902"
FT                   /db_xref="GOA:B9JGQ6"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGQ6"
FT                   /protein_id="ACM24902.1"
FT                   /translation="MKSAAPADKSTVTGSPSELDLTFTESLNLKFSGVKLTGPDKTAVK
FT                   LGDPGLTRNDKVLIVPVSSPLGSGTYTVEWHVLSTDGHKTNGSYTFTVKP"
FT   gene            129044..129817
FT                   /locus_tag="Arad_0135"
FT   CDS_pept        129044..129817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0135"
FT                   /product="serine/threonine specific protein phosphatase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24903"
FT                   /db_xref="GOA:B9JGQ7"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGQ7"
FT                   /protein_id="ACM24903.1"
FT                   /translation="MVANTIREKVTRGFGQQRRRERLDLLNMPIYVIGDVHGRYDLLSA
FT                   LERKIFTDAATLPGRKLIVMLGDYIDRGPASAQVISRLMVPPPNGFDRICLTGNHEMAM
FT                   LDYIDGDISLDDWVALGGDATLKSYGADIQNLRQQYPQQKKLDTFIRTWLPDDHINFLR
FT                   SLPILLDTPEALFVHAGIDPDRPIAEQADDDLVYIRSRFHDSAQPLPKLIIHGHTPVKE
FT                   ADADGLRLNIDTGAFYSGKLTAARLWQGRVLITTT"
FT   gene            complement(129857..131338)
FT                   /gene="gabDch"
FT                   /locus_tag="Arad_0136"
FT   CDS_pept        complement(129857..131338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabDch"
FT                   /locus_tag="Arad_0136"
FT                   /product="succinate-semialdehyde dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24904"
FT                   /db_xref="GOA:B9JGQ8"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGQ8"
FT                   /protein_id="ACM24904.1"
FT                   /translation="MTFTTAMTKHVPFSSPFLRDAGYINGVWTAGGATKTFDVINPATG
FT                   EVLASLPDMGAAETTAAIDAAYAAQAAWAARPAKERSAILRKWFDLMVANADELGAILT
FT                   AEMGKPLPEAKGEILYAASYVEWYAEEAKRIYGETIPAPSNDKRMLVIRQPVGVVGTIT
FT                   PWNFPAAMIARKVAPALAVGCTVVSKPAEQTPLSAIALAVLAEQAGIPAGVFNVIVGVD
FT                   GPAIGRELCGNAKVRKISFTGSTEVGRILMRQCSDQIKKVSLELGGNAPFIVFDDADLD
FT                   AAVEGAIASKYRNAGQTCVCANRIYVQSNVYDAFAAKLAAKVAELAVGDGFTPGVAIGP
FT                   LIDEQGIAKVEDHVRDAVSKGAKVLTGGKRIEGAGTFFTPTILTGIDRTMKVAREETFG
FT                   PVAPLFRFETVDDVIAQANDTEFGLAAYFFAGDLKKVWRVAEALEYGMVGINTGLMSAE
FT                   TAPFGGIKQSGLGREGSRHGADDYLEMKYLCIGNL"
FT   gene            complement(131413..132684)
FT                   /gene="gabT"
FT                   /locus_tag="Arad_0138"
FT   CDS_pept        complement(131413..132684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabT"
FT                   /locus_tag="Arad_0138"
FT                   /product="4-aminobutyrate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24905"
FT                   /db_xref="GOA:B9JGQ9"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGQ9"
FT                   /protein_id="ACM24905.1"
FT                   /translation="MTLTDRKNAAISRGVGMTTQIYADRAENSEIWDKEGRRYIDFASG
FT                   IAVVNTGHRHPRVIAAVKEQLDRFTHTCHQVVPYENYVHLAERLNALTPGDFAKKTIFV
FT                   TTGAEAVENAIKIARAATGRSAVIAFGGGFHGRTFMGMALTGKVVPYKVGFGSMPGDVF
FT                   HAPFPVPLHGVTVEQSLAALKKLFAADVDPQRVAAIIIEPVQGEGGFYSAPASFMKALR
FT                   ELCDQHGILLIADEVQTGFARTGKMFAMDHHEVAPDLMTMAKSLAGGFPLAAVTGRAEI
FT                   MDAPGPGGLGGTYGGNPIGIAAAHAVLDVIVEEDLCNRANQLGSRLKQRLESLRDKVPE
FT                   IVDIRGPGFMNAIEFNDATTKLPSADFANKVRLIALDKGLILLTCGVHGNVIRFLSPIT
FT                   IQDGVFSEALDILEASMLEASAGK"
FT   gene            132880..133698
FT                   /locus_tag="Arad_0139"
FT   CDS_pept        132880..133698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0139"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24906"
FT                   /db_xref="GOA:B9JGR0"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGR0"
FT                   /protein_id="ACM24906.1"
FT                   /translation="MNSIEPVRYKVAEAARLAGVSASTLRLWESQGLVVPSRSDTGHRQ
FT                   YSAEDVARLKRISWFRAERGLNPAAIREALETEDATLPGTENGEQAASSGIGRKLRALR
FT                   HAAGKTLDQVAADMGVTSSTLSTLERTSQGVSFKTLHDLADYYGTTVSRLSGEEREDVP
FT                   VLIRSGEWRAWPETTPGVTVQLLAEGRTMMDCHRFVLAPGATSEGAYRHDGEEFIHILA
FT                   GRLELVLDNDQFFDLMPGDSLYFESRRDHSWRNRHDGETILLWINTPPTF"
FT   gene            133785..134411
FT                   /gene="rnd1"
FT                   /locus_tag="Arad_0140"
FT   CDS_pept        133785..134411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnd1"
FT                   /locus_tag="Arad_0140"
FT                   /product="RNAse D protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24907"
FT                   /db_xref="GOA:B9JGR1"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGR1"
FT                   /protein_id="ACM24907.1"
FT                   /translation="MAATIRYHEGDISAADAARYTGAIAIDTETLGLIPRRDRLCVVQL
FT                   SPGDGTADIIRIASGQSQAPNLVAMLADTTRQKIFHYGRFDIAVLFHTFGVTTTPVFCT
FT                   KIASRLCRTYTDRHGLKDNLKELLEVDISKAQQSSDWAAEKLSPAQLEYAASDVLYLHA
FT                   LRDKLTARLVRDGRMEHAEACFAFLPTRAKLDLLGWEEADIFAHS"
FT   gene            134656..136353
FT                   /locus_tag="Arad_0141"
FT   CDS_pept        134656..136353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0141"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24908"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGR2"
FT                   /protein_id="ACM24908.1"
FT                   /translation="MLSPVAAVSVVGASIEKPVVATAETSSVQAAATPVAVLSSAVNAS
FT                   AGGKLNMLLAAARERMFESLLSAIDAASVALNVPREPGESNAALAQRLVDAIRSLPPQQ
FT                   LAAAQQQLNAQMKTPVPLPLLAEALDNPDSPKAVQIAVSLDASLTQEPDAVIRAVVNSY
FT                   GQNAGEPDAVGQQTPIPAQAMPKTSEAAATNTATTAPSALPEKMAAPSPTPVTASPSTP
FT                   SAQAPQQAATTILQTIAGPVMIPVPEAMHELEAAVMPQTAPNPQVSATPQAASMPAAER
FT                   GVLPQIAVIVEDKALPTASLPLAAVGEAKLPTEIALIRSPLTPPPVPRDIQQLQADIKQ
FT                   GLQVVISPAIDVTGPDLPQVTRSDMPLAERVIAQALAAGQQDLQPLPQTVRDESLRNLA
FT                   AALAGQTAASSEEAQTASAAALPVKSQGNVPAMTIMDMSEAVAQTGTTIAPLLGIPFAI
FT                   AHYLPADTPTEDDPKRVDRVDLVDEEREQGQGGETARDDSEDESPPEEADQPAAAAADP
FT                   AAEDANVDVISASAIPVAPKIAALPAPAPVDPLSDHAFDFYRRMVGWE"
FT   gene            complement(136437..138140)
FT                   /gene="rpsA"
FT                   /locus_tag="Arad_0142"
FT   CDS_pept        complement(136437..138140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsA"
FT                   /locus_tag="Arad_0142"
FT                   /product="ribosomal protein S1"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24909"
FT                   /db_xref="GOA:B9JGR3"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGR3"
FT                   /protein_id="ACM24909.1"
FT                   /translation="MSVATPSREDFAALLEESFAKNDLAEGYVTKGIVTGIEKDVAVVD
FT                   VGLKVEGRIALKEFGARAKDGTLKVGDEVEVYVERIENALGEAVLSREKARREESWIKL
FT                   EAKFEAGERVEGVIFNQVKGGFTVDLDGAIAFLPRSQVDIRPIRDVTPLMHNPQPFEIL
FT                   KMDKRRGNIVVSRRTVLEESRAEQRSEIVQNLEEGQVVDGVVKNITDYGAFVDLGGIDG
FT                   LLHVTDMAWRRVNHPSEILSIGQQVKVQIIRINQETHRISLGMKQLESDPWDGIQAKYP
FT                   EGKKISGTVTNITDYGAFVELEPGIEGLIHISEMSWTKKNVHPGKILSTSQEVEVVVLE
FT                   VDPTKRRISLGLKQTLENPWAAFARNHPAGTEVEGEVKNKTEFGLFIGLDGDVDGMVHL
FT                   SDLDWNRPGEQVIEEFNKGDVVKAVVLDVDVDKERISLGIKQLGKDAVGEAAASGDLRK
FT                   NAVVSCEVIAVNDGGIEVKLVSHDDITSFIRRADLSRDRDEQRPERFSVGQVVDARVTN
FT                   FSKKDRKIMLSIKALEIAEEKEAVAQFGSSDSGASLGDILGAALKNRGAE"
FT   gene            complement(138320..138964)
FT                   /gene="cmk"
FT                   /locus_tag="Arad_0143"
FT   CDS_pept        complement(138320..138964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmk"
FT                   /locus_tag="Arad_0143"
FT                   /product="cytidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24910"
FT                   /db_xref="GOA:B9JGR4"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGR4"
FT                   /protein_id="ACM24910.1"
FT                   /translation="MTTPFTIAIDGPAAAGKGTLSRRIADQYGFHHLDTGLIYRATAKA
FT                   LLDAGLPLNDEAMAEAMARKVDFGGLDRAVLSKHEIGEAASKVAVMPAVRRVLVEAQRA
FT                   FSRKEPGTVLDGRDIGTVIRPDAPVKIYVTASAEVRAKRRYDEIADAGGSADYQAIFED
FT                   VKRRDERDMGRADSPLRPAEDAHLLDTSEMSIEAAFQAAKSIIDAALSRNA"
FT   gene            complement(138961..140325)
FT                   /gene="aroA"
FT                   /locus_tag="Arad_0144"
FT   CDS_pept        complement(138961..140325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroA"
FT                   /locus_tag="Arad_0144"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24911"
FT                   /db_xref="GOA:B9JGR5"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGR5"
FT                   /protein_id="ACM24911.1"
FT                   /translation="MPHDTHSRPATARRSTNLSGTIRVPGDKSISHRAFMFGGLASGET
FT                   RITGLLEGEDVLNTGKAMRAMGAKIEKAGDEWIIKGVGNGALLAPEAPLDFGNAGTGSR
FT                   LTMGLVGVYHFESTFIGDASLSKRPMGRILDPLRQMGVQVKSSEGDRLPVTLHGPETAN
FT                   PITYRVPMASAQVKSAVLLAGLNAPGITSVIEPVMTRDHTEKMLAGFGAELSVETDRDG
FT                   VRIIRLQGQGKLFGQTIDVPGDPSSTAFPLVAALIVAGSDITIRNVLMNPTRTGLILTL
FT                   QEMGADIEILDKRLAGGEDVADLRVRSSALKGVTVPAERAPSMIDEYPVLAVAAAFAEG
FT                   TTVMLGLEELRVKESDRLSAVAEGLTLNGVDCTEGEASLTVRGRPDGKGLGNAGGEVKT
FT                   HLDHRIAMSFLVMGLASEHPVKVDDSAMIATSFPEFFDLMAELGADMDVEGSISP"
FT   gene            140592..140978
FT                   /locus_tag="Arad_0145"
FT   CDS_pept        140592..140978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0145"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24912"
FT                   /db_xref="InterPro:IPR012644"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGR6"
FT                   /protein_id="ACM24912.1"
FT                   /translation="MTVAKAELGTKRTDPDNGKKFYDLNRDPVVSPYTGKSWPLSYFEE
FT                   TSAAKEVPEEEEVAEVDTENTEVELVSLEDADEAVAGDEIPDIGDDDVEIGDDDDDTFL
FT                   EADEDEDDDDMSDIIGVTGDDDDV"
FT   gene            141132..141204
FT                   /locus_tag="Arad_5003"
FT   tRNA            141132..141204
FT                   /locus_tag="Arad_5003"
FT                   /product="tRNA-Ala"
FT   gene            141398..141673
FT                   /locus_tag="Arad_0146"
FT   CDS_pept        141398..141673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0146"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24913"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGR7"
FT                   /protein_id="ACM24913.1"
FT                   /translation="MRTCSDALSCLCVKYVYILTSIEAPDHHYVWVTGDLKARLAKHNS
FT                   KEVPHTSKYAPCSLKTYIAFSDEAQALAFEKYLKSGSGRAFAKKRL"
FT   gene            141782..142504
FT                   /locus_tag="Arad_0147"
FT   CDS_pept        141782..142504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0147"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24914"
FT                   /db_xref="GOA:B9JGR8"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGR8"
FT                   /protein_id="ACM24914.1"
FT                   /translation="MTRQRRRRLIKTRRTVTGFLLVASISFIAGMTDAVGLMLTGNFVS
FT                   FMTGNTTRAAIALGTGDFGHAAVLFAAIVTFIGGNALGIVVAHAADRRAFVVLACVSIL
FT                   LALAAGFEVPSLILVQFYLVVLAMGMVNATVEHIEGLPIGLTYVTGALSRFGRGIGRFI
FT                   LGDRDFAWTVQIVPWSGMIIGAILGALLAGAFGSHALWLVSMVALSLAFATLFIPRPLQ
FT                   RRFNQRLMVTASMVKRSK"
FT   gene            complement(142568..142804)
FT                   /locus_tag="Arad_0150"
FT   CDS_pept        complement(142568..142804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0150"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24915"
FT                   /db_xref="GOA:B9JGR9"
FT                   /db_xref="InterPro:IPR021529"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGR9"
FT                   /protein_id="ACM24915.1"
FT                   /translation="MPNGKLPKHYSAVVMPLILSLLMTSVVSAISILRSQGVTAEAFAL
FT                   WPSTWGISWAIAFPVLLLLLPVVRRVTAAIVES"
FT   gene            143061..143852
FT                   /locus_tag="Arad_0152"
FT   CDS_pept        143061..143852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0152"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24916"
FT                   /db_xref="GOA:B9JGS0"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGS0"
FT                   /protein_id="ACM24916.1"
FT                   /translation="MFVFSKLVWIFGQPLSLAFLFGVLAFISVLVRRRGIALASSLLSI
FT                   LILFVALYTNAGAYVVQGLEERFPRVAADPADLKCMIVLGGATQNQVTTVRGGYELDSG
FT                   GDRLIEALRLAQKYPQARIVVSGGDGSIGGDYEGDAVISERFFTALGIGKDRLVEDKTS
FT                   RTTFENAVNTKELLAQNGLSGCLLITSGFHMPRSMGIFRKQGIDVVPWPVDYRSTGKET
FT                   LGLDFTQPSLNAQLLSTGVREWIGLVGYYAVGRTSAFYPGP"
FT   gene            144324..145148
FT                   /locus_tag="Arad_0155"
FT   CDS_pept        144324..145148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0155"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24917"
FT                   /db_xref="GOA:B9JGS1"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGS1"
FT                   /protein_id="ACM24917.1"
FT                   /translation="MTNATRLRITISRDFNGVSSPKHEATAGVVASASASLYLPACAAL
FT                   ATVIHSIKIAAGILLEFPMSLLSFLDYAGVALFAATGALAASRKQLDLIGFLFFAAVTG
FT                   TGGGTLRDIILGRVPVFWVLNPTYVIICALVGVLVFFTAHLFESRYRLLIWLDAIGLSA
FT                   YCVMGAAKGMAATGSPTVAIVTGALTATFGGILRDLLANEPSVLLRPEIYVTAALIGAG
FT                   VFTAANATMMPLYASAGLGVAAAFAVRGGALWFGWTFPTYHHRPGRHPDDVM"
FT   gene            complement(145163..145531)
FT                   /gene="irr"
FT                   /locus_tag="Arad_0156"
FT   CDS_pept        complement(145163..145531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="irr"
FT                   /locus_tag="Arad_0156"
FT                   /product="iron transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24918"
FT                   /db_xref="GOA:B9JGS2"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGS2"
FT                   /protein_id="ACM24918.1"
FT                   /translation="MRPTRQRIALGDLLFAKGDRHLTVEELHEEAVTAGVPVSLATVYN
FT                   TLHQFTEAGLIRVLAVESAKTYFDTNVSDHHHFFVEGHNEVLDIPISNLTIANLPEPPV
FT                   GMEIAHVDVVIRLRRKQR"
FT   gene            145878..146393
FT                   /gene="fabA"
FT                   /locus_tag="Arad_0158"
FT   CDS_pept        145878..146393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabA"
FT                   /locus_tag="Arad_0158"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabA"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24919"
FT                   /db_xref="GOA:B9JGS3"
FT                   /db_xref="InterPro:IPR010083"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9JGS3"
FT                   /protein_id="ACM24919.1"
FT                   /translation="MTTRQSSFNYEEILSCGRGELFGPGNAQLPLPPMLMVHRITDISE
FT                   TGGAFDKGYIRAEYDVRPDDWYFPCHFAGNPIMPGCLGLDGMWQLTGFFLGWLGEPGRG
FT                   MALSTGEVKFKGMVRPDTKLLEYGIDFKRVMRGRLVLGTADGYLKADGEVIYQASDLRV
FT                   GLSKDKAA"
FT   gene            146446..147669
FT                   /gene="fabB"
FT                   /locus_tag="Arad_0159"
FT   CDS_pept        146446..147669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabB"
FT                   /locus_tag="Arad_0159"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase I
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24920"
FT                   /db_xref="GOA:B9JGS4"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGS4"
FT                   /protein_id="ACM24920.1"
FT                   /translation="MRRVVVTGLGIVSSIGNDAQEVTASLREAKSGISFSNDFAEHGFK
FT                   CQVWGSPKIDTTDLVDRRAMRFLSQGGAWNHVAMKQALADSGLEESDISNERTGIIMGS
FT                   GGPSTRTLIEAADITRKNNSPKRVGPFAVPKAMSSTASATLATWFKIYGVNYSISSACS
FT                   TSAHCIGNAAEMIQWGKQDVMFAGGHEDLDWTMSNLFDAMGAMSSKFNEDHPETASRAY
FT                   DASRDGFVIAGGAGVLVLEELEHAKARGAKIYAEIVGYGATSDGYDMVAPSGEGAVRCM
FT                   RQALATVKGDVDYINTHGTSTPVGDSKEIGAIREVFGSKIPPIQSTKSLTGHSLGAAGV
FT                   QESIYSILMMQERFIGESAHITELDPEFEGVPVVRKRIDNAKIDIALSNSFGFGGTNAT
FT                   LVFQRYNG"
FT   gene            147674..148480
FT                   /gene="fabI1"
FT                   /locus_tag="Arad_0161"
FT   CDS_pept        147674..148480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabI1"
FT                   /locus_tag="Arad_0161"
FT                   /product="enoyl-(acyl-carrier-protein) reductase (NADH)
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24921"
FT                   /db_xref="GOA:B9JGS5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGS5"
FT                   /protein_id="ACM24921.1"
FT                   /translation="MTGIMQGKRGLIMGVANNHSIAWGISKALAAEGAELAFTFQGEAL
FT                   GKRVKPLAAEVGSDFLLPCDVEDLASVDAVFDEIKARWGKLDFIVHAIGFSDKNELKGL
FT                   YANTTRDNFTRTMVISCFSFTEIAKRAADLMADGGSMLTLTYNGSTRVIPNYNVMGVAK
FT                   AALEASVRYLAADYGPRGIRVNAISAGPIRTLAGAGISDARAILSWNQRNAPLRKSVTI
FT                   DQVGSSSLYLLSGLSAGVTGEIHFVDAGYNITSMPTLEALASADAE"
FT   gene            148534..149124
FT                   /locus_tag="Arad_0162"
FT   CDS_pept        148534..149124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0162"
FT                   /product="acetyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24922"
FT                   /db_xref="GOA:B9JGS6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGS6"
FT                   /protein_id="ACM24922.1"
FT                   /translation="MIPPGFSMTFTNAEPFASTERLILRGFMPEDFEAYSAYRSLPSIY
FT                   RFLYRDPPSAEALRERFDASLNSCLSEDGSSLRWAVLRREDGALLGDVSLKLTSKAALQ
FT                   AEVGYIFNPAYAGKGYATEAVRTIIDLGFDKLGFHRIFARLDAQNNASVGVVERLGLRR
FT                   EAHLIENDRFNGVWGDEYIYAVLSHQWADGAGT"
FT   gene            149350..149931
FT                   /locus_tag="Arad_0163"
FT   CDS_pept        149350..149931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0163"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24923"
FT                   /db_xref="GOA:B9JGS7"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGS7"
FT                   /protein_id="ACM24923.1"
FT                   /translation="MAEVLLFHHAQGLTPGVRAFADDLRASGHIVHTPDLFDGRTFRSI
FT                   DEGLAYIGEIGFDDMRERGVRFADELPPEIVYAGFSFGVLPAQKLAQARPGARGALLFY
FT                   SCMPISGEWAFGPWPDGVAVQIHGMDNDPIFVGEGDIDAAREIVEKVEDAELFLYPGDQ
FT                   HYFADNSLPSYDADATALLTIRVREFLDRV"
FT   gene            complement(150186..151202)
FT                   /locus_tag="Arad_0164"
FT   CDS_pept        complement(150186..151202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0164"
FT                   /product="rRNA (guanine-N2-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24924"
FT                   /db_xref="GOA:B9JGS8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGS8"
FT                   /protein_id="ACM24924.1"
FT                   /translation="MSRDALKTLFHPFASGTVATPGEGERILFLGAEAGFSLPADFAAE
FT                   LSAVQGFRPFYRQLQAQRIEVTPEIEGADYDGALVLCTKHKGENEASIATALSRVKAGG
FT                   LIVVAGGKEDGIQPLRKRVEGFGLEVNHMPKYHGVAFWFARPADISAPTAQLVKPATRV
FT                   DGRFTTTAGMFSHDRIDAGSELLASRLPTDFSGDAADFGAGWGYLSAELATKSPRIARI
FT                   DLYEAHYDALEAARANLLANCPKVAQRFFWHDLAGEPVKDKYDLIIMNPPFHEGHAAEP
FT                   SLGQAMIKTASSALRSGGRLMLVANRGLPYEPVLAENFKESGETCRNARFKVLWAKK"
FT   gene            complement(151285..153417)
FT                   /gene="pnp"
FT                   /locus_tag="Arad_0165"
FT   CDS_pept        complement(151285..153417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnp"
FT                   /locus_tag="Arad_0165"
FT                   /product="polyribonucleotide nucleotidyltransferase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24925"
FT                   /db_xref="GOA:B9JGS9"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9JGS9"
FT                   /protein_id="ACM24925.1"
FT                   /translation="MFDIHTVEIEWAGRPLKLETGKIARQADGAVMATYGETVVLATVV
FT                   SAKSPKPGQDFFPLTVNYQEKTYAAGKIPGGYFKREGRPSEKETLVSRLIDRPIRPLFP
FT                   EGYKNDTQVVVTVIQHDLENDPDILSMVATSAALTLSGVPFMGPIGGARVGYINGEYVL
FT                   NPHLDEMDESSLDLVVAGTQEAVLMVESEAKELSEDVMLGAVMFGHRGFQPVIDAIIKL
FT                   AEVAAKEPRDFQPEDHSALEAEMLSIAEGELRTAYKNTQKAERYAAVDAVKAKVKAHFF
FT                   PEGVEPKYSAEVIGAVFKHLQAKIVRWNILDTKSRIDGRDLSTVRAIVSEVGVLPRTHG
FT                   SSLFTRGETQAIVVATLGTGEDEQYVDSLTGMYKERFLLHYNFPPYSVGETGRMGSPGR
FT                   REIGHGKLAWRAVRPMLPTAEQFPYTLRVVSEITESNGSSSMATVCGTSLALMDAGVPL
FT                   AKPVAGIAMGLIKEDERFAVLSDILGDEDHLGDMDFKVAGTDGGITALQMDIKIEGITE
FT                   EIMNVALNQAKGGRLHILGEMAKAISESRGQLGEFAPRIEVMNIPVDKIREVIGSGGKV
FT                   IREIVEKTGAKINIEDDGTVKIASSSGKEIEAARKWIHSIVAEPEVGQIYEGTVVKTAD
FT                   FGAFVNFFGARDGLVHISQLASERVAKTQDVVKEGDKVWVKLLGFDERGKVRLSMKVVD
FT                   QATGQELAAKKDDAAE"
FT   gene            complement(153800..154069)
FT                   /gene="rpsO"
FT                   /locus_tag="Arad_0169"
FT   CDS_pept        complement(153800..154069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /locus_tag="Arad_0169"
FT                   /product="ribosomal protein S15"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24926"
FT                   /db_xref="GOA:B9JGT0"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9JGT0"
FT                   /protein_id="ACM24926.1"
FT                   /translation="MSITAERKAALIKEYATVEGDTGSPEVQVAILTERINNLTDHFKD
FT                   HKKDNHSRRGLLTMVSSRRSLLDYLKKKDEGRYSKLIGSLGIRR"
FT   gene            complement(154222..155073)
FT                   /locus_tag="Arad_0170"
FT   CDS_pept        complement(154222..155073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0170"
FT                   /product="hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24927"
FT                   /db_xref="GOA:B9JGT1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGT1"
FT                   /protein_id="ACM24927.1"
FT                   /translation="MRGVTIGILTFFSLFLTVASAHSAERWAALPSFPPMPEPKTSGMA
FT                   DVNDIKMYYAEYGEGTPILFIHGGLGNADVWGRQVADFARDHLVIVADSRGHGRSTRSQ
FT                   QPFGYDLMTSDYVALLDYLKISKVTLVGWSDGGIIGIDMAMKYPDKLTRVIAQAANVTT
FT                   DGVKPDVMNNKTFSNYIDVAGEYYRKLSPTPNEYDAFVNQISEMWATQPAWTAADLGKI
FT                   AVPVTLAIGDHDEAVKLDHTQMMAKEIPGAKLVILKDASHFAMLQDPEGYDAMIRNAMA
FT                   GR"
FT   gene            complement(155171..156103)
FT                   /gene="truB"
FT                   /locus_tag="Arad_0171"
FT   CDS_pept        complement(155171..156103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truB"
FT                   /locus_tag="Arad_0171"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24928"
FT                   /db_xref="GOA:B9JGT2"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015240"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGT2"
FT                   /protein_id="ACM24928.1"
FT                   /translation="MSKPRKPKGRPISGWLILDKPVDFGSTEAVSKIKWLFKAQKAGHA
FT                   GTLDPLASGMLPIALGDATKTVPYVMDGRKIYEFTVSWGEERATDDLEGEVTQSSDKRP
FT                   SEDEIRALLPNYTGVINQIPPQFSAIKIAGERAYDLAREGETVEIPSREVEIFRLTLLA
FT                   CPDADTAHFEVECGKGTYVRALARDFGRDLGCYGHISGLRRSFVAPFAEEAMVPLADLV
FT                   ALEAIEDADERLAALDALLIDTAEALSSLPHLVINDDQAHRLKMGNPILVRGRDAPVAE
FT                   TEAYATARGKLIAIGEIGEGEFRPKRVFG"
FT   gene            complement(156116..156535)
FT                   /gene="rbfA"
FT                   /locus_tag="Arad_0172"
FT   CDS_pept        complement(156116..156535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="Arad_0172"
FT                   /product="ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24929"
FT                   /db_xref="GOA:B9JGT3"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGT3"
FT                   /protein_id="ACM24929.1"
FT                   /translation="MATRPTTSAPSQRMLRVGEQVRAAITQVLQRGEVRDDLIERTVIS
FT                   ISEVRMSPDLKIATAFVTPLGVADHDLIIDTLNRHTKYIRGRLGQHLRQMKYMPEIRFR
FT                   DDTSFDNYKKIDALLRSPEVQRDLKDDDIDTDENR"
FT   gene            complement(156611..159337)
FT                   /gene="infB"
FT                   /locus_tag="Arad_0173"
FT   CDS_pept        complement(156611..159337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="Arad_0173"
FT                   /product="translation initiation factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24930"
FT                   /db_xref="GOA:B9JGT4"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGT4"
FT                   /protein_id="ACM24930.1"
FT                   /translation="MTDNQDDKTLSASGKKTLTLKPSGVNQGTVRQDMGRGRTKAVVVE
FT                   TRKRRPLRPEDEKPIVATPTAAAAPSVTRVAEPTPQPPRPPQPAPRIHQPGGQQQRPQQ
FT                   SNQNNQQRPQQERSSRPVVLNHLSAGEMDARRRALAEAQIRDAADAVRRAEEEARRAEE
FT                   EAARRIVEQAEAARRAEEEAARALEPKVETPEPVEAAKPAAQATAAPVVARRPDAAPQP
FT                   ARPGAPAAEAPANRRRVNEEETDRGPPRGGAPARGKVVRPEPAKPVTTRPKTDEERRRG
FT                   KLTVTTANVDEDGSARGRSLSAMRRRQEKFRRSQMQETREKITREVVLPETITIQELSQ
FT                   RMSERAVDVIKFLMKEGQMMKPGDVIDADLAELIAGEFGHTVKRVSESDVELGIFNVGD
FT                   EDGELVSRPPVVTIMGHVDHGKTSLLDAIRHANVVAGEAGGITQHIGAYQVEQNGHKIT
FT                   FIDTPGHAAFTAMRARGAQATDIAILVVAADDSVMPQTIESINHAKAAGVPIIVAINKI
FT                   DKPSADPQKVRNQLLQHEVFVETMGGEVLDVEVSAKNRTNLDKLLEAILLQAEILDLKA
FT                   NPNRTAEGTVIEAQLDRGRGSVATVLIQKGTLRPGQIVVAGDQWGRVRALVNDKGEHVK
FT                   EAGPATPVEVLGLSGAPQAGDKFAVVENESRAREISEYRQRLTRDKAAARQSVQRGSLE
FT                   QMMMTLQTTGTKEFPLVIKGDVQGSIEAIAGALDKLGTDEVRARIVHSGVGGVTESDIS
FT                   LAGASDAAIIGFNVRANSQARTLAEREGIEIRYYNIIYDLVDDVKAAMSGLLSPERRET
FT                   FLGNAEILEVFNITKVGKVAGCRVTEGKVERGVGVRLVRDNVVIHEGKLKTLKRFKDEV
FT                   SEVNMGQECGMAFENYEDIRAGDTIECFRVEHITRTL"
FT   gene            complement(159439..160128)
FT                   /locus_tag="Arad_0174"
FT   CDS_pept        complement(159439..160128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0174"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24931"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR035931"
FT                   /db_xref="InterPro:IPR037465"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGT5"
FT                   /protein_id="ACM24931.1"
FT                   /translation="MTSTTEPNAAPEDDDLGTDVNGRMCIVTRESGSPDELIRFVAAPD
FT                   GTIVPDLKRQLPGRGCWVKLDRALVDKAVAKKLFARALKAEVTAPSDLGATVDRLLVAQ
FT                   LAGMMHMARKASQFVNGSSKVDGAVRNGSALAVFHAIDAADDGVRKIDQARKAWHLGME
FT                   TEKEIPSFRVFTEAEMEELMGQNAFIHAAALAGRAGQGVVKRANLLERYRNGGQSRATG
FT                   GAGRRKQ"
FT   gene            complement(160125..161729)
FT                   /gene="nusA"
FT                   /locus_tag="Arad_0176"
FT   CDS_pept        complement(160125..161729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="Arad_0176"
FT                   /product="N-utilization substance protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24932"
FT                   /db_xref="GOA:B9JGT6"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGT6"
FT                   /protein_id="ACM24932.1"
FT                   /translation="MAVSANRLELLQIADAVAREKVIDREIVLAAMADAIQKAARSRYG
FT                   TESNIRADINPKTGEIRLQRLLEVVEKAEDYSTQIPLELARDRNPDAALGDFIADPLPP
FT                   MDFGRIAAQSAKQVIVQKVREAERDRQFDEFKDRVGEIVNGTVKRVEYGNVIVDLGRGE
FT                   GIIRRDEMIPRENFRYGDRVRAYVYDVRREQRGPQIFLSRTHPQFMVKLFTMEVPEIYD
FT                   GIIQVKSVARDPGSRAKIAVISNDSSIDPVGACVGMRGSRVQAVVGELQGEKIDIIPWS
FT                   NEPANFVVNALQPAEVSKVVLDEDAERIEVVVPDEQLSLAIGRRGQNVRLASQLTGWDI
FT                   DIMTEAEESERRQKEFNERTNLFMDALDVDEMVGQVLASEGFAAVEELAYVELDEIASI
FT                   DGFDEETAQEIQQRAREYLERLEAEMDEKRKALGVADELRQINGMTAQMMVALGEDGIK
FT                   TIEDFAGCAADDLVGWSERKNGETKKFEGLFSKLEISRVEAEQMIVQARLSAGWITEAD
FT                   LANETEEVAEDETEQEA"
FT   gene            complement(161790..162530)
FT                   /locus_tag="Arad_0177"
FT   CDS_pept        complement(161790..162530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0177"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24933"
FT                   /db_xref="GOA:B9JGT7"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9JGT7"
FT                   /protein_id="ACM24933.1"
FT                   /translation="MPCNLAGTGLYPLQILDRVMKSGPQGPALFYYLDLPIAAPCRSER
FT                   LSEVTNADNINEPRLIVETGLDQRIAAIIEPVIVGMDYRLVRVRLMNQNGLTLQVMAER
FT                   NDGSMNVQGCEEISTAISPVLDVEDPVDKAYHLEVSSPGIDRPMVRKSDFVRWNGHIVK
FT                   CETSILVDNRKRFRGKITDVNDDGFTIERDQVAYGEEPKVTIPFSTLAEAKLILTDDLI
FT                   RDALRADKQAKAEAANQNEADEEE"
FT   gene            complement(162556..164016)
FT                   /locus_tag="Arad_0178"
FT   CDS_pept        complement(162556..164016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0178"
FT                   /product="transglycosylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24934"
FT                   /db_xref="GOA:B9JGT8"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR011970"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGT8"
FT                   /protein_id="ACM24934.1"
FT                   /translation="MRRVHTPLCHFVTSPPQGGRLVTCGTASSQTSIVSTETEEQRFDG
FT                   VRNTLPTISPPVGEMSRKGQRRVSAARQTRHFLSFIYILLLALLPLPAFAASKADVEAQ
FT                   FQTWIQKDLWLEAKKDGISEKTFRAAFAGVTLNWSLPDLAPPGFPKPKEQKQTQAEFSS
FT                   PAPYFNEGRLQRLAVTGRSFASQYGPVLKRIEKVYGVPGPILLAIWGRETGFGAAKLPN
FT                   SAVQVLATKAFMSTRKEMFRTELIAGLRILEHGDVAPDQFMGSWAGALGQPQFMPTSYL
FT                   KYAVDFDGDGHRNIWTSVPDTLASIANYLVQKGWQRGRGWGYEVTIPESVSCAQEGPDL
FT                   AKPISQWTSLGIARIAGKAFPSDELRAGGMMLVPAGRDGPEFIVTPNFYTIKEYNNSDL
FT                   YGLYIGNLADRIAYGSGAFQGQWGDVGKMLRSDVAGMQKTLERKGYDVGGTDGLPGYKT
FT                   RRSIGQWQQKSGLKPTCYPDSSMLGVLK"
FT   gene            complement(164039..164644)
FT                   /gene="recR"
FT                   /locus_tag="Arad_0179"
FT   CDS_pept        complement(164039..164644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="Arad_0179"
FT                   /product="DNA recombination protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24935"
FT                   /db_xref="GOA:B9JGT9"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9JGT9"
FT                   /protein_id="ACM24935.1"
FT                   /translation="MAKRVTGPEIEKLIQLLAKVPGLGPRSARRAALHLIKKKDQLLGP
FT                   LSHAMGEAYDKVKICSRCGNVDTVDPCTVCTDGHRDQSVIIVVEDVADLWALERAAAMN
FT                   AAYHVLGGVLSPLDGVGPDDLNIRGLIQRVGEGGVREIIIAVNATVEGQTTAHYITDQL
FT                   AGLEVKITRLAHGVPVGGELDYLDEGTLTAALRARTAI"
FT   gene            164666..165328
FT                   /locus_tag="Arad_0180"
FT   CDS_pept        164666..165328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24936"
FT                   /db_xref="GOA:B9JGU0"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGU0"
FT                   /protein_id="ACM24936.1"
FT                   /translation="MRERNHGRDDRPMKILAVCIGAAEMLPGRKSKTGINKHAVGAAVM
FT                   IDAKGLIGDAICNRVHHGGVDQAAYVEGSLTLDWWSRELGRRLEPGAFGENLVIDGLDN
FT                   CEIAVGDRFIAGDLVLEVTSARVPCATFAAKMGDPKFVKRYFQARRPGIYCRVKTAGTV
FT                   AAGMAVTHIPYAGARVTMPEMIATHGQRLSPQDRARYLSTPIHHKLRAMLESEAAGS"
FT   gene            complement(165385..165921)
FT                   /locus_tag="Arad_0182"
FT   CDS_pept        complement(165385..165921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0182"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24937"
FT                   /db_xref="GOA:B9JGU1"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGU1"
FT                   /protein_id="ACM24937.1"
FT                   /translation="MSDIIVLPGLGGSGEGHWQTLWEQQDPRMRRFQPASWDRPELTDW
FT                   IAALDRKIGRAKTPPILIAHSLACQFIAHWAVSAKTEILGAFLVAVPDPTGEVYLGGAP
FT                   SFANPPRQRLPFPSLLVTSTDDPYGPFDYAKESASVWGSELIDVGPLGHINSASGIGDW
FT                   PEGQALFRRFSAGLG"
FT   gene            166055..166507
FT                   /locus_tag="Arad_0184"
FT   CDS_pept        166055..166507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0184"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24938"
FT                   /db_xref="GOA:B9JGU2"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGU2"
FT                   /protein_id="ACM24938.1"
FT                   /translation="MDPTDLSMIEILQQDGRISVSELGRRVGLSQPAASERLKRLEERG
FT                   IIAGYRAIVDPTAVGLGMMAVIRLRTTHEHIRPYLKQFSEMPEIIEVLRLTGEDCFLLK
FT                   VLVPSPTDLETIVDSIARHGAVTTSLVLRNEPAKPIGRELIRKTVR"
FT   gene            complement(166529..166852)
FT                   /locus_tag="Arad_0185"
FT   CDS_pept        complement(166529..166852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0185"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24939"
FT                   /db_xref="GOA:B9JGU3"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGU3"
FT                   /protein_id="ACM24939.1"
FT                   /translation="MRDIMGMMGKVKEMQAKMEKMQAEIADIRVEGKAGGGLVTVTVNG
FT                   KGLMLGIKIDPSLFKEDDVEILEDLIVAANKDAQDKAEAITAEKTRELTAGLPIPPGFK
FT                   MPF"
FT   gene            complement(166959..168836)
FT                   /gene="dnaX"
FT                   /locus_tag="Arad_0186"
FT   CDS_pept        complement(166959..168836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="Arad_0186"
FT                   /product="DNA polymerase III"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24940"
FT                   /db_xref="GOA:B9JGU4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022107"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGU4"
FT                   /protein_id="ACM24940.1"
FT                   /translation="MSDTERQAKDAASTGTGYRVLARKYRPKDFTDLMVGQEPMVRTLT
FT                   NAFETGRIAQAYMLTGVRGVGKTTTARILARALNYRTPEIDRPTIDLREPGEHCQAIME
FT                   GRHVDVIEMDAASHTGIDDIREIIEQVRYRPVSARYKVYIIDEVHMLSTAAFNGLLKTL
FT                   EEPPEHVKFIFATTEIRKVPITVLSRCQRFDLRRISASDLVGLFTTIAGKEGIEAEPEA
FT                   LAMIARAAEGSARDGLSLLDQAIAHGSGVVVADAVRSMLGLADRARIVDLFHHIIKGDV
FT                   AAALAEFNSQYEAGANPVVVLADLADFTHLVTRLKYVPDAANDPSLSEVERNKAAEFAQ
FT                   GVAVTTLSRIWQMLLKGIPETESAARTAGAAEMVLIRLAHAAHLPAPEDAARRLAEFSD
FT                   GNGNGGVRPSPSGHGNGGGTQVSYQGNVMARAVETAPPRPTPQAPVAMLRAVPNTQPDS
FT                   APVGRIEQKPVEAPKPLIAINSMTDIAELAGQKRDPKLKAMVRSFVRPVRLEPGRLDVS
FT                   LTPGAPGTLLNELAVKLKEWTGIHWIVSLSRDEGEPTVVEAEANAQRQRVADARQDPDV
FT                   AAILSQFPGAKIIDVRVRAPDVEEEEQVAAPAAAESDEGDILPGDDIEF"
FT   gene            complement(168883..168980)
FT                   /locus_tag="Arad_5116"
FT   ncRNA           complement(168883..168980)
FT                   /locus_tag="Arad_5116"
FT                   /product="SRP RNA; Bacterial signal recognition particle
FT                   RNA"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            169072..169482
FT                   /locus_tag="Arad_0187"
FT   CDS_pept        169072..169482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0187"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24941"
FT                   /db_xref="GOA:B9JGU5"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR026026"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGU5"
FT                   /protein_id="ACM24941.1"
FT                   /translation="MKEFTLDDRLANDSVSVTITGLCDVRLSKDSRWPWLVLVPRRPGI
FT                   SEIFELTPLDQVLLTFETNKVAAALKTVTGATKINVGALGNIVRQLHVHVIARFEGDAN
FT                   WPGPIWGHGKAEPYTDEDMNSFIAKLRDTLSQ"
FT   gene            169479..170438
FT                   /locus_tag="Arad_0188"
FT   CDS_pept        169479..170438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0188"
FT                   /product="NTP pyrophosphohydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24942"
FT                   /db_xref="GOA:B9JGU6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015375"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGU6"
FT                   /protein_id="ACM24942.1"
FT                   /translation="MNHSIFSSDAPHPEASSLTAFAENQLNRDAEHRDEETIQRALSKE
FT                   GTHILAFARDKLVLKHDGQVLDPLFARYELQELDPDWEAAVLLGYRKTGEPRLAVPVRI
FT                   NADELASHYKPADMRSLWRDFLLEGEILGEAAQGMSLIRWNSDNRFCGRCGSVMESRIG
FT                   GYKRVCTACEHMIFPRTDPVVIMLTVDEERNLCLLGRSHHFAPGMYSCLAGFVEPGETI
FT                   ENAVRRETHEESGIQTGRVRYHASQPWPMPHSLMIGCYAEAKSTEIHIDATELDDCRWF
FT                   TPEETLEMLDRVSASGNTSPPKGAIAHRLMRDWVEWKR"
FT   gene            170452..171138
FT                   /locus_tag="Arad_0189"
FT   CDS_pept        170452..171138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0189"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24943"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGU7"
FT                   /protein_id="ACM24943.1"
FT                   /translation="MARSERLLTLLQTLRRYRRPVSGAVLAGETGVSLRTLYRDIASLQ
FT                   SQGAMIEGEPGIGYVLKPGFMLPPMMFSQDEIEALVLGSRWVARAADERLAAAGADALA
FT                   KIAAVLPDDMRETVEQATLVVATRRALEDKADLSLMRKAIRSERIVQLTYGDVNGAIST
FT                   RRIWPFALGYFDEVRMVMGWCELRQDFRHFRADRIVDFAVLETRYPRRRVVLAKEWHKQ
FT                   QGMVHD"
FT   gene            171567..171935
FT                   /locus_tag="Arad_0192"
FT   CDS_pept        171567..171935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0192"
FT                   /product="glyoxalase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24944"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR026275"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGU8"
FT                   /protein_id="ACM24944.1"
FT                   /translation="MTSPNLIIFYVKDPAESIPFYRDLLGREPAVAAPNFVAFPLDNGF
FT                   TLGLWRRSSVEPQPSAIGSRGELAFMVEGEGAVAAHYKDWKARGLPVAQELTTLDFGPT
FT                   FVVLDPDGHRLRVCEPDK"
FT   gene            complement(172032..172886)
FT                   /gene="pheA"
FT                   /locus_tag="Arad_0193"
FT   CDS_pept        complement(172032..172886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheA"
FT                   /locus_tag="Arad_0193"
FT                   /product="prephenate dehydratase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24945"
FT                   /db_xref="GOA:B9JGU9"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGU9"
FT                   /protein_id="ACM24945.1"
FT                   /translation="MTTKTNKISFQGEYGANSDMACRDMFPTMEPLPCQTFEDAFTAVD
FT                   SGEADLGMIPIENTIAGRVADIHHMLPESHLHIVGEYFMPIRFQLMVLPGVKKEEIRTV
FT                   HSHIHALGQCRKIVRANGWKPVIAGDTAGAAKLVQETGDRTMAALAPRLAADLYKLDIV
FT                   AENVEDTEDNVTRFVILSREEKWAERSSPEEKIVTTFVFNVRNIPAALYKALGGFATNG
FT                   INMTKLESYQLGGRFVATQFYADIEGHPTDANVQRALEELRFFSEKVRILGVYKGHPMR
FT                   GQL"
FT   gene            complement(172911..173666)
FT                   /gene="kdsB1"
FT                   /locus_tag="Arad_0195"
FT   CDS_pept        complement(172911..173666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdsB1"
FT                   /locus_tag="Arad_0195"
FT                   /product="3-deoxy-manno-octulosonate cytidylyltransferase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24946"
FT                   /db_xref="GOA:B9JGV0"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9JGV0"
FT                   /protein_id="ACM24946.1"
FT                   /translation="MTDSNLDKTLVLIPARMASTRLPGKPLADICGLPMIVQVAKRARE
FT                   AAIGRIVVAVDHDDTYAAVANAGFDVVMTGMDHQSGSDRIHEALRAVDPDGRAEIIVNV
FT                   QGDLPTIDPETIRASLRPLENPAVDIATLTVEIKDEEEKTLPSVVKVVGSAISESRLRA
FT                   LYFTRATAPYGKGPLYHHIGLYTYRRAALERFVSLGPSPLEKRESLEQLRALEAGMRID
FT                   VEIVDTIPLGVDTAADLEKARRILSGASR"
FT   gene            173818..174405
FT                   /gene="cycM"
FT                   /locus_tag="Arad_0196"
FT   CDS_pept        173818..174405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cycM"
FT                   /locus_tag="Arad_0196"
FT                   /product="cytochrome-c protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24947"
FT                   /db_xref="GOA:B9JGV1"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGV1"
FT                   /protein_id="ACM24947.1"
FT                   /translation="MNSSYVNMGVGALLATLFVLKSVSLASGFIFHSETPEKPGFEIVA
FT                   AEAPAGDAGGKAAEAKETPIAQLLQTADAKVGETIFKKCQACHSGEKGGPNKVGPDLWG
FT                   IVDRPVAEHEGFAYSAAIKGFSKDGAEKWTYDHLYHFVAAPKKFISGTAMGFAGLPKEK
FT                   DRADLIAYLRTLADTPVPLPDPNAAPAPAATN"
FT   gene            complement(174476..175636)
FT                   /locus_tag="Arad_0198"
FT   CDS_pept        complement(174476..175636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0198"
FT                   /product="Patatin"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24948"
FT                   /db_xref="GOA:B9JGV2"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR021095"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGV2"
FT                   /protein_id="ACM24948.1"
FT                   /translation="MNIAAPLTTNPASAYAQKVFVLQGGGALGSYQAGAFEALREQNIE
FT                   PDWIAGISIGAINAAIMAGNVPGERLEKLRSFWNKVSVQMPVDLLMKKQRNTNPFYRTV
FT                   SSWWVSTFGVPGFFSPWQIPSWFQARGSAGATSIYDTEQLRQTLLDHVDFDRINHGPVR
FT                   LSLGAVNVRTGNFAFFDNRDVQIKPEHVMASGALPPGFPAIKIGSEYYWDGGLVSNTPL
FT                   TYVLRNGADVDTVVFQVDLFSAAGPQPQDLEEVEERRKDITYSSRTRLNTDLFLERHRL
FT                   RRTISELYARLPEEAKADPAIQKLKAQCSDYGVTIIHLIYRNKQFRSHSKDYEFSALSM
FT                   HEHWETGLRDARKALLAEDWRVPPNAEDGLKVYDIDQRTRSRRHSV"
FT   gene            complement(175778..176722)
FT                   /locus_tag="Arad_0199"
FT   CDS_pept        complement(175778..176722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0199"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24949"
FT                   /db_xref="GOA:B9JGV3"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGV3"
FT                   /protein_id="ACM24949.1"
FT                   /translation="MSEIFSDVLPVFLLILVGWVIVRTGILTASVGEAMSEFVFKIAVP
FT                   LLLFQTIAEADFRGASPFRLWAAYFAGVAVTWTAGHLVATRLFGRDARIGVLAGVSSAF
FT                   ANTIFVGLPLVGRTVGPDGIMAMSILIAVHLPTMMIAGTLLMEQAERKENGGAGRSTIE
FT                   LLQQVGKNLIRNPLVIGLLGGLVVHLIGIPLPATLGTVVDNIANIAGPAALISLGMALR
FT                   QYGVSGNLGIASVMAAFKLVLLPACVLAASYLLGLSQEWRAALVLTAAVPTGVNAWLIA
FT                   NRFGVGHSLAASTITLTTALGAFSVSLWAYLLG"
FT   gene            177129..178121
FT                   /locus_tag="Arad_0201"
FT   CDS_pept        177129..178121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0201"
FT                   /product="sugar kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24950"
FT                   /db_xref="GOA:B9JGV4"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGV4"
FT                   /protein_id="ACM24950.1"
FT                   /translation="MTRFDVLTVGNAIVDIIARCDDQFLIDNKITKAAMNLIDAERAEL
FT                   LYSRMGPALEASGGSAGNTAAGVANFGGRAAYFGKVAEDQLGEIFEHDIRAQGVHYETR
FT                   PKGTFPPTARSMIFVTEDGERSMNTYLGACVELGPEDVEPDVVADAKVTYFEGYLWDPP
FT                   RAKEAIRECARIAHAHGREVSMTLSDSFCVGRYRGEFLDLMRSGTVDIVFANRDEALSL
FT                   YETEDFDTALQLIAADCKIAAVTTGKDGAVIVRGNERYVVDAHPIEERVDTTGAGDLFA
FT                   AGFLFGYTQGRSLEDCGKLGNLAAAIVIEQIGPRPMKSLSEAAREFGLL"
FT   gene            complement(178202..178819)
FT                   /locus_tag="Arad_0202"
FT   CDS_pept        complement(178202..178819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0202"
FT                   /product="quaternary amine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24951"
FT                   /db_xref="GOA:B9JGV5"
FT                   /db_xref="InterPro:IPR004676"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGV5"
FT                   /protein_id="ACM24951.1"
FT                   /translation="MIVDNIVGILGLAVVLFASTNIDDIFVLLGFFVDPKFRTRQIVIG
FT                   QYLGIAALCGVSLLASMISLVIPAAYIGLLGLAPIFLGLKKLWEWRKGSEIDHDPEDHS
FT                   GASIGHGKIAAVAMVTIANGGDNISIYTPLFATRTMGEIAVIAVVFTVLTTLWLSAAHF
FT                   LINHPRIGAPIRRYGHRVVPFMLVALGTLILYEAGTIRLLCR"
FT   gene            complement(178900..179439)
FT                   /locus_tag="Arad_0203"
FT   CDS_pept        complement(178900..179439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0203"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24952"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR010466"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGV6"
FT                   /protein_id="ACM24952.1"
FT                   /translation="MRGKVLKSCAVFAIGLMMAGATADLAAAQAAKGPSGLPLPRFVTL
FT                   KSKRVNLRVGPSADYAVSWLYLKQGLPVEIIQEYDNWRRVRDADGTEGWVNQSLLSGQR
FT                   SALAAPWMKGKGKAVFVNMRRDAQPSGTVIAKLQPGVMMNVRECTGDWCLATADGTEGW
FT                   VAQSEIWGAYPGEAFK"
FT   gene            179630..180631
FT                   /locus_tag="Arad_0205"
FT   CDS_pept        179630..180631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0205"
FT                   /product="D-2-hydroxyacid dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24953"
FT                   /db_xref="GOA:B9JGV7"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGV7"
FT                   /protein_id="ACM24953.1"
FT                   /translation="MTTKKKPKVYVTRKLPDAVETRMRELFDAELNIDDVPRTQAELAE
FT                   AVRTVDVLVPTVTDRIDAALIEEAGPQMKLIASFSNGTDHIDVEAAARKGITVTNTPNV
FT                   LTEDTADMTMALILAVPRRLAEGARVLTDKPGEWAGWSPTWMLGRRIHGKRIGIVGMGR
FT                   IGTAVARRAKAFGLSIHYHNRKRVSTATEDELEATYWDSLDQMLARVDIVSVNCPSTPA
FT                   TFHLISARRLALLQPTSYIVNTSRGDVIDETALIKILREGKIAGAGLDVFENEPAVNPK
FT                   LVKLANEGKVVLLPHMSSATLESRIDMGDKVIINIRTFIDGHRPPNRVLPFR"
FT   gene            180717..181529
FT                   /locus_tag="Arad_0206"
FT   CDS_pept        180717..181529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0206"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24954"
FT                   /db_xref="GOA:B9JGV8"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGV8"
FT                   /protein_id="ACM24954.1"
FT                   /translation="MLETDKVFAGSIPENYDRYMVPLIFEPFAVDLARRAASLAPSAVL
FT                   EIAAGTGVVTRLLAPKLSSDASYIVTDLNQPMLDYAASRQGPDSRIQWHQADAMALPFE
FT                   DAAFDLVCCQFGAMFFPDRVSAYREAKRVLKPGGHFLFNVWDRIEENVFANDVTNALAE
FT                   MFPKDPPRFLARTPHGYHDTALIRSELEEAGFSRVMIETRAEQSRASSPRIPAVAYCQG
FT                   TLLRNEIEAREAGKLNAATDYATSVITGRHSEGAVAAKIQAHVIVAVA"
FT   gene            complement(181539..182018)
FT                   /locus_tag="Arad_0207"
FT   CDS_pept        complement(181539..182018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0207"
FT                   /product="acetyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24955"
FT                   /db_xref="GOA:B9JGV9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGV9"
FT                   /protein_id="ACM24955.1"
FT                   /translation="MSDVTIQCLDDSFEHWDELLALILSSFAYMNGRIDPPSSALSLTP
FT                   QSLKEKAGTEISYIALDGNRLAGCIFCRPEAESLYIGKLAILPSEQGKGIGRQLLTLAE
FT                   TTALERGLNALRLETRIELTDNHATFARWGFRKTAENRHAGFDRTTSIEMRKTLI"
FT   gene            complement(182015..182785)
FT                   /gene="moeB"
FT                   /locus_tag="Arad_0208"
FT   CDS_pept        complement(182015..182785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moeB"
FT                   /locus_tag="Arad_0208"
FT                   /product="molybdopterin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24956"
FT                   /db_xref="GOA:B9JGW0"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGW0"
FT                   /protein_id="ACM24956.1"
FT                   /translation="MDPLTPDEIARYQRHILLPEVGGAGQQKLKAARVLVIGAGGLGAP
FT                   VLQYLAAAGVGTIGIADDDRVSLSNLQRQVIHDTGTIGELKTQSAADAIARLNPHVRTI
FT                   RFEERFSTETAARHLAGFNLVVDGSDNFDTRYAAADAAELARLPLVTGAVGRFDGSVTT
FT                   LKPYEDGADGALNPGYRDLFPTPPPEGLIPACAETGIIGALTGVIGTLMAMEAIKLITG
FT                   TGEPLIGRLLLYDGLAARFDTIRYRRKRARAAAE"
FT   gene            complement(182823..183950)
FT                   /gene="recF"
FT                   /locus_tag="Arad_0209"
FT   CDS_pept        complement(182823..183950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="Arad_0209"
FT                   /product="DNA replication and repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24957"
FT                   /db_xref="GOA:B9JGW1"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9JGW1"
FT                   /protein_id="ACM24957.1"
FT                   /translation="MPHKVFISRLKLTDFRNYAAAALTLDERHVVLTGDNGAGKTNLME
FT                   AVSLLSPGRGLRRAAYADVVRVAAPNGFSIFAELEGMEDTVEIGTGVDTSDETTARKLR
FT                   INGTPAKTVDELTDHLRVLWLTPAMDGLFTGGSSERRRFLDRLVLSLDPAHGRRASDFE
FT                   RAMRSRNRLLSESRFDPSWLAGIEEQMASLGIAMALARQEMLGLLTRLIAETREATPFP
FT                   SAALELSGFLDGQFDRPALDLEDAYAGMLREGRYRDAAAGRTLDGPHRTDLLVRHREKD
FT                   MEAERCSTGEQKALLVGLILAHARLVGNLTGHAPVLLLDEIAAHLDEGRRAALFDLIDR
FT                   LGGQAFMTGTDRAMFSALGERAQFFTVAHGGITKS"
FT   gene            complement(184247..185395)
FT                   /gene="dnaJ1"
FT                   /locus_tag="Arad_0210"
FT   CDS_pept        complement(184247..185395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ1"
FT                   /locus_tag="Arad_0210"
FT                   /product="molecular chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24958"
FT                   /db_xref="GOA:B9JGW2"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9JGW2"
FT                   /protein_id="ACM24958.1"
FT                   /translation="MAKADYYETLGVSRTADEKELKSAFRKLAMQFHPDKNPDDNDAER
FT                   KFKEINEAYETLKDPNKRAAYDRYGHAAFEHGGMGGGGFGGGGFGGGGGFSDIFEDIFG
FT                   EMMGGGRGRARSSGGRERGADLRYNMEISLEEAFTGKTAQIRVPTSITCDVCSGSGAKP
FT                   GTQPKTCGTCQGSGRVRAAQGFFSVERTCPTCHGRGQTIPDPCGKCHGQGRITEERSLS
FT                   VNIPSGIEDGTRIRLQGEGEAGTRGGPSGDLYIFLSVKPHEFFQRDGADLYCAVPISMT
FT                   TAALGGTFDVATLDGTKSRVTVPEGTQVGKQFRLKAKGMPVLRSSQVGDLYIQIQIETP
FT                   QKLTKRQRELLQEFEQISSKDNNPESTGFFARMKDFFDTFSD"
FT   gene            complement(185479..187443)
FT                   /gene="dnaK"
FT                   /locus_tag="Arad_0212"
FT   CDS_pept        complement(185479..187443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="Arad_0212"
FT                   /product="chaperone protein (Heat shock protein 70)"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24959"
FT                   /db_xref="GOA:B9JGW3"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGW3"
FT                   /protein_id="ACM24959.1"
FT                   /translation="MPDRGSDSLLQGENDMAKVIGIDLGTTNSCVAVMDGKDAKVIENA
FT                   EGARTTPSMVAFTEDGERLVGQPAKRQAVTNPTNTLFAVKRLIGRRYEDPTVEKDKHLV
FT                   PFNIVKGDNGDAWVEAHGKGYSPAQVSAMILQKMKETAEAYLGEKVEKAVITVPAYFND
FT                   AQRQATKDAGRIAGLEVLRIINEPTAAALAYGLDKKDGKTIAVYDLGGGTFDISILEIG
FT                   DGVFEVKSTNGDTFLGGEDFDMRLVEYLVAEFKKDNGIDLKGDKLALQRLKEAAEKAKI
FT                   ELSSAQQTEINLPFITADATGPKHLTLKLTRAKLESLVDDLVQRTIAPCKAALKDAGVT
FT                   AAEIDEVVLVGGMSRMPKVQEVVKQLFGKEPHKGVNPDEVVALGAAIQAGVLQGDVKDV
FT                   LLLDVTPLSLGIETLGGVFTRLIERNTTIPTKKSQTFSTADDNQSAVTIRVSQGEREMA
FT                   ADNKLLGQFDLVGLPPAPRGMPQIEVTFDIDANGIVQVSAKDKGTGKEQQIRIQASGGL
FT                   SDADIEKMVKDAESHAAEDKKRREGVEAKNQAESLIHSSEKSLKDFGDKVTEADRNAIS
FT                   EAIAALKTATEASEPDAEDIKAKTQTLMEVSMKLGQAIYEAQQSEAPSADASAGGHHDD
FT                   VVDADYEEIKDEDDRKRSA"
FT   gene            complement(187692..190064)
FT                   /locus_tag="Arad_0213"
FT   CDS_pept        complement(187692..190064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0213"
FT                   /product="penicillin binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24960"
FT                   /db_xref="GOA:B9JGW4"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGW4"
FT                   /protein_id="ACM24960.1"
FT                   /translation="MAGKSRSSQRIEPSFSSGKERSDDGFSAGERIAGGGRSSGRESSK
FT                   RDSSPEPDKPRRSSRRRKQQRRRSGGGFFGFIRSAIYWGIVLSIWAGIGLAGLVVYYGS
FT                   RMPSASTWAIPERPPNVKIADLDGSIIANRGTTGGEALALSDMSPYIPEALIAIEDHRF
FT                   YSHFGFDPIGLGRAVVTNVLTGHAVQGGSTLTQQLAKNLFLSPDRTLERKVQEVLLAIW
FT                   LEHKFTKDQILAMYLNRVYFGSNAYGVEAASRRYFNKSARDVNLGEAAMLAGLVKAPSK
FT                   LSPARDPAAAEARAQLVLQAMRDQGFISEADIKTAMSQPPTRAKSYWSGAENYVADMVM
FT                   GQLPGLIGGDVKEDLTVDTTIDMSLEEKAEQALNDVLAKDGKKLSASQASLVSVDATGA
FT                   IRALVGGRDYAQSQFNRAVTAKRQPGSAFKPFVYTAALEMGLTPNSIRNDAPVKIGNWA
FT                   PENYEQKYSGPVTLATAVAHSLNTVAAQLATEVGPDQVIKVAHRLGIESDLQANASIAL
FT                   GTSEVSLLELTSAYASFMNGGFKATPHVITKVTTASGKVLYQANFDNPPRVLNPDVVTN
FT                   MNAMMAGVINFGTGKSARIPGWQAAGKSGTTQSFRDALFVGFTSHLTTGVWFGNDDGKS
FT                   MKKVTGGGLPAKAWKEFMVAAHKGLSPTPIFGGGQIIDNSVPMAQSAPGANQPATIDGI
FT                   ISGTLGGDGGQVAHQGQPTLQQRPAQQPIQQQGNQTAANDDLEDLPPANLANDNNPYSA
FT                   NSYDTGDIPPADIGDTAPTPATARPHRTSLLDVILGR"
FT   gene            190422..190610
FT                   /locus_tag="Arad_0214"
FT   CDS_pept        190422..190610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24961"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGW5"
FT                   /protein_id="ACM24961.1"
FT                   /translation="MSSHIAIEKVGETKLREVWSVEDFARRHRICKDEEVRLKKLFGDF
FT                   ATKQELLSNAQRPPLFR"
FT   gene            191075..191317
FT                   /locus_tag="Arad_0216"
FT   CDS_pept        191075..191317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0216"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24962"
FT                   /db_xref="InterPro:IPR010385"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGW6"
FT                   /protein_id="ACM24962.1"
FT                   /translation="MRHIKWSNPIEIGFTQGSFQTVTGPSEALNCMANLWPDRRGPFYV
FT                   AARSVCRAAIDGRKSAEEAREIFISAMREAHLKTH"
FT   gene            complement(191538..192458)
FT                   /locus_tag="Arad_0219"
FT   CDS_pept        complement(191538..192458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0219"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24963"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGW7"
FT                   /protein_id="ACM24963.1"
FT                   /translation="MRHKLLAAFTLTALVALPALAQAAEGFATANVNMRSGPSTQYPAV
FT                   TMIPAGVPLEINGCLNETPWCDVSFVGGRGWVAGRYIQATYQSRRIYVGPQYYRPLGIP
FT                   TITFNVDDYWGRYYRGRDFYRDRDRWRRGPGWSDRRPDSGWDRRPDRNPGWDNDSDRNW
FT                   DRRPDRNRDWSNQPDNNQDWGQQRRDRNRDWGNQQDNNQDSGQQRRDRNRDWNRQPDDN
FT                   QGWGGGNRQDRRRDDNRQDNQQRRPEPQPQQAQPQPQAQPQPQPQRQDNRRPNAGAPGP
FT                   YSPDHVDPCPASQPDCRMTPRGFNR"
FT   gene            complement(193088..193160)
FT                   /gene="suhB"
FT                   /locus_tag="Arad_5114"
FT   ncRNA           complement(193088..193160)
FT                   /gene="suhB"
FT                   /locus_tag="Arad_5114"
FT                   /product="suhB"
FT                   /ncRNA_class="other"
FT   gene            complement(193167..194621)
FT                   /gene="nodTch"
FT                   /locus_tag="Arad_0222"
FT   CDS_pept        complement(193167..194621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nodTch"
FT                   /locus_tag="Arad_0222"
FT                   /product="nodulation protein (outer membrane efflux
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24964"
FT                   /db_xref="GOA:B9JGW8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGW8"
FT                   /protein_id="ACM24964.1"
FT                   /translation="MVSIRTAAPALLLFLAGCVSGPDHKPPEMPLPAKFSEGGTKINGD
FT                   LAGSQWWTAFGDSKLNAFAAQGLAENLNIQQALERINQAQAAVITAGAGGLPSLTASGD
FT                   HTTNGQKGSLRTQSETQNSTTGGASVSWLLDLWGQYRRAKEGAVASLDAAYSSVDTARL
FT                   TYLQDLANSYVNARYYQARISIAQDNLKSRRETLALTKFQLEAGAASRLDVVQAEGLVN
FT                   STLSEVPGLEISYRQSVHHIATLLNVSSATVIAQMQGGGRQPVFRGRVNSGIPADLIRN
FT                   RPDIRVAERNLANATAQIGVAEAQLFPTITLSGAISPSYVHTSSRSGSLTTWSFGPTLT
FT                   LPIFDGGALRANVKTAESSSRELYIVWQQTVRSAVEDVENALSAVSRDAQTVSALRAQV
FT                   KSYQEALQLSTASYKDGASSLLDVLDAQRNVSTAQESLATAIQQSAIDYISLNVNIGAG
FT                   YVPAEKGPVAAKSAKVVKVAEKKAVN"
FT   gene            complement(194973..195962)
FT                   /gene="purC"
FT                   /locus_tag="Arad_0223"
FT   CDS_pept        complement(194973..195962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="Arad_0223"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24965"
FT                   /db_xref="GOA:B9JGW9"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGW9"
FT                   /protein_id="ACM24965.1"
FT                   /translation="MKRPRGGCTSPLVTVLRILSEAHFPELPNYYRGKVRENYDLPDGS
FT                   RIIISTDRLSAFDRILTCIPYKGQVLTQTARYWFEATKDICPNHVIAYPDPNVVVGKRL
FT                   DILPVEVVVRGYLAGTTGTSILTLYKKGQREMYGITLPDGMRDNQILPTPIITPTSKEF
FT                   DGGHDEPLTPTQIVEGGLLTSEQWQTLSDYALALFARGQEIASKQGLILVDTKYEFGTD
FT                   ENGTIILADEIHTPDSSRYWLADSYQDSFDKGTRPASFDKDFVRAWVAERCDPYKDEIP
FT                   EIPLDLVEQTSKVYIRAYEAITGKSFVPDDRGATPRDRVRASLERYFP"
FT   gene            complement(196031..196711)
FT                   /locus_tag="Arad_0224"
FT   CDS_pept        complement(196031..196711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0224"
FT                   /product="purine/pyrimidine phosphoribosyltransferase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24966"
FT                   /db_xref="GOA:B9JGX0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGX0"
FT                   /protein_id="ACM24966.1"
FT                   /translation="MQPHDFWQELHPPKSFPTSGEFRDVYVAELPDGRQLRLPIRMLAD
FT                   GEHALASLIINQAGFSVQEALAQALAERIAAYDIDVVAGLPTLGLTLASAVARALGHDR
FT                   YVPLGTSRKFWYREELSVPLSSITTPNQEKRLYVDPRMLPLLEGKRVALIDDVISSGAS
FT                   IVSGLELLSACAIEPVVIGAAMLQSERWREQVDASGTTWSERIVGVFSTPILDRTENGG
FT                   WRRP"
FT   gene            complement(196698..197534)
FT                   /locus_tag="Arad_0226"
FT   CDS_pept        complement(196698..197534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0226"
FT                   /product="pseudouridylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24967"
FT                   /db_xref="GOA:B9JGX1"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGX1"
FT                   /protein_id="ACM24967.1"
FT                   /translation="MSQRHSPQRSGKPAKGRQESDGKRVTLPRALSKLGYCSRTQAEAL
FT                   IAAGRVTVDGREITDPTAWIDLDRARIAVDGEAIAAEKKLYFMLNKPRGLVTTRDDPEG
FT                   RPTVYDCLRDIDARHLAPVGRLDKASEGLLLFTNDTVLAQALLDPISHVGKIYHVQVNT
FT                   IMEQELLDRMERGVIDDGELLTATAARLLRSGDRNGWIEVELKEGRNRQIRRMLEVLGV
FT                   ECLRLVRVAFGDIALGDLAKGAVRALTEAEVLGLRRRAGMEKTGRNGMKAGRNAAP"
FT   gene            197878..198597
FT                   /locus_tag="Arad_0228"
FT   CDS_pept        197878..198597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0228"
FT                   /product="two-component response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24968"
FT                   /db_xref="GOA:B9JGX2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGX2"
FT                   /protein_id="ACM24968.1"
FT                   /translation="MASASLLLVEDDREIRALLEEFLTREDYTVEAVDSAAAMDRALAR
FT                   GFPDLIILDLMLPGEDGLSACRRIRTRSRVPILMLTAKSEDIDRILGLEMGADDYLGKP
FT                   FNPRELLARIRAILRRAGPERPEEVVGSRRRKSFAGLIVDLDGRAIEVEGEGPMRLTTA
FT                   EFDLLVCFLERPRRVLSRDQLLDWTRGRGADPFDRTIDVTVSRLRTKLAQYLPDGAQII
FT                   TTVRNAGYLLTADVRDV"
FT   gene            198601..199956
FT                   /locus_tag="Arad_0229"
FT   CDS_pept        198601..199956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0229"
FT                   /product="two-component sensor histidine kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24969"
FT                   /db_xref="GOA:B9JGX3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGX3"
FT                   /protein_id="ACM24969.1"
FT                   /translation="MLKLGLVSRIIMIVAVALFIIQLAAFVAASLKPDTPLSHEFSPAT
FT                   QIKSTLRLLDAIPPETQEQAVRALNAAGLDLRLADIVTPAPNDAATDPALDRKLARDYA
FT                   SMALGNRYFRLRALPERPQGSWFSVGASDRTIEVSIGLTSGKVAVFNLADTPTVRLYGM
FT                   PVGFMAGLLGVLVAVIAIVAVARETRPLTRLSRTVNSIGKGLQPINIPERGACELRLLI
FT                   RAINGMQLRIAALVNNRTLILGAISHDLRTYLTRFRLRMEMMPDTPHRERAIADVEAMQ
FT                   RLVEEALGFARSTVVSAGRDITDLDGTVRTLVAERQDAQGLVSFSPLGRELEVTIPQTA
FT                   LARVLDNLIDNALRYGASADVRVECRGDHAAVIIGDRGPGIPAERRKDVLEPFIRLEES
FT                   RNRDLGGSGLGLTIVRQILDTHNGALCLEDRSGGGLDAIILLPLAVSDRIAA"
FT   gene            complement(200016..200222)
FT                   /locus_tag="Arad_0230"
FT   CDS_pept        complement(200016..200222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0230"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24970"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGX4"
FT                   /protein_id="ACM24970.1"
FT                   /translation="MDTTSSKSIVEVSVDSAAGRKALGIMNMRQALDLPDLPSFTYTHP
FT                   DPRKAAAGVVVSREELARFLTCH"
FT   gene            200995..202503
FT                   /locus_tag="Arad_5103"
FT   rRNA            200995..202503
FT                   /locus_tag="Arad_5103"
FT                   /product="16S ribosomal RNA (operon 2)"
FT   gene            202784..202857
FT                   /locus_tag="Arad_5004"
FT   tRNA            202784..202857
FT                   /locus_tag="Arad_5004"
FT                   /product="tRNA-Ile"
FT   gene            202987..203059
FT                   /locus_tag="Arad_5005"
FT   tRNA            202987..203059
FT                   /locus_tag="Arad_5005"
FT                   /product="tRNA-Ala"
FT   gene            203785..206406
FT                   /locus_tag="Arad_5104"
FT   rRNA            203785..206406
FT                   /locus_tag="Arad_5104"
FT                   /product="23S ribosomal RNA (operon 2)"
FT   gene            206539..206657
FT                   /locus_tag="Arad_5105"
FT   rRNA            206539..206657
FT                   /locus_tag="Arad_5105"
FT                   /product="5S ribosomal RNA (operon 2)"
FT   gene            206801..206874
FT                   /locus_tag="Arad_5006"
FT   tRNA            206801..206874
FT                   /locus_tag="Arad_5006"
FT                   /product="tRNA-Met"
FT   gene            207604..209547
FT                   /gene="mcpCf"
FT                   /locus_tag="Arad_0232"
FT   CDS_pept        207604..209547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcpCf"
FT                   /locus_tag="Arad_0232"
FT                   /product="methyl accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24971"
FT                   /db_xref="GOA:B9JGX5"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGX5"
FT                   /protein_id="ACM24971.1"
FT                   /translation="MALIQHKIIVASAAIFALAGGATGVGLWSATTLAQNNAEVARSSQ
FT                   VLRNHMQADMMHDALRADVLASLLAANPAAGIGADAVKADLAEHETSFHDMIAANKKLA
FT                   TDKTTQDVLAKIEAPLLTYIDSATKMVDLAAKDQTAALKSLPDFMNQFSALESAMEQAG
FT                   EQISSVSEATAKRSADMQVLVDTLMKALLALAALFSFSLYWLTRRTVTKPILMLSNDMQ
FT                   ALADGNTDIACSAIGRSDEIGTMGSAVEIFRQAAIANRKLEQDAEAARTQAEADRIAAR
FT                   RQADEEAAERLRAATSGLAAGLKRLAGGDLAFQLQEPFSPDFEALRQDFNSSVKQLGDA
FT                   LGAISTGIAAIDDGTREISSAANDLSKRTEQQAASLEETAAALDQITANVSNSSSRTEE
FT                   ARTAATQANRSAAKSAEVVSHAEEAMRRIEASSQQISSIIGVIDEIAFQTNLLALNAGV
FT                   EAARAGEAGKGFAVVAQEVRELAQRSAQAAKEIKGLIQKSSSEVESGVKLVMDTGASLK
FT                   TIGEQIAEINQHMNAIATSAKEQSTGLAEVNTAVNSMDQTTQQNAAMVEQSTAASASLA
FT                   MEAAKLRDLVSQFKLQAMASAQSSALRQTARALAAPAWQDSGTSMPRPRRVAVSGNGSS
FT                   AAANIQNEWEEF"
FT   gene            complement(209635..210693)
FT                   /gene="potA"
FT                   /locus_tag="Arad_0233"
FT   CDS_pept        complement(209635..210693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potA"
FT                   /locus_tag="Arad_0233"
FT                   /product="spermidine/putrescine ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24972"
FT                   /db_xref="GOA:B9JGX6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGX6"
FT                   /protein_id="ACM24972.1"
FT                   /translation="MTVSLSIEAITAHYGNTAVLQDLSLSIAAGELVSLLGSSGCGKTT
FT                   TLRLVAGFLQPTSGTIRLGDQDLTRLPAHARNIGLVFQNYALFPHLTVLDNVAFGLKQR
FT                   GIATAARSKKAGEMLERVGLSGFSDRLPSALSGGQKQRVALARALVIEPPLLMFDEPLS
FT                   NLDAKLRIDMRVEIRQLQRANGTTSLYVTHDQEEAFSISDRVAIMNAGRIMQLDTPEVL
FT                   YQKPANAFVARFVGFENLLAMRVVERNGTSVTAEAKGGARITLSQDDYGPIPDNFILAC
FT                   RADGLAVRRDGAGLPAVLGTRTYLGRAYQYQCTTPAGDIVANGALTDALAAGSEAVLVP
FT                   MPEQCCVLAPEQ"
FT   gene            complement(210700..211488)
FT                   /gene="potC"
FT                   /locus_tag="Arad_0234"
FT   CDS_pept        complement(210700..211488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potC"
FT                   /locus_tag="Arad_0234"
FT                   /product="spermidine/putrescine ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24973"
FT                   /db_xref="GOA:B9JGX7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGX7"
FT                   /protein_id="ACM24973.1"
FT                   /translation="MVHRVHPLLIAFAVCVFFFLLAPLVIIIGSAFSDTSYLTFPPQGL
FT                   TLHWFWNIFEIEAFRTTAITSFELAFLGTGLSLLMGIPAAYAISRYRLELPSWLSTLFI
FT                   LPILVPEIVFGFSLMKSITIGLDLPIFASLLIGHALLVLPYSVRVVSASLASFDFSIEE
FT                   AAISLGCSPVKTFMTVVLPNIRAGVIAAFILAFITSINDVSVSVFLTGPGISTLPIQIL
FT                   AHMEQFFDPTIASVSVLLMLVTVGVMAIVEATLGLTFLTK"
FT   gene            complement(211491..212315)
FT                   /gene="potB"
FT                   /locus_tag="Arad_0235"
FT   CDS_pept        complement(211491..212315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potB"
FT                   /locus_tag="Arad_0235"
FT                   /product="spermidine/putrescine ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24974"
FT                   /db_xref="GOA:B9JGX8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGX8"
FT                   /protein_id="ACM24974.1"
FT                   /translation="MKHLAKWGLAAPAMVAVVLFLVVPVVITIAATFMEPKGVFSPYVA
FT                   FFNSGFRRTVLYRTIEIALITTVISLLVGFIAAYVIAQMPGRAKSVMIIAAVFPLLTGV
FT                   VVRSFAWLIILGKNGILNTMLLSVGVISEPLSMLYTEGSVIVAMVYLFVPLMILTLVGV
FT                   LEGIPQDLIQAATSLGATPAATFRQVILPLATPGLIVGAVLVFTGSFTSYATPQLLGGE
FT                   KQMTMGTFLYQRAMVTFDWVGASTIAAIMVVVTIGIVLIMSRIARRLNPMAV"
FT   gene            complement(212356..213396)
FT                   /gene="potD"
FT                   /locus_tag="Arad_0237"
FT   CDS_pept        complement(212356..213396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potD"
FT                   /locus_tag="Arad_0237"
FT                   /product="spermidine/putrescine ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24975"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGX9"
FT                   /protein_id="ACM24975.1"
FT                   /translation="MKGLTLPRVASLALIAATTVALPAYAQATTLTISWWGYNGEKMKV
FT                   NIIEPFKKICGCDVVFETGNNADRLNKLKLRGGKGVDVIYLTDSYSQIGIQQGLFQEVD
FT                   RAKLPNITDLYDLAKAPQGNYGPAYTIGRVGIVYDKAKVNPPITSWSDLWRDDLKSAVT
FT                   LPGITTTAGPLTVLEAGKHAGADAYEDTDKAFEAITALKPNVVKNYNTGSELVNLISTG
FT                   EAKVALAQDFTLASMQAAVPTMTWASLKDGDMATLNTVNIPKGSENVELAHQFINFILS
FT                   KDVQQAEAEQGVDAPVSTKVVLTPDQAKLWTYGADMIAKLGRIDYAKLNAAQSDWIDRW
FT                   NEIFGM"
FT   gene            213669..215546
FT                   /gene="ade"
FT                   /locus_tag="Arad_0238"
FT   CDS_pept        213669..215546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ade"
FT                   /locus_tag="Arad_0238"
FT                   /product="adenine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24976"
FT                   /db_xref="GOA:B9JGY0"
FT                   /db_xref="InterPro:IPR006679"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR026912"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGY0"
FT                   /protein_id="ACM24976.1"
FT                   /translation="MASLPTNLPDDLLINAADEVLIRQDLTLTALGRRPADRLLRVGRL
FT                   LDVHSRTWLEDQEIVIKGRRIAYVGPAGSYTGEVGERLSEPHLAAVPGFGEAHKHIESS
FT                   HLTPEWEAALVMPHGVTWTCEASHEFSNVNGLRNLEFWLEARRRGSPMKIFPLPGSAVP
FT                   PTAYEWGGGHFGYDEQKAFLSESLMVAGLDEVMDWPSVSNPENPAYDRLWGMIRATFEQ
FT                   RGVVEGHGAGLRDLASINAFAGAGLASDHEGWFLDEIWEKLTHGLFIELRPHSLPEVIK
FT                   GLIEKSLSDWSQIAFVTDDRSASDTLKMGATDYNVRLAIENGLAPEIAIQCVTINPARH
FT                   MRLTPWVGSIAPGRFADIVLLDDVETLSIAKVWADGRPASEGKSFVGIRPEIAWPDWAT
FT                   KTVKIDRTVLPEDFRIAAPSNAPTAKAALLRPFHWADEFITMDLPVADGAVQRDHDRNV
FT                   TKFAIVDRFSGEAKVARMFWLGTGPRTPDTALGATLGHDKHNIWVVGSSDEAMAMVANA
FT                   LNEQQGGWVLVSGGKVVARVHYEVGGLMTARPAEELDAEMQALYKAGAEIDWMYEPTFS
FT                   PRWWPGFPERLSFATLTCAPWRWVLVAPSERAPEGFVNVATGETHPIVW"
FT   gene            215805..216644
FT                   /locus_tag="Arad_0239"
FT   CDS_pept        215805..216644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0239"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24977"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGY1"
FT                   /protein_id="ACM24977.1"
FT                   /translation="MTLAFSTLGCAELELDEALALAARHGLDAIEIRALGGTIDLSAYF
FT                   TERFGTPAGLAQALDRSPVAVCALNTSLRLVGATPEAKEAFLRYLPWAEAAGIKSLRVF
FT                   DGGTTGDAGELAEAFSTLGWWRETARREGFAADMVVETHDVLVRSETIGRFLEAAPDCA
FT                   LIWDTHHTWRKGGQDPVETWKQVRHNTRHLHVKDSVSQPSEKLPYSYALPGTGEFPMAA
FT                   LLSVLAADRYAGVMSLEWERLWHMQLPPLDLALQEARKRDWWPRSNPDDQLSSDFAH"
FT   gene            216908..217780
FT                   /locus_tag="Arad_0240"
FT   CDS_pept        216908..217780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0240"
FT                   /product="kinase/esterase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24978"
FT                   /db_xref="GOA:B9JGY2"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGY2"
FT                   /protein_id="ACM24978.1"
FT                   /translation="MFRTRLRRFKARGLPIEFPPAVDPSAIGGLMPARSKQSDSAHNAL
FT                   ILKAIAGGGLSFAIQQVHKIENISNILYAESLARVTDTEGVVHTASSFVPQLHDGFNLD
FT                   LRILDMVLSALAADTTLILGCNLTAANLSASDRFADIFGRITRHPELSSRLVVEITETH
FT                   PLVGAAIERLKMIRALGCRIAIDDFGVGFATPANLLQVSADIVKIDASFVRDNRSGRDG
FT                   RDSLYHMVGFASCIAPVVVVEGIETQAQFEAARTAGATHVQGFLLSRPAWLPRPRQEKS
FT                   KFSSRGGER"
FT   gene            217777..218367
FT                   /locus_tag="Arad_0241"
FT   CDS_pept        217777..218367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0241"
FT                   /product="Two component response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24979"
FT                   /db_xref="GOA:B9JGY3"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGY3"
FT                   /protein_id="ACM24979.1"
FT                   /translation="MKRPSFARDYGFSAAMTARDVQPRARLDVLFEELRDLFSGAGNTP
FT                   PVALMGGGDPHIAIRTGSRNISARVTIDAENGLYVFCELDRTAGIVLATASEERLIDEI
FT                   VAHLSAGDDDLVPRTIDSAVGILVGQTMEDVERKLILQTLRHCSGNLTHTAFMLGISLT
FT                   ALCRKLAVYFPDTAKDLSKGTTDVARRAEGDRR"
FT   gene            218417..218935
FT                   /gene="rosR"
FT                   /locus_tag="Arad_0242"
FT   CDS_pept        218417..218935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rosR"
FT                   /locus_tag="Arad_0242"
FT                   /product="transcriptional regulator protein-nodulation
FT                   competitiveness determinant"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24980"
FT                   /db_xref="GOA:B9JGY4"
FT                   /db_xref="InterPro:IPR008807"
FT                   /db_xref="InterPro:IPR041920"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGY4"
FT                   /protein_id="ACM24980.1"
FT                   /translation="MDDDMTQSREAKHAGPNEIRETIMDAFSSKKDLTQLQASSLSDGC
FT                   VKIVSAYVSHNTVPIGSLSKLITDVHEALQTLDGTTPSVERSKPVPAVDLKKSVTNDYI
FT                   ICLEDGKRFKTLKRHLRVHYGMTPEEYRQKWGLAPTYPMVAQNYANRRSELAKLSGLGA
FT                   NGNKKDSVR"
FT   gene            complement(219120..220727)
FT                   /gene="pit"
FT                   /locus_tag="Arad_0243"
FT   CDS_pept        complement(219120..220727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pit"
FT                   /locus_tag="Arad_0243"
FT                   /product="phosphate transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24981"
FT                   /db_xref="GOA:B9JGY5"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGY5"
FT                   /protein_id="ACM24981.1"
FT                   /translation="MVDVASSNAEGGNANHPIHGAGGSAKWFLPLFGVVVLGGLGYVGY
FT                   ALGNDLAEAATVPWILLGLALLIALGFEFVNGFHDTANAVATVIYTRSMPAEFAVIWSG
FT                   FFNFLGVLTSSGAVAFGILALLPVELILQVGSGSGLAMVFALLIAAIVWNLGTWYLGLP
FT                   ASSSHTLVGSIIGVGLANQFLAPAGSATSGVDWSQASSVGLSLLLSPLIGFGLAALLLL
FT                   VSKALIRNKALYEAPKGNAPPPLWIRTLLIFTCTGVSFAHGSNDGQKGMGLIMLILIGL
FT                   VPTAFALNRTPDINYLEAYKAASTQVESVLGKYVKPGVAAPADPKAAVSDAVKNKTWTD
FT                   TTTPALQAYIHATGIEIASYPSVEKLPNGLVGNVRNDIYLIGEALKLIDKRKLLPMGAD
FT                   DLKAVTQYHAAVDNATKFIPLWVKVAVALALGLGTMVGWKRIVVTVGEKIGKTHLTYGQ
FT                   GAAAEVVAMLTIGAADHLGLPVSTTHVLSSGVAGTMAANGSGLQWSTVRNMLMAWILTL
FT                   PASIALAFTLFIVLRQVF"
FT   gene            221007..221333
FT                   /locus_tag="Arad_0244"
FT   CDS_pept        221007..221333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0244"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24982"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGY6"
FT                   /protein_id="ACM24982.1"
FT                   /translation="MRLSVFAIAAVLGGLAVSSAEAMPVSATGSIPAVVRTAAEAPVVK
FT                   VDYACGRGWRLTRWGECRPRRWGPPRGYGYYRPAPPPPWGYYGHRPHRDRWERDGWRER
FT                   RRDW"
FT   gene            complement(221375..222040)
FT                   /locus_tag="Arad_0245"
FT   CDS_pept        complement(221375..222040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0245"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24983"
FT                   /db_xref="GOA:B9JGY7"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGY7"
FT                   /protein_id="ACM24983.1"
FT                   /translation="MTRSMHPAHGFMRGKCLTGCGALLWLICLMALGWPISVAAHGGGS
FT                   SGSQAGIPIPSLTHGEMAVIDPYYRRIVALAAAATDTDETFRRVLNFAQIQRSYCLWGV
FT                   MPGGISDEESPFNECSHAYLAAAKAVLLRMRTMKDEMVAAGDLVSEIDADLVRNNLSLI
FT                   LCRFSGESFNTADLIRPRLSDIVVHAKSLATILLALLAMAVGMWWTARALRTKPLTTK"
FT   gene            complement(222042..222782)
FT                   /locus_tag="Arad_0246"
FT   CDS_pept        complement(222042..222782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0246"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24984"
FT                   /db_xref="GOA:B9JGY8"
FT                   /db_xref="InterPro:IPR012666"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGY8"
FT                   /protein_id="ACM24984.1"
FT                   /translation="MVGRLLLRGMLVGALAGILIFIYARIFGEPLVDWAIGFEEKVAQA
FT                   AGEASEPEIVSRATQAGVGLLIGSLIYATAVGGLFALVFAFVYGRISSLGARGTAALLA
FT                   IAAFVAISLVPDLKYPANPPAVGNPDTIGARTELFFVMIVASIVGMIVAVGFGRRLVAR
FT                   YGSWNGVILAGIGYFVFIALIQYLLPPINEVPEQFSAIVLWQFRITSLGMHAILWATLG
FT                   LAFGAWAERDLPQVRYGRTALRRA"
FT   gene            complement(222795..223004)
FT                   /locus_tag="Arad_0247"
FT   CDS_pept        complement(222795..223004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0247"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24985"
FT                   /db_xref="GOA:B9JGY9"
FT                   /db_xref="InterPro:IPR012667"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGY9"
FT                   /protein_id="ACM24985.1"
FT                   /translation="MSDTAFAPSAIPTPIPLGQILPWAIFAGLLMLLAIYFVGAEEGAT
FT                   SLISGMYVHEFVHDARHLLGFPCH"
FT   gene            223244..223810
FT                   /locus_tag="Arad_0248"
FT   CDS_pept        223244..223810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0248"
FT                   /product="phosphoglycerate mutase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24986"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGZ0"
FT                   /protein_id="ACM24986.1"
FT                   /translation="MRAHLSWVCHGPTEANRNSRFPADEPLEAKAAQHARILAEQLGTV
FT                   DRAWSSPALRARQTAAALGLDGVAEPAFSECDYGRWRGKSIADLNNSDPEALALWMLDL
FT                   DAAPHGGEALSAVFARVGGWMKDHIGDSGHTVVVTHATVIRVAILHMLQAPPSAFWSID
FT                   VEPLGIVEMTSDGRRWQLRFPNVLR"
FT   gene            complement(223894..224724)
FT                   /locus_tag="Arad_0251"
FT   CDS_pept        complement(223894..224724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0251"
FT                   /product="cytochrome oxidase complex biogenesis factor
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24987"
FT                   /db_xref="GOA:B9JGZ1"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGZ1"
FT                   /protein_id="ACM24987.1"
FT                   /translation="MPALSGVMFPPAFFAPPMEFCALTDIPTDSLSEKPRSTLKLATWV
FT                   ILLLLLTALLIGLGTWQVQRLSWKLDLIARVDARVHAPPVAAPGPAEWSAIDAAGYEYK
FT                   RVEVTGTFLNDKETQVYASTVLGPGYWVLTPMREVDGTVVVINRGFVPTVKRNPDTRPA
FT                   GELSGETTVTGLLRINEPKGTLLRSNVPAEERWYSRDVTAIAEVRGLKNVAPYFIDADD
FT                   TKNPGDLPVGGLTQIAFHNSHLVYAITWYGLSLMTLGLAGYLIRFERQRTKARR"
FT   gene            complement(224752..225153)
FT                   /gene="cyoD"
FT                   /locus_tag="Arad_0252"
FT   CDS_pept        complement(224752..225153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoD"
FT                   /locus_tag="Arad_0252"
FT                   /product="cytochrome o ubiquinol oxidase subunit IV"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24988"
FT                   /db_xref="GOA:B9JGZ2"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR014210"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGZ2"
FT                   /protein_id="ACM24988.1"
FT                   /translation="MSSNNHSHHSADAHGHDHHGGHEASHGTFKSYMTGFVLSVILTAI
FT                   PFWLVMGKVFADPVVTAALIMVFGAIQIIVHMIYFLHMNTKSEGGWNMMALIFTIVLVI
FT                   IALSGSLWVMHHLNANMMVMSPEMMRNMP"
FT   gene            complement(225150..225779)
FT                   /gene="cyoC"
FT                   /locus_tag="Arad_0254"
FT   CDS_pept        complement(225150..225779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoC"
FT                   /locus_tag="Arad_0254"
FT                   /product="cytochrome o ubiquinol oxidase, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24989"
FT                   /db_xref="GOA:B9JGZ3"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014206"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033946"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGZ3"
FT                   /protein_id="ACM24989.1"
FT                   /translation="MTTQTSYALKDGETPAFYLTEEHHPEGSTMLGFWIYIMSDCLIFA
FT                   VLFATYAVLGHNYAAGPSPADLFELPLVALNTAMLLFSSITYGFAMLAMEKGNKSGTMM
FT                   WLAITGLFGAAFIYFELYEFYHLILEGAGPQRSAFLSAFFALVGTHGLHVTVGIVWLIT
FT                   LMVQVSQHGLIPENKRRLMCLSMFWHFLDVVWIGVFSFVYLMGVLG"
FT   gene            complement(225785..227788)
FT                   /gene="cyoB"
FT                   /locus_tag="Arad_0255"
FT   CDS_pept        complement(225785..227788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoB"
FT                   /locus_tag="Arad_0255"
FT                   /product="cytochrome o ubiquinol oxidase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24990"
FT                   /db_xref="GOA:B9JGZ4"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014207"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGZ4"
FT                   /protein_id="ACM24990.1"
FT                   /translation="MFSNPDLYKFIFGRLTLDAIPYHEPILVLTFTGVAIGGIALLSVL
FT                   TYFRLWGYLWKEWFTSIDHKKIGIMYIILALIMLLRGFSDALMMRAQQALAFNGSEGYL
FT                   PPHHYDQVFTAHGVIMIFFVAMPMVTGLMNFVVPLQIGARDVSFPFLNNFSFWMTTAGA
FT                   IIVMISLFIGEFAKTGWLAYPPLSGIAYSPDVGVDYYIWGLQVAGIGTLLSGINLVATI
FT                   VKMRAPGMTMMKMPIFTWTSLCTNVLIVAAFPVLTAVLALLSLDRYAGTNFFTNDLGGN
FT                   PMMYVNLIWIWGHPEVYILILPAFGVFSEVVATFASKRLFGYASMVYATVVITILSYLV
FT                   WLHHFFTMGSGASVNSFFGITTMIISIPTGAKLFNWLFTMYRGRIRFEVPMLWTVAFMV
FT                   TFTIGGMTGVMLAVPPADFVLHNSLFLIAHFHNVIIGGVLFGMFAGIAYWFPKAFGFKL
FT                   DPFWGKMSFWFWVVGFYFAFMPLYVLGLMGVTRRVSQFDDPSLQIYFIIAALGAVMIAI
FT                   GIASFLIQLVVSFIKREELRDLTGDPWNGRTLEWSTSSPPPAYNFALTPIVYDHDAWWD
FT                   MKNRGHKRPTEGFIPIHMPKNTGTGIILGVLSIAFAFGMIWYMWWLAAITFAAMIVVTI
FT                   GHTFNYKRDFYIPADEVVKTENERTKLLAGQV"
FT   gene            complement(227836..228963)
FT                   /gene="cyoA"
FT                   /locus_tag="Arad_0257"
FT   CDS_pept        complement(227836..228963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoA"
FT                   /locus_tag="Arad_0257"
FT                   /product="ubiquinol oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24991"
FT                   /db_xref="GOA:B9JGZ5"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006333"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR010514"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR034227"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGZ5"
FT                   /protein_id="ACM24991.1"
FT                   /translation="MLRLSKIFSRLFVLPLFLLLSGCNLVVMAPSGDIAVQQRDLIVIS
FT                   VVLMLIIIIPVIFLTLFFAWKYRQSNTAAPYDPEWHHSTRLELVIWSAPLAIIIALGAV
FT                   TWISTHQLDPYRPLDRIAAGKPVAENVKPLTVEVVALDWKWLFFYPDLGIATVNELAAP
FT                   VDTPINFKITASAVMNSFFVPALAGQIYAMPGMETKLHAVINHPGEYQGLSANYSGAGF
FT                   SHMRFKFHGFSQADFDQWVAKAKSQGSALGRPEYLALAKPSEREPVRYYNAVDKDLYEA
FT                   ILNMCADPSKMCMSEMMHIDAKGGAGKDSQENRERLIHDNRDADHADVTPVRADAPAAH
FT                   SMQHGDNSMPGMDMGDGSSSNSSTGSSQPAQHQDH"
FT   gene            229353..230690
FT                   /locus_tag="Arad_0258"
FT   CDS_pept        229353..230690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0258"
FT                   /product="ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24992"
FT                   /db_xref="GOA:B9JGZ6"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9JGZ6"
FT                   /protein_id="ACM24992.1"
FT                   /translation="MVSVTHEAVNATSTGFERDARSMHAGSEVAPGNIAIGVIIGRTSE
FT                   FFDFFVYAIASVLVFPKLIFPFADPLHGTMLSFLIFSLAFIARPIGSFIFMAIDRAYGR
FT                   GVKLTIALFLLGGSTASMSFLPGYAEIGGYAILLLAVFRIGQGLALGGAWDGLASLLAL
FT                   NAPANRRGWFAMIPQLGAPIGFMLASALFAYFVMSLTTADFLEWGWRYPFFCAFMVNVV
FT                   ALFARLRLVATPEFGALLERHELEPVKMTELLRVHGRDVLIGAFVPLASFATFHLVTVF
FT                   PLSWMTLYSDQSPGSFLLVEFVGAICGIVAIICSGLLADRIGRRNQLAVGAVLIACFAF
FT                   VAPWLLDGGSTGRHIYVVLGFTLLGLSFGQAAGASASRFSRNYRYSGSALTSDLSWLIG
FT                   AGFAPFVALSLSSQFGLVYTSLYLLSGVVCTLVAIFFSKTLETRDT"
FT   gene            230914..231930
FT                   /gene="sfuA"
FT                   /locus_tag="Arad_0259"
FT   CDS_pept        230914..231930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfuA"
FT                   /locus_tag="Arad_0259"
FT                   /product="iron(III) ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24993"
FT                   /db_xref="GOA:B9J6N7"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6N7"
FT                   /protein_id="ACM24993.1"
FT                   /translation="MTFSFTHLTSALALAAGLAVAPLMANAAESEGIVVYNAQHETLTQ
FT                   AWADGFTKETGIKVTIRNGSDMQFANQIVEEGAASPADVYLTENSPGMTLVDANKLFAP
FT                   VDADTLAQVPENFKAVDGNWVGVAARSTVFAYDKTKLKEADLPKSLLDLADPKWKGRWG
FT                   ASPAGADFQAIVSALLELKGEDATKSWLKAMKENATPYKGNSVAMKAVNAGEIEGAVIY
FT                   HYYWFGDQAKTGENSKNVLLHYFKNQDPGAFVSISGGGVLASSQHQKEAQAFLKWITGK
FT                   GGQAVLRDGDSYEYAVGNGAESNPKLVPIKDLQAPKVEPSKLNSKKVTDLMTEAGLI"
FT   gene            232056..233657
FT                   /gene="sfuB"
FT                   /locus_tag="Arad_0260"
FT   CDS_pept        232056..233657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfuB"
FT                   /locus_tag="Arad_0260"
FT                   /product="iron(III) ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24994"
FT                   /db_xref="GOA:B9J6N8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6N8"
FT                   /protein_id="ACM24994.1"
FT                   /translation="MLQKNTYAAPAGRAAAMRVPPLTAASRGRVPHASVIALASVVALL
FT                   SLVPLGFIIWITVDTGWNEAIALIFRNRVGELLVNTVLLEVCTIPLCILLAVTLAWLTE
FT                   RTDIPGARLWSWLAVAPLAVPAFVHSYAWVSLVPGMRGLSSGVLVSVLAYYPFLYLPVA
FT                   AALRRLDPAIEDAAASLGLNPWRVFFRAILPQLRLAICGGSLLIGLHLLAEYGLYVMIR
FT                   FDTFSTAIVDQFQSAYNSPAANMLGGVLVFCCLLLLGIEVLVRGNERYARVGSGAARPA
FT                   DRRRLGWFVVPAVALPVLVAAFTLGVPFVTLARWLYLGGAGIWRMETVGNALLQTIGLA
FT                   IAGGLLATVAAIPMAWLSVRAPGRLQRILEACHYYVGSLPGVVVALALVSITVRLILPL
FT                   YQTFATLLLAYVLLFLPRAMVGLRASIAQAPVELERAAMALGRTPAQAVRQITMRLAAP
FT                   GFAASVALVALGITNELTATLMLSPNGTVTLATKFWSLTSEIDYVSAAPYAFMMVVLSL
FT                   PLTLLLYTQSKRTAGQ"
FT   gene            233654..234715
FT                   /gene="sfuC"
FT                   /locus_tag="Arad_0261"
FT   CDS_pept        233654..234715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfuC"
FT                   /locus_tag="Arad_0261"
FT                   /product="iron(III) ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24995"
FT                   /db_xref="GOA:B9J6N9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR015853"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030287"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6N9"
FT                   /protein_id="ACM24995.1"
FT                   /translation="MTFLAIKTISKRYGPVCALDTIDLTVAPGSRTAIVGPSGSGKTTL
FT                   LRIIAGFETPDAGQVTLEGETLADGPSVVPAHRRGIGIVSQDGALFPHLSVADNISFGM
FT                   ERGRPDRAEQINALIDMVELDRNMLDRRPHQLSGGQQQRVALARALGRKPRLMLLDEPF
FT                   SALDTGLRENMRKAVARVLQIAGITTILVTHDQAEALSFADQVAVLRDGKLVQAGTPQT
FT                   LYLHPRDRETATFLGDAILLPADLGDGFANCALGRIPTDTNGRQGRADIMLRPEQLQLS
FT                   VLDDAGASAACVGKVTDVEFGGAVCTVTVVLSQANGAETLNIKSSGVGLPEIGSMVSVT
FT                   VLGKAHVFDKTGV"
FT   gene            234797..235972
FT                   /locus_tag="Arad_0263"
FT   CDS_pept        234797..235972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0263"
FT                   /product="hippurate hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24996"
FT                   /db_xref="GOA:B9J6P0"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6P0"
FT                   /protein_id="ACM24996.1"
FT                   /translation="MSLPDEISQDLPFLTSLRHNLHAHPELGFEEERTSGIVATLLEEA
FT                   GITVHRGLGKTGVVGTLQVGNGTRRIGLRADMDALAMPEKGNKPYKSTIPGKMHACGHD
FT                   GHTTMLLGAARQLAATRGFSGTVHFIFQPAEEGRGGAKRMVEEGLFDLFPCDAVYGLHN
FT                   MPGLDIDEMAVVEGPQLASSDSWRITFRGTGTHGAKPHLGKDPITAAATFLSSLQTIVG
FT                   RVVDPLQPAVVSACSVQAGDPKALNVIPDAVEIGGTARAYTPEVRDQLEQEIGRLAHGT
FT                   AAMYGIAVDYQFERRIPPVVNDPEATARALKVATAIFGEKVLTRFPPSTAGDDFAFFGQ
FT                   NAPGCYVWLGNGPAVDGALHHNTAYDFNDDAIASGVAFWTTLVEQELGADA"
FT   gene            complement(235969..237753)
FT                   /gene="ade"
FT                   /locus_tag="Arad_0264"
FT   CDS_pept        complement(235969..237753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ade"
FT                   /locus_tag="Arad_0264"
FT                   /product="adenine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24997"
FT                   /db_xref="GOA:B9J6P1"
FT                   /db_xref="InterPro:IPR006679"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR026912"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6P1"
FT                   /protein_id="ACM24997.1"
FT                   /translation="MIQHSLEPGDLNAPELRARAVAAARGDAPFDLLIAGGRLVDMVTG
FT                   QIRAADIGVVGPLIASVHAPGSRTNAAETIDAAGCFLSPGLIDTHMHIESSMVTPALYA
FT                   EAVLPRGVTTIVWDPHEFGNVHGLDGVRWAVEATRLLPLRVIPLAPSCVPSAPGLELAG
FT                   ADFDASAMAEMLAWPEIGGVAEVMTMRGVIDGDPRASAIVNAGLQSGKLVCGHARGLEG
FT                   ADLSAFMAAGVSSDHELTSGADFLAKLSAGLTIELRGSHDHLLREFVEVINDLGFLPQT
FT                   VTLCTDDVFPDELHVNGGLDDVVRRLVRDGLKPEWALRAATLNAAMRLGRNDLGLIAAG
FT                   RRADIVLFEDLRAFKAKRVIANGEIVAKAGKIAGTIAPLDTAPLQNSIKLAPLSEDDFR
FT                   VPANGNHVRLATIDRPRFTQWGEIEAEVADGYVVLPAGTTMIAVAHRHGKADGRPRVGF
FT                   LTGWGEWRGALCTTVSHDSHNLTVFGGNIRDMTLAANAVIAAGGGLAVASDGKVQIVLS
FT                   LPLSGLVSDAPLEETALTFSVLREAMDKIVDWQPPYLVFKACFGATLACNVGPHQTDRG
FT                   IADVVTGQVLETAVLGKI"
FT   gene            complement(237750..238673)
FT                   /locus_tag="Arad_0265"
FT   CDS_pept        complement(237750..238673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0265"
FT                   /product="inosine-uridine preferring nucleoside hydrolase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24998"
FT                   /db_xref="GOA:B9J6P2"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6P2"
FT                   /protein_id="ACM24998.1"
FT                   /translation="MGIWIDTDMGFDDIAAILVVAHSSLAIDGVSLVSGNAPLAQIRAN
FT                   AASAAAAFDWTFPIHTGRELPVLCKLETAQNILGSSGIPTEGKSLPPADALPSSDAFAA
FT                   LCDWLADGLGPKRILALGPLTNIAAVALARPDLAARIDELTWMGGGVTSGNHTASAEFN
FT                   AFADPEALAIVLAHGLPLRMIDLDICRKVLARPDDVERVRQAGGKNAELLADLLGGYVN
FT                   IAISRGRPAMAVYDPTAAAIFVAPDIARLQHARIDVELWGQHTRGRTVVETRASHAEFN
FT                   AHFAAEIDADRARAIIFDAMINEARR"
FT   gene            complement(238760..240145)
FT                   /gene="dapE1"
FT                   /locus_tag="Arad_0266"
FT   CDS_pept        complement(238760..240145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapE1"
FT                   /locus_tag="Arad_0266"
FT                   /product="succinyl-diaminopimelate desuccinylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACM24999"
FT                   /db_xref="GOA:B9J6P3"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6P3"
FT                   /protein_id="ACM24999.1"
FT                   /translation="MTDVSPVLDRADQNLPSSLDNLFELLRIQSISTDPAFKPECRKAA
FT                   EWLTAYLIKLGFTASVRDTPGHPMVVAHHDAASADAPHVLFYGHYDVQPVDPIELWESD
FT                   PFAPAIKDMGDGRKILVGRGTSDDKGQLMTFVEAVRAYKEIKGELPVRITILFEGEEES
FT                   GSPSLKPFLEANAAELKADYALVCDTGMWDGDTPAIAAALRGLVGEEITINAADRDLHS
FT                   GLYGGAAANPIHILSDILAGLHDETGRITLPGFYDGVEETPANIKASWETLGRSAQNFL
FT                   GEVGLSIPSGEKGRSVLELTWARPTAEVNGIWGGYTGAGFKTVIAAKASAKVSFRLVGQ
FT                   QNPAAIRDSFRAYVRSKLPADCSVEFHEHGASPAIHLSYDSPVLTKAKSALSNEWPKPA
FT                   IVIGMGGSIPIVGDFQKMLGMESLMVGFGLADDRIHSPNEKYELRSYHKGIRSWIRILD
FT                   ALA"
FT   gene            240343..242679
FT                   /locus_tag="Arad_0269"
FT   CDS_pept        240343..242679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0269"
FT                   /product="sensory box/GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25000"
FT                   /db_xref="GOA:B9J6P4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR005330"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6P4"
FT                   /protein_id="ACM25000.1"
FT                   /translation="MFSVMACIRDEHDIRLIFVAAAICLIGSLATMLLFSRAQECRSQQ
FT                   RSYWVVAAAFASGVSIWATHFIAMLAYDGGLPISYGLSLTILSVVFAILGSWFAIAVAF
FT                   EWDNTISFAIGGMLMALGIASMHFTGMQAIQAPAILAHDPSRTLAAIAAGAALGALSFV
FT                   AFFRMGGHRRIALGTLLLVLAICALHFTAMSGVTLTPDPTVEAATLSIDRIVLAGIIMA
FT                   ASTGLVLIALGAAFVDRHLTDLRGFANASLEGMLIVRDGRVIDANERFVAISGWSLQRL
FT                   IGKSPGDFLTLDAAMRPEEAASLETALLSESGRSIPVEVVIRTIIYRGHECRVLVVRDL
FT                   TERRQAQQMIEHLAHHDTLTDLPNRAFFDERIRQALQMAEHKGTEAAVFCLDLDRFKAI
FT                   NDVFGHAEGDRILCKVADILRRSAEDSDTVARLGGDEFAIIQPGQSQPEGARRLAERIL
FT                   AEFAAEMDTARDPTAVGVSLGIAIYPRDGHSAEQLYCNADIALYRVKHTSRGFACFFDA
FT                   GMDETVRTRRQIESDLRQAILRRQLHVDYQPILDAQNGQISGYEALLRWDHPVRGVIEP
FT                   DTFIPIAEESGSIVQLGEWVLEQACIEAARWHDKASIAVNVSPVQFMIPTLYDQVAQIL
FT                   ARTGLDPHRLELEITEAALMRDRVVVLSTLQRLHRLGVRVVMDDFGTGYSSLSNLRAFP
FT                   FDKIKVDRSFTGALEHDPAARSIVRAIIGLGHSLNMPVVTEGVETESQRRIVVEEGCAQ
FT                   LQGFLLGKPDIEPSSRFSASDKTVA"
FT   gene            complement(242680..243111)
FT                   /locus_tag="Arad_0270"
FT   CDS_pept        complement(242680..243111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0270"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25001"
FT                   /db_xref="GOA:B9J6P5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6P5"
FT                   /protein_id="ACM25001.1"
FT                   /translation="MGFNRTDSATYLANQMAKGFSRSLQQRAARLGFSPGQFPILLELW
FT                   TEDGLTQKQLLERVDIEQATMANTLSRMERDGLVERRPHPSDKRAQLIFLTGKATAMQT
FT                   EAVEAAIAADRDLFRGFRTFERELLLEYVKRILENAKHI"
FT   gene            243543..246545
FT                   /gene="polA"
FT                   /locus_tag="Arad_0271"
FT   CDS_pept        243543..246545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="Arad_0271"
FT                   /product="DNA-directed DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25002"
FT                   /db_xref="GOA:B9J6P6"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6P6"
FT                   /protein_id="ACM25002.1"
FT                   /translation="MKKGDHLFLVDGSGFIFRAFHALPPLTRKSDGVPVGAVSGFCNML
FT                   WKLLTSARDTSVGVTPTHFAVIFDYSSKTFRKDIYDAYKANRSAPPEELIPQFGLIRQA
FT                   TRAFNLPCIETDGFEADDIIATYARQAEATGADVTIISSDKDLMQLVTPMVHMYDSMKD
FT                   KQIGIPDVIEKWGVPPEKMIDLQALTGDSVDNVPGIPGIGPKTAAQLLETFGDLDTLLA
FT                   RAGEIKQEKRRENIIANADLARISRQLVTLRTDVPLELPLDALVLEPQNGPKLVGFLKA
FT                   MEFTSLTRRVAEACNCDPTAIEPSDVNVEWGDTAHGPDLDVGDNVELVAGGTVAAEGAS
FT                   VPAPAVKPRVGVEGLTEPADLTKARAASFATAPIDHSKYVTIRDVGTLDRWIADARETG
FT                   IVAFDTETTSLDVMQAEIVGFSLAIADNKNDPSGASIRAAYVPLNHKNGVGDLLGGGLA
FT                   DNQIPLRDALPRLKALLEDTSVLKIAQNLKYDYLLMKRYGIETKGFDDTMLLSYVLDGG
FT                   ANATHGMDSLSERWLGHKPIAYKDVAGSGKSNITFDLVDIDRATAYAAEDADVTLRLWL
FT                   VLKPRLAAEKLATVYERLERPLVPVLAHMEERGITIDRQILSRLSGELAQGAARLEDEI
FT                   YTLAGERFNIGSPKQLGDILFGKMGLAGGSKTKTGQWSTSAQVLEDLAAAGFELPRKIV
FT                   DWRQLTKLKSTYTDALPGYVHPETKRVHTSYSLASTTTGRLSSSEPNLQNIPVRTAEGR
FT                   KIRTAFISTPGHKLISADYSQIELRVLAHVANIPQLEQAFADGVDIHAMTASEMFGVPI
FT                   EGMPSEVRRRAKAINFGIIYGISAFGLANQLSIERSEAGDYIKRYFERFPGIRDYMEST
FT                   KATARDKGYVETIFGRRVHFPEIRSSNPSVRAFNERASINAPIQGSAADVIRRAMIKME
FT                   PALADAGLGDRVRMLLQVHDELIFEVEDADVERSTPVIVSVMENAAMPAVNMSVPLKVD
FT                   ARAANNWDEAH"
FT   gene            complement(246568..247110)
FT                   /gene="phnN"
FT                   /locus_tag="Arad_0272"
FT   CDS_pept        complement(246568..247110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnN"
FT                   /locus_tag="Arad_0272"
FT                   /product="phosphonate metabolism
FT                   protein/1,5-bisphosphokinase (PRPP-forming) PhnN"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25003"
FT                   /db_xref="GOA:B9J6P7"
FT                   /db_xref="InterPro:IPR012699"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6P7"
FT                   /protein_id="ACM25003.1"
FT                   /translation="MVVVVGPSGAGKDTLMNLAARHFAGRSDIHFVRRVITRYGDAGNE
FT                   DHRSVSDADFDAMEQDGAFAVSWEAHGLKYGIPSDVEGELANGHLVVANGSRSVLHRFQ
FT                   AAFPKLKVINVTARREVLAERLIARGRESREDVMKRLERGSLTVQGSYDVADIDNSGTL
FT                   EEAGRVIVAELETLIRR"
FT   gene            complement(247167..248306)
FT                   /gene="phnM"
FT                   /locus_tag="Arad_0274"
FT   CDS_pept        complement(247167..248306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnM"
FT                   /locus_tag="Arad_0274"
FT                   /product="phosphonate metabolism protein PhnM"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25004"
FT                   /db_xref="GOA:B9J6P8"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR012696"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6P8"
FT                   /protein_id="ACM25004.1"
FT                   /translation="MTKEIVLSNARIVLEDKILEGSVLIRDGRIADISDGRSGIGEDFE
FT                   GDYLIPGLVELHTDHLEAHYSPRPGVRWNKTAAIQAHDAQIVTSGITTVFDCLRMGSDE
FT                   DGGFEKGEMRDMADAIQAAQREDRLRADHLIHLRCEVSSDNVLDHFQDFEKDPYVRLVS
FT                   LMDHAPGQRQFQTMDQYIFYYQKKRGLSDEAFAVFVAKRQAESARYATPHRDAISKVCN
FT                   ERGITIASHDDATLVHVDEAINYGVRLAEFPTSVDAAKASHGAGMSVLMGAPNIVRGKS
FT                   HSGNIAARDLAELGVLDVLSSDYVPLSLLHAPFILADEVEGISLSQAIAMVTATPAKTV
FT                   SLNDRGRIAEGLRADLVRVRRDHGVPVTRSVWREGRRVA"
FT   gene            complement(248317..249009)
FT                   /locus_tag="Arad_0276"
FT   CDS_pept        complement(248317..249009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0276"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25005"
FT                   /db_xref="InterPro:IPR009389"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6P9"
FT                   /protein_id="ACM25005.1"
FT                   /translation="MRYALYFTPPKADPLTALAARWLGRDAFSNEIFSDKAIGVVPENH
FT                   AEVTADPRRYGFHATLKAPFELASSVTERDLLDVAADFAARTPAFAIPELVLGQLGQFF
FT                   ALVPGAVYQPLQDFAAQVVKTFEPFRAALSEADIARRKPEGLSEAERANLLRWGYPYVN
FT                   DEFRFHMTLTGKVAAEQQASIHDLLRDRFADHTGKPLDISGLAVFVEEERGAPFTVRSW
FT                   LPLADAQK"
FT   gene            complement(249200..250546)
FT                   /gene="phnE"
FT                   /locus_tag="Arad_0277"
FT   CDS_pept        complement(249200..250546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnE"
FT                   /locus_tag="Arad_0277"
FT                   /product="phosphonate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25006"
FT                   /db_xref="GOA:B9J6Q0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005769"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6Q0"
FT                   /protein_id="ACM25006.1"
FT                   /translation="MSVIDASRMQDIEARYPEILHRSFRQRFGALMVFIGVILYGFYAV
FT                   WFFDLPKVITEAHWERVGIYLSEWVSYDVQPEFRISGDTISIKYPRFSPLGDNPHPDWV
FT                   TNNPDGSLTVSVSGTSRTVTITKTQAILTAHGVTIPIDITGDVPKVIGSEPVPAWMTVY
FT                   DDNILVDMGFAGNVSISTDRVKIRKRFIGWANFVFDTHSPFFDKPAGEVISLIVSGPRL
FT                   NPDESNLSLAFDNVWNNAAWQHGDVWSKLFQTIVMAFLGTLLGSVVGFPLAFLAARNIT
FT                   PNRLLNQVLKRFFDFLRSVDMLIWALFLTRAFGPGPLAGSGAIFLTETGTLGKLYSEGL
FT                   ENIDNKPREGVKSTGSSTILVHRYGIMPQIVPVIVSQTLYQWESNVRGATIIGAVGAGG
FT                   IGLKLWEAMRTNANWENVAYMVLLILIVVFLFDAASSALRTRLMGTQNR"
FT   gene            complement(250555..251535)
FT                   /gene="phnE"
FT                   /locus_tag="Arad_0278"
FT   CDS_pept        complement(250555..251535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnE"
FT                   /locus_tag="Arad_0278"
FT                   /product="phosphonate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25007"
FT                   /db_xref="GOA:B9J6Q1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005769"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6Q1"
FT                   /protein_id="ACM25007.1"
FT                   /translation="MTIADAQPQMQSAPHSAKEIGDAWSRMVARRRLYTGLGLAILIIA
FT                   FVSSVRFADESNAGHFFDRLPHLFDFLSWLIPKDWADVYRALFDLASPNGANGVGGEEF
FT                   NFPLGRVYVWGNFYIPEYFELMIITINVALVSTIIGFIVALPLSFFAARNMSPSNPVRL
FT                   VTKRVMEFLRAFPEIVIAGLFSAILSIGPIAAIIAVGLHTIGALGKLFYEVVENIDMKP
FT                   DEGMKAVGASWTERVRFGALPQVMPNFMSYALLRLEINVRASTIIGAVGGGGIGEELKL
FT                   SISRGFGAKTVALVLLLFITIIAVDQFSAWLRRRLVGEHAFLLQH"
FT   gene            complement(251604..252509)
FT                   /locus_tag="Arad_0279"
FT   CDS_pept        complement(251604..252509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0279"
FT                   /product="phosphonate ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25008"
FT                   /db_xref="GOA:B9J6Q2"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="InterPro:IPR017797"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6Q2"
FT                   /protein_id="ACM25008.1"
FT                   /translation="MLKKTLLAATALLALAGGAAAQDLKEFRVGILGGENEADRLRNYA
FT                   CLSDHLKKEFGFEKVSLFPAADYDGVIQGLLGGTLDFAELGASGYAAVAIKDPKAVTPI
FT                   LTTQQADGSTGYYSIGLALKSSGIKSIKDAKGKKLGYADPDSTSGYLVPLTQIPKDTGM
FT                   PNDKFFASTQFNGGHENNLLAAYDGKVDVAVDDSSGLGDFKDGYTSGTFRKEVDKGAVD
FT                   PNKLVEVWRSPLIPNGPLVVRNALGAEWQTKLTDFFLKLPTADAKCFNAIEGGDFKGYV
FT                   KVKPDFYNAVIEVRKAAIGG"
FT   gene            complement(252605..253459)
FT                   /gene="phnC"
FT                   /locus_tag="Arad_0281"
FT   CDS_pept        complement(252605..253459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnC"
FT                   /locus_tag="Arad_0281"
FT                   /product="phosphonate ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25009"
FT                   /db_xref="GOA:B9J6Q3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012693"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6Q3"
FT                   /protein_id="ACM25009.1"
FT                   /translation="MFELKNVSRRFGNKLAVDSVTLDIPQGQMVGVIGRSGAGKSTLLR
FT                   MINRLADPTSGSIHFAGTEVSKLSGRALRNWQRDCAMIFQQFNLVPRLDVLTNVMLGRL
FT                   NQRSTVMSLLSVFTREERIEAIAALERLGIEQTALQMAGTLSGGQQQRVAICRALMQQP
FT                   KMMLADEPIASLDPLNAKIVMDALRDINEREGITVITNLHTLDTARNYCERIVGMAAGR
FT                   VVFDGKPSDLTAAAVKEIYGTDKDGAGVDETMTSTAINIPDQAAQAAAHASAGLQPLAL
FT                   AGP"
FT   gene            complement(253686..254249)
FT                   /locus_tag="Arad_0282"
FT   CDS_pept        complement(253686..254249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0282"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25010"
FT                   /db_xref="GOA:B9J6Q4"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6Q4"
FT                   /protein_id="ACM25010.1"
FT                   /translation="MAKQFESIDDRLNDFIARQHIFFTASATGTSRVNVSPRETLCLRI
FT                   ISPNTAIYLDRTGSGNETSAHMKADGRLTIMFCAVAGPPMILRLYGRGRIIHRTSAEYR
FT                   ELLHTHYAGDEPLGARQIVWLDIDLVQTSCGFGVPLFSYEGERPSLDQWAKAKGPDGIE
FT                   EYRREKNVRSMDGLPTGLFDADSN"
FT   gene            complement(254344..254961)
FT                   /locus_tag="Arad_0283"
FT   CDS_pept        complement(254344..254961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0283"
FT                   /product="acetyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25011"
FT                   /db_xref="GOA:B9J6Q5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR017694"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6Q5"
FT                   /protein_id="ACM25011.1"
FT                   /translation="MSRQLGESPFISPTATVKNSTFGRYTEVSERCRIDEVEIGDYSYI
FT                   MQDGAVWCATIGKFVNIAASVRINATNHPTWRATLHHFTYRAADYWPDADMETDFFTWR
FT                   RENRVVIGHDVWIGHGATILPGVAVGNGAVIGAGAVVSKDVAPYTIVGGVPAKLIRERF
FT                   TTEVGARMDKLAWWDWDHATLRTALTDFRALSAEDFLIRYGA"
FT   gene            complement(254958..255665)
FT                   /gene="phnL"
FT                   /locus_tag="Arad_0285"
FT   CDS_pept        complement(254958..255665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnL"
FT                   /locus_tag="Arad_0285"
FT                   /product="phosphonate C-P lyase system protein PhnL"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25012"
FT                   /db_xref="GOA:B9J6Q6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012701"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6Q6"
FT                   /protein_id="ACM25012.1"
FT                   /translation="MATPLVVSEVFKSFTMHLRDGIRLPVVADVSFSVAAGECVVLGGP
FT                   SGIGKSSLLKMIYGNYAVDAGQILVAHKDRITDLATADPRTVLEVRRHTMGYVSQFLRT
FT                   VPRVAAIDVVAEPLLARGVVLADARQRAGALLAQLNLPQELWQLPPATFSGGEQQRVNI
FT                   ARGFITDHAILLLDEPTASLDARNRAVVVSMIEEKKKAGVALLGIFHDEEVREAVGSRI
FT                   LDVSRFSPRKSAA"
FT   gene            complement(255678..256454)
FT                   /gene="phnK"
FT                   /locus_tag="Arad_0287"
FT   CDS_pept        complement(255678..256454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnK"
FT                   /locus_tag="Arad_0287"
FT                   /product="phosphonate C-P lyase system protein PhnK"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25013"
FT                   /db_xref="GOA:B9J6Q7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012700"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6Q7"
FT                   /protein_id="ACM25013.1"
FT                   /translation="MSDTPLLKVKDISKFYGSRIGCRDVSFDLWPGEVLAIVGESGSGK
FT                   TTLLNCISTRLLPTTGSVEYHMRDETYRDLFRMNEAERRFLMRTDWGFVHQNPADGLRM
FT                   TVSAGANVGERLMAIGNRHYGNIRATAVDWLERVEIDADRIDDQPRAFSGGMRQRLQIA
FT                   RNLVTGPRLVFMDEPTGGLDVSVQARLLDLVRGLVNDLGLSAIIVTHDLAVARLLSHRM
FT                   MVMKDGYVIEHGLTDRVLDDPREPYTQLLVSSILQV"
FT   gene            complement(256451..257347)
FT                   /gene="phnJ"
FT                   /locus_tag="Arad_0288"
FT   CDS_pept        complement(256451..257347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnJ"
FT                   /locus_tag="Arad_0288"
FT                   /product="C-P (carbon-phosphorus) lyase component protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25014"
FT                   /db_xref="GOA:B9J6Q8"
FT                   /db_xref="InterPro:IPR010306"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6Q8"
FT                   /protein_id="ACM25014.1"
FT                   /translation="MTDLATYNFAYLDEQTKRMIRRAILKAIAIPGYQVPFASREMPMP
FT                   YGWGTGGVQLTAAIIGPDDVLKVIDQGADDTTNAVSIRAFFQKVANVAVTTRTEEATII
FT                   QTRHRIPEAKLGPNQVLVYQVPIPEPLRFLEPRETETRKMHALEEYGLMHVKLYEDIAR
FT                   NGRIATTYAYPVKVAGRYVMDPSPTPKFDNPKMHLSDALQLFGAGREKRIYAVPPYTDV
FT                   VSLDFEDHPFEVQRFEKPCALCGAEQVYLDEVILDDKGGRMFVCSDTDFCEDRRAHGHV
FT                   GPMLAPNGPAPNQEAAE"
FT   gene            complement(257344..258453)
FT                   /gene="phnI"
FT                   /locus_tag="Arad_0289"
FT   CDS_pept        complement(257344..258453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnI"
FT                   /locus_tag="Arad_0289"
FT                   /product="C-P (carbon-phosphorus) lyase component protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25015"
FT                   /db_xref="GOA:B9J6Q9"
FT                   /db_xref="InterPro:IPR008773"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6Q9"
FT                   /protein_id="ACM25015.1"
FT                   /translation="MYVAVKGGEAAIANAHRLLADRRRGDRSLPALGIDQIVAQLALAV
FT                   DRVMAEASLYDRTLAALAVRQSRGDMIEAIFLLRAYRTTLPRFGYSQPLDTAAMKIERR
FT                   ISATYKDLPGGQLLGPTFDYTHRLLDPSLLTDEPVDEPMQRSAEEGRVMRVSEILAEEG
FT                   LIEGDGEMPIDHETGDLTREPMEFPMTRDLRLQALARGDEGFLLALGYSTQRGYGRNHP
FT                   FTGEIRIGEVEVELDVPELGFAVSLGSIQVTECQMVNQFKGSAKAPPQFTRGYGLVFGQ
FT                   SERKAMAMSLVDRALRADELGEDIVAPAQDEEFVISHSDNVQATGFVEHLKLPHYVDFQ
FT                   AELDLVRRMRRDFEAARDGGKDPLTEAAE"
FT   gene            complement(258457..259083)
FT                   /gene="phnH"
FT                   /locus_tag="Arad_0291"
FT   CDS_pept        complement(258457..259083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnH"
FT                   /locus_tag="Arad_0291"
FT                   /product="C-P (carbon-phosphorus) lyase component protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25016"
FT                   /db_xref="GOA:B9J6R0"
FT                   /db_xref="InterPro:IPR008772"
FT                   /db_xref="InterPro:IPR038058"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6R0"
FT                   /protein_id="ACM25016.1"
FT                   /translation="MTLSNTITPDNDALTGGFTNPVFDAQSVFKMMMDAMARPGTLQTV
FT                   VSDIAPPAPLGIAAGAIALTLCDHDTSVWMSGGLARSTMPEWLGFHTGAPVTSEKLEAR
FT                   FAFVEAGVLLASLNQFDVGTQEYPDRSTTIALEIASLEGGKELALSGPGIADINMIAPI
FT                   GLPDTFLRFWNDNRALFPRGVDLVLTAGRQFLCLPRTTKIIATEI"
FT   gene            complement(259083..259598)
FT                   /gene="phnG"
FT                   /locus_tag="Arad_0292"
FT   CDS_pept        complement(259083..259598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnG"
FT                   /locus_tag="Arad_0292"
FT                   /product="C-P (carbon-phosphorus) lyase component protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25017"
FT                   /db_xref="GOA:B9J6R1"
FT                   /db_xref="InterPro:IPR009609"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6R1"
FT                   /protein_id="ACM25017.1"
FT                   /translation="MVVYINRHFEEDAMNSAQRQEVAAQERRERKRTADLLARAERDEL
FT                   DAAWEALSDKPAIQPVRGPETGLVMVRGRIGGGGAPFNLGEVTVTRATIRLASGTVGHA
FT                   HALGTDREKVRLAAIFDALWHQPATKDFVEKAILLPITERIAGRDRQRAEETAATRVDF
FT                   FTMVRGED"
FT   gene            259662..260396
FT                   /gene="phnF"
FT                   /locus_tag="Arad_0293"
FT   CDS_pept        259662..260396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnF"
FT                   /locus_tag="Arad_0293"
FT                   /product="phosphonates metabolism transcriptional regulator
FT                   PhnF"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25018"
FT                   /db_xref="GOA:B9J6R2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR012702"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6R2"
FT                   /protein_id="ACM25018.1"
FT                   /translation="MAGQKVQRQTGVALWRQIADRIRASINQGDFDETGMVPPETALAL
FT                   QFGVNRHTVRSALAALGQEGIVRAVQGRGTLIERKERLNFPISKRTRFSQGIGDQAREA
FT                   RSVLVAASREIASAEVARWLKLTPGAAVVRLETIGRADHRPVSRATSWFPADRFADIAE
FT                   IYGTTGSITKAFRELGVADYVRVVTEITATHAEEGDLTDLELSPGAIVMNTRALNADLD
FT                   GVPVQYSISRFAADRVRFTIEN"
FT   gene            complement(260675..261310)
FT                   /gene="gpmA"
FT                   /locus_tag="Arad_0294"
FT   CDS_pept        complement(260675..261310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmA"
FT                   /locus_tag="Arad_0294"
FT                   /product="phosphoglycerate mutase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25019"
FT                   /db_xref="GOA:B9J6R3"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J6R3"
FT                   /protein_id="ACM25019.1"
FT                   /translation="MSGTLVLVRHGQSDWNLKNLFTGWKDPDLTALGVEEAKTGGKALA
FT                   DYGIKYDIAFTSVLTRAQHTLKIILDEVGQPGLETIKDQALNERDYGDLSGLNKDDARA
FT                   KWGEEQVHIWRRSYDVPPPGGESLRDTGARVWPYYLTEILPRVLAGQKVLVAAHGNSLR
FT                   SLVMVLDRLTKEQILALNLATGVPMVYKLNADSTVASKEVLGDMSGAH"
FT   gene            complement(261336..262160)
FT                   /gene="dapB1"
FT                   /locus_tag="Arad_0295"
FT   CDS_pept        complement(261336..262160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB1"
FT                   /locus_tag="Arad_0295"
FT                   /product="dihydrodipicolinate reductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25020"
FT                   /db_xref="GOA:B9J6R4"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J6R4"
FT                   /protein_id="ACM25020.1"
FT                   /translation="MSDDAMKLVVVGAAGRMGQALIRLIHATEGLTLHAAVARPGSAFI
FT                   GKDAGEIAGLGQIGIPVTDDPLSAFLHADGVIDFTTPATSVTFADLAAQARIVHVIGTT
FT                   GCSAEDETRFKAAARHARIVKSGNMGLGINLLSVLVEQAARALPPADWDIEVLEMHHKH
FT                   KVDAPSGTALLLGEAAAKGRGIDLGDHSVRVRDGYTGPRPAGSIGFATLRGGAVIGDHS
FT                   VIFAGEGERLTLSHSAGDRSLFARGALQAALWARDKKPGLYSMLDVLGLSTR"
FT   gene            complement(262176..264014)
FT                   /locus_tag="Arad_0296"
FT   CDS_pept        complement(262176..264014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0296"
FT                   /product="multidrug ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25021"
FT                   /db_xref="GOA:B9J6R5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6R5"
FT                   /protein_id="ACM25021.1"
FT                   /translation="MCHVRLAWFETGSRFLKSPNTKKTDIDSEAITVVLKRVIAENGRD
FT                   HIWGYSIAIFCLVVVAASTAMMAFVMRPIVNGAFYERRAEVMWLICLAIFAAFIARGFA
FT                   GYFQSVILSKIGNDIIARYQRRLYAHLMTLSVGFFSEARSAQIAARVSQNVSGIRDVMN
FT                   LVITSTARDFLSFVFLLGNMVYQDPLLSLIFFVIAPPVFLALRHISKRLRAVTREAVVL
FT                   NSRVLGAMQETIQGISIVKAFTMEPELDRKINKLITAAENRQNRIVRISERNGPLIETV
FT                   AGFAVAGVFAYAAYRSIYENVPPGAVFSFIVSLLLAYDPARRLAKLQTQLERAVVNARM
FT                   IYELLDMEPRQRDLPDAKPLVVTDARIEFRDVQFAYGDDTVLSGVSFTAEGGQTTALVG
FT                   PSGAGKSTVINLIPRFYDPKAGSILIDGQDISHVTKQSLREHLAYVSQQPYLFEGTIRD
FT                   NIRYGRLEATDADIEEAARHAYAHDFILAQPQGYDTPVGENGVTLSGGQRQRLSIARAL
FT                   VRNAPILLLDEATSALDTESEAAVQKALDEAMSGRTVVVIAHRLSTVVRAEKIIVMQNG
FT                   RVVEEGNHETLAEADNGLYARLNSLQRPAVSGNSRK"
FT   gene            complement(264155..265177)
FT                   /gene="glk"
FT                   /locus_tag="Arad_0297"
FT   CDS_pept        complement(264155..265177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glk"
FT                   /locus_tag="Arad_0297"
FT                   /product="glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25022"
FT                   /db_xref="GOA:B9J6R6"
FT                   /db_xref="InterPro:IPR003836"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J6R6"
FT                   /protein_id="ACM25022.1"
FT                   /translation="MPELNHSEAPLPFPILIGDIGGTNARFSIVVDAHSEPAHFPIVQT
FT                   ANFKTIDDAIEEALSKSAVRPRSAILAMAGPVRGDEIPLTNCDWVIRPKTMIANLGMED
FT                   VLIINDFEAQALAIAGISEEHRATIGEISEGMVASRAVLGPGTGLGVAGLVHAQHAWIP
FT                   VPGEGGHIDLGPRSERDLRIWPHLETIEGRISAEQVLCGRGLQNLYHAICKTDGIEPSL
FT                   KEPADITAHALAETNIQAEETLTLFVTYLGRVAGDIALVFMARGGVYITGGISQKILPA
FT                   LQKPEFRAAFEDKAPHTALLKSIPTHVVTHPLAALSGLTAYARAPASFGLATDGRRWRR
FT                   "
FT   gene            complement(265210..265590)
FT                   /gene="mgsA"
FT                   /locus_tag="Arad_0298"
FT   CDS_pept        complement(265210..265590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgsA"
FT                   /locus_tag="Arad_0298"
FT                   /product="methylglyoxal synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25023"
FT                   /db_xref="GOA:B9J6R7"
FT                   /db_xref="InterPro:IPR004363"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR018148"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J6R7"
FT                   /protein_id="ACM25023.1"
FT                   /translation="MAGGKCIALIAHDQKKDAMAEFARRNQDVLADWHIVATGTTGGRV
FT                   LDACPDLKVTRLKSGPLGGDQQIGAMIATGDIDMLIFFIDPLTPMPHDVDVKALTRLAV
FT                   LYDIPMALNEATAERLIKTLNH"
FT   gene            complement(265694..266740)
FT                   /gene="mepA"
FT                   /locus_tag="Arad_0300"
FT   CDS_pept        complement(265694..266740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mepA"
FT                   /locus_tag="Arad_0300"
FT                   /product="murein endopeptidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25024"
FT                   /db_xref="GOA:B9J6R8"
FT                   /db_xref="InterPro:IPR005073"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6R8"
FT                   /protein_id="ACM25024.1"
FT                   /translation="MISLLVRTISTVSKLALATTIGASLVTGDALAQQAGPTPGSAKAI
FT                   FGGVALPTAGQSQSIGFYAKGCLSGAVALPTDGPTWQAMRPSRNRRWGRPEMIGLLERL
FT                   SRDAAKYDGWPGLLVGDMAQPRGGPMFNGHASHQIGLDADVWLTPMPSRTLTAAERESL
FT                   PFTSMLAKDKFLTINDRVWTPAHARLLMRAASYPEVQRIFVNPAIKKKMCDSWTGDRTN
FT                   LGKLRPEYGHDSHFHIRLSCPAGSVGCTPQAPVTVGDGCDKTLAWWLGPEPWAKPKPST
FT                   KPPVKPREVMVSDLPKACQAVLDAPSVPSARAATYGIKAAAPTTATGTLPVSSSGTGNT
FT                   PPGSIPQQ"
FT   gene            267138..267725
FT                   /locus_tag="Arad_0301"
FT   CDS_pept        267138..267725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0301"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25025"
FT                   /db_xref="GOA:B9J6R9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6R9"
FT                   /protein_id="ACM25025.1"
FT                   /translation="MRTPKRRRGHDRVAVLLEAAATVFVDKGYDAATMTEIAAKAHSSI
FT                   GSLYQFFPTKPLLAEALHIDRLERLKAVFQDIAEKSGGLSAADSGEAIFDRLAAFIETF
FT                   PEYPVLAARRDIPRDRKLRSRAEVKELISSILRRAEPPVTDDVALMSAIILELIRIAVI
FT                   AANEPEAVEDRRLIRELRLMLRKRLEEATAKA"
FT   gene            267836..269674
FT                   /locus_tag="Arad_0303"
FT   CDS_pept        267836..269674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0303"
FT                   /product="peptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25026"
FT                   /db_xref="GOA:B9J6S0"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6S0"
FT                   /protein_id="ACM25026.1"
FT                   /translation="MALSRLKAGLVVSLFCLLALPAPSNADESQFRIGTAILGDLKYQP
FT                   GFKHFDYVNPDAPKGGELKQSSIGTFDTFNPVLFKGNPADGIELIYDTLLKKADDEANS
FT                   SYGLLAEGVSYPDDVSSATFRLRAEAKWADGTPVTPEDVIFSFEKFKELNPQAASYYGH
FT                   VVSAEKTGERDVTFHFDEKGNREMPSILGQLTIVPKHWWEAKGPDGKPRDITRTTLEPV
FT                   MGSGPYRIASVQPGASIRYELRDDYWGKILPINVGENNFGAINYLYFSDYDVAFEAFRS
FT                   GVIDYWQDNSTSHWVTGYDFPAAKDGRIKREELPNTLRSVGIMQALVPNMRREQFKDER
FT                   VREALNYVYDFEELNRTLSFGKLTRVDSFFFGTKFASSGLPQGEELNVLNSVRDKIPAE
FT                   VFTSPYTNPVGGDPQKTRDNFRKAIGLFKEAGWVLKGNKMVNAQSGQPFSLELLLNNPS
FT                   LERSVLPYIQNLKRIGIDASVRTVDPSQYINRIRSFDYDMIWVVWAQTLNPGNEQAEFW
FT                   GSASAGRQGSRNYAGIADPGIDALIQKVIFAKDVPEKEATTRALDRVLLAHHYVLPTFY
FT                   GTTTRIAYWDKFDHPAELPYYSIGFPDLWWSKSVAK"
FT   gene            269848..270939
FT                   /locus_tag="Arad_0305"
FT   CDS_pept        269848..270939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0305"
FT                   /product="peptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25027"
FT                   /db_xref="GOA:B9J6S1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6S1"
FT                   /protein_id="ACM25027.1"
FT                   /translation="MGAYILRRLLLMIPTIVGIMAISFTIVQFAPGGPVEQMIAQLTGQ
FT                   ADNASGRLSGGGDMLAQQATDDGGSKYRGAQGLDPELIAKLNKQFGFDKPPLERFGQMM
FT                   WNYIRFDFGESFFRNTSVIDLIAEKLPVSISLGIWILIFSYAISIPLGIRKAIQDGSTF
FT                   DVWTSGVIIVGYAVPSFLFGIMLIVLFAGGSFFDWFPLRGLVSDNFADLNWWQKILDYL
FT                   WHLVLPLISLSLAAFATTTLLTKNSFIEEIKKQYVITARAKGLSERRVLYGHVFRNAML
FT                   IVIAGFPGAFISAFFTGSLLIENIFSLDGLGRLSYLSVVQRDYPIVFATLFIFSLLGLF
FT                   VSLISDLIYTWIDPRIDFERRDV"
FT   gene            270939..272090
FT                   /locus_tag="Arad_0306"
FT   CDS_pept        270939..272090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0306"
FT                   /product="peptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25028"
FT                   /db_xref="GOA:B9J6S2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6S2"
FT                   /protein_id="ACM25028.1"
FT                   /translation="MDAASSVPTATIKPPRKGLFSPTNIRRWQNFKANRRGYWSLWLFL
FT                   VLFFFSLGAEFIANDRPILVSYKGEILVPVLVDYPEEKFGGFLAQTDYRSGDIEDEINA
FT                   HGWMIWPPIHYSYQTANSNLPQGISAPTAPFWLMTKEQRCSGYAQGVADPNCTWSNLNW
FT                   LGTDDQARDVFARMIYGFRISVLFGLALTICSAVVGVAAGAVQGYFGGWTDLLLQRFIE
FT                   IWSSMPVLYILLIIASVLPPGFFILLGILLLFSWVGLVGVVRAEFLRARNFEYVRAARA
FT                   LGVNNITIMYRHLLPNAMVATLTFVPFILSGSITTLTSLDFLGFGMPPGSPSLGEMIAQ
FT                   GKSNLQAPWLGLSAFFTMSIMLSLLIFVGEAVRDAFDPRKTFR"
FT   gene            272087..273724
FT                   /locus_tag="Arad_0307"
FT   CDS_pept        272087..273724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0307"
FT                   /product="peptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25029"
FT                   /db_xref="GOA:B9J6S3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6S3"
FT                   /protein_id="ACM25029.1"
FT                   /translation="MSDNSTLLLSVRNLSVAFHQGGRTSTAVDGISFDIHKGEVLALVG
FT                   ESGSGKSVSANSILKLLPYPSASHPSGEILFKGKDLLKASDNELRAVRGNDITMIFQEP
FT                   MTSLNPLHSIEKQITEILALHQGVVGQQARRRTLELLNQVGIREPEKRLKAYPHELSGG
FT                   QRQRVMIAMALANRPELLIADEPTTALDVTVQAQILELLRDLKGVHGMSMLFITHDLGI
FT                   VRKFADRVCVMTKGKIVETGTVEEVFTNPQHDYTRHLLAAEPRGEPPVSDTSKPVVMEG
FT                   SDIKVWFPIKAGLMRKVVDHVKAVDGIDLKLRAGQTLGVVGESGSGKTTLGLALARLIS
FT                   SKGRIAFVGKDIADYSFKEMRPLRSQLQVVFQDPYGSLSPRMSVGDIIAEGLKVHEASL
FT                   SSEERDRRVCWALEEVGLDPLTRWRFPHEFSGGQRQRIAIARAMVLKPRFVMLDEPTSA
FT                   LDMSVQAQVVDLLRDLQQRHDLAYLFISHDLKVVKALANDLIVMRFGKVVEQGPSADVF
FT                   RAPQEDYTKALLAAAFNIEAVPTAAIQQ"
FT   gene            273736..274695
FT                   /locus_tag="Arad_0308"
FT   CDS_pept        273736..274695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0308"
FT                   /product="hydroxyacid dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25030"
FT                   /db_xref="GOA:B9J6S4"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6S4"
FT                   /protein_id="ACM25030.1"
FT                   /translation="MPAKSPVLVDLKFNPESVAKALKSFFADRGSINLADPATKGVDLS
FT                   HVDYALLWKPDVDLYQRAPNLKIIFSGGAGVDSLITAATPLDIPIVRFVDRSLTVRMSE
FT                   WVVLQCLMHLRDVCGHFRHQRKRVWGRPAGLEARDVTVGVMGLGVLGLDAAAKLKVMGF
FT                   DVIGWSRQKKQIEGMETFDASELDAFLAKTDILVGLLPLTPETTGLYNASLFSKLRRDG
FT                   ALGKPVFINAGRGKSQVQADIVSAIETGILGGASLDVFEVEPLPADDPLWGLENVVITP
FT                   HDAAVSEEYSLMRHVEEQIARFEGGEPLQHVVDRSLGY"
FT   gene            274888..276192
FT                   /gene="pncB"
FT                   /locus_tag="Arad_0309"
FT   CDS_pept        274888..276192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncB"
FT                   /locus_tag="Arad_0309"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25031"
FT                   /db_xref="GOA:B9J6S5"
FT                   /db_xref="InterPro:IPR006406"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J6S5"
FT                   /protein_id="ACM25031.1"
FT                   /translation="MTKTDIAARVYNHTWKLDPIVRSLIDTDFYKLLMLQMIWKLYPDV
FT                   DATFSLINRTKSVRLAEVIDEKELREQLDHARTLRLSKKEMIWLAGNSFYGRAQIFEPE
FT                   FLTWLSNFQLPDYELSKRDGQYVLDFHGSWKETTMWEIPALAIINELRSRTALKALGPF
FT                   TLDVLYARAKAKMWEKVERLRELPDLHISDFGTRRRHSFLWQRWCVEALKEGVPHAFTG
FT                   TSNVLLAMDSDLEAVGTNAHELPMVAAALAKTDEELGKAPYKVLRDWNRLYGGNLLVVL
FT                   PDAFGTASFLRNAPEWVADWTGFRPDSAPPIEGGEKIIDWWKKMGRDPRQKLLIFSDGL
FT                   DVDAIIATYKHFEGRVRMGFGWGTNLTNDFAGCAPTEIHGLNPISIVCKVIEANGRPAV
FT                   KLSDNPQKATGEPAEVERYLKFFGAEDRVDHEVLV"
FT   gene            276280..276564
FT                   /locus_tag="Arad_0311"
FT   CDS_pept        276280..276564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0311"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25032"
FT                   /db_xref="GOA:B9J6S6"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6S6"
FT                   /protein_id="ACM25032.1"
FT                   /translation="MSSALKASVKIDPEVNERLEKLAASRHRQPDLLLKEAVEQYVDRE
FT                   EKRDSLLRDGRLSLDEYEATGLHVTGDEVIAWLETWGDEDEKAPPECHR"
FT   gene            complement(276856..277851)
FT                   /locus_tag="Arad_0312"
FT   CDS_pept        complement(276856..277851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25033"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6S7"
FT                   /protein_id="ACM25033.1"
FT                   /translation="MREYCPVPGDISVFNFLKKLFGGAGRREARIEQPAPRQTQPDSQP
FT                   ATIKSLDLNIPDEALQDEARFAAYLQERLPFFGDVLKVDYDPGAGSLTMHNRNGNTITK
FT                   FLNNALLALREKQGQARAQALLHYLNVTEAAAGAGDLGKVLPVLKSRSFVDVARRQMMQ
FT                   AVRSEREPPQFVYLDEAEDLVRLFVVNGETTVSYVMTSTLDHWGMDAGELAETAQDNLY
FT                   KFLSKTGVQIAKRSQFQYVEIDGQFESSVAFLPKFWAQVQDQSGGAAPIAAFLSRDKVF
FT                   FTHENDAPGLQLLELISADLSDVPYVISPDQYRWENGKWSLFKRVGRTMQ"
FT   gene            277994..280168
FT                   /locus_tag="Arad_0314"
FT   CDS_pept        277994..280168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0314"
FT                   /product="small-conductance mechanosensitive channel
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25034"
FT                   /db_xref="GOA:B9J6S8"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6S8"
FT                   /protein_id="ACM25034.1"
FT                   /translation="MGVVGGQGRSVGVLLLCLFGFAMPVVALAQSAATTPAAVAAPPPE
FT                   KVRELIQLMNEPDVKQWLAAQVNTTSSTTAAPASDPGMGGGQMSELSDTLGHTRRHLET
FT                   VSGAVMTLPSEVMAASQKLEAEGEAAGRLRIGIQALVLFFLGLVAEWVVGRLINAKHTQ
FT                   RTKEAAGVETELQAARFQFMGGVVPAIVHGLATLIPLLIFDWPPIIESFAIACVIAFVS
FT                   MRLAISIGKLLMELIAMRRASDVLDEDGGVARIAERRRVATYWYRRGALFVIYFSCGWA
FT                   VMQAIVPLGFSNGARYLVGYTLGIGLFLIAVEAVWSRPSQAGKPGRTAISWLLTVYFAA
FT                   LWCLWVTGFDGLLWVGIYTILLPRALSVSSRAVEALHDAAGGVFGTGSLAAVFLDRGVR
FT                   ALIIAFAAFWLGRMLGVEADMMMRTPESGIDRVARGILGGIVVLLAADLIWHLAKTYID
FT                   GKLMQALPLVSDSEELRASRARLQTLLPIFRNILAVVIVIIAIMMVLSGLGIQIGPLIA
FT                   GAGVVGVAVGFGAQTIVKDVISGMFYLWDDAFRVGEYIESGNHKGVVESFSLRSVKLRH
FT                   QRGPLATVPFGSLGAVNNMNRDWAIDKIIVKVTYDTDLVKMKRIIKDIGQRLLDDEELA
FT                   PNIIQTLKMKGVEQFGDFAIEIRLAFTAKPNELSAIRRSALAMIKQAFDENGIQFAFPT
FT                   VQVAGDRDASAAAARQLMEMRAANIEPQAG"
FT   gene            complement(280253..281323)
FT                   /locus_tag="Arad_0315"
FT   CDS_pept        complement(280253..281323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0315"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25035"
FT                   /db_xref="GOA:B9J6S9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6S9"
FT                   /protein_id="ACM25035.1"
FT                   /translation="MEALLVKGTIKLADVAKAAGVSQGTASNVFSRPDVVREEVREHVL
FT                   ETARQLGYPGPSLTGRLLRAGKVNAIGVAAVEPLAYFFDDPWARALLAAVAQVCDASGT
FT                   GLALVSAKDRQKLDWNIKSALVDGFILLCVEAGEKLVQLTRERQLPFIALALNDDDPSI
FT                   PSIGVNNIGGAAAAATHLVELGHRRFAVLATKFVNDHVGLVGTGEIERAIYSTSRHRAI
FT                   GYWQALEASGIQRQDIPIYETNNDKTSVETCLEHLFSAPKPPTAILAMSDNIALLAMSW
FT                   LAARGLTVPGDVSIIGFDGVPEGGMVEPGLTTVAQPFAEIAQRAVQAVLEDAMPTEREM
FT                   IDVTLVVRGSTAAPKT"
FT   gene            281463..281762
FT                   /locus_tag="Arad_0316"
FT   CDS_pept        281463..281762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25036"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6T0"
FT                   /protein_id="ACM25036.1"
FT                   /translation="MLTNYFFRDLYNDRWGDPANPNAVEPSSLEDNHRSRSQGVLGRLA
FT                   RFFQRRRRRPSAWSFTISCESPDTENCTNGHYRSQCDIMQPKFLNLAKALSRNC"
FT   gene            complement(281785..282513)
FT                   /locus_tag="Arad_0318"
FT   CDS_pept        complement(281785..282513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0318"
FT                   /product="short chain dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25037"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6T1"
FT                   /protein_id="ACM25037.1"
FT                   /translation="MSTPSAVIVGVGAEQGLGAALCRLLADKGYHVVIAGRTLDKITKV
FT                   ADGINASGGSAEAIETDATDEAAVTRLFDHAFAPRDGIDPPDFIVFNAGINRPIGFRDV
FT                   TAAEFEEFWRICCFGGFLVGREAARHLAPLGRGTVIFTGASASLRGKAGYAQFAAAKAG
FT                   LRMISQSMAREFGPLGLHVAHTIIDGGIDGDRLRLRRPEIQADSLLNIDAIAETYWHIH
FT                   RQHPSAWTQEIDLRPYKENF"
FT   gene            complement(282510..283631)
FT                   /gene="nerA"
FT                   /locus_tag="Arad_0319"
FT   CDS_pept        complement(282510..283631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nerA"
FT                   /locus_tag="Arad_0319"
FT                   /product="glycerol trinitrate reductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25038"
FT                   /db_xref="GOA:B9J6T2"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6T2"
FT                   /protein_id="ACM25038.1"
FT                   /translation="MTATLFSPLSVGPYELAHRVVMAPLTRMRASQPGNVPSPMNVEYY
FT                   AQRASEGGLIISEGSQISPSGQGMPATPGIHTLEQIIGWKAVTDAVHAKGGRIFLQLWH
FT                   VGRISHSSHQPGGAAPIAPSAVAASGQAFTASFERVPFETPQAIDIDLMPLLIDVYAQA
FT                   AANAKQAGFDGVEIHGANGYLIEQFLQARSNQRTDQYGGSIENRTRLLLDVVEAVSKVW
FT                   GSNRVGVRLSPFGIANDSGEDDPLRLYGHVIRELDRLHLAYLHLIEPRASGAGQAEVDH
FT                   KNVPSAAELFRPAWSGTLIAAGNFKPETAEAALAAGHADAIAFGRLFIANPDLPERIRQ
FT                   GAPLNPYHRPTFYGGGTEGYTDYPTLDAREAAE"
FT   gene            complement(283836..284642)
FT                   /locus_tag="Arad_0320"
FT   CDS_pept        complement(283836..284642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0320"
FT                   /product="peroxidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25039"
FT                   /db_xref="GOA:B9J6T3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6T3"
FT                   /protein_id="ACM25039.1"
FT                   /translation="MEFKDDDLEIFAAEGATPLPATDIQGHVEHDGVRIWYAAYGEGQP
FT                   VILLHGGLGNGGNWGHQVPALVEAGYQAVVIDSRGHGRSTRDPRPYKYELMASDVLAVM
FT                   DRLNIEKAAIVGWSDGACTGLIVARTHPARIAGVLFFACNMDPSGAKEFVPTPIVDRCF
FT                   SRHVKDYAALSATPDQFDAFVEAVGLMQRTQPNYSVTDLAEIDVPVTIVHSEHDEFIKR
FT                   EHADHLARSIPGAELILLPGVSHFAPLQRPAQFNGAMLAFLARITA"
FT   gene            complement(284738..285610)
FT                   /locus_tag="Arad_0321"
FT   CDS_pept        complement(284738..285610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0321"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25040"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6T4"
FT                   /protein_id="ACM25040.1"
FT                   /translation="MFAILGATGKIGRTTIAALRERGAPVRAILRDRSRAQEFVDLGCE
FT                   VAVADMADAGALSDAIDGARAVQVICPIDVRAIDARAEMLRLIETMGEALDKANPELVL
FT                   AISDYGAEVKSGTGITLLFNALEARLRKLRSRKIFLRSAEHMENSARVTRVAVETGQLH
FT                   SFHHPLTKLFPTVSAFDVGAIAADLLLEEKDMSLRIVHAEGPRRYTPNDVAAVITSLVA
FT                   RPVVARELPRSQWEAILTRGGLSESYARLVTELYEAHNAGRIDAERDVGEIRRGTSELT
FT                   EALRQFVTP"
FT   gene            complement(285712..286590)
FT                   /locus_tag="Arad_0322"
FT   CDS_pept        complement(285712..286590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0322"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25041"
FT                   /db_xref="GOA:B9J6T5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6T5"
FT                   /protein_id="ACM25041.1"
FT                   /translation="MDQFGNPNLSKNGAANILLSSRHLGWAGLNAELLHIRAGRTYVPG
FT                   LPSHRLGVHFGRAVNAHCQCDGRHSLRIQKHGDIDVVPAGLDGWWEDDADCTILRLGIG
FT                   PELLSTAATAMGRNPETVSLAPKFQLRDARIESIAWAIKTELEASVPSDRLYGETLALA
FT                   LAIRLVENGDQSGGEKPATVRSLSALQRRRLVDFIEDHIDQSLSLADLAAVSGLSLSHL
FT                   KPLFRATFDMPMHQYVLTRRVERARLMLLSEDMPLSQVALETGFAHQSHMAHWMRRILG
FT                   ITPGMIARTRQ"
FT   gene            complement(286735..287196)
FT                   /locus_tag="Arad_0323"
FT   CDS_pept        complement(286735..287196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0323"
FT                   /product="acetyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25042"
FT                   /db_xref="GOA:B9J6T6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032962"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6T6"
FT                   /protein_id="ACM25042.1"
FT                   /translation="MPNLPMIRPVARKDFDQWLLLWEGYNAFYGRSGATALAPEITQMT
FT                   WARFFDAYEPMHALIAENEGQLVGLTHYLFHRSTTAIQPSCYLQDLFTLEAARGKGVGK
FT                   ALIGEVYERAAEAGAARVYWQTHETNLAAMKLYDQVAERSGFVVYRKLF"
FT   gene            complement(287279..287710)
FT                   /locus_tag="Arad_0324"
FT   CDS_pept        complement(287279..287710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0324"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25043"
FT                   /db_xref="GOA:B9J6T7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6T7"
FT                   /protein_id="ACM25043.1"
FT                   /translation="MPTDADELGRLILEVFRLNGRLLARGDEIVGPIGLTSARWQVLGA
FT                   IARPRNGRTVAQIAKEAGVARQGVQRIVNELVRDGLVEFRDNPHHKKAQLVVLTGKGSD
FT                   TYEAADQLRRDWIGALAAKFQSADIAKAIDVLAALRQGL"
FT   gene            287807..288148
FT                   /locus_tag="Arad_0325"
FT   CDS_pept        287807..288148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0325"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25044"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6T8"
FT                   /protein_id="ACM25044.1"
FT                   /translation="MKTESIFRVDKFAVPAQSRDAFMARLQVTHKTLGAADGCVQNLVL
FT                   EQVSGAGEFNVVTIVEWRDTAAYENARQAAQQRQKENGFDPQSYFRELGIKADLGNYTP
FT                   MSEGFSSAL"
FT   gene            complement(288232..289122)
FT                   /locus_tag="Arad_0326"
FT   CDS_pept        complement(288232..289122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0326"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25045"
FT                   /db_xref="GOA:B9J6T9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6T9"
FT                   /protein_id="ACM25045.1"
FT                   /translation="MRFDLTDLRLFLAVVDAGSITHGAADVGLSLAAASERLRDMEATG
FT                   EVRLLERGRRGISPTPAGEALAHHARLIQRQMAQMHGELGEHASGLRATLRLAANTATI
FT                   TEFLPERLAPWMAAHPQIDIELKERQSIEIAKAVAAGLAEIGILWDAVDTSGLELRPFA
FT                   IDRLVVVMPRDHALAEKKRIAFADILHHHFVGLSGGALQDHIDAQAARIGVKLKMRVRL
FT                   RTFKAICQMAADGVGLGIVPETAARRCGRSTKITAIRLADDWATRRLSVCIRAREELTA
FT                   PARDLFEHLASHGMQ"
FT   gene            289173..289970
FT                   /locus_tag="Arad_0327"
FT   CDS_pept        289173..289970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0327"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25046"
FT                   /db_xref="GOA:B9J6U0"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6U0"
FT                   /protein_id="ACM25046.1"
FT                   /translation="MDHPHCVGRQIPYVSGMMDHSILLVVAIAATFFAAGIVKGVTGMG
FT                   LPTVAMGVLGALISPLAAAGLLIAPSFVTNVWQLFAGPKFGSLLRRLWPMMLAIVVGTV
FT                   VGSSLLTSGDTMLTTAALGAALVIYAAYTLTARQLRVPARLEPWLSPAIGLVTGAVTGG
FT                   TGVFVIPAVPYLQALGLEKDDLVQALGLSFTISTIALAAGLAWRGAFRLDNLAMSALAI
FT                   LPALAGLWVGQLIRNSVSPATFRLWFLICLLLLGAEMLARPFL"
FT   gene            complement(289991..291286)
FT                   /locus_tag="Arad_0328"
FT   CDS_pept        complement(289991..291286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0328"
FT                   /product="antibiotic resistance permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25047"
FT                   /db_xref="GOA:B9J6U1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6U1"
FT                   /protein_id="ACM25047.1"
FT                   /translation="MRSDDDVVLDADFAKTKIVSDKTEQWASSHGEPRRTPPLSRAIML
FT                   LFAVASGLAVANAYFAHPMLDVMADDLGLSRAHAGLIVGATQVGYGLGLILLVPIGDLI
FT                   DRRRLVITQSLLSVAALIAIGFASSGNMLLVAMAVMGLLAVVTQAFVAYAASLAPPAER
FT                   GHIVGVVTSGIVLGILLARTVAGTLTDLSGWRTVYLVSAAATLIIVALLWKALPRQEAR
FT                   PASMSYPRLIGSLFGLLVSEPALLIRGIICMLIFANITTLLTPLVLPLSAPPFSLSHTA
FT                   IGLFGLAGVAGALGATRAGRWTDRGLGQRTTGISLALMLLAWGPISLLPHSILWLVIGV
FT                   VIIDFGLQAVHVTNQAMIYRVRPDAQSRLTAGYMVFYSIGSALGSSMSTLAYAYAGWLG
FT                   VCLLGAGISALALAFWGLTLRVMPANATRTLS"
FT   gene            291382..291840
FT                   /locus_tag="Arad_0329"
FT   CDS_pept        291382..291840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0329"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25048"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6U2"
FT                   /protein_id="ACM25048.1"
FT                   /translation="MVGRKSLSGNYCPSARSLDVIGDWWSLLIVRDAFDGLTRFGEFQK
FT                   SLGIAKNILAQRLRTLVERGILTSVPAANGGAHQEYHLTDMGRDLFPVMVALRQWGERY
FT                   LFEPGEPHSKLVDRDTGRPIRLDVRTDDGNAVTADKALILKVPVADEE"
FT   gene            complement(291889..292995)
FT                   /locus_tag="Arad_0330"
FT   CDS_pept        complement(291889..292995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0330"
FT                   /product="oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25049"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6U3"
FT                   /protein_id="ACM25049.1"
FT                   /translation="MGMTYYTLGNSGLKVPRLTLGTMTFGTEWGWGADKDTARAMFDAY
FT                   VEAGGNFFDTADAYTGGTSEAWLGEFIAERGLRDEAVIATKFSMNIAGNNPNIAGNGRK
FT                   NILRAVEGSLKRLNTDHIDLYLLHCWDRLTPPEEVMRTLDDLVRSGKVRHVGLSDVPAW
FT                   YASRAQAVAEHRGYEPVSALQMEYSLAERNIEQEFIPFGTRYGAGIMVWSPLASGFLSG
FT                   KYRSDSREQVSGRLEKVRGTSNPGFQKFTERNWAIVAELEKVSAALGRSMAQVAVNWVM
FT                   TQPGVASVILGATRLDQLKDNLGAVEFEIPPELRRRLDEVSALPPTFPYSFFGSEIQGG
FT                   LTGGKTVGYKPEGYFPDLTLSGSFAGVS"
FT   gene            293132..294046
FT                   /locus_tag="Arad_0331"
FT   CDS_pept        293132..294046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0331"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25050"
FT                   /db_xref="GOA:B9J6U4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6U4"
FT                   /protein_id="ACM25050.1"
FT                   /translation="MDRDLLAHLPVIVAVARRGGFAAAAAELGMSPSAVSHAVRLVEER
FT                   LGQPLFARTTRSVALTDAGKSLVGTLAPALQDIHERMERIRSVKGRPSGLLRINAARIS
FT                   LPLAVTPIVAAMAERYPDVEVEIFSDERLTDIVSEGFDAGIRIGEMIAQDMVAVRLTSP
FT                   FRSIVIASPGYISSRGRPMNLTDLSQHNCIGYRLIRSGGLYQWDLVQDGRDVAVAVRGS
FT                   AIVTESHSAVELALAGVGLAYVFEPLVKADIAAGRLIQVLDPYAVTEDGLFLYFPRRAE
FT                   LAPKLRAFIATARSVGHSAAPLS"
FT   gene            complement(294117..294845)
FT                   /locus_tag="Arad_0332"
FT   CDS_pept        complement(294117..294845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25051"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6U5"
FT                   /protein_id="ACM25051.1"
FT                   /translation="MESHTVFELRRYRLLPGGREPLISLFDREFVEPQEELGMRVEAEF
FT                   RDLGDHNAFVWVRSFRDMEARTEALQSFYSGPIWKKHGPDANATMLNSDNVLLLKSAGA
FT                   MQPFARNLQRKQETERPETRGIVIANTCSLAPATEGDFARFFFDRVLPIIQDAGARVDA
FT                   AFVTEQSPNGFRRLPVREGETVFVWFECHEDEAGVARYRERLRQNADWTDEIYPRMDSL
FT                   CWREIEVARLTPTSRSLCAW"
FT   gene            294941..295567
FT                   /gene="betI"
FT                   /locus_tag="Arad_0333"
FT   CDS_pept        294941..295567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betI"
FT                   /locus_tag="Arad_0333"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25052"
FT                   /db_xref="GOA:B9J6U6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6U6"
FT                   /protein_id="ACM25052.1"
FT                   /translation="MIGNRRTNDPEGVRRRIVDTAYDAFIKQGYIATGMLEIREKASVS
FT                   GGAMAHHFPAKRELGLAVIRDRVSHAVQQTWIEPLDTCVDAPAAVDLIFEGIIGELTYK
FT                   GSVSGCPLNNMAMDVSPHDPEMRVALGDIFAAWHEALSAKFQADLTSGRASDIRPSSLA
FT                   TLVIAVYSGAMAMAKARQDVGALIESRAELTALLALKYRAATPAS"
FT   gene            complement(295681..295767)
FT                   /locus_tag="Arad_5050"
FT   tRNA            complement(295681..295767)
FT                   /locus_tag="Arad_5050"
FT                   /product="tRNA-Ser"
FT   gene            296002..296319
FT                   /locus_tag="Arad_0334"
FT   CDS_pept        296002..296319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0334"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25053"
FT                   /db_xref="GOA:B9J6U7"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6U7"
FT                   /protein_id="ACM25053.1"
FT                   /translation="MRFLLRFASLVALVVAVVAGTIDSIQSVAASAVVMTPMGDAWKDV
FT                   SPSSLASVQSLISYYIHPRLYDMAMQWLLFQPAFAVFLVLSLLLWMVAYKKPPVAGRFS
FT                   V"
FT   gene            296669..297664
FT                   /locus_tag="Arad_0335"
FT   CDS_pept        296669..297664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0335"
FT                   /product="outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25054"
FT                   /db_xref="GOA:B9J6U8"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6U8"
FT                   /protein_id="ACM25054.1"
FT                   /translation="MKKSLLTLFALAAMSATALAADIKPAIVYGTGGKFDKSFNEAAYN
FT                   GAEKFKKETGIAYRDFEPTGDTQGEQALRNFASKGFNPVIAVSFAWTSALQKVAAEYPK
FT                   TEFVLIDDSLDLPNVRSVKFKENEGSYLAGVMAALSSKSGKIGFVGGMDIPLIRKFECG
FT                   YELGARAANPKIEVFQNMAGTTGAAWNDPVRGGELTKNQIDQGADVIYAAAGATGLGVL
FT                   QTAADNKKLSVGVDSNQNYLHPGSVLTSVVKRVDLAVYNAFTDAKAGKFTPGTQELGLK
FT                   EEGVGVALDDNNKPLITPEIKSAVDKATADIIAGTIKVHDYTTDNACPKS"
FT   gene            297745..299256
FT                   /locus_tag="Arad_0338"
FT   CDS_pept        297745..299256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0338"
FT                   /product="sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25055"
FT                   /db_xref="GOA:B9J6U9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6U9"
FT                   /protein_id="ACM25055.1"
FT                   /translation="MSQLPAIELVGIDKKFGAVHANKDINLTVSKGSIHGIIGENGAGK
FT                   STLMSIIYGFYQADSGEIRINGNPIAIRDSQTAIAAGIGMVHQHFMLVDNFSVLENVML
FT                   GAEGGALLAKGVAAARAELGRLETDYGLDVDPDALIEELPVGQQQRVEILKAMYRGAEI
FT                   LILDEPTGVLTPAEADNLFRILRVLRDQGKTILLITHKLREIMAITDTVSVMRRGEMVA
FT                   TRKTAETTVEELAELMVGRRVLLRVEKGTAHPGDVLLSVRNLTVKDGRGVTMVDNVSFD
FT                   VRAGEIVGIAGVAGNGQSELLEAIAGIRKPASGEICLHGKPIGSADPAALRALGLAHIP
FT                   EDRHHMGLVLKFEEYENSMLGYHRDVKYGRAGMLDLDAMRKDAIEKIEKYDIRPPNARL
FT                   KTANFSGGNQQKIVVAREIERDPKALLIGQPTRGVDIGAIEFIHRRIIEMRDAGKAILL
FT                   VSVELDEIRALSDRILVMFAGHVVGEKTADAGEQTLGLMMAGIAA"
FT   gene            299264..300367
FT                   /locus_tag="Arad_0339"
FT   CDS_pept        299264..300367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0339"
FT                   /product="sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25056"
FT                   /db_xref="GOA:B9J6V0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6V0"
FT                   /protein_id="ACM25056.1"
FT                   /translation="MSTAFVPLPNWINYGLIPLINLLLAFIVSGLVIWLIGESPIDALN
FT                   SLVQGSLGSGEAISYTLFYATSFIFTGLSVAVAIHAGLFNIGSEGQAYIGGLGAALVAL
FT                   SLDNYVPWYVTMPFAMIGAAVFGAAWAFIPAWMQAKRGSHIVITTIMFNFIGAPLMVFL
FT                   LSHVLIVPGKQAAETRTFLEGGQLPKLDWLVSMFGSSIGAAPLNVSFLIALVMCFLVWL
FT                   LIWRTKLGYEMRTLGLSPTAAVYAGIPYARTVIISMLISGGLAGMMALNPVMGAQARLG
FT                   VEFVAGAGFVGIAVSLMGRNHPLGIIFAAILFGILSQGGDMVNFDIPTISRDMVIMIQG
FT                   LVILFVGALEYMLRPTFVRIYQLFGRA"
FT   gene            300377..301348
FT                   /locus_tag="Arad_0340"
FT   CDS_pept        300377..301348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0340"
FT                   /product="sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25057"
FT                   /db_xref="GOA:B9J6V1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6V1"
FT                   /protein_id="ACM25057.1"
FT                   /translation="MDYYDILISVLGSTIRLSIPLIFTALAGLFSERAGVFDIGLEGKM
FT                   LAAAFAAACMATVTGSAWAGLGAGIVVSVTFGLLHGFASITNRGNQIVSGVAINFLIAG
FT                   LTVVLGQAWFGQGGRTPQLGADARFVPIILPGADAMRGVPIIGPLYANVISGNNILTYI
FT                   AFLAVPISWWILYRTRFGLRLRAVGENPGAVDTAGISVAWLRYRSLICAGILCGFSGTY
FT                   LAIAQSAGFIANMSAGKGYIALAALIFAKWKPVPVMLSCLLFGFLDAFSNFMQGKSVPG
FT                   IGEVPVQIFQALPYILTCILLAGFIGVAKPPKAGGVPYTKER"
FT   gene            301352..301744
FT                   /gene="cdd"
FT                   /locus_tag="Arad_0341"
FT   CDS_pept        301352..301744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdd"
FT                   /locus_tag="Arad_0341"
FT                   /product="cytidine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25058"
FT                   /db_xref="GOA:B9J6V2"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6V2"
FT                   /protein_id="ACM25058.1"
FT                   /translation="MSHDLFEAARGAMAFAHAPYSKFPVGAAIRAEDGKIYAGANIENL
FT                   SFPQGWCAEPTAISHMIMGGAKKIVEMAVIAEKLPLCPPCGGCRQKIAEFASKETRVYL
FT                   CDEAGVRKMMTMDELLPFSFETEILG"
FT   gene            301741..302541
FT                   /locus_tag="Arad_0344"
FT   CDS_pept        301741..302541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0344"
FT                   /product="purine nucleotide phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25059"
FT                   /db_xref="GOA:B9J6V3"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011268"
FT                   /db_xref="InterPro:IPR011269"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6V3"
FT                   /protein_id="ACM25059.1"
FT                   /translation="MTAAVDILAAKLGDLQPSYGIVLGSGLGSLVDQVQDAVRVPYAEI
FT                   PGFPVSAVSGHAGTLVAGRLGNVPVIMLSGRVHYYEKGDANAMRVPIETLKALGVETLI
FT                   LTNSAGSLREEMPPGSVMQITDHINYSGMNPLIGEESDKRFVGMTSAYDADLIMRMRKA
FT                   AEKAEIKLSHGVYMWFSGPSFETPAEIRMARILGADAVGMSTVPEVILARLFGLRVAAA
FT                   SVITNYGAGMTGAELTHEETKDMAPVGGARLAAILTEMIADGGN"
FT   gene            302544..303317
FT                   /gene="deoC"
FT                   /locus_tag="Arad_0346"
FT   CDS_pept        302544..303317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoC"
FT                   /locus_tag="Arad_0346"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25060"
FT                   /db_xref="GOA:B9J6V4"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6V4"
FT                   /protein_id="ACM25060.1"
FT                   /translation="MTSHSLRETAAVALSLLDLTNLKDDCTPAQIETLCARAQSPYGNT
FT                   AAVCIWPRFVAQARGILGTDHAVKIATVVNFPAGDMEVADVAAEAREAIADGADEIDLV
FT                   IPYQALLAGNEQAVTDMVAAVKAECTGPVIMKTILETGELKDVALIQRASELAIEAGSD
FT                   FIKTSTGKVAVNATLEAADIMLRAIRDSGRKVGFKPAGGIGSVADAALYLSLAETIMAP
FT                   DWAMPSTFRFGASSLLDDILGVLAGGQSKTASSGY"
FT   gene            303322..304629
FT                   /gene="deoA"
FT                   /locus_tag="Arad_0347"
FT   CDS_pept        303322..304629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoA"
FT                   /locus_tag="Arad_0347"
FT                   /product="thymidine phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25061"
FT                   /db_xref="GOA:B9J6V5"
FT                   /db_xref="InterPro:IPR000053"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR013102"
FT                   /db_xref="InterPro:IPR013465"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR017872"
FT                   /db_xref="InterPro:IPR018090"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="InterPro:IPR036566"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6V5"
FT                   /protein_id="ACM25061.1"
FT                   /translation="MIPQEIIRLKRNGGILSAADINSFIGALARGELAESQIGAFAMAV
FT                   WFRGMTREEVVALTLAMARSGDTLAWSGIGRPIVDKHSTGGVGDNVSLMLAPIAAACGL
FT                   AVPMISGRGLGHTGGTLDKLESIPGYGITPDAARFRKVVDEVGCAIIGQTGALAPADGK
FT                   LYAVRDVTATVDSVPLITASILSKKLAAGLETLVLDVKIGSGAFMTSAEEAETLARSLV
FT                   EVANGAGVKTSALITDMNQPLADAAGNVVELRNCLDFLKGGKAGTRLETVVLAFAAEML
FT                   TQAGVEKTLAEAEASARDALASGKAAELFGRMVHGLGGPVDLLENPAKYLAVAPVHKPI
FT                   LASSDGWLAACDARAIGMGVIDLGGGRRRPEDKIDHRVGFSDILPLGTKVSKGDRIATV
FT                   HAADDASAEKAAADLAANYRIADTAPILPPVIVSRI"
FT   gene            complement(304635..305162)
FT                   /locus_tag="Arad_0348"
FT   CDS_pept        complement(304635..305162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0348"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25062"
FT                   /db_xref="GOA:B9J6V6"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR011969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR034122"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6V6"
FT                   /protein_id="ACM25062.1"
FT                   /translation="MLVRVLVFAGIIAVAATQVPSLLNIQIAIDENSAPMAISPPAEQQ
FT                   VSVVSLSHGSVLLPAGAGGHYQGDFKINGRPVQGMIDTGATYVAINESTARRLGISGSD
FT                   LDYRYTTQTANGSSKVALVKLDRLEIGTIKVRDVDAVVSKDGALNTTLIGMSFLKKLKS
FT                   YGAENGSLRLTQ"
FT   gene            complement(305310..305939)
FT                   /gene="upp"
FT                   /locus_tag="Arad_0349"
FT   CDS_pept        complement(305310..305939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="upp"
FT                   /locus_tag="Arad_0349"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25063"
FT                   /db_xref="GOA:B9J6V7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J6V7"
FT                   /protein_id="ACM25063.1"
FT                   /translation="MDGVTVIDHPLVQHKLTIMRKKETSTGSFRRLLREISTLLCYEVT
FT                   RDLEMTMETIETPLQPMESPILEGKKLVFASILRAGNGLLEGMLDLVPSARVSHIGVYR
FT                   DHETLQPVEYYFKAPEDISERLIIVVDPMLATGNSSIAAIDKLKERGAHNIRFLCLLAA
FT                   PEGIANFRAAHPDVPVFTAAIDSHLNELGYIVPGLGDAGDRMYGTK"
FT   gene            complement(306062..307030)
FT                   /gene="add"
FT                   /locus_tag="Arad_0352"
FT   CDS_pept        complement(306062..307030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="add"
FT                   /locus_tag="Arad_0352"
FT                   /product="adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25064"
FT                   /db_xref="GOA:B9J6V8"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR028892"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J6V8"
FT                   /protein_id="ACM25064.1"
FT                   /translation="MTSHLKKVELHCHLEGAAPPALTLAQARKYNVDTNAFMRDGVYLW
FT                   KDFAEFLVCYDKVSEVYRTEEDYALLTETYLEELAGIGTIYSELIVSPDHGDRIGLGAD
FT                   AYMEGVSAGIRAAKEKSGIEARLIVTGERHFGPERVVKAAEYAAKSDNPLISGFNMAGE
FT                   ERMGRVADYARAFDIAREAGLGITIHAGEVCGAFSVADAVELVRPARIGHGVRAIEDAD
FT                   LVKRLADLGTVLEVCPGSNIALNVFPDFPSHPLRKLRDAGVRVTISSDDPPFFHTSLKR
FT                   EYELASTAFGFSDDEINAMTRTAIEAAFLDEATRAALLARL"
FT   gene            complement(307027..308247)
FT                   /gene="deoB"
FT                   /locus_tag="Arad_0353"
FT   CDS_pept        complement(307027..308247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoB"
FT                   /locus_tag="Arad_0353"
FT                   /product="phosphopentomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25065"
FT                   /db_xref="GOA:B9J6V9"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR010045"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024052"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J6V9"
FT                   /protein_id="ACM25065.1"
FT                   /translation="MARAFLFVLDSFGVGGSPDATSYGDEGADTLGHIAEFCAAGAADR
FT                   EGLRSGPLSLPIMSGLGLLEIAKAATGRYPLGMPLPQKLYGLYGCANEISRGKDTPSGH
FT                   WEIAGTPVTFDWGYFPTEGDAFPPELVEAICKAADLPGILGNCHASGTDIIARYGEEHI
FT                   RSGKPICYTSSDSVFQIAAHEQHFGLERLISLCQIVRTLLDPYNIGRVIARPFIGETPA
FT                   NFERTGNRRDFSVLPPEPTLLDRLVAAERKVHAVGKIGDIFAHQGISRIIKANGNMKLM
FT                   DATLKTMDEAADGDLVFTNFVDFDMVYGHRRDVAGYAAALEAFDARLPEVHRKLKPGDL
FT                   LILTADHGCDPTWRGTDHTRERVPIIAYELGIRSRPIGIRQTYADIGETVAHHLGIAAG
FT                   PHGRSFL"
FT   gene            complement(308385..308963)
FT                   /locus_tag="Arad_0354"
FT   CDS_pept        complement(308385..308963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0354"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25066"
FT                   /db_xref="GOA:B9J6W0"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6W0"
FT                   /protein_id="ACM25066.1"
FT                   /translation="MAGRTMAARIYTRLRHFRRDERGIGAIEFAILFPVLLMLYLGAFE
FT                   ITVGLSVEKRTSRAAGSIADILTQKTSTTKAELATMPSVAGAIFTPYATTGLTLKVTGI
FT                   QIDAGSSATVAWSWAQDGSKPYTAGSAVTVPSDLNLPSSFLVRTELAIPYQILSFGSDF
FT                   LPAGSNQITIGRSYFYRPRGVDPITCSDC"
FT   gene            complement(308978..309691)
FT                   /locus_tag="Arad_0356"
FT   CDS_pept        complement(308978..309691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0356"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25067"
FT                   /db_xref="GOA:B9J6W1"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6W1"
FT                   /protein_id="ACM25067.1"
FT                   /translation="MCASSKYGGRRETDCQGSHPSLATIQIAADSVMTQDDALLGDKAF
FT                   APRRAKRGLRAFGRAHDGAAAIEFALLAIPYFMIIFAILETFVAFIAEQVVSNAVDTLS
FT                   RQVRTGQITATNTTGQQFRQAFCNEISVLIACSAAELATPTNLYLDVKSYSTFADMPTT
FT                   IPRVSSDPYSDLNTTGFSFAPGGTGTINMVRAYYRWQIIIDLLRPYLTNIHPSDGSMPS
FT                   TYLIVATGAFQNENY"
FT   gene            complement(309754..310173)
FT                   /locus_tag="Arad_0357"
FT   CDS_pept        complement(309754..310173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0357"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25068"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6W2"
FT                   /protein_id="ACM25068.1"
FT                   /translation="MPIRGRTAFLAGVAAMAGLMPQLSRAADDGMLRVYMDHARVLKLD
FT                   RPVSKVIVGNAQVADATVADPKTIVLTGRSFGTTNIVLLDADGNAIVDERILVSIDEGN
FT                   TVRVFRQTNRSVLSCTPNCEQHAQQNNNAAAATSQ"
FT   gene            310578..310760
FT                   /gene="pilA"
FT                   /locus_tag="Arad_0358"
FT   CDS_pept        310578..310760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilA"
FT                   /locus_tag="Arad_0358"
FT                   /product="component of type IV pilus"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25069"
FT                   /db_xref="GOA:B9J6W3"
FT                   /db_xref="InterPro:IPR007047"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6W3"
FT                   /protein_id="ACM25069.1"
FT                   /translation="MTKLFSRFLKDESGATAIEYGLIAALISVAIIAGATTLGNTLSTT
FT                   FNGISTKMNTASVAH"
FT   gene            310847..311029
FT                   /gene="pilA"
FT                   /locus_tag="Arad_0359"
FT   CDS_pept        310847..311029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilA"
FT                   /locus_tag="Arad_0359"
FT                   /product="component of type IV pilus"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25070"
FT                   /db_xref="GOA:B9J6W4"
FT                   /db_xref="InterPro:IPR007047"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6W4"
FT                   /protein_id="ACM25070.1"
FT                   /translation="MTKLFSRFLKDESGATAIEYGLIAALISVAIIAGATTLGNTLSTT
FT                   FNGVSDKMNTASVAH"
FT   gene            311123..311635
FT                   /gene="cpaA"
FT                   /locus_tag="Arad_0360"
FT   CDS_pept        311123..311635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpaA"
FT                   /locus_tag="Arad_0360"
FT                   /product="prepilin peptidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25071"
FT                   /db_xref="GOA:B9J6W5"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6W5"
FT                   /protein_id="ACM25071.1"
FT                   /translation="MLEAATLLIFPLCLSVAAISDLLTMTIPNRVSLILLGAFIVLAPF
FT                   VGLTLPEIGMHVAGAAIVFCACFALFALNVMGGGDAKLLAASALWFGFDPSLLAFLVYV
FT                   AFIGGAVTIAILMIRSQSSAIMAMGLPLPNSLLIAKKIPYGIAIAIGGFLAFPSSPLVV
FT                   AAASHIL"
FT   gene            311801..312613
FT                   /gene="cpaB"
FT                   /locus_tag="Arad_0362"
FT   CDS_pept        311801..312613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpaB"
FT                   /locus_tag="Arad_0362"
FT                   /product="pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25072"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017592"
FT                   /db_xref="InterPro:IPR031571"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6W6"
FT                   /protein_id="ACM25072.1"
FT                   /translation="MKPARIMILAVAVVTAGLAGLLAMHLAGSRNIVQQVETVVEKEAT
FT                   VNVLVADANLPVGSRLNEKSIHWMAWPQSGVVKGLITQAERPDALKDLNGAVVRLPIFE
FT                   GEPIREEKVADASSRILSSLLPSGKRAVATEISVATGAGGFILPNDRVDVIMVRKGDTQ
FT                   KFVTETVLSNVRILAVDQQIEEKQDGSKAVVGTTATLELTPDQTKVLAVAQQMADRLTL
FT                   ALRSVADAQQPDTTAADYLLSGDNGGAVVQVIKSGAIIANGTAAAKTQ"
FT   gene            312610..314127
FT                   /gene="cpaC"
FT                   /locus_tag="Arad_0363"
FT   CDS_pept        312610..314127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpaC"
FT                   /locus_tag="Arad_0363"
FT                   /product="pilus assembly secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25073"
FT                   /db_xref="GOA:B9J6W7"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6W7"
FT                   /protein_id="ACM25073.1"
FT                   /translation="MRRGGTMLKISQITGLPLLAALSFSVAFAGLPIAEAPVFLRTAVA
FT                   KADGADSIVTISGLNTKRTLKLGLNKALVVDLPADAHDILVSDPKMADAVTRTSRRIYL
FT                   FGKTVGQTNIFVFGANGQEIVSLDLQIERDISGLQANLKRFIPDSDINVEIVSDNIVLT
FT                   GSVRTPQDSSRAQQLAGAFLKGGEATTRTETASGTGGDSSVALFAEGRQTSQIVNLLQI
FT                   EGEDQVTLKVTVAEVKRSVLKQIGFDNLVSNSSGLTVAQLGNISSDSTAATGNGGLSAL
FT                   FKTALGKYNVSSYLNAMEQAGAVRTLAEPTLTAISGQAATFNSGGQTLYSVIDSDGNVT
FT                   ITPYTYGISLAFTPVVLSAGRISLHVQTQVSEPTGTTGAATYNRRAADTSVELPSGGSI
FT                   ALAGLLSDNVQQSTTGTPGASKIPILGALFRQKTFQRDESELVIIATPYLVRPVARNQI
FT                   ARPDDNFSPTNDAGVFFMNRVNKIYGRKDAPPVADADFHGTVGFIYK"
FT   gene            314181..314888
FT                   /gene="cpaD"
FT                   /locus_tag="Arad_0364"
FT   CDS_pept        314181..314888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpaD"
FT                   /locus_tag="Arad_0364"
FT                   /product="pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25074"
FT                   /db_xref="InterPro:IPR013361"
FT                   /db_xref="InterPro:IPR019027"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6W8"
FT                   /protein_id="ACM25074.1"
FT                   /translation="MASLDRNAPRTGGPRFAALAMIVMATAVSGCAGSRDGMTTSAITD
FT                   DYRQRHPIVLTDKEHRVDIPVSVSDRRLTSGMRDTVRGFVQDYRAHATGTVEIMTPRES
FT                   ANSAAASALRRQIRQELMASGIPSARITDNYYPAGGPGDAAPIRLRFMATAAVTNACGQ
FT                   WPADLADNAFDNQNYYNFGCATQNNLAAQVANPTDLIAPRAMTPIDADQRSKVIDNYRS
FT                   GSTATSTASVSSF"
FT   gene            314926..316197
FT                   /gene="cpaE"
FT                   /locus_tag="Arad_0365"
FT   CDS_pept        314926..316197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpaE"
FT                   /locus_tag="Arad_0365"
FT                   /product="pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25075"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6W9"
FT                   /protein_id="ACM25075.1"
FT                   /translation="MSAIDYDIRPTAADAEDAPRTGDIENMRPLPRISVHAFCESEQLH
FT                   QVMDRCANDRRMSKVNLRITGGSTAAAANMFASAPTPNLIILETRANPQNLLAELAPLA
FT                   AVCDPTTKVVIVGHHNDISLYRELIRNGISEYIVQPVTMTDIMAAMAAIFVDPDAEPIG
FT                   RSVAFIGAKGGVGASTIAHNCAFGISNLFSVETILADLDLPYGTANIDFDQDPAQGIAE
FT                   AVFAPERLDEVFLDRLLTKCSQHLSLLAAPSMLDRAYDFEGQAFQPVLDVLQRSAPVTV
FT                   LDMPHLWTEWTRSVLSSVDEVVICAVPDLANLRNAKNMLDALRKLRPNDKAPHLILNQV
FT                   GMPKRPEIGPSEFCEPLETDPIAIIPFDINLFGNAANSGRMISETDPKSPIAETFSQIS
FT                   HIVTGRVALKKAKKGGLLGLLKRK"
FT   gene            316445..317761
FT                   /gene="cpaF"
FT                   /locus_tag="Arad_0367"
FT   CDS_pept        316445..317761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpaF"
FT                   /locus_tag="Arad_0367"
FT                   /product="pilus assembly secretion ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25076"
FT                   /db_xref="GOA:B9J6X0"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6X0"
FT                   /protein_id="ACM25076.1"
FT                   /translation="MQTPTRRRPVRTEEYYDTKSQVFAALIDTIDLSQLSKLDAEAARE
FT                   EIRDIVNDIITIKNFAMSISEQEELLEDICNDVLGYGPLEPLLARDDIADIMVNGAGQT
FT                   FIEVGGKTIESEIRFRDNAQLLSICQRIVSQVGRRVDESSPICDARLPDGSRVNVIAPP
FT                   LSIDGPVLTIRKFKKDKLTLDQLVRFGAITPEGATLLQIIGRVRCNIVISGGTGSGKTT
FT                   LLNCLTNYIDRHERVITCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRM
FT                   RPERIIVGEVRGPEVFDLLQAMNTGHDGSMGTLHANTPRECLSRIESMIAMGGYSLPAK
FT                   TVREIISTSVDVIVQAARLRDGSRRITQITEVIGMEGDVIITQDLMRYEMEGEDANGRI
FT                   IGRHMSTGVGKPHFWDRARYYNEEKRLAAALDEMENNSK"
FT   gene            317772..318779
FT                   /locus_tag="Arad_0368"
FT   CDS_pept        317772..318779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0368"
FT                   /product="pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25077"
FT                   /db_xref="GOA:B9J6X1"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6X1"
FT                   /protein_id="ACM25077.1"
FT                   /translation="MFGVDPVVLLIVVLAAVSAAAVCYGVLYSQIEAQKKTDSRVSRVK
FT                   AAESDRTKVKVARDRVQEMSKRRKSVQDTLKDLEKRQVENTKKKQSLKARLVQAGLSLT
FT                   PARFYVFSVLFGLFVMVVAFLFGAPLAVIAGLPFAAAFGLPRWVVGFLIKRRQNKFLEE
FT                   FPNALDLITRSIRSGLPLNDAVRLVASEAREPVRTEFRRVVETQQVGLSMTDACARMNN
FT                   HMPLQEVNFFSIVIAIQAQAGGNLSEALGNLAKVLRERKKMKAKVVALSMEAKASAVII
FT                   GALPFIVMLLVYLTSPQYMMILFTDPRGHLIMLLAGIWMAFGVIIMRQMVNFDI"
FT   gene            318801..319778
FT                   /locus_tag="Arad_0369"
FT   CDS_pept        318801..319778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0369"
FT                   /product="pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25078"
FT                   /db_xref="GOA:B9J6X2"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6X2"
FT                   /protein_id="ACM25078.1"
FT                   /translation="MADIAAKLTDPGMILAVFVAIAVFATFYTIAVPFLERGDLNKRMK
FT                   AVSTEREQIRARERARLNTDGSKASLRSQNNKNVRQIVERFNLRNALVDTNTVNRLRAA
FT                   GLRSENALNMFLVARFLLPFLFLAVAVFLVFGLGYFAAKPFAFRLLGVIGTAYLGFYSP
FT                   NIYISNRVTKRQKSIKRAWPDALDLMLICVESGISIEAGMRRVSEEMAEQSPALAEEMV
FT                   LTTAELSFLQDRRTAFDNLAARTQIEIVKSVTQALIQAERYGTPVSQALRVMAQEGRDE
FT                   RMNEAEKKAAALPPKLTVPMIVFFLPVLMAVILGPAIIQVMDKF"
FT   gene            319922..320566
FT                   /locus_tag="Arad_0370"
FT   CDS_pept        319922..320566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0370"
FT                   /product="amino acid efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25079"
FT                   /db_xref="GOA:B9J6X3"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6X3"
FT                   /protein_id="ACM25079.1"
FT                   /translation="MSSFAIFFTVIAAVLIGAVSPGPSFVLVSRIAVSCSRQAGLAAAF
FT                   GMGTGSVIFATLALFGLSALLMQVEWLYLALKIAGGLYLIYIGIRIWRGAAQDLALDAP
FT                   ASPAGASVARNYWFALGTQLSNPKTAIFYGSIFAALLPAQPPLWLLLALPPAVFVIEAG
FT                   WYTVVTLAFSSNRPRALYLGSKLWIDRVAGAVIGALGARLVSEGLPRHIWR"
FT   gene            complement(320571..321398)
FT                   /locus_tag="Arad_0371"
FT   CDS_pept        complement(320571..321398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0371"
FT                   /product="pilus assembly protein (contains TPR repeats)"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25080"
FT                   /db_xref="GOA:B9J6X4"
FT                   /db_xref="InterPro:IPR011717"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR014596"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6X4"
FT                   /protein_id="ACM25080.1"
FT                   /translation="MSAASTTSLLKTFLFRGASAALLALALAGCSTTGKDKMTTGSIPT
FT                   VSKPIDQMDSADLARATLTLGKAYDTNPKDRDTGVNYANVLRMTGRNEQALAVMQQVAI
FT                   NHPSDRGVLAAYGKAQAAAGQLQEALATIDRAQLPDRPDWRLVSAEGAILDQLGRSNEA
FT                   RGKYRDALVLAPNESSILSNLGMSYVLTGDLKTAESYLRSAAGQQAADSRVRQNLALVV
FT                   GLQGRFPEAEQIARQELTQQQADANVAYLRGMLTQQNSWQKLAASDSAKKAVN"
FT   gene            321546..322937
FT                   /locus_tag="Arad_0372"
FT   CDS_pept        321546..322937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0372"
FT                   /product="leucine aminopeptidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25081"
FT                   /db_xref="GOA:B9J6X5"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6X5"
FT                   /protein_id="ACM25081.1"
FT                   /translation="MAPYQYIERATPFNSKGGATLPIFAVTPAHIDTGTIDPIALDWAH
FT                   KAGYKAESGSLLLIPTAEGHLGGALFGLGSNPSEQPFLTGKLARSLPAGEWHIETAPLT
FT                   ANRLSLGFGLGSYRFDRYKSEKAAGPTLMIPRDADAADIKRQLAGVFLARDLINTPTND
FT                   MGPEQLEAAFRALAEHYKAEMSVIIGDDLLKENFPLVHTVGRASADAPRLLELRWGKKG
FT                   HRRITLVGKGVCFDTGGLDIKPASSMLLMKKDMGGAANVMGLALMIMDAKLKVDLRVIV
FT                   PVVENSISANAFRPGDIYRSRKGLTVQIDNTDAEGRLILADALAYADEDAPDLMIDMAT
FT                   LTGAARVALGPDLPPFFTDDNDLARDLTEASLETDDPLWRLPLYNGYDKDIRAKFADIT
FT                   NAPSGGMAGSITAALFLRRFVTKTPSWVHFDIYGWAQNERPHSPGGGEAQAIRALYHHI
FT                   RESVR"
FT   gene            323247..323603
FT                   /locus_tag="Arad_0375"
FT   CDS_pept        323247..323603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0375"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25082"
FT                   /db_xref="GOA:B9J6X6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6X6"
FT                   /protein_id="ACM25082.1"
FT                   /translation="MPLPLELSASQALGLWHGVALEQVRREDHDLTLRQTTILLQIYLV
FT                   PPPHTVRGLAATLGVTKPVITRALDTMGEMGLVDRVRDDRDRRNVIIKRTVTGALYLEK
FT                   LGDLVIAQGRKLSV"
FT   gene            323615..324469
FT                   /locus_tag="Arad_0376"
FT   CDS_pept        323615..324469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0376"
FT                   /product="endopeptidase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25083"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR041382"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6X7"
FT                   /protein_id="ACM25083.1"
FT                   /translation="MTLDHRLNAYRPDLAEASLRGRVEAERFVEGARAQVVVPVVALRP
FT                   QPDLARGIDTELLLGEDVTVFERKDGWAWVKAVSDGYVGYLPEDTIKEGLVAPTHIVVP
FT                   QRTFLYPEPELRKPYTGVLSMGSRVRVTGTAEARGNHYVVLEDGTAIFAKHVQPIGYND
FT                   GGDYVDVAAKFMETPYLWGGRSGLGVDCSSLIQLALLMTGRAAPRDSDMQAAGLGESIA
FT                   REELKRGDFVFWKGHAAVMEDAETIIHANGHTMTVARENFAAAVERIGWLYEYPTGYRR
FT                   LGD"
FT   gene            324547..324786
FT                   /locus_tag="Arad_0377"
FT   CDS_pept        324547..324786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25084"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6X8"
FT                   /protein_id="ACM25084.1"
FT                   /translation="MPITAMEQSIRDILGDSHLRRSRKIDRLLELQSEARGIQRAGSES
FT                   TMSADDGLQDDLRVIEKALQDLGADVEEKGAATL"
FT   gene            complement(324795..326186)
FT                   /gene="gatA1"
FT                   /locus_tag="Arad_0379"
FT   CDS_pept        complement(324795..326186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA1"
FT                   /locus_tag="Arad_0379"
FT                   /product="glutamyl-tRNA amidotransferase subunit A protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25085"
FT                   /db_xref="GOA:B9J6X9"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6X9"
FT                   /protein_id="ACM25085.1"
FT                   /translation="MTETTDLSIRQLLEKFSAKSLSPSEYWLALETHIAAWEPTIAALY
FT                   AYDPEDARKQAAASTERWAKGTPLGPLDGIPVTLKELIATKGQPVPLGTAAVELVSATE
FT                   DAPIAARMREDGAVIFAKTTCPDYGMLSSGLSSFHKLSRNPWDPSQNPGGSSAGASAAA
FT                   AAGYGPLHIGTDIGGSVRLPAGWTGIFGFKPSHGRIPVDPYYVGRCAGPMTRTVEDAAY
FT                   SMATLSRPDWRDGTSLPPNDFDWMDLDIDVRGLKIGLMLYAGCGLPVDDDVRDAVVAAA
FT                   KRFEEAGAIIIDVAPVLTRQMLDGLDVFWRARFWGDIVNLSEERREMILPYIHSWAKGG
FT                   ADVSGVDAVRGFNQTIEMRKSCGKLFTQVDAVLSPTNPIVSYPAEWASPTNDPALPFEH
FT                   IGFTVPWNMSEQPASSINCGFSRSGMPIGLQIVGPRFGDMLVLKLSKAFETWSGGMTNW
FT                   PKAPG"
FT   gene            complement(326212..327069)
FT                   /locus_tag="Arad_0381"
FT   CDS_pept        complement(326212..327069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0381"
FT                   /product="dipeptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25086"
FT                   /db_xref="GOA:B9J6Y0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6Y0"
FT                   /protein_id="ACM25086.1"
FT                   /translation="MTMAETASPRRFRFRALRRANLIIGAIIILALVGVAVLSLFWTPL
FT                   PPAKMQIIHKLQPPLGFGLLGTDQLGRDVLSMLMAGCWNSLSISVSAVAIGGTIGTMIG
FT                   VAAAAQRGLFEALVMRACDVIFALPPILSAMILGAFLGTGRLTAIIAIATFMVPVFARV
FT                   ALSSALQAWSRDYVMAARAIGNTPFSITMRHVLPNILSGIIVQATIQLGLAILTEAGLS
FT                   FLGLGVPPPAPTWGRMLADAQTYLGLAPWLAILPGLAIALSVLGFNMLGDGLRDLLDPR
FT                   EARR"
FT   gene            complement(327066..328019)
FT                   /locus_tag="Arad_0382"
FT   CDS_pept        complement(327066..328019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0382"
FT                   /product="dipeptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25087"
FT                   /db_xref="GOA:B9J6Y1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6Y1"
FT                   /protein_id="ACM25087.1"
FT                   /translation="MIVLLTRRIMGLFLTLIAVSLLLFAVMALLPGDPAAITLGTSATP
FT                   ETLAALRHEMGLDQSLILRYGQWLGGALTGDLGMSYTYGVPVAGLILERLAVTLPLAIL
FT                   AILLSILIAVPLGVAAAAKRGGVFDIIATLFSQMSIAVPGFWVGLLLILLFATSLGWMP
FT                   AVGFPGWGNGLWPALKALIMPAVALALPQAGVLTRVTRSAVLDTLHEDFARTAVAKGLS
FT                   RNAVLWGHVVPNALMPVMTILGLQFTFLVAGAVLIENVFNLPGLGRLAYQALSQRDVIV
FT                   LQDVVLFFAGLVIVVNFLVDLSYLVIDPRLRSGGAR"
FT   gene            complement(328068..329597)
FT                   /locus_tag="Arad_0383"
FT   CDS_pept        complement(328068..329597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0383"
FT                   /product="dipeptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25088"
FT                   /db_xref="GOA:B9J6Y2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6Y2"
FT                   /protein_id="ACM25088.1"
FT                   /translation="MTTFLRPSLGDFARRLACGAAISAGLLLMGMTSAEAAKTTLNIGM
FT                   TVEPTGLDPTIAAPVAIGQVTWQNIFEGLVAIDESGKVIPQLAKSWEISSDGLTYTFKL
FT                   QSGVKFHDGQTFDSAAAKFTLDRARDAKSVNPQKRFFATIASIDTPNPETLVLHLSSPT
FT                   GSLLYWLGWPSSVMVGPKSTANDKTTPVGTGPFKFASWAKGDHVELAKNPDYWNKSVDV
FT                   KLEKVTFRFIPDPQAEAAALKAGDLDAFPEFGAPELMSSFDGDPRLMTKVGNTELKVVA
FT                   GMNNTRKPFDDKRVRQALMMALDRKTVIDGAWSGFGTAIGSHYTPNDPGYQDLTGKLPF
FT                   DPAKAKALLAEAGYPNGFTFTIKTPQMAYAPRSAQVMQAMFADIGVTMNIEPTEFPAKW
FT                   VQDVFTGRDYDMTIVAHAEPRDIDIYARDPYYFNYKNPDFNDLMKKVQLTADPAEQDKL
FT                   YGQAQTILAEDVPALFLFVMPKLGIWDKKLKGLWENEPIPSNVLTNVSWED"
FT   gene            complement(329764..330681)
FT                   /locus_tag="Arad_0384"
FT   CDS_pept        complement(329764..330681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0384"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25089"
FT                   /db_xref="GOA:B9J6Y3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6Y3"
FT                   /protein_id="ACM25089.1"
FT                   /translation="MQIRALIYFDELVRTNSMRQAAENLNVAPTAISRQIENLEYHFGT
FT                   PLVERSARGVKLTAAGELLAVRAGRTLRELDHVHQLIEDLKGLQRGRVSVYASGATVAN
FT                   LLAPALAEFSLRYPKLRFEVTITSARSAIEAVNGAEADIAVTLFAPPLSGTKVRLRSEI
FT                   TYDVIAATSHSLAALKEVSLAELAAHSLAVPDRSFGARQAFDALFEREGLVLDPVFESS
FT                   SLEMQKELVLRGAAITMLPALTVQREIQAGQLVALPVAGGKGIRTPIDLCVAPDRQLSF
FT                   AAGKLLDFIERFMREQVAHKGRSD"
FT   gene            complement(330697..331842)
FT                   /locus_tag="Arad_0385"
FT   CDS_pept        complement(330697..331842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0385"
FT                   /product="peptidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25090"
FT                   /db_xref="InterPro:IPR005321"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6Y4"
FT                   /protein_id="ACM25090.1"
FT                   /translation="MVRKPTGPSRTTRVDPSGLTTPQTHLVFSPSLRSYRHDNLALRKA
FT                   KDFSLADLLNLLTDIDGVAVGHSTDLALGSGVTAIIFDEPAVASGSVLGGAPGGRDTAL
FT                   LDPAMTISTIDGLVLSGGSAFGLDAAGGVQAGLREVGRGLQIGTALIPLVPQAILFDLT
FT                   NGGNKDWGLYSPYRDMGYAAFKAAEKGAFALGTVGAGTGGTTATVKGGLGSASAVSSRG
FT                   HRIAAIVAVNALGTATIGDSPHFWAAPFEKTEEFGGLGMPETIDTRLRLKGGNVTATTI
FT                   GAIVTDAQLTKAEAHRLSICGHDGLARALLPAHLPLDGDTVFAASTARHPRDDMPSFME
FT                   LCHLATIVMARAIARGVYEATALPVEGAQPAWRDRFPNRMA"
FT   gene            complement(332022..332216)
FT                   /locus_tag="Arad_0386"
FT   CDS_pept        complement(332022..332216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0386"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25091"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6Y5"
FT                   /protein_id="ACM25091.1"
FT                   /translation="MKKQVIEYAGVPVGIVIPDEDRLKFIAVKYHVHDLDEQRFRNTDE
FT                   VKLAIRDLLSRQQAKPIHV"
FT   gene            complement(332730..335657)
FT                   /locus_tag="Arad_0387"
FT   CDS_pept        complement(332730..335657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0387"
FT                   /product="aminotransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25092"
FT                   /db_xref="GOA:B9J6Y6"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6Y6"
FT                   /protein_id="ACM25092.1"
FT                   /translation="MTDAALVNRMQLPRPDITPEEAAELLLTHYGLSGTLTELGSQQDR
FT                   NYRISAGDNSYVLKICQTEYDTVELEAQNAAIRHLHAKPEAPRLPNIVPSLNGRDILVV
FT                   TIREQNYLARLLSYLPGQSLTRRKHLPLASVSALGTLSARLARDLADFDHPGLHRNLQW
FT                   DLRRAGPVAVQLLSAITDHEARDRIAKAMVAAVKRIQPLAGGLRVQPVHHDVTDDNVVC
FT                   HPDTHGQPIPDGVIDFGDIIQGWLVGDLAVTCASLLHHAEGDPFAILPAIKAYHAVYPL
FT                   EEVEAKALWPLIVARAVILTASTEQQLAIDPDNDYVRGNLKHEREIFDVATGADPDVME
FT                   AAILRTIGFDIAPIDTDGWAALLPDIAPDTIAAIDLSTTSPHFTDGNWRKPDMDWRLLA
FT                   KEAVASGTAATRYGEFRLSRGELLSMTPPQNFALHSDVCLPAGTTVAAPFAGRIQWDGQ
FT                   HLVLVSDAVSLHLDGIDCTLEEGAEIEQGATIGTIAGEGSTVGGLRVQLCRSPSLVPPL
FT                   FAVAHQADGWSAVCPSPAVLLSPACEAPREDGATLLARREAHFAGPQKHYYETPPQIER
FT                   GWREFLFDVEGRAYLDMVNNVTMLGHAHPRLTAAVEQQWSRLNTNSRFHYAAVTEFSER
FT                   LAALAPEGLDSVFLVNSGSEANDLAIRLAWAHTGKKNMLCLLEAYHGWTLASDAVSTSV
FT                   ADNPQALTTRPDWVHPVVSPNTYRGPFRGPDSGADYVAGVTTPLETIDEKGDGLAGFIA
FT                   EPVYGNAGGIALPRGYLTDVYAAVRQRGGLCVADEVQVGYGRLGHHFWGFEQQGVVPDI
FT                   ITIAKGMGNGHPLGAVITRKEIAASLEKEGYFFSSAGGSPVSSVVGLTVLDIIRDEGLQ
FT                   ENAHVVGDHLKAGLIALMEHFPLIGAVHGTGLYLGVEFVRNRETLTPATEETADICDRL
FT                   LDLGVIMQPTGDHLNVLKIKPPLCLSSESADFFVKALEKALEDTV"
FT   gene            complement(335792..336352)
FT                   /locus_tag="Arad_0388"
FT   CDS_pept        complement(335792..336352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0388"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25093"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6Y7"
FT                   /protein_id="ACM25093.1"
FT                   /translation="MSFYPNGTLLLAAFLLSAPASHAATTQDDPSKIDLAKLIECTTYD
FT                   VPSYYDFVAWVAGPESAAAMKQLGLSEMPWPNRSWQKFKLSAPITVFGRQTTMIVFTFG
FT                   GLLAVLDEPDPHPLAKTLGVTAAVDRPDKYIGEKEVSSSKEQHEYGYYAYPPLSLTTRI
FT                   SLSVFTVGDLPGKTLAGCSYSIG"
FT   gene            complement(336471..337355)
FT                   /gene="purU"
FT                   /locus_tag="Arad_0389"
FT   CDS_pept        complement(336471..337355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purU"
FT                   /locus_tag="Arad_0389"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25094"
FT                   /db_xref="GOA:B9J6Y8"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6Y8"
FT                   /protein_id="ACM25094.1"
FT                   /translation="MTHYVLTVSCHSTRGIVAAIANYLADQGCNIVDSSQFDDLDTGKF
FT                   FMRVSFISEQGVGQEALVEGFKPIAGKFEMEVEIHDTQKRMKVLLMVSRFGHCLNDLLY
FT                   RWKIGALPIDIVGVVSNHFEYQKVVVNHDIPFHHIPVTKANKPQAEARIMDVVEQTGTE
FT                   LIVLARYMQILSDSMCQKMSGRIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVT
FT                   ADLDEGPIIEQDTARITHAQSADDYVSIGRDVESQVLARAIHAHIHYRTFLNGNRTIVF
FT                   PASPGSYASERMG"
FT   gene            complement(337522..338757)
FT                   /locus_tag="Arad_0391"
FT   CDS_pept        complement(337522..338757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0391"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25095"
FT                   /db_xref="GOA:B9J6Y9"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6Y9"
FT                   /protein_id="ACM25095.1"
FT                   /translation="MQSSGEKQPINYVILAISLLAVLYNCILAFINHNITPLTPNAVVM
FT                   SEVLLQVASFAYILKRGIYEEDMAPLLYLLLTIVLTVFVIAINKQPYVDHLRNVMIIFV
FT                   FSIMGRLCNERTLKLAFRISCIAVLAVLICEIVSVTEYVALFHPAEYFQNTRGVPPATY
FT                   SDIGLFRGALGFEGRFSFGLIDHRSSSIFLEQVSLANFCGVMVLYLISFSSRLRLSDRL
FT                   LFLSTVILILLTNDTRTMLIFSLISIAGYFIYPWLPKILDLLTMPLIILVGFVINALKP
FT                   GVTGDNFVGRINGTVRAFLGMDLQSTIGLQLDQVGIFYDSGYVYIIYGATIFGLILFWL
FT                   YASLYPGGETVNQRRLGHALSLFLFLNLMIGSTAIFSMKTAGLVWLLVGFLKFNEGTQA
FT                   KQPQTLSLATNS"
FT   gene            complement(338844..339923)
FT                   /gene="egl"
FT                   /locus_tag="Arad_0393"
FT   CDS_pept        complement(338844..339923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="egl"
FT                   /locus_tag="Arad_0393"
FT                   /product="endoglucanase precursor (cellulase) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25096"
FT                   /db_xref="GOA:B9J6Z0"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6Z0"
FT                   /protein_id="ACM25096.1"
FT                   /translation="MAGSMTRLLRRSLAATVMLAFVAEADPSLAASQLCYRGINLSGAE
FT                   YGERGGVLGTNYIYPSEDTVRYFAGKGMNVVRLPFRWERLQPVLNQPLDGKELQNLKDA
FT                   VDLIQKHGMAVILDPHNYGYYDKIQLPQMPATDLAFGDFWARLAVEFANRKGVSFGLMN
FT                   EPHDIKAPDWLELANTAIRSIRTVGARNLILVPGTNWTGAHSWSADVLGGGANGTVMLG
FT                   VKDPLNFYAFEFHQYLDADSSGTHPACDGTANGTKGMNDVTDWLRKNGKRGFLGEFGVA
FT                   GNDGCLAGLKQVLGIMNDNSDVWLGWSYWAAGDWWAPDEPLNVQPHDGRDKPQIKVLAD
FT                   GLSKKVSLAPACALIKPAN"
FT   gene            340133..341803
FT                   /locus_tag="Arad_0394"
FT   CDS_pept        340133..341803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0394"
FT                   /product="succinoglycan biosynthesis transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25097"
FT                   /db_xref="GOA:B9J6Z1"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6Z1"
FT                   /protein_id="ACM25097.1"
FT                   /translation="MSSLERNKRSSHFPSWRSNEPSEGQGEGLRLRGPVVRPRDFVHEV
FT                   QPVAAEQSVDTVKPAIPAHPEPPIAIEPKTEAALPPEVRPTVAGAIPAAEPVVVAPQVV
FT                   SPAPVADAPLLDLHSAVRSIWAKKRLVLALAVAGAVLGAAAIPMLPQKFTAETSLYFDP
FT                   RQTGGVDSSQSPPIAPELILTMIDSQTQILSSGKVLGRVVDALKLDQNPQFNGGASGDA
FT                   AKYMAVTVLAKAVQIAREASTYVVSLKVTTRDAQKSAAIANQLVASFVEEEGKAAANSY
FT                   QTSNTALDGRLEDLREQVRAAEKAAEAYRADNDMVAVGGNLMSDKRLTALNDMLVVAQQ
FT                   KTIEAKARADAADRLSFTDVVSNGPSATATAASTPLSSLRQQYAVLAANVGSLQSQLGA
FT                   RHPRLLAAKSSLDSLATEIRSELQRQTTSARADYDQAQKAEQDIAKELAVQKASQVNTS
FT                   GKLVGLNELERKAAAARDAYQAVLKRSGQTSDARDLSQSNIRVISEAEPPLTADGPSRK
FT                   VMMVAGLIAGALFGMGLGMAFAVLVGLFRHPVIRGYLGK"
FT   gene            342019..344007
FT                   /gene="lpsB2"
FT                   /locus_tag="Arad_0395"
FT   CDS_pept        342019..344007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpsB2"
FT                   /locus_tag="Arad_0395"
FT                   /product="dTDP-glucose 4"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25098"
FT                   /db_xref="GOA:B9J6Z2"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6Z2"
FT                   /protein_id="ACM25098.1"
FT                   /translation="MVPADKLVLPFLALPRSTKRALALLVDASLCVLTVWFAYCLRLDD
FT                   WVILEGVEWLPAIVSLLVAIPIFIVLGLYRAIFRYAGMSAFMTVVKAVAIYALAFMTIF
FT                   TAISVPGVPRTVGILQPLLLLIAIGLSRMWTRYWLGNAYQRLLNRNQLAKVLIYGAGAS
FT                   GRQLSGALANSAELNVVGYLDDDRNLHGSIMGGLPIYDPTDLPALVVSGDIKGVLLALP
FT                   NASRQRRNEILESMRKARVTVRTMPDLTALAQGRVAVSDLRELDIEDLLGRNVIAPDRA
FT                   LIDKNIRGKVVMVTGAGGSIGSELCRQILKNGPSCLLLVEQNEFGLYAIHGELEKAAAT
FT                   SGNSEIRIIPFLASIRDDRRLRQIMEAWRPKTVYHAAAYKHVPLVEYNPVEGIRNNVLG
FT                   TLTTAEVARDCGVEDFVLISTDKAVRPTNIMGASKRLAEMVLQAMDADRKPGADGTNFA
FT                   MVRFGNVLGSSGSVVPLFRQQIRDGGPITLTHPDITRYFMTIPEASQLVIQAGAMSGGG
FT                   DVFLLDMGEPVRIADLARRMVELSGLTVRDEDEPDGDIELEITGLRPGEKLYEELLIGD
FT                   NPQSTSHPRIMRAKEDFLPWPELSKKLAALQAALDENDVPLARGLLQSLVSGYAPSGDV
FT                   IDLVFREREMDLPLDEPSFDNVVRLLP"
FT   gene            complement(344004..344843)
FT                   /locus_tag="Arad_0396"
FT   CDS_pept        complement(344004..344843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0396"
FT                   /product="glycosyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25099"
FT                   /db_xref="GOA:B9J6Z3"
FT                   /db_xref="InterPro:IPR002654"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6Z3"
FT                   /protein_id="ACM25099.1"
FT                   /translation="MILEQANRIIKDTQAPGAGSLAPQVCIYVINLDRSRERWERLCGQ
FT                   AARYGLNVIRVAAIDGAKIPEGDRIDFQQQQFVYHNGRKLLAGEYGCYRSHLLALQQFI
FT                   DSGDKMAIIMEDDVELNERLIPRALSAMNSVCGARLVKLVNHRLVGFKPLSETTENDVV
FT                   GRCMHGPQGSAACYIVNRSAAKKLLITLKPMLLPYDIALERGWSTGVETFSTLENIADF
FT                   SPHRSDTTIGKRVHYRAVKRHFLLRATAYWFRACDQLHRWHYTVKAKPQPARENTET"
FT   gene            345137..345469
FT                   /locus_tag="Arad_0398"
FT   CDS_pept        345137..345469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25100"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6Z4"
FT                   /protein_id="ACM25100.1"
FT                   /translation="MWTRSKIVIAALLLANAMPVAALADNPLLPKPYVRPVYPYKNLPG
FT                   VIAPKMAADEKFQCRTTTVRVRDFHDGIFWRGLPRLGYVCEQNGVISESTSKPNYQYWQ
FT                   YNGPGR"
FT   gene            345665..346825
FT                   /locus_tag="Arad_0400"
FT   CDS_pept        345665..346825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0400"
FT                   /product="oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25101"
FT                   /db_xref="GOA:B9J6Z5"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6Z5"
FT                   /protein_id="ACM25101.1"
FT                   /translation="MRVGIIGLGFRLGYLGYVFKAIDENFEIAGYVDPAPAGLPGLVEN
FT                   GISAGKAYATPQELIANEKLDLLMIGSPNHMHLDHIRIGLEAGLKIFSEKPVVTTIEQS
FT                   IELARLMAKFGHEQLTVGLVLRYAPMYRDLLAAQAEGKLGNVVSIEASEHIEPYHGAFF
FT                   MRDWRRYEHYSGSFMLEKCCHDLDLYNGVIGARPERVASFGGRKSFIPENDPAKEGIND
FT                   LEMFHRKPSGWMGSDKVFDSDGDIIDYQVAIVEYANGVGMNFHTNINVPDQFRRFAIMG
FT                   SRGMAEGDFIRGYFNVHEMLTGNKVIEKTYATRTTLSQHYGADEQMAADIMAHVRSGLH
FT                   LPVSTLNALEAGILALSMDEARMKKTVVDLRPIWDRFDEALHSRAA"
FT   gene            346839..347723
FT                   /locus_tag="Arad_0402"
FT   CDS_pept        346839..347723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0402"
FT                   /product="sugar uptake ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25102"
FT                   /db_xref="GOA:B9J6Z6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6Z6"
FT                   /protein_id="ACM25102.1"
FT                   /translation="MGVQRSTVIFAWLLLLPAVLYVLVIVAYPLVDTVILSFTDASLKK
FT                   LTNWVGFENYAKIFNDTFASVIVRTFIWTFFSVSIKMIIGTCGAMLLNAAVPGRALFRV
FT                   LTMPPWVVPMAIGIFMWGWMYNGQFGMVSGLLQRFGLVDSPVAFLAYGSTAFWATIITD
FT                   VWIGVPMVTLYMLAAMQAIPQDLHEAAWTDGAGRFYRLRRITLPLMVPSMVTMSMLSLI
FT                   STFNSFDIIWILTRGGPNGETTTMIIDTYRTAIGSYKYGEGSARAVLICIFLSLFCLAY
FT                   FRLTSRFSAGAKR"
FT   gene            347720..348577
FT                   /locus_tag="Arad_0403"
FT   CDS_pept        347720..348577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0403"
FT                   /product="sugar uptake ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25103"
FT                   /db_xref="GOA:B9J6Z7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6Z7"
FT                   /protein_id="ACM25103.1"
FT                   /translation="MSQPMMINRYRWYELVGIYAGILLFLTFVLAPFVEGFLVSLKPLS
FT                   QLFSSPYRFIPENGSFEAYRTMWTSVPGFGWYIFNSFLISGTITIIVLVLAVPAAYAFA
FT                   RFEFRGAGLLLGAFLAVKMFSGAVLLIPLFRLMRSFGVLNTYFAMIVPGVAFIIPTGIW
FT                   LLHTYMRRIPRELDEAAYVDGASQFYTLRRVILPIAMPGIVVVAISSFIEAYAQQFIYA
FT                   LTFNSKTEYMPLPVGLFAYFGRQEVVWNELMAASFVGIAPALVVIFFLQRYLVSGLTAG
FT                   AVKQ"
FT   gene            348615..349844
FT                   /locus_tag="Arad_0404"
FT   CDS_pept        348615..349844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0404"
FT                   /product="sugar uptake ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25104"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6Z8"
FT                   /protein_id="ACM25104.1"
FT                   /translation="MTIHIKTGLFALALLGSTALGAVTVQAADKEISWIYCGDSIDPIH
FT                   VKYIKQWEDKNPGWAVKPEVVGWEQCQDKATTLAAAGTPVAMAYVGSRTLKQFAENDLI
FT                   VPVPMTDAEQKTYYPGIVGTVTFDGQQWGVPIAFSTKALYWNKDIFKQAGLDPEKPPTT
FT                   WAEEIADAKVIKEKTGIPGYGLSAKTFDNTMHQFLHWVYSNNGKVIDGDKIVLDSPEVL
FT                   AALQAYKDITPYSVEGATAYEQNEMRAIFLDGKVGMLQAGSGAAYRLKETKINWGVAPL
FT                   PLGPAAKGHGTLLITDSLAVFKGSGVEDKAIEFAKFITSPGPQGEYELQGGAGLTPLRP
FT                   SPQVDEFEKKDPFWKPFIDGISYGGPEPLFKDYKGFQNVMIEMVQSVVTGKAEPAAALK
FT                   KAAADLEQYK"
FT   gene            349930..351066
FT                   /locus_tag="Arad_0406"
FT   CDS_pept        349930..351066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0406"
FT                   /product="sugar uptake ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25105"
FT                   /db_xref="GOA:B9J6Z9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6Z9"
FT                   /protein_id="ACM25105.1"
FT                   /translation="MGQLHLNQVKKFYGHFEVIKGVELDVTDGEFIVFVGPSGCGKSTL
FT                   LRMIAGLDDVTSGDIMINGQRVNDLPPVKRGIAMVFQSYALYPHMTVFENIAFPLRVEK
FT                   MPEDKLKARVEHAARILHLDQRLQQKPGMLSGGQRQRVAIGRAIVREPKIFLFDEPLSN
FT                   LDAALRADMRIELAKLHRQLQATMIYVTHDQVEAMTMADRIVVLNAGEIAQTGEPLELY
FT                   HKPANKFVAGFIGNPKMNFLPVICRGVSEAGVEVDYKGQMALLPVAPRDGVVGQELTLG
FT                   IRPEHIQLGDGDISLTIMPSVIERLGAQTVAYAALEADSGENFCATLSGSIAIRPEVPL
FT                   KTGIRTADCHLFDEDGVAFERRVELTDIDMGLLNPVAP"
FT   gene            complement(351256..352359)
FT                   /locus_tag="Arad_0407"
FT   CDS_pept        complement(351256..352359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0407"
FT                   /product="amino acid processing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25106"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR042208"
FT                   /db_xref="UniProtKB/TrEMBL:B9J700"
FT                   /protein_id="ACM25106.1"
FT                   /translation="MAHDIVSEISPKPGDRIEDISTPRPIIDEDRMAGNIARVQSYMDA
FT                   HGLNFRPHIKTHKIPALASAQVAAGAKGINCQKITEAEVFADAGFEDILITYNIIGAEK
FT                   LARLSALNDRIAALKVVADSNYTVDGLSAWFATRKPLTVLVECDTGGGRCGVQTPEAAA
FT                   TLARHIAGKPGLVFGGLMNYPKPNSAADTQTFLAETISLLKRNGIECPIVSNGGSPSLF
FT                   DAHLVPAATEHRAGTYIYNDRSMVRAGHCREEDCAMHILATVVSRPTPDRAVIDAGSKA
FT                   LTSDLLGFSDHGVVVGYPEAVITGLSEEHGVIDLSKCTGPRPEIGDKVRIIPNHTCVVS
FT                   NLFDSMVFHRDGIVTRVEDVAARGLVW"
FT   gene            complement(352361..353836)
FT                   /locus_tag="Arad_0408"
FT   CDS_pept        complement(352361..353836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0408"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25107"
FT                   /db_xref="GOA:B9J701"
FT                   /db_xref="InterPro:IPR009197"
FT                   /db_xref="InterPro:IPR010799"
FT                   /db_xref="InterPro:IPR015995"
FT                   /db_xref="UniProtKB/TrEMBL:B9J701"
FT                   /protein_id="ACM25107.1"
FT                   /translation="MRIFTAVLATETNTFSPICVDRRAFEASLYAPPGTHPETPTLCSA
FT                   PITVGRRVAAEKGWELIEGTAAWADPAGLVNRRTYEDLRDEILDQLRAALPVDGVVLGL
FT                   HGAMVADGYEDTEGDFLTRVREIVGPDILLCVELDPHSHLTKKRLAAVDFLVYFKEFPH
FT                   TDFVDRAEDLWRIAVDTLEGRVKPVMSVFDCRMIDVFPTSREPMRSFVDKIMAMEEADK
FT                   DILSISVIHGFMAGDVPEMGTKLLVVTDNKPDKGSALARDLGLELFSKRGTFIMPQIDE
FT                   KQAVSEAMAATSWPVVIADLWDNPGGGTAGDATVVLQELLHRGARDTAIGTIWDPMAVQ
FT                   ICMAAGEGAEIPLRFGAKSAPGTGNPIDGIVKIMRLVANAEMRFGESFAPFGDAAHIEL
FT                   DGIDIILNSTRAQSFDPTLFSVMGIDPTQKKILVIKSTNHFYASFSKIASEILYCSAGT
FT                   PYPNNPARTPYRRAPKDIWPMVADPHAAKEGIA"
FT   gene            complement(353848..354405)
FT                   /locus_tag="Arad_0409"
FT   CDS_pept        complement(353848..354405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0409"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25108"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B9J702"
FT                   /protein_id="ACM25108.1"
FT                   /translation="MTIESGIWPVKIVIYEKNLNTAGPMRDPFQNPFPTDDTARHAIWE
FT                   MLVPRDIDAFLAADWSLVAHDFVEDGFIGIDGRREISPDKWRLAFPTLSAYRDEWLRQA
FT                   QDFARQSFAEDPRTAIFTTTTLEDIEIEGETALVRKKFDGSLKKADGGVDVLKWQTLYY
FT                   CRLHEGRWKISGFTGYLPNPME"
FT   gene            354445..354834
FT                   /locus_tag="Arad_0410"
FT   CDS_pept        354445..354834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0410"
FT                   /product="translation initiation inhibitor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25109"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B9J703"
FT                   /protein_id="ACM25109.1"
FT                   /translation="MPIKRYGSGQTGAGGKPLPFARAVEANGWLHVSGQVAMENSEIID
FT                   GGIIAQTHKTIGNVIAILQEAGYGLEHVVRVGVWLDDPRDFWSFNKIYQDYFGAHPPAR
FT                   ACVQASMMVDCKVEIDCVAYKTPDA"
FT   gene            354861..355724
FT                   /locus_tag="Arad_0412"
FT   CDS_pept        354861..355724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0412"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25110"
FT                   /db_xref="GOA:B9J704"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B9J704"
FT                   /protein_id="ACM25110.1"
FT                   /translation="MDIFTTMQEERARLSQSENRIADIVLNDFEFAVNASIIELAGKAD
FT                   VSPPTVTRFCRRLGCDSFSDFKVQLARTAYVGMRYIRPEPKSIAPADVAQDIITKAQNA
FT                   LFLLHRGLDIPAIEQAANRLAGAEMIYAFGSGGNSSMIASELQNRLFRLGLRVTASSDH
FT                   SMQLMMAAAAKPADVLIGSSFSGRNAELVRAFTLAREAKVPTIALTQSQSPVALAADIT
FT                   VPVDLPEGDNIYRPTSTRIAYLAVVDILASLVAYRIQPQATVTLRRIKQQLVAHRDGDD
FT                   RQLLGD"
FT   gene            355749..356525
FT                   /locus_tag="Arad_0414"
FT   CDS_pept        355749..356525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0414"
FT                   /product="oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25111"
FT                   /db_xref="GOA:B9J705"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9J705"
FT                   /protein_id="ACM25111.1"
FT                   /translation="MSRSVAIVTGAAGDIGRAIARRLADDHDIVLLADIDPAAAEAAAR
FT                   ELGPAERFVAVKVDVTSEADTVNMAKVAAGLGVVRTLVNNAGAARAVSLHDTTPEIWRA
FT                   DNALNLEAAFLCFRAAEDMLKASKGSLINIASVNGMAVFGHPAYSAAKAGLLHFTRLVA
FT                   VEYGKFGIRANAVAPGTVRTQAWEARASANPNVFEEARRWYPLQRVVDPADVANAVGFL
FT                   ASPLAASITGVCLPVDCGLTAGQAELAHTFSQSDHY"
FT   gene            356554..358473
FT                   /gene="hexA"
FT                   /locus_tag="Arad_0415"
FT   CDS_pept        356554..358473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hexA"
FT                   /locus_tag="Arad_0415"
FT                   /product="beta-N-acetylhexosaminidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25112"
FT                   /db_xref="GOA:B9J706"
FT                   /db_xref="InterPro:IPR015882"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025705"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="UniProtKB/TrEMBL:B9J706"
FT                   /protein_id="ACM25112.1"
FT                   /translation="MQPASYHLEHTWSPEGGPNGRLTFTLINLSDAPLTGFSIVYTSLT
FT                   RVIDTKACDNAVFLRRNANFHEFAPPAGLSVAPGDSWTFSVSGLHRVAKHCTDGAKSAY
FT                   LTLADGSHVDVSISDLLLEGRVSEPPPVLLPEGKLDLPFAIQPWPAAIDVKPGEDFPVA
FT                   LYPAKGTDGASLKAVATAQALFQRLFPVNHTPFSLISVPQGRPLRFVERAALAKEAYEL
FT                   AFSSTEIVLAYSAEAGRLYGLTTLAQLLDGARREPGKFRFPVTGTISDQPRYGWRGCHL
FT                   DVSRQFTPKDDVKRLIDILAWLKLNIFHWHLTDDEAWRLEIKAYPALTSTGVLRGPDEP
FT                   LLPQLGNGAEPVGGFYSQDDIREIVAHALALGIEVVPEIDIPGHNAATLVALPDLTDGQ
FT                   EAPESYHSVQGYPNNALNPAIELTYEFLGKVFDEMVELFPSEYLHIGGDEVANGSWLAS
FT                   PMARKLMEQEGISGTFALQSYFLKRVKTMLTERGRKLSGWNEVAHGGGVGTEGTLLMAW
FT                   EKPEVGIELAREGYDVVMTPGQAYYLDMVQAEAWQEPGASWAGTVPPAHTYAYEAEGDF
FT                   PDELKDRLKGVQACIWQENFLSRAYFNRLVFPRLPAIAEAAWTPRAGKDWQRFAAIVPL
FT                   SPSL"
FT   gene            358608..358922
FT                   /locus_tag="Arad_0416"
FT   CDS_pept        358608..358922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0416"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25113"
FT                   /db_xref="UniProtKB/TrEMBL:B9J707"
FT                   /protein_id="ACM25113.1"
FT                   /translation="MKKIILVAAFGLCASSAMAISRYDTQAMSCAAVHDKVAQEGEVVL
FT                   QHPSSTVSNLTVYDRYVSNSAACVNRGIPTKVSVPTSDDPSCKVLLCAPATGKGHNRKG
FT                   "
FT   gene            complement(358991..359851)
FT                   /locus_tag="Arad_0417"
FT   CDS_pept        complement(358991..359851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0417"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25114"
FT                   /db_xref="InterPro:IPR041307"
FT                   /db_xref="UniProtKB/TrEMBL:B9J708"
FT                   /protein_id="ACM25114.1"
FT                   /translation="METWLLLSNCQTFGLANSLNLLNPKFHIEAVDVYAFQHGIEKYRA
FT                   TLPDYFRVIIHPYFQTMDFDFTAARNLDIIPSIEFDAYHPDVCYAFSESGGPLDGPMSA
FT                   YHSMIVLAAYEAGLSAEATRKLFRRDVFERCGFLTRWEEERTDLINNFAQHGLDISSAF
FT                   RNWSRGDSFMYSVNHPKIHCVYDIARAFMKRLGVQTFEGGIVPMDNLLKGPCYPVYPEI
FT                   AETFGARGSYFFKMHNDYRLISLETFIDLSFASYSRFPTGTLHIEKSVRGRYAQVKAVI
FT                   AEAVG"
FT   gene            360006..360245
FT                   /locus_tag="Arad_0418"
FT   CDS_pept        360006..360245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0418"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25115"
FT                   /db_xref="UniProtKB/TrEMBL:B9J709"
FT                   /protein_id="ACM25115.1"
FT                   /translation="MGNSRHGGATGANGHRNDVPDMEWLMGDAEADGRPCIDGWRSCLG
FT                   NFAPANLAAGGESYIEAVRGNIIDIRLAPEGELI"
FT   gene            complement(360296..360379)
FT                   /locus_tag="Arad_5049"
FT   tRNA            complement(360296..360379)
FT                   /locus_tag="Arad_5049"
FT                   /product="tRNA-Leu"
FT   gene            complement(360472..361902)
FT                   /gene="noeK"
FT                   /locus_tag="Arad_0419"
FT   CDS_pept        complement(360472..361902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="noeK"
FT                   /locus_tag="Arad_0419"
FT                   /product="phosphomannomutase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25116"
FT                   /db_xref="GOA:B9J710"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:B9J710"
FT                   /protein_id="ACM25116.1"
FT                   /translation="MSSLKFGTSGLRGLSVDLVGRASALYATAFARHLLKSGQAQPGDL
FT                   ILVGRDFRDSSPSISATCIGALKRAGFTPVDCGTLPTPALALYGLELKAASLMITGSHI
FT                   PADRNGIKFYRPDGEIDKQDELAISAEAAAIGDANLDETPGTGEDRSAQTEALYFERNI
FT                   ALLPADSLKGLTIGVYQHSTVARDLLGLVLAHYGARVVPLGRSESFIPVDTEAVSAETI
FT                   RLLKGWAPEHGLDAIVSADGDGDRPLLADETGEPLRGDLLGLIAANFLGAEVVVTPVTS
FT                   NSGIEAAGTYSVTRTRVGSPYVIAGMDEALAAGKTNVMGFEANGGTLTASRFIIEGEPV
FT                   QPLPTRDGFLPILATLYAAALAGQPLSAVAGGYRLPFAAADRLENFPVETSAALMAYLR
FT                   ASDANLASFLAPVSGVASKSDIDGLRVTLSDGRIIHFRPSGNAPEMRCYVEAAGENEAK
FT                   ALLEQGLGLIRAWAKARA"
FT   gene            362088..362516
FT                   /locus_tag="Arad_0420"
FT   CDS_pept        362088..362516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0420"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25117"
FT                   /db_xref="GOA:B9J711"
FT                   /db_xref="InterPro:IPR012413"
FT                   /db_xref="UniProtKB/TrEMBL:B9J711"
FT                   /protein_id="ACM25117.1"
FT                   /translation="MTVFAKIAYGCALGLALLSPLDVSHAASKNPTIVIPPRANGSVLC
FT                   DYRGCFGFGRQQWYRRPGQPIPNPPPALGGRNRYDNPGIVIPPRNNYVPPKTNYRAPVD
FT                   NSTRHRVWCADRYRTYNPGTNLYTTLHNGFQACRSPYQ"
FT   gene            362629..362814
FT                   /locus_tag="Arad_0421"
FT   CDS_pept        362629..362814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25118"
FT                   /db_xref="UniProtKB/TrEMBL:B9J712"
FT                   /protein_id="ACM25118.1"
FT                   /translation="MSSLPCGRDPNKEPEMAKGQVRGNRETRKPKKDKTAEAPKPQPGF
FT                   AVKQAGTPMGFGKKDK"
FT   gene            complement(362863..363156)
FT                   /locus_tag="Arad_0422"
FT   CDS_pept        complement(362863..363156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0422"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25119"
FT                   /db_xref="InterPro:IPR011893"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B9J713"
FT                   /protein_id="ACM25119.1"
FT                   /translation="MSDKPRITILYCTQCNWLLRSGWMAQELLQTFTDSLGEVALLPGT
FT                   GGVFEIRIDGELLWERKRDGGFPGPKELKQRVRDVIDPDRDLGHTDRASLES"
FT   gene            363306..364016
FT                   /locus_tag="Arad_0423"
FT   CDS_pept        363306..364016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0423"
FT                   /product="glutamine amidotransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25120"
FT                   /db_xref="GOA:B9J714"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B9J714"
FT                   /protein_id="ACM25120.1"
FT                   /translation="MKNTPIGALGMALKEVGAELEWFRAWDGERLPQDVTSHDALVVLG
FT                   GEQNARDDETHPYLPELAQLMRRFEEADKAVLGICLGSQILARAYEAENLIGAAREFGW
FT                   KTVGVTEEGKADPLLASVGDEFTIFEWHSDTFTLPACAVRLATNDIARNQAYRIGRATY
FT                   GTQFHFEANADVVEGWRKDFKETIERIEPGWQERFPEIAAQHAAAAETAGLVIARAWVR
FT                   TIGVAVEQREEVAL"
FT   gene            364137..364592
FT                   /locus_tag="Arad_0425"
FT   CDS_pept        364137..364592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0425"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25121"
FT                   /db_xref="GOA:B9J715"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:B9J715"
FT                   /protein_id="ACM25121.1"
FT                   /translation="MTQPELPWEGGCRCGQVRLKVSARPLLAMACHCTGCQRMSSSAYS
FT                   LSIAIPSDGFEVTQGEPVIGGMRDEKLKHYFCPSCMSWMFTRLEGLDWFVNLRLTMLDD
FT                   ASWFTPFVETWTSEKLPWAATPAKHSYAALPAMEDFEVLTKEYMGQG"
FT   gene            complement(364601..366433)
FT                   /gene="lepA"
FT                   /locus_tag="Arad_0426"
FT   CDS_pept        complement(364601..366433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepA"
FT                   /locus_tag="Arad_0426"
FT                   /product="GTP-binding protein LepA"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25122"
FT                   /db_xref="GOA:B9J716"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/TrEMBL:B9J716"
FT                   /protein_id="ACM25122.1"
FT                   /translation="MARMSTNSTTPLSHIRNFSIVAHIDHGKSTLADRLIQTTGGLAER
FT                   EMSEQVLDNMEIERERGITIKAQTVRLHYKANNGETYILNLIDTPGHVDFAYEVSRSLS
FT                   ACEGSLLVVDASQGVEAQTLANVYQAIDNNHEIVTVLNKIDLPAAEPDRIKDQIEEVIG
FT                   IDASEAVLISAKTGLGIPDVLEAIVHKLPAPKSPGGEKAPLKALLVDSWYDTYLGVMVL
FT                   VRIIDGVMTKGQTIRMMGTDVKYQVERVGVLTPKMLTVESLGPGEIGFITASIKEVADT
FT                   RVGDTITEDKRPTAQALPGFKPAQPVVFCGLFPVDAADFEDLRSAMGKLRLNDASFSFE
FT                   MESSAALGFGFRCGFLGLLHLEIIQERLEREFNLDLIATAPSVVYQLTMTDGTEIELHN
FT                   PADMPDVVKIAEFREPWIKATILTPDEYLGSILKLCQDRRGVQTELTYVGNRAMITYDL
FT                   PLNEVVFDFYDRLKSISKGYASFDYNLTDYRDSDLVKMSILVNAEPVDALSMLVHRSAA
FT                   EKRGRVMCEKLKDLIPQHMFQIPIQAAIGGRIIARETVKALRKDVTAKCYGGDASRKRK
FT                   LLDKQKEGKKRMRQFGKVEIPQEAFIAALKMGDE"
FT   gene            366609..367178
FT                   /locus_tag="Arad_0428"
FT   CDS_pept        366609..367178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0428"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25123"
FT                   /db_xref="GOA:B9J717"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B9J717"
FT                   /protein_id="ACM25123.1"
FT                   /translation="MDDDLEIAIGARIKQLRIARGMTLDELANASAVSRAMISRIERAE
FT                   ASPTASLLARLCAALGLSLSSFFAEEEEDVSPLARSDAQPIWRDPETGYVRRAVSPAGT
FT                   QSPVDLVEVTFPAGARVSFPPNAASRGMSQHVWLFEGEMEITVGEAVHRLMPGDCLFMG
FT                   IGDGHVFHNPGDEPARYCVVLDRPRS"
FT   gene            367194..367715
FT                   /locus_tag="Arad_0429"
FT   CDS_pept        367194..367715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0429"
FT                   /product="acetyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25124"
FT                   /db_xref="GOA:B9J718"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9J718"
FT                   /protein_id="ACM25124.1"
FT                   /translation="MPDIRLLSASEARTVSAELCEVLADCVNGGASVGFMQPYGPDDAA
FT                   PYWRGVADSVEAGATLLLVAVIEGKVVGTVQIGAAQMPNQPHRGDLKKLLVHRSARGKG
FT                   LARLLMEAAEREAAKHGKTLLVLDTATGSDAEAIYPRLGWERAGVIPDYALWPQGGFCD
FT                   TTLFYKRIAV"
FT   gene            complement(367719..368324)
FT                   /locus_tag="Arad_0430"
FT   CDS_pept        complement(367719..368324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0430"
FT                   /product="hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25125"
FT                   /db_xref="GOA:B9J719"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B9J719"
FT                   /protein_id="ACM25125.1"
FT                   /translation="MKVLMVDVDGVLVHGRPSDGLHLFTDLERDLGLSRELIQKEFFQT
FT                   HWGNIVTGREDLEPRLASVLAKIAPGLSATALIDYWFENDSRLDRALLADLAALRATGI
FT                   PMFLATNQEHRRAAYLMENLGLSSHFDGIFYSAMLGYQKPAPEFFRLATERVGIDASEI
FT                   AFIDDYPANIEAARQFGWKAMHWAPGARLEDALAAFSR"
FT   gene            368476..369501
FT                   /gene="aphA"
FT                   /locus_tag="Arad_0431"
FT   CDS_pept        368476..369501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aphA"
FT                   /locus_tag="Arad_0431"
FT                   /product="acetylpolyamine aminohydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25126"
FT                   /db_xref="GOA:B9J720"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:B9J720"
FT                   /protein_id="ACM25126.1"
FT                   /translation="MRVIYSEDHKLRDAKTELHDGQLVTPFEAPFRAEWILAAVKEAGF
FT                   VDVVAPEAHGLETARKVHDPAYLDFLGTVWERWVAAGYKGEAIANSFPVRRTSQRVPEN
FT                   IVGMIGHYANAADTSISKGSYEAAIASMRCALTGADWLHAGNRFAFALCRPPGHHAGFD
FT                   LFGGYCFINNAAVAAQRLRDHGAKKVAVLDVDFHHGNGTQDIFYQRGDVFTASLHGDPI
FT                   HAFPYFLGHADEEGEGEGLGANRNYPMLRGTSWTVWSEALVDALTRIKAFGAEAIVLSL
FT                   GVDTFERDPISFFKLTSEDFIRIGKLVAGAGLPVLTCMEGGYGVPEIGLNVANVLKGLE
FT                   A"
FT   gene            369700..370512
FT                   /locus_tag="Arad_0432"
FT   CDS_pept        369700..370512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0432"
FT                   /product="permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25127"
FT                   /db_xref="GOA:B9J7F5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7F5"
FT                   /protein_id="ACM25127.1"
FT                   /translation="MCLLSMCCIQFGAALSSSAIATYGPAGATWLRLSFAAVVLAIIVR
FT                   PKVMRYSRAQWLGALTLGTVSALMTLSFFSAIERIPLGLAVAIDFLGPLLVATLGFGLS
FT                   RQLAWPLIAAIGVLLLAYDGEGWVGNLSGILFACGAGTGWACYILLTKKVGSVFSGFEG
FT                   LSMSLIIAAIVATPFGFASVVPHLTGYGFIEMAGLALLVPLLPYALEMVALRRMPTSSF
FT                   GILMSLEPAIGAVAGFVILTQPLTPSQMFGTGLVVAASIGATVFAARA"
FT   gene            complement(370516..370980)
FT                   /locus_tag="Arad_0433"
FT   CDS_pept        complement(370516..370980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0433"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25128"
FT                   /db_xref="GOA:B9J7F6"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7F6"
FT                   /protein_id="ACM25128.1"
FT                   /translation="MDNDLQGRAAHLAGIRERAEAEMTRIGIDAAFIDRLVDTFYGRIQ
FT                   THPRLGPVFDGRLAGRWPDHMDKMKRFWSSVAFKNGAYGGKPVQAHLGVQGIAPDLFPE
FT                   WLVLFSQTLDDIAPTDEAKVWFMATAERIAKSLTLSLFYNPAVDDPAKKP"
FT   gene            371233..372216
FT                   /locus_tag="Arad_0434"
FT   CDS_pept        371233..372216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0434"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25129"
FT                   /db_xref="GOA:B9J7F7"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR017040"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7F7"
FT                   /protein_id="ACM25129.1"
FT                   /translation="MLLGFFRSPKRSFASLSEQEILAVAIAAEEDDARIFLAYADTLRA
FT                   QYPDSAKVFVDMAEVEDTHRKTLIDMHRRRFGERIPLIRREHVSGFYDRKPDWLRKNLS
FT                   LDAIRQEAEAMEQQAYNFYVEAAKQVSDASTRQLLGDLALAEQGHEEVARMLGDKHTPQ
FT                   SVKQEEDASAHRQFVLTYVQPGLAGLMDGSVSTLAPIFAAAFATQNTWQTFLVGLSASV
FT                   GAGISMGFTEAAHDDGKISGRGSPIKRGLACGIMTALGGLGHALPYLIPHFWMATVIAA
FT                   IVVFFELWVIAFIQNKYMETPFLRAAFQVVVGGSLVLAAGILIGNA"
FT   gene            complement(372300..372854)
FT                   /locus_tag="Arad_0435"
FT   CDS_pept        complement(372300..372854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0435"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25130"
FT                   /db_xref="InterPro:IPR010319"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7F8"
FT                   /protein_id="ACM25130.1"
FT                   /translation="MSSSAMPAPQKTASMAIGNVTSQPIGHYEFCERHTDECGPTRNTG
FT                   PVDLNADTWALVNQVNLRVNKTITPATDMEVYGQEEYWEYPKTAGDCEDFALLKRKLLM
FT                   QKGVSAANLLMTVVRKPDGEGHAVLTLRTKQGDYILDNLEDEVKVWYKTPYSYLKRQAS
FT                   FNAGRWVTIENGTDVLVGSVK"
FT   gene            complement(373136..373948)
FT                   /locus_tag="Arad_0437"
FT   CDS_pept        complement(373136..373948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0437"
FT                   /product="hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25131"
FT                   /db_xref="GOA:B9J7F9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7F9"
FT                   /protein_id="ACM25131.1"
FT                   /translation="MSEALASLEPTFLSVGAGDDQRQIAIQQRAAQKGAKGATFVWLSG
FT                   YRSDMSGTKALELDALAERLGLGCIRFDYSGHGRSGGKFTDGTISRWLEEALAVIDHTK
FT                   PKRIVLVGSSMGGWIALRLIQELRKQKKAPVIHGLVLIAPAPDFTIDLIEPNLSDTERR
FT                   SLAERGYFEEPSEYSSEPNIFTRALIEDGRTNRVLTGIVETGCPVHILQGMQDEDVPFA
FT                   HSLKLVEHLPADDVVLTLVRDGDHRLSRPQDIERMLVAAETLALNNLP"
FT   gene            374212..374763
FT                   /gene="infC"
FT                   /locus_tag="Arad_0438"
FT   CDS_pept        374212..374763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /locus_tag="Arad_0438"
FT                   /product="translation initiation factor IF-3"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25132"
FT                   /db_xref="GOA:B9J7G0"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7G0"
FT                   /protein_id="ACM25132.1"
FT                   /translation="MENTTIRRPFKTDAPVKDGPRSNREIRVSKVQLIAADGQNLGVVP
FT                   TDEALRMAEEAGLDLVEISPNAEAPVCKILDLGKLKYANQKKAAEARKKQKIVEVKEIK
FT                   MRPNIDTHDYEVKMKAIGRFFEEGDKVKVTLKFRGREMAHQELGMKLLQQVKEDTVEIA
FT                   KVEAEPKLEGRQMMMVLAPK"
FT   gene            375085..375288
FT                   /gene="rpmI"
FT                   /locus_tag="Arad_0440"
FT   CDS_pept        375085..375288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="Arad_0440"
FT                   /product="ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25133"
FT                   /db_xref="GOA:B9J7G1"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J7G1"
FT                   /protein_id="ACM25133.1"
FT                   /translation="MPKMKTKSSAKKRFKITATGKVKAAAAGKRHGMIKRSNKFIRDAR
FT                   GTMVLAEPDGRKVIKNYLPNGL"
FT   gene            375326..375730
FT                   /gene="rplT"
FT                   /locus_tag="Arad_0441"
FT   CDS_pept        375326..375730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="Arad_0441"
FT                   /product="ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25134"
FT                   /db_xref="GOA:B9J7G2"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J7G2"
FT                   /protein_id="ACM25134.1"
FT                   /translation="MARVKRGVTSHAKHKKVLKQARGFYGRRKNTIRTAKAAVDRSKQY
FT                   AYRDRKVNKRNFRALWIQRINAAVREHGLTYGRFIDGLTKAGIEVDRKVLSDMAIHETE
FT                   AFGALVAASKKALEYLKDAGTKNEFEAAVN"
FT   gene            375811..376020
FT                   /locus_tag="Arad_0443"
FT   CDS_pept        375811..376020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25135"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7G3"
FT                   /protein_id="ACM25135.1"
FT                   /translation="MLSIVSGGPVGRNPGKRIVHRAASAKHRFLGGFLSFARLIGRLHM
FT                   GSDLQRLIVATSFMMHAFIHYSAD"
FT   gene            376059..377141
FT                   /gene="pheS"
FT                   /locus_tag="Arad_0444"
FT   CDS_pept        376059..377141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="Arad_0444"
FT                   /product="phenylalanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25136"
FT                   /db_xref="GOA:B9J7G4"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J7G4"
FT                   /protein_id="ACM25136.1"
FT                   /translation="MTELVTLETQLMAEVAAATDEQSIEAVRVAALGKKGSVSELLKTL
FT                   GSMSPEERQTRGAAINALKNSVTDAINARKGALKDAAIDAKLKAETVDVSLPVRSSPAE
FT                   RGRIHPISQIVDEITAIFGDMGFSIAEGPDVETDYYNFTALNFPEGHPAREMHDTFFFQ
FT                   PDEKGERKVLRTHTSPVQIRTMEAQKPPIRIIIPGKTYRQDSDATHSPMFHQVEGLVID
FT                   KTANVANIRWVLEEFCKTFFEVDNVTMRFRPSFFPFTEPSFEVDIQCDRSGPIVKFGEG
FT                   TDWMEILGCGMVHPNVLRHGGLDPDEYQGFAWGMGLDRIAMLKYGMPDLRDFFNADVRW
FT                   MNHYGFRPLDMPTLFGGLSA"
FT   gene            377157..379580
FT                   /gene="pheT"
FT                   /locus_tag="Arad_0445"
FT   CDS_pept        377157..379580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="Arad_0445"
FT                   /product="phenylalanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25137"
FT                   /db_xref="GOA:B9J7G5"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7G5"
FT                   /protein_id="ACM25137.1"
FT                   /translation="MKFTLSWLKEHLETDATLDEICARLTMIGLEVEDVDDKAAFKPFV
FT                   IAKVLSAEKHPQADRLKVLMVDTGAGKPIQVVCGAPNARAGLVGAFAAPGTYVPGIDVT
FT                   LAVGNIRGVESHGMMCSEKELEISDSHDGIIDLPEDAPVGTSFAAYTGIDDPMIEINLT
FT                   PNRPDCTGVYGIARDLAASGLGTLKPRAVPSFAIEGETPTDVKIELDDARLCPGFALRL
FT                   VRGVKNGPSPKWMQQRLQAIGLRPISALVDITNYMTFDQGRPMHVFDAAKVKGNLVVRR
FT                   AKDGETVLALDQREYKLGPNNVVIADDNGIESIGGIMGGEHSGCDENTVDVLIESALWD
FT                   PMNIAKSGRGLGIITDARYRFERGVDPEYMVPGLERTTELVLACCGGTAAKAKVEGYKG
FT                   YDAKIVDFPFSEVKRLTGLDVSTEEGKSILTKLGFLVSGSGERVSVAVPPWRSDVDGKA
FT                   DLVEEIMRIHGVDNIKPQPLASHNVVNGKILTVLQIRTRTAKRALASRGMLEAVTWSFI
FT                   SEDQAKLFGGGSNALKLANPIAADMSDMRPSLLPGLLSAAQRNADKGYGDVAIFEVSGT
FT                   YENDRPEGQRRVAGGIRRGTATLAGAGRMWSNAAKGGGKPVDVFDAKADALAVLEACGL
FT                   PMGNIQIEQGGPAWYHPGRSGTIKMGPKVVLGYFGEFHPKTLEALDVAGALAGFEVYID
FT                   AMPEPKKKATRTKPALELSPFQAVKRDFAFVVDKSVEAGTIIRAATGADRKLITGVNVF
FT                   DIFEGASLGEDKKSIAIEVQIQPAERTLTDEDFEALTQKIVANVTKTTGGVLRG"
FT   gene            complement(379619..379978)
FT                   /locus_tag="Arad_0447"
FT   CDS_pept        complement(379619..379978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0447"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25138"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR039437"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7G6"
FT                   /protein_id="ACM25138.1"
FT                   /translation="MSEEQAIRAVVHLYVDGMAFANEPALRKALHPRAAIIGNYQGAVE
FT                   WMTRDEFIAAIVEEGSAPPGTIPLMEIELIDIEGDAASVKVVDEFAGMRFSDYLSLVKI
FT                   DGRWSVVNKVYHLHR"
FT   gene            complement(380073..382160)
FT                   /gene="pbpC"
FT                   /locus_tag="Arad_0448"
FT   CDS_pept        complement(380073..382160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbpC"
FT                   /locus_tag="Arad_0448"
FT                   /product="penicillin-binding protein 1C"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25139"
FT                   /db_xref="GOA:B9J7G7"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR009647"
FT                   /db_xref="InterPro:IPR011815"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7G7"
FT                   /protein_id="ACM25139.1"
FT                   /translation="MKARWKIAIGLGAATLSVAVLAFGLVASDRAFPPPLDRAGVVSSE
FT                   VLDANGNLLRAFATPEGRWRLKTDVGDVDPQFLRMLVAYEDRRFYDHHGVDPMAFGRAF
FT                   LQLVTHGRIVSGGSTLSMQVARLIEPRSERSVTAKLLQIARAIQIERRLSKEQILDLYL
FT                   THAPYGGNLEGVRAASLAYFGKEPRQLSIAQAALLVALPQLPERRRPDRNLASAETARK
FT                   RVLARAAVVDVVGDGEAERAALVPVPAKRRQLPAYAAHLAEMALRKQPGVIQHHTTLRR
FT                   DIQQGLEAVADEAARRLGPKVSVAMVMADVQTGEIVGEVGSANYFDSSRSGWIDMTRVL
FT                   RSPGSTLKPFIYGLAFEEGYVAQETIIEDRPADFYGYRPRNFDMTYQGDVSVREALQLS
FT                   LNVPAVRLLDAVGPTRLLVRFRRAEVKPVLPPNEAPGLAIGLGGAGITLKDLVQLYAGL
FT                   ANRGKPMRIGDGIQDQPGPIEGQPLMEPVAAWNITDILSDIIAPRGSKQLGIAYKTGTS
FT                   YGNRDAWSIGYDGAHVLGVWVGRPDNGAVPGLAGYVSAAPILFEAFAKSGVAITPFPSP
FT                   PMGAVRISATQLPISQRRFSVTAAGLLSASSREPAPQIVYPPEGARVDLGANGGASSIM
FT                   PLALKLQGGRAPFRWLANGKPLPDLSRRRTNQWVPDGAGYSTLTVIDAAGRAASVRVFV
FT                   E"
FT   gene            complement(382170..387686)
FT                   /locus_tag="Arad_0449"
FT   CDS_pept        complement(382170..387686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0449"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25140"
FT                   /db_xref="GOA:B9J7G8"
FT                   /db_xref="InterPro:IPR000177"
FT                   /db_xref="InterPro:IPR001599"
FT                   /db_xref="InterPro:IPR002890"
FT                   /db_xref="InterPro:IPR003609"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR011625"
FT                   /db_xref="InterPro:IPR011626"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR021868"
FT                   /db_xref="InterPro:IPR026284"
FT                   /db_xref="InterPro:IPR041203"
FT                   /db_xref="InterPro:IPR041246"
FT                   /db_xref="InterPro:IPR041462"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7G8"
FT                   /protein_id="ACM25140.1"
FT                   /translation="MSMRAFIGLSAFLLATFTTLMPAGAADTKRQVVTTQDGDYYGFDL
FT                   RTEQNVTLDQCSTSCIGDKSCKAFTYNPKVKWCFLKSDFNQLNTVAGAIAGKIVETAAA
FT                   SEPDIGAAPALSFLSDNFIQSARDAKSRLTLGAELKGQGVESLIALGRIEITSGNVNNA
FT                   LNAFQGALSLTPDNGDLWIEMARAANTTTNDTSLATQAAYAALNGYQLSRTTSSRADAL
FT                   AVLATSLQNAQNYRQALSAYKASLALTSSAAVQAAYDDLKARQGFRVSGNTLDNDNASP
FT                   RACVQFSEKLVKSGVDYTPFVTVNGAAPKGVDAKDNQICVEGLDFGQRYRISLRPGLPS
FT                   SVDEDLATQVNVDIYVKDRSASIRFTGDNFVLPSTARRGIPIVSVNTATANLKLYRIGD
FT                   RNIAQLLNNSQFLTQMSGYGAQTIQDTSGELVWQGSIEIQQNLNKDVVTSFPVDEALPK
FT                   RKPGVYVLTAVAPNSSVQEWDSQATQWFVVSDIGITTYAGTDGLNVFTRSLGSAKPTAG
FT                   VELQLLAKNNEILGTAKTDANGRATFSAGLMRGTAGMTPAVITAQNGDQDYVFLDMTRA
FT                   GFDLSDRGVAGRTAPGAIDLTAWTERGIYRVGETVHASALARDISSVAVENLPLTFVFL
FT                   RPDGVEDRRIVTDGGKLGGYNVDLPLQQTAMRGSWTMNIYTDPKGSSIGSQTFLVDDFV
FT                   PDRTEFDMKSDAKAIEVGKPTPVNIEGRYLYGAPAAGLSLEGEVTLKPTRQSDDYKGYQ
FT                   FGLADEGAGQNASDDSDSSSSDNKAESSQVPLEDLQALDEDGKTTFDVTINDTPSTTQL
FT                   LNADITVRMQEAGGRAVERSLTLPVRADGPRIGIKPEFDGDLGENSLGAFHVIAIDQNG
FT                   QKQAMQGLTWKLLSVERDYQWYRDGNSWKYEPITSTKQVATGTINATTDGAEISVPVTW
FT                   GRYRLEVDTADTNGPESSVEFNAGWYVASTSTETPDALEVALDKSSYHVGDTAKLKVTS
FT                   RYAGQLMVTAGSETLISVANADIGATGGEVDIPVTADWGAGTYLTATLFRPGEAQESRM
FT                   PMRAIGIKWAAVDPGERKLQVKLDAPPKTLPRQPLNIAVQVTGAGANEDAYVTLAAVDV
FT                   GILNLTRYEPPAPDDWYYGQRQLGLEIRDIYGRLIDGSLGATGKLRTGGDGGQAGLAAS
FT                   PPTQKLVAFFSGPVKLDADGKANISFDIPQFNGTARLMAVAWSKAGVGHATQDVIIRDP
FT                   VVVTASLPRFLAPGDKANLRLDIANTDAPAGDYKLAVTGNAAVTVDASATQQTINLQPG
FT                   GKYDITLPLTGGQPGAGTVSINLSGASGLSLDQSLDLPVRPAQLPVTERRLVSLAPGKS
FT                   LTINADLLADSVLPGASVSVNVSRSGAFDVPALLMSLSHYPYGCAEQTASSAMPLLYFS
FT                   DLAIKNGLADDTEIRQRVQDSIYREMSYQSSTGSFGLWGPGSGDLWLDAYVTDFLTRAR
FT                   EQKYTVPDQAMAQALENLQNALSANTNVKDNGNEIAYALYVLARNKKASISDLRYYADT
FT                   MLNDFPTPLSKAHLAAALALYGDAQRSRNIFVDSLQMSQQATVTKVSFARSDYGSSLRD
FT                   GAAVLALAAESRPVPPIVPELSTVVANEWKNKTYTSTQEQTWMLLAARALQNGDDGLTL
FT                   DVNGAAHTGTYMAQMSGDALIGHPLTVTNTTRQPLAAAVTTVAAPVSPLPAGGNGFTIE
FT                   RKYYTLDGEEANVTQAQQNERYVVVLHITGANSWTSRILVTDLLPAGFEIDNPSIVNSA
FT                   QLSNFDWLSEVQPAHVEFRNDRFVAAFDESWGSRDLSLAYVVRAVTPGTYDHPAASVED
FT                   MYRPQFSARTAMGRMEVQAAQQQ"
FT   gene            complement(387971..388966)
FT                   /locus_tag="Arad_0451"
FT   CDS_pept        complement(387971..388966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0451"
FT                   /product="oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25141"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7G9"
FT                   /protein_id="ACM25141.1"
FT                   /translation="MKTRKLGQDLTVSAVGLGCMGMSFGYGASDENESVKTLHRAVDLG
FT                   VTFFDTAETYGPFTNEVLLGRALKPVRDRVVIATKFGFKLDLTKSGLASMVGVDSRPEH
FT                   VKEVAEASLKRLGTDVIDLFYQHRVDPNVPIEDTVGAMADLVKEGKVRALGLSEAGAAT
FT                   IRRAHAVHPIAALQSEYSLWTRDPEEDVLAVCRELGIGFVPYSPLGRGFLTGAISKVDD
FT                   LATDDFRRSLPRFQDENFDANAALVAKLESLAKDKGVTAAQLALAWVLHQGDDIVPIPG
FT                   ARKLHHLEQNAAAADIRLSAAEVQALSDIMPLEKVAGKRYTEASLAMTNI"
FT   gene            389104..389997
FT                   /locus_tag="Arad_0452"
FT   CDS_pept        389104..389997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0452"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25142"
FT                   /db_xref="GOA:B9J7H0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7H0"
FT                   /protein_id="ACM25142.1"
FT                   /translation="MNRTQLSQLAVLAAVAAHRSFRAAGKELSIAPSAVSHAISSLEES
FT                   LGVRLLARTTRSVLPTEEGQTLLDRLAPALEQIDIALEDTLAMRGRPAGNLRITAPRFA
FT                   SDLLMAPRLGDFLNTYPDITLEIANEDGFSDIVKEGFDAGIRLEESVEGDMIAVKVSPD
FT                   IRTVIAGSPAYFENNPRPLHPRDLVHHRCIKRRFTDGSIYRWEFEKDGRELIVAVDGPL
FT                   IVIEDRLAVLAAVNGAGLSYLFDIRVKQELADGSLIRVLEDWCPPYPGFCIYYPSRRQM
FT                   RPALRAFIDFFKYTGP"
FT   gene            390097..390714
FT                   /locus_tag="Arad_0453"
FT   CDS_pept        390097..390714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0453"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25143"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7H1"
FT                   /protein_id="ACM25143.1"
FT                   /translation="MKKPGSMKGLEELGRVRLSKNFFFRDFLHSEIADFYRIPNIPEDP
FT                   DLAIESGRRLCEELLEPLEATFGRLHIRSGYRAPDVNAFGNRNGLNCSTNPHTAAHHIW
FT                   DMRDLDDCMGAAVCVVVPWLIDHCHEEGDWRKLAWWIHDHLPYASLCFFPKLWAFNIQW
FT                   HERPMRTIQSYVSPRGMLTKRGMANWEGDHSALYEGLPKLRT"
FT   gene            complement(390704..391147)
FT                   /locus_tag="Arad_0454"
FT   CDS_pept        complement(390704..391147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0454"
FT                   /product="acetyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25144"
FT                   /db_xref="GOA:B9J7H2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032962"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7H2"
FT                   /protein_id="ACM25144.1"
FT                   /translation="MTVVVRDAKPEDETRWRKLWAGYLAFYRADVAPDITDMTWRRIFD
FT                   PVSAMFMRVAEVDGEVKGFALCLTHESTWIREPECYLEDLFVDESTRGQGVGRALLDDL
FT                   VSLCKGNGWARLYWHTEEDNAAARKLYDSYIKSDGLIRYRIKF"
FT   gene            complement(391162..392112)
FT                   /locus_tag="Arad_0455"
FT   CDS_pept        complement(391162..392112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0455"
FT                   /product="oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25145"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7H3"
FT                   /protein_id="ACM25145.1"
FT                   /translation="MDLRKLGRTDLFVAPIVFGGNVFGWTADEKTSYALLDAFFDAGFN
FT                   TIDTADVYSRWVPGNKGGDSEEIIGKWLKQSGIARDKAIIITKVGSDMGPDKKGLKADY
FT                   ILQAVDASLKRLQTDYIDLYLSHWPDPETPHEESLSAYAKLKEQGKIRHVGCSNLNAEQ
FT                   LQASLDAAAKTGLPRYDVLQPEYNLYARDSFEGPLADLCVREDIGVITYFSLAAGFLTG
FT                   KYRTKADTEGRARENRVAAYLDDKGLRILAALDKVSDETGSKPAEVALAWLLRKRGVTA
FT                   PIASATSLGQLDALINSAKFKLSDEAMALLDKAGE"
FT   gene            complement(392219..393217)
FT                   /locus_tag="Arad_0456"
FT   CDS_pept        complement(392219..393217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0456"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25146"
FT                   /db_xref="GOA:B9J7H4"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7H4"
FT                   /protein_id="ACM25146.1"
FT                   /translation="MNQGDRHVHRRIIPVYVVLPPYTLLMDVAGPMEVLRRANVEQDDV
FT                   LFDYRFIAARPTQTTSVGLLLAELSPLPDRIPDGAYVVVSGSVTPPSDADDVEPELDIL
FT                   TAWLKTAIRPGITLVTICSGAVLAARAGLLEGHACTTHAACIEEVRHYAPTARVLDNRL
FT                   YVEDRERYSSAGISTGTDLMLHIASKLTSPVTALTIARHMVVYMRRTGAEPQLSPWLSG
FT                   RNHVHPAIHRVQDAIMADPAHGWSLSELARIGAMSARHISRLFQEHAGLSVTAYVNLMR
FT                   VTLARDVLTNSRMDMERVAEKSGFASPRHMRRVWSKYNELPPSHYRRSAAE"
FT   gene            complement(393214..393786)
FT                   /locus_tag="Arad_0458"
FT   CDS_pept        complement(393214..393786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0458"
FT                   /product="isochorismatase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25147"
FT                   /db_xref="GOA:B9J7H5"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7H5"
FT                   /protein_id="ACM25147.1"
FT                   /translation="MSHADTALLVIDVQESFRQRPYWQTDDLPAFTSRLQALIDGAKAR
FT                   GIPVVQIFHVDGDGDEHFSLKSGYVRKLEEITLDADAVFHKHRHSALVGSGLDVWLVEN
FT                   GIRKLIVSGIRTEQCCETTTRHASDLGYAVDYVTEATLTFPMTHASGTVFSADDIKKRT
FT                   ELVLAGRFARIATVEDALASTALRSAA"
FT   gene            394103..395092
FT                   /locus_tag="Arad_0459"
FT   CDS_pept        394103..395092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0459"
FT                   /product="oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25148"
FT                   /db_xref="GOA:B9J7H6"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7H6"
FT                   /protein_id="ACM25148.1"
FT                   /translation="MLRFGILSTAKIGRDLVVPAIQDAENCVVTAVASRDLARARQMAD
FT                   RFSVPHAFGSYEEMLASDKIDAVYIPLPTAQHVEWTIKAADAGKHVLCEKPIALKAEEI
FT                   DSLIAARDRNKVLVSEAYMVTYAPVWRKVRSLLADGAIGRLRHIQGAFTYFNRDAGNMR
FT                   NIPALGGGGLPDIGVYPTISARFVTGREPLRIQAVTERDPEFGTDIYSSVKADFGDFDM
FT                   SFYISTQMANRQVMVFHGTEGFIEVKSPFNADRYGAEELELTNRSHTESQIFRFPDSRQ
FT                   YRREAEAFASAALGNKEAEVVSLESSKLNQKVIDAIYRASEKDGWEPV"
FT   gene            complement(395102..395488)
FT                   /locus_tag="Arad_0461"
FT   CDS_pept        complement(395102..395488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0461"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25149"
FT                   /db_xref="GOA:B9J7H7"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7H7"
FT                   /protein_id="ACM25149.1"
FT                   /translation="MKKLLRFLIAGGVGFVVDAGVLHLLLWYTPFGPFVGRAVSIPSAL
FT                   LATWFLNRNFTFGRSGRSLAAEGFRYGSVGLTSAVLNYALFSSLLVAEPSLRPIIALIL
FT                   ASAAATAFSFFGYSRFVFRHRQNP"
FT   gene            complement(395485..396498)
FT                   /locus_tag="Arad_0462"
FT   CDS_pept        complement(395485..396498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0462"
FT                   /product="glycosyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25150"
FT                   /db_xref="GOA:B9J7H8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7H8"
FT                   /protein_id="ACM25150.1"
FT                   /translation="MWNEKLNIAVLLPCYNEAATIGDVVRGFRKALPQAGIYVYDNNST
FT                   DTTALHAMLAGATVVRERRQGKGHVVRRMFADIDADIYLMADGDGTYAPDDAEELIRTL
FT                   LTEGSDMVVGTRRGVHDDAGRQGHAFGNRIFNWLYRTIFGPDFTDIFSGYRAFSRRFVK
FT                   SFPAVSGGFEIETEMSVHASRLKLPVSELELDYGRRPEGSHSKLSTFRDGWKILWMFAM
FT                   LMKETRPFAFFGILGAISMEMSIGFMIPVFVEYFETGQVLRMPTWVLSMALMMISFMLF
FT                   TAGLILDSVARARAEQLRIHYMSLAKPASHRIDDEQTVYMTKHEKPASRRKRAKAA"
FT   gene            396730..398556
FT                   /locus_tag="Arad_0464"
FT   CDS_pept        396730..398556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0464"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25151"
FT                   /db_xref="GOA:B9J7H9"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7H9"
FT                   /protein_id="ACM25151.1"
FT                   /translation="MAQTLTVTRGAAVTAQTEVPSLWSRPRLVALIYTLFTIVVLLIFN
FT                   RHATDYVGPDNDDVMRLVEVRDLLGGQGWFDMMQYRLGLDGGTLMHWSRFIDLPIASLI
FT                   AFFRLFLAPESAEAAALTVWPLMLVLPLMAFMGLAGRRIAGVEGMHFSLILTTLFVLTS
FT                   RRFMPGSIDHDNVQLGLVALSVAMLADESYRPRNFAIAAIALAIALGIGAETTPFVAVA
FT                   CMAVAGLWAWDGEVFAPAARAFALTLTIAVSAAFFALVPPHLYSAVTCDNLSLGFYSIT
FT                   SVGGAGLLLSALFASRLPRPWRLAVLAANGAAVFATTLVIAPQCLRNPLADLDPMLVQL
FT                   WLNKVTEAQSIFSLTQHQPETLGAFYFTGLLAILLCVFRMLRGERVRLHAVLLALVAVN
FT                   WIIALVQVRGAEFSNLLAIPPLAILLAELRRVSAADTKNVRAAVMYVVVTLLSVPAVWA
FT                   VGGALAKNGVTNSFAANVDETGDCASREAFAPIAGLAPGVVSAPSNMGSPLLRFTPHRT
FT                   LSGPYHRDPDGMLTELHIGLAEPKEAEAFLRGAHVTLLAFCPGDPQVQEVSELKPEGLY
FT                   AQLGKGHVPAYLEPIPAAAKSDVRFFRFKPQD"
FT   gene            398885..400600
FT                   /gene="xseA"
FT                   /locus_tag="Arad_0466"
FT   CDS_pept        398885..400600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseA"
FT                   /locus_tag="Arad_0466"
FT                   /product="exodeoxyribonuclease VII, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25152"
FT                   /db_xref="GOA:B9J7I0"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7I0"
FT                   /protein_id="ACM25152.1"
FT                   /translation="MKSHFATGPIGRAKDAAALFESPHFRQVRIKDRMSSFFENDSPSN
FT                   LAEYSVSELSGSIKRTVESAFDQVRVRGEISGYRGPHSSGHAYFSLKDDRARIDAVIWK
FT                   GTFSKLKFRPEEGMEVIATGKVTTFPGSSKYQIVIETLEPAGAGALMALLEERKRKLGA
FT                   EGLFDAERKRRLPFMPKVIGVVTSPTGAVIRDILHRISDRFPVHVLVWPVKVQGEGSGD
FT                   EVANAIRGFNEVAPGGPLPRPDVLIVARGGGSLEDLWSFNDEAVVRAAAASEIPLISAV
FT                   GHETDWTLIDYAADVRAPTPTGAAEMAVPVKADLEAQLASFAARLQGGVSRQMDQRRQA
FT                   VRALLRALPSLDQLLALPRRRFDEAASGLGRGLELNTLNKRRTFERAASHLRPDVLSNR
FT                   IVERRQMLSERMTRAERTIERMIDRARARIGRADAVFATLPSRLETQTGRARDLLGNLS
FT                   RRTDTAIRHQLVRARGELAAQERVLQSLSYKNVLKRGYAVVRDEADRPVSLAAALATGA
FT                   AISIEFADGRVGAVTGDNSVAPAPTETPTGVPPQKKRVAKPAGSADPSNQGSLF"
FT   gene            400600..401190
FT                   /locus_tag="Arad_0467"
FT   CDS_pept        400600..401190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0467"
FT                   /product="NAD(P)H dehydrogenase (quinone) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25153"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7I1"
FT                   /protein_id="ACM25153.1"
FT                   /translation="MRILLVLAHPLEDSFAAAVAKTAKETLVAGGHQVDLLDLYREGFD
FT                   PRLSEAERRGYFDQPYDTAGVADIVARLQAADGLILVFPQWWFNFPAILKGFFDRAFAP
FT                   GIAFSHDAAGGRIVPKLTNIRLFWALTTTGSPWWIVHFYMGNPVRRLLKRGIAAFCAKQ
FT                   LDFRMLTLHDMDRVSEAGHLAHLARVRAALAAL"
FT   gene            complement(401203..402453)
FT                   /locus_tag="Arad_0468"
FT   CDS_pept        complement(401203..402453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0468"
FT                   /product="aminopeptidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25154"
FT                   /db_xref="GOA:B9J7I2"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="InterPro:IPR035097"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7I2"
FT                   /protein_id="ACM25154.1"
FT                   /translation="MTSASNHHPVDTAKLEKLAEVAVKVGLQLQGGQDLLVTAPVAAMP
FT                   LVRLITREAYKAGAGLVSTFYSDEETTLARYEYGHDESFDRAASWLYEGMGKAFANNTA
FT                   RLAISGDNPMLLSGQDPAKVARANRANSAAYKPALEKISNFDINWNIVSYPNPSWAKLV
FT                   FPDDPEVIAVAKLAKAIFSASRVDVEDPVAAWAEHNANLRKRSEWMNGQRFATLHFQGP
FT                   GTNLKVGLADGHEWHGGASTAKNGITCNPNIPTEEVFTTPHALRVEGHVSSTKPLSHQG
FT                   TLIDNIQVRFEGGRIVEAKATRGEEVLNKVLDTDEGARRLGEVALVPHSSPISASGILF
FT                   YNTLFDENASCHIALGQCYSKCFVDGATLSQEQITAQGGNSSLIHIDWMIGSDKVDIDG
FT                   IKPDGSSVPVMRKGEWA"
FT   gene            complement(402548..403021)
FT                   /locus_tag="Arad_0469"
FT   CDS_pept        complement(402548..403021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0469"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25155"
FT                   /db_xref="GOA:B9J7I3"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7I3"
FT                   /protein_id="ACM25155.1"
FT                   /translation="MSKTTRATQVLTQAKVAFTVHAYDYDPNAERVGMQAAEALGEEPH
FT                   RVLKTLMAEVDGKPVCVVVPSDHEVSMKKLAAAFGGKSAGMMKPVDAERLTGYHVGGIS
FT                   PFGQKKIVPTAIEAQAMTESYVYINGGQRGLQVRLSPQDALRVLKANAAPLIA"
FT   gene            complement(403052..403279)
FT                   /locus_tag="Arad_0471"
FT   CDS_pept        complement(403052..403279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0471"
FT                   /product="Helix-turn-helix protein, CopG"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25156"
FT                   /db_xref="GOA:B9J7I4"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7I4"
FT                   /protein_id="ACM25156.1"
FT                   /translation="MSTLTIRLPNDQHERLKALAAARGTSLNKLFEELSTKALTEFDAE
FT                   TRFRLRAATGDKARGLEILEKLDRIHSKRG"
FT   gene            complement(403753..404106)
FT                   /locus_tag="Arad_0472"
FT   CDS_pept        complement(403753..404106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0472"
FT                   /product="arsenate reductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25157"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7I5"
FT                   /protein_id="ACM25157.1"
FT                   /translation="MTITIYGIKNCDTMKKARTWLESHGIAYDFHDYKAAGIDRDHLER
FT                   WTAEAGWEIVLNRAGTTFRALPEADRADLTKDKAIALMLAQPSMIKRPVLEADGKLLIG
FT                   FKPEIYASTLKSQ"
FT   gene            404263..404784
FT                   /locus_tag="Arad_0473"
FT   CDS_pept        404263..404784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0473"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25158"
FT                   /db_xref="GOA:B9J7I6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7I6"
FT                   /protein_id="ACM25158.1"
FT                   /translation="MTVDRETLRLENIFGALSLALVDKMEKAFADETGLGPSTIAAIIQ
FT                   IGTEPGMTIETLRRMIALSHSATVRLVDQLVTENLVLRAGGVEGDRRAKSLQLTEAGSA
FT                   LFHKSLGARRAVIHRAFATLDAQETRELGRLAEKLLPTLVDLGADQDVVCRVCDQGVCD
FT                   QQRCPITFMT"
FT   gene            404921..405082
FT                   /locus_tag="Arad_0474"
FT   CDS_pept        404921..405082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25159"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7I7"
FT                   /protein_id="ACM25159.1"
FT                   /translation="MTMTGNRVFLGKTASLNQPRLAAVLNLIRNVGELLRQATVIAFTM
FT                   RCKVIGDR"
FT   gene            complement(405089..406150)
FT                   /locus_tag="Arad_0476"
FT   CDS_pept        complement(405089..406150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0476"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25160"
FT                   /db_xref="GOA:B9J7I8"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7I8"
FT                   /protein_id="ACM25160.1"
FT                   /translation="MNITEIVLEGDTTGIAWRLPVLHFTGSKPDAPKIYIQAALHAGEL
FT                   PGTALVHFLCERLRQAEADGALLSDITVVPHANPIGAAQSHFGEMQGRFDLGSRTNFNR
FT                   DFPLISLRDRHLLIANLERYSAVDRLKRQLIHMALGADLVIDLHCDDESLQYAYIDDAF
FT                   WPEAADLAAALDMDAVLLSDGESSAFEEAVSFAWKYEVPGEKKAQLPGKLSVTVELRGT
FT                   RDVYPEMARKDAKGLWRFLAARGAVRDDSVTLSAFTGPAVPLDNVEMIRAPQAGTVLFH
FT                   RNIGERVEEGDLLATIITAPGMQNGTIDVHAPQAGLIVTRVSDRLVRRRGDLMKIGCDR
FT                   PSAAARKPGTLED"
FT   gene            complement(406263..407444)
FT                   /locus_tag="Arad_0477"
FT   CDS_pept        complement(406263..407444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0477"
FT                   /product="efflux transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25161"
FT                   /db_xref="GOA:B9J7I9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR023008"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7I9"
FT                   /protein_id="ACM25161.1"
FT                   /translation="MNTASQTIQSNSALTLISIVALTFFGYLAIGLPLAVLPTHVDSGL
FT                   GFGVVWAGIAISTQYVATIVSRAQVGRLCDQYGPRRSVFLGFFAYGLCGTLTLASALVT
FT                   DIPAASLSLLLAGRLALGIGESLVSTAAITWAIGLMGSRETVRIISWNGIATYGGIALA
FT                   APFGAWLEGQYGFVAIGAVTIGLAIAGLMLAQTRPPVPGIKEKGIGTGQVLGRILPYGV
FT                   ALALASSGFGVVMAFVALFFHNRGWDGASLALSAFGLAFMGIRLGLAQAVARFGGLPLA
FT                   RISLVLEIVGLLTIALASTPTVAIIGAALAGAGFAPVFPALGNEAMARIPPQNRGVALG
FT                   LYSMFLDVALGGTGPIAGILADHFGYTAPFLLGGGAVLLSLAICFWLRKTSNA"
FT   gene            complement(407636..408610)
FT                   /locus_tag="Arad_0479"
FT   CDS_pept        complement(407636..408610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0479"
FT                   /product="quinone oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25162"
FT                   /db_xref="GOA:B9J7J0"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7J0"
FT                   /protein_id="ACM25162.1"
FT                   /translation="MPLAIAMNSPGGPETMQLVDLPVTEPGPGQARIRQSISGVNFVDI
FT                   YIRSGLYPRPPGQTILGFEGAGIVDAIGPDVEGLKVGDRVAYVGHPLGSYAEMRTLPAS
FT                   RLIKLPDGVNERLAGSSMLRGLTAQMLLHKVHPVQPGEWILVHAAAGGVGQIVTRWAKR
FT                   LGANVIATVGSEAKAEFAYEAGADTVLLHTSEDWVEETRRIADRRGVHFAIDGIGGAML
FT                   SQTLAAVRPFGMVASLGQPAGPIPPIEIEELTAPRAIALSRPSVLVYANDPDLYRQGAE
FT                   ILMTELQAGLINPIGAEYTLKDAAIAHADLEAGRTTASVVLTM"
FT   gene            408704..409582
FT                   /locus_tag="Arad_0480"
FT   CDS_pept        408704..409582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0480"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25163"
FT                   /db_xref="GOA:B9J7J1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7J1"
FT                   /protein_id="ACM25163.1"
FT                   /translation="MIDWQDLLHFASLARTGSLSAAARELGVDHATVGRRIAALERTLD
FT                   LRLIDRRPRTSPLTADGRAIAELVVGMEENVEAIRRYSKSAVAGLSAAVKISAPPSIAA
FT                   HLIAPKAVGFRAEHPDITLTIAGVTRRAALDHGEADIAVRMTRPEESDLLVRRIGVMRF
FT                   GLYAIPEIAETPEEDWIFIGYDAALEHLTQQTWLRSLLAGRPIVFRAGDIFGQLEAARA
FT                   GLGVVALPAFLGDGEAALTRLSTAIPSPTRDLWLVTYPDLRRSPAIRAVMDFVSETIGR
FT                   SCPLRDADAAN"
FT   gene            409675..411333
FT                   /locus_tag="Arad_0481"
FT   CDS_pept        409675..411333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0481"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25164"
FT                   /db_xref="GOA:B9J7J2"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7J2"
FT                   /protein_id="ACM25164.1"
FT                   /translation="MTKLSGLPAINKADVIAGISVAGLMLPEAVAYAGIAGLPPHRAIL
FT                   AGIAGCLVYAIFGRSRFAIVSPTSSSAAILAATLAIVPGDATVKAGLATVAVALAGILF
FT                   VIAAALRLGGITGFISRPVLRGFALGLAITIILHQLPILVGASVQGSNIFSYAAALFAA
FT                   IPQWNPVSVAVGVVALAALLLVKRLPGIPGAFLVLAAGILSSFVLDLAGHGVKLVGTIE
FT                   VLPQWPSLPDAGWVAYSRLAQFTVPLVLILFAESWGTMRALALRYGDTLAVNRELGALG
FT                   FANIASAVVQGMPVGAGFSAGFASEAAGAKTRATAVFAAIGLAILIACAGPLVARLPEP
FT                   VLAAVVIAALTHALDPSPILRLRRLHRDFYVALGATAGVLIFGVLNGMLLAIALSLAAM
FT                   MHRLASPYIARLGRLGSSHNFVDLSRHQEASETPGVAIWRPGEPLFFGNADTIFGEILS
FT                   RSRGEAGIRAVVLSLEESSDLDSTALDALMEFDGAMRVAGIRLQFARVHDRVRDLMTAA
FT                   GMADVDGRCSFSVDDAIAAVGQAAKSSASQSDSSQ"
FT   gene            complement(411312..411926)
FT                   /locus_tag="Arad_0482"
FT   CDS_pept        complement(411312..411926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0482"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25165"
FT                   /db_xref="GOA:B9J7J3"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7J3"
FT                   /protein_id="ACM25165.1"
FT                   /translation="MRNNGQLSLNLGVGSRMRKSKADPTHVEALYFAILPDPDIASASV
FT                   DLANDLRLQHGFSAKPRRPDLSHISLYKIGSYRGLPEEAAFAAMQAASTVRRRSFQVEF
FT                   DRAVSFGGGDNRPLVLWNRDGNAELKALHRELNDAMQLTGFANDDGGKFEPHMTLLYQG
FT                   HLIPEVMLERPVTWTVRDFVLVNSLQGKARHEHLCYWLLSD"
FT   gene            412110..412673
FT                   /locus_tag="Arad_0484"
FT   CDS_pept        412110..412673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0484"
FT                   /product="methylated-DNA-(protein)-cysteine
FT                   S-methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25166"
FT                   /db_xref="GOA:B9J7J4"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7J4"
FT                   /protein_id="ACM25166.1"
FT                   /translation="MSDAQQYYLIFETAGGFCGIAWNDIGVTRFQLPTKDASSTERLLL
FT                   RRLSDARLGTPTLDVANAIAAVKRYFAGEQIDFSGVKLDLGEQDAFFKQIYAAAREIGW
FT                   GHTTTYGALAKQLGAGPEAARDVGQAMARNPVALIIPCHRVLAAGGKIGGFSAPGGSTA
FT                   KARMLELEGVQLAPPKPVQQSLGF"
FT   gene            412898..413794
FT                   /pseudo
FT                   /locus_tag="Arad_0485"
FT                   /note="hypothetical protein fragment; Incomplete gene
FT                   (pseudogene)"
FT   gene            complement(413893..414831)
FT                   /locus_tag="Arad_0486"
FT   CDS_pept        complement(413893..414831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0486"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25167"
FT                   /db_xref="GOA:B9J7J5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7J5"
FT                   /protein_id="ACM25167.1"
FT                   /translation="MDKSDVSLERMRTFVRVAERGSLSAVARELEIGQSTVTRHLRELE
FT                   EAVGVPLLSRTTRRVTMTDEGSRYYADSIQILRLVEQAGDEARSTRGAPAGTIRISCTA
FT                   AFGVLHISRMIFAFQDRYPEIAVDLSLTDERVDLVEEGVDIALRLGPLADSSTKLRALG
FT                   QSRRLLAAAPAYLAARGTPVVPQDLCDHEGIRMSNIAGSDTLVLQGPDGKRHMVPFGGR
FT                   FRVDHGLAAREALVAGRGIAPTHHWLVDDLLATGRLVAILPDYALPPVPLSMLIVPERA
FT                   GIARVRLLIDFLAQEIGGIAGIGQPGERNSI"
FT   gene            414930..415727
FT                   /locus_tag="Arad_0487"
FT   CDS_pept        414930..415727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0487"
FT                   /product="NAD(P)H dehydrogenase (quinone) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25168"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7J6"
FT                   /protein_id="ACM25168.1"
FT                   /translation="MKILLVFAHPEPRSLNGALRDVAIKELEAQGHEVRVSDLYADGWK
FT                   SEIDRADFPSLAPDARLIAVAASKNAFDADTLTDDVKAEIEKLLWADTLILQFPLWWFS
FT                   MPAILKGWVERVFAYGFAYGVGEHSDKRWGDRYGEGTLAGKRAMLIVTAGGWEAHYSPR
FT                   GVNGPIDDLLFPINHGILYYPGYDVLPPFVTYSVDRLDEAGFGSVAEGLRERMRTLGST
FT                   PPIPYRQQNGGDYLIPSMQLRPELGETAATGFVLHLKDETMAD"
FT   gene            complement(415762..416193)
FT                   /locus_tag="Arad_0489"
FT   CDS_pept        complement(415762..416193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0489"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25169"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7J7"
FT                   /protein_id="ACM25169.1"
FT                   /translation="MQNLSDQPCLIARSLALVGDAWSMLILRDAHAGLTRFDEFRKSLS
FT                   IAPTILTRRLAALTEDGLLEKRRYSERPPRDEYVLTEAGLDFLPVLFAIGAWGRKHRNT
FT                   DGVTRFFDAETGTEIDPVTIDRTTGTPIGTRPIRIVMPK"
FT   gene            416284..417099
FT                   /locus_tag="Arad_0490"
FT   CDS_pept        416284..417099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0490"
FT                   /product="oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25170"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7J8"
FT                   /protein_id="ACM25170.1"
FT                   /translation="MSNKERGVALVTGASSGIGLATARALRRNGYRVFGTSRKPMADTS
FT                   DGVIMLVCDVTDDRSVQNVVDDVVSRAGRIDLLVNNAGIGLLGGAEESSAAQAKALFDV
FT                   NVFGVVRLTNAVLPVMRRQRKGRIINMSSILGLIPAPFNALYASTKHAIEGYSESLDHE
FT                   VRTQGIRVVLVEPGITRTAFEENLTRPDQPLSVYDTVRADAEKLMREIVETGDAPEIVA
FT                   DMVVKAANATAPKRRYTAGKAAGQIRFIRRFLPESFVDKNLRKFNRLPA"
FT   gene            417140..418141
FT                   /locus_tag="Arad_0492"
FT   CDS_pept        417140..418141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0492"
FT                   /product="zinc-binding oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25171"
FT                   /db_xref="GOA:B9J7J9"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7J9"
FT                   /protein_id="ACM25171.1"
FT                   /translation="MKAFLIDRYAKGAALRFGEAPEPELLDNDVLIQIHATSVNPLDGK
FT                   IRDGEFKLILPYRLPLILGNDAAGVVVRVGSRVRRFKPGDEVYARPAKDRIGTFAEFIA
FT                   MNEADVAAKPKSLTMEEAASMPLVALTAWQALVERAKLKKGQKVLIHAGSGGVGAIAIQ
FT                   LAKHIGATVATTTSTANVDLVRSLGADVVVDYKKDDFENVLQGYDVVLNSLGKDTLEKS
FT                   LRVLKPGGKLISISGPPDPEFARENGSGWLLRQVMGALSFGIRRKSKRHGVSYSFLFMK
FT                   PSGEQLGQIAALIETGAIRPVIDRVFPFEKTNEALAYVETGRAKGKVVIAVK"
FT   gene            complement(418210..418806)
FT                   /locus_tag="Arad_0493"
FT   CDS_pept        complement(418210..418806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0493"
FT                   /product="G:T/U mismatch-specific DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25172"
FT                   /db_xref="GOA:B9J7K0"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR015637"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7K0"
FT                   /protein_id="ACM25172.1"
FT                   /translation="MPPQGRLIRRIMPYMDDQAEIAARASGLAEILAPRLSVVFCGLNP
FT                   ALTAHRDGHNFSNRSNRFWRVLHLAGFTPRLLRAEEEREMLRYGLGLTSAVSRPTKSAS
FT                   ELTKRDYITAAPALEDKITKLAPRNLAFLGKAAYAAISLQAHVEWGRQPDKFADASVWV
FT                   LPNPSGLNRAFDLTRLTEHYRKVKLAVDRAAALIE"
FT   gene            complement(418836..419207)
FT                   /locus_tag="Arad_0494"
FT   CDS_pept        complement(418836..419207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0494"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25173"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7K1"
FT                   /protein_id="ACM25173.1"
FT                   /translation="MRVMVLVKATDDSERGFFPTPETMEMMAAMGRFNDELRDAGILVT
FT                   ADGLKPSSHGKRIAFDGPGRTVIDGPFTETRELVAGFWLWDVKDMDEAVAWVKRCPNPM
FT                   PGPSEIEIRPLYEMADLRQ"
FT   gene            complement(419313..420167)
FT                   /locus_tag="Arad_0495"
FT   CDS_pept        complement(419313..420167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0495"
FT                   /product="hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25174"
FT                   /db_xref="GOA:B9J7K2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7K2"
FT                   /protein_id="ACM25174.1"
FT                   /translation="MSERIIMADGVEIATQVFGDPTDQPTLLIMGAMASMLWWPEAFCR
FT                   RLAAQGRYVIRYDNRDTGLSTFYEPGSSPYTMDDMAEDAVHVLDAYGIDSAHLVAMSLG
FT                   GMIAQIATLAHPARVRTLTLISTTPIGIDTSALPQTSDSYMEHAAAGESIDWTDDAQVI
FT                   DFIVKDTRMIAGTAHPYDEAGARDLVERDVKRAKNFVSATNHFMLKGGEAWKNKLSELA
FT                   APLLIIHGTADPIFPVEHGELLAETIEGAKLLRLEGGGHEIHPEDWDEIIAAIDAHTGA
FT                   QRR"
FT   gene            420339..421109
FT                   /locus_tag="Arad_0496"
FT   CDS_pept        420339..421109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0496"
FT                   /product="methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25175"
FT                   /db_xref="GOA:B9J7K3"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7K3"
FT                   /protein_id="ACM25175.1"
FT                   /translation="MLNRADFYDAELKRHNGHLRAAASVGVRDRVLDIGCGAGQSTREA
FT                   ARIAVEGDAIGVDTSSEMLEVARRRSKEAGLQNIAFEEGDAQYHAFPAASFDLCISRFG
FT                   VMFFADPAAAFANIARALRPGARLAWMVWQSQARNEWSGAIRRALAPETAVSANALTPF
FT                   SLGDPTIATELLSTAGFVSIDFIDVREPVFYGSNVDAAFDALINLYLVKDALSRTEEAP
FT                   DKALQRLRDLLGAHMTTEGVLFDSRAWIITARRG"
FT   gene            421303..421743
FT                   /locus_tag="Arad_0497"
FT   CDS_pept        421303..421743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0497"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25176"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7K4"
FT                   /protein_id="ACM25176.1"
FT                   /translation="MKISSGFRSVTVAAIAAAGIGFASAAHADSGTIRFAVYKAAFFVG
FT                   GSGGEGTLTFHGRKYPVSIGGISGGLAFGASKTYFQGTVRHIRRAQDVSGIYGAAGGGG
FT                   AVGKGAQMIVMTNDKGAQLELTGRQVGLQINADISGLSITVK"
FT   gene            complement(421947..422843)
FT                   /locus_tag="Arad_0499"
FT   CDS_pept        complement(421947..422843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0499"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25177"
FT                   /db_xref="GOA:B9J7K5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7K5"
FT                   /protein_id="ACM25177.1"
FT                   /translation="MIDWDDIRYFLAVARGGSVRAAAEGLGVYHSTVLRRIAQLEERLG
FT                   AQMFEKLPSGYRLTAAGEEVLELANEMEASSHQLETRVFGRDQSVRGLLRVTLAPTLAT
FT                   HLLMPDLADFAHLHPDIEMDIVSSGELANLTNREADVAIRVVYDRKTLPLNLHGLKGPE
FT                   LFSGVYMSRDRLAAWHSGAPDPVRWIVISIHGIPDWASEGEVRTTGVPFRTTDGEAQIV
FT                   AVRQGLGMTTLPCFVGDADPLLVRVPGTDLHMHGTLWLLTQGETRKTKRVRLFTEFVFR
FT                   RLAAYAPLLAGLSILRD"
FT   gene            423112..423846
FT                   /locus_tag="Arad_0502"
FT   CDS_pept        423112..423846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0502"
FT                   /product="dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25178"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7K6"
FT                   /protein_id="ACM25178.1"
FT                   /translation="MGKLEGKVAVITGGSSGMALASAKRFVEEGAYVFITGRKQEALDE
FT                   AVKLIGRNVTGVRGDAANLDDLDRLFDTVKREKGKIDILYASAGMGEAVPLGEITEQHF
FT                   DAAFGLNARGTLFTVQKALPLFNDGGSIFMTGSVASIKGFPGYSVYAASKATLHAFARG
FT                   WLNELKGRNIRVNVLHPGPIATPMQDQVLTEEAKQMFESLIPRGKMGRPEEIAAAALFL
FT                   ASDDSSFVNGVELSVDGGFSAI"
FT   gene            423936..424535
FT                   /gene="idhA"
FT                   /locus_tag="Arad_0503"
FT   CDS_pept        423936..424535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="idhA"
FT                   /locus_tag="Arad_0503"
FT                   /product="myo-inositol 2-dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25179"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7K7"
FT                   /protein_id="ACM25179.1"
FT                   /translation="MSYAIVGFGRIGQALAQAFARNNIEVAVASRRPAEVLAPQARAIG
FT                   PTVAAKSLRDALEADTIILAVPFGEYREVAKALSSWKGKTVIDAMNAFPVPEELDGLPS
FT                   SAFVAEAFTGAKLVKGFNHLIAATLATDPVVEGGHRVVFLSSDDPDAIAPVAALAKQLG
FT                   FAPVELGKFDEGGALVHARGRTWGQLIFQDLFKKEQ"
FT   gene            complement(424871..425350)
FT                   /locus_tag="Arad_0504"
FT   CDS_pept        complement(424871..425350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0504"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25180"
FT                   /db_xref="GOA:B9J7K8"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7K8"
FT                   /protein_id="ACM25180.1"
FT                   /translation="MNMAVEPDSAGVRFPPPFIYLGALLLGLAAERFVTLRSFGTDWRS
FT                   LIAAGALLFVAGAAVMLAAAGLFRRLGTNVRPSQPTTLIATTGPYRWTRNPMYLGMALV
FT                   YAGLAIGFDGPIAFALLPLVLIAIQTQVIAREERYLEAKFGDDYRRYKAEVRRWL"
FT   gene            complement(425366..426262)
FT                   /locus_tag="Arad_0506"
FT   CDS_pept        complement(425366..426262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0506"
FT                   /product="thioredoxin reductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25181"
FT                   /db_xref="GOA:B9J7K9"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7K9"
FT                   /protein_id="ACM25181.1"
FT                   /translation="MDDVIIIGGSFAGLAAALQLGRARRKVTVLDTGLPRNRFAGHSHG
FT                   LLGHDHKPPLDILAEARQQLARYPTIRLVNARADSISGAIDNFSVLTGDGESLGARRLI
FT                   LSYGVVDQMPNVPGFAESWGTSIVPCPYCDGFEVAGQHWGLVWSGPQSMNQVRLFHDWT
FT                   DRLTVFADGHDIPPDIRADLARRNVPVVDGRITGIAQRGAQNATVKLDTGPDVAVDILF
FT                   AHPRNKPSASLHESLGLATVKTPLGIILKVDERRETSMPGIYAAGDLANPITPPSVTLA
FT                   SSHGAMAGIFAQQSMLV"
FT   gene            426531..427199
FT                   /locus_tag="Arad_0508"
FT   CDS_pept        426531..427199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0508"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25182"
FT                   /db_xref="GOA:B9J7L0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7L0"
FT                   /protein_id="ACM25182.1"
FT                   /translation="MSRTVIIVTQNSQARRGRPANEALSQTIVDAACELFVELGFQATT
FT                   LDKVAQRARISKLSIYRHFENKEALFSAAIAAHCQQFAPQALIESVGGSAEHQLMAVGT
FT                   YLLRTLLSPDVRSVEAMIMADKTNQNSLSKLHYEAGPAYVIAQIEALLRQLHAKAALNV
FT                   PDPLRSARLFAALIKGSDLLIIARFDQARAEDDNEIESYCRSAVAMFIAAHGGNDQAGG
FT                   "
FT   gene            complement(427282..428844)
FT                   /gene="guaA1"
FT                   /locus_tag="Arad_0510"
FT   CDS_pept        complement(427282..428844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA1"
FT                   /locus_tag="Arad_0510"
FT                   /product="GMP synthase-glutamine amidotransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25183"
FT                   /db_xref="GOA:B9J7L1"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J7L1"
FT                   /protein_id="ACM25183.1"
FT                   /translation="MTQTAQPDTVLIVDFGSQVTQLIARRVREAGVYCEIVPFQSADAG
FT                   FKRLQPKAVILSGSPASTVDEGSPRAPQIIFDSGVPVFGICYGQQTMCMQLGGKVESGH
FT                   HREFGRAFLDVNKDCALFEGLWSSGSRHQVWMSHGDRVTALPDGFEVVATSSNAPYAFI
FT                   ADEKRKYYGVQFHPEVVHTPDGAKLIGNFIHNIAGIKGDWSMSAYRAKAVQAIRDQVGD
FT                   KRVICALSGGVDSSVAALLIHEAVGDQLTCILVDHGLMRKDEAANVVAMFSEHYNLHLL
FT                   HVDASERFIGELEGVSDPETKRKIIGRLFIETFEEEAKKLGGADFLGQGTLYPDVIESV
FT                   SFTGGPSVTIKSHHNVGGLPERMNMQLVEPLRELFKDEVRALGKELGLPDSFIGRHPFP
FT                   GPGLAIRCPGGITREKLEILREADAIYLDEIRKAGLYDAIWQAFAVLLPVQTVGVMGDG
FT                   RTYEFVCALRAVTSVDGMTADFYHYDMEFLGRAATRIINEVRGINRVVYDVTSKPPGTI
FT                   EWE"
FT   gene            complement(428948..429589)
FT                   /gene="pfs"
FT                   /locus_tag="Arad_0511"
FT   CDS_pept        complement(428948..429589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfs"
FT                   /locus_tag="Arad_0511"
FT                   /product="methylthioadenosine
FT                   nucleosidase/adenosylhomocysteine nucleosidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25184"
FT                   /db_xref="GOA:B9J7L2"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010050"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7L2"
FT                   /protein_id="ACM25184.1"
FT                   /translation="MTFELKRVSGKSILFVMAAEAEYGPFLRSRFEPLITGVGPVEAAV
FT                   VLTRTLARLEAQDDLPDLVVSLGSAGSARLEQTEVYQATSVSYRDMDASPLGFEKGRTP
FT                   FLDLPATIELPLRIPGVPEASLSTGGNIISGAEAYGRIAADMVEMETYAVLRACQAFGR
FT                   PLIGLRGISDGKVDLQHISDWTEYLHIIDRKLSNAVDGLFTALEDGVFWF"
FT   gene            complement(429586..430035)
FT                   /locus_tag="Arad_0512"
FT   CDS_pept        complement(429586..430035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0512"
FT                   /product="phenylacetic acid degradation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25185"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7L3"
FT                   /protein_id="ACM25185.1"
FT                   /translation="MTGENSGDYRARIRTSFERQAAMATIGAELTRVEHGMVEIELPFD
FT                   VKLTQQHGILHAGIISAALDSACGFAAYSLIDPTASILTIEFKVNLMSPGRGERFLFRG
FT                   EVTKPGNTIIVADGRGYAIGDGPAKLIASMTGTMMVIRGREGITG"
FT   gene            430196..431272
FT                   /locus_tag="Arad_0516"
FT   CDS_pept        430196..431272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0516"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25186"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR018721"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7L4"
FT                   /protein_id="ACM25186.1"
FT                   /translation="MATILQSTKAYESWMRAQLGADLVVADLEKKYKKMKSGGFVFLRA
FT                   TYWRWAETIFDICPDLADAPQVLAIGDTHLENFGTWRDEEGRLVWGVNDFDDAATMPYM
FT                   LDLVRLAASAILARGDDGPTPRVIADAILGGYRRGLQKPSAVILERDYKWLRNAVILSN
FT                   AERKAFWDKFRDLPPTVKPVPEPYLDALRRSLPDPTLTFVPKPRTAGTGSLGRPRFVAD
FT                   VEWRGGPVLREVKALAQSAWSLRHNPSNTAIYTGIIAAGRTRAPDPRYQVTGKLLVRRL
FT                   SPNSRKIEVVGDAQILLSPDMLDLMGFEIANCQADDASRIPGILADLDKRGGDWLRISA
FT                   KAAATAISVEQAEFAKRW"
FT   gene            complement(431301..432386)
FT                   /locus_tag="Arad_0518"
FT   CDS_pept        complement(431301..432386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0518"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25187"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008311"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7L5"
FT                   /protein_id="ACM25187.1"
FT                   /translation="MRSALIDRRAFVKAAGLTFLAALKPGALMALERADAVYASGMRAA
FT                   DGSFAVATVSERGEIIDLIALPARAHGMAFSKATGKTVAFARRPGTYAMIFDPWNKGEP
FT                   IVITAREGRHFYGHGTFSPDGKLLYASENDFDANKGMIGIYDARNRFTRIGEYETYGTG
FT                   PHDMTVSDDGKLLIVANGGIETHPDFGRTKLNLDHMEPSLTLIDAASGRLIEKHALPPQ
FT                   YAQVSTRHVDIDATGRIWFACQYEGRRNDLPPLVGHFAKGEDLTFVPLPDDTTRALGNY
FT                   VGAIAVNRADNLVGVTSPVEGTSVTLDAKTGAVLKVESVADAAGIAPAEHGFAVSSYRG
FT                   EFLGQRSDVAWDQHIVRIGRG"
FT   gene            complement(432392..433513)
FT                   /locus_tag="Arad_0519"
FT   CDS_pept        complement(432392..433513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0519"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25188"
FT                   /db_xref="InterPro:IPR018976"
FT                   /db_xref="InterPro:IPR034984"
FT                   /db_xref="InterPro:IPR038352"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7L6"
FT                   /protein_id="ACM25188.1"
FT                   /translation="MRPWTSLAKPLAASLLLSLTALPAGAQEATTNGAGLNEAAVPGVM
FT                   QKAIDDVIRPGYRAVHDSASKLTTAMKALCADPSAASLSAAQSAFGDTVKSWSRIEIVQ
FT                   TGPIIEKNRFEHILFYPDRKGVGLKQVQALIAKADEHDTTVEAVAGKSVALMSMTALEY
FT                   VLYGNGSSVLSSEKQGFRCRYGAAIAGNIENVSKEIADEWDDPNGVQKSWKNPGKDSEE
FT                   FMDNKEAVTALLGILVHGAGNVRDQRLETFYKGDPAAARPKMAIYWRSGNTWTSLTANL
FT                   EGLKALWEKAGMADLLPADKRDMAGKIDALLDKLIATAPTINPDIDAAIASDADRAKID
FT                   RLLADTRDLTTGFSDNYGGAIGLSAGFSFADGD"
FT   gene            complement(433513..435072)
FT                   /locus_tag="Arad_0520"
FT   CDS_pept        complement(433513..435072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0520"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25189"
FT                   /db_xref="GOA:B9J7L7"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR010538"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7L7"
FT                   /protein_id="ACM25189.1"
FT                   /translation="MTRIPARRALLPAFVAGFLVFSIALAAAEILNFPSVRTDLSPEQL
FT                   KRVQDITRPTADFSKAEPYEAMESGATTTIAPVSRDIFSQPSANLDLEREENFHLGNAL
FT                   FRKLWVSAPSSTQASDGLGPLFNARSCQSCHIRDGRGHPPDAAGTAATSMVLRLARPAI
FT                   TPEEEQALREFKAINFPDATYGAQLQDLAVPGLAAEGKVAVSYSEETVTLSGGEIITLR
FT                   KPHYALADLAYGPLGETTTLSARIAPPMIGLGLIESIPEADILAHADPDDKDGDGIRGR
FT                   AAIVRDHRTGELALGRFGWKAQNASVRDQVASAFSADIGISTPDRPDPYGDCTVKQPKC
FT                   LSMPTGVQKRLGDTEAPGPILDLVTFYSENLAVPARRKASFPDVLRGKDMFYQSGCPAC
FT                   HTPKFVTRDDLKGSDGKDKAQAFQLIWPYSDFLLHDMGDGLSDGQPVGVASGRDWRTPP
FT                   LWGIGLTQTVSGRQAYLHDGRAHTLTEAILWHGGEAEKARNTFTNLPPDDRQALINFLE
FT                   SL"
FT   gene            complement(435118..436395)
FT                   /locus_tag="Arad_0521"
FT   CDS_pept        complement(435118..436395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0521"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25190"
FT                   /db_xref="InterPro:IPR018976"
FT                   /db_xref="InterPro:IPR038352"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7L8"
FT                   /protein_id="ACM25190.1"
FT                   /translation="MKLKINLAAALALAVATSAVPVLAKAPEPAAIIKHYAEVAHAKYE
FT                   DSLITAKALDKAIDALLANPSDKTLKAAQAAWIKARVPYQQSEVYRFGNPIVDDWEGKV
FT                   NSWPLDEGLIDYVDASYGTESDENSLYVANVIANKTIKINGKDVDTSHLTPEFLSGTLH
FT                   QAGGVEANVATGYHAIEFLLWGQDLHGTGPGAGERPATDYDLKNCTHGNCDRRAEYLKS
FT                   ASTLLVSDLQEMTEKWTPDGEATKHVEADPKAGLAAILTGMGSLSYGELAGERMKLGLL
FT                   LHDPEEEHDCFSDNTYNSHNNDAIGIAAAYNGNYTRIDGKKLKGPSLHDLVAAKDKALD
FT                   KEVETKLNATLDAMKAMVHRGETVEKYDQMIGEGNTVGNATVQKAIDGLLDQTKSIQRV
FT                   VAALDLGTIKLEGSDSLDNPNAVFKK"
FT   gene            436677..437117
FT                   /locus_tag="Arad_0522"
FT   CDS_pept        436677..437117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0522"
FT                   /product="CBS-domain-containing membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25191"
FT                   /db_xref="GOA:B9J7L9"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7L9"
FT                   /protein_id="ACM25191.1"
FT                   /translation="MKSGIGAVTGMVAVGGLTIATGIPLLIAPFGATAVLIFGQPKSPL
FT                   AQPANVLGGYLLAALVGSLAMALFPGLWWAAAIAVGLAIAGMLMLRVTHPPAGAVPLVA
FT                   LGSHLSAWTLFTVVGLGGLLLIAIAVLHHHIPPKQQYPLRAE"
FT   gene            complement(437124..438413)
FT                   /gene="sun"
FT                   /locus_tag="Arad_0523"
FT   CDS_pept        complement(437124..438413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sun"
FT                   /locus_tag="Arad_0523"
FT                   /product="tRNA and rRNA cytosine-C5-methylase (RNA
FT                   methyltransferase) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25192"
FT                   /db_xref="GOA:B9J7M0"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7M0"
FT                   /protein_id="ACM25192.1"
FT                   /translation="MRLGGRLQGAIEVLADIETRKRPVADALKDWGLAHRFAGSGDRAA
FT                   IGNIVYDALRMRLSHAWLMGDDSPSALAHAVLFRQWGLTPEALAAELDGDKFAPEAPSA
FT                   EALTAFAARKLGDAPRHIQGDIPEWVEHSFQQAFGDSWLAEAQALAERPTLDLRANALK
FT                   ASRDKAVKALERAGAQASKIARNGIRIPAGEGASRLPNVTAELSFQKGWFEVQDEGSQI
FT                   VADLVLPQEGDQVLDYCAGGGGKTLAMSAAMHNKGQVHAYDTDRRRLAPIIERLKRAGT
FT                   RNVQVHDERNALLALRGKFDKVLVDAPCTGTGTWRRRPDTKWRLTQKNLDERISQQQEA
FT                   LAQAGEFVRPGGMLLYVTCSVLPDENETQVNRFAANNPEFEVVEALSSWEKLFGNDAPK
FT                   PRSSDGKTITLTPASTDTDGFFFCRLQRKQ"
FT   gene            complement(438633..439001)
FT                   /locus_tag="Arad_0525"
FT   CDS_pept        complement(438633..439001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0525"
FT                   /product="rare lipoprotein A protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25193"
FT                   /db_xref="GOA:B9J7M1"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7M1"
FT                   /protein_id="ACM25193.1"
FT                   /translation="MKKINRAIAIAATISASFAFLSTDAFAATGCGGASWYGGTTKTAS
FT                   GERMSSSRLTAAHRSLAFGTRLKVTNRNNGRSVVVRINDRGPFIRGRVLDLSRAAAQDI
FT                   GMVSSGTAKVCYEIVASR"
FT   gene            complement(439399..440295)
FT                   /locus_tag="Arad_0526"
FT   CDS_pept        complement(439399..440295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0526"
FT                   /product="nucleoside-diphosphate-sugar epimerase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25194"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7M2"
FT                   /protein_id="ACM25194.1"
FT                   /translation="METGGSGMMHVMIFGCGYSGTVIAKAFAGSGVRITGTTRSADKAD
FT                   LLARQGVEAFVFDGETLDPALAEAMKSATHLIQSIAPGTAGDPLLRLAHLDVATLMPKL
FT                   EWIGYLSTVGVYGDHKGAWINEETSLHPVSSRSVERVEAEDGWLRVGVRLGIPVAVLRL
FT                   AGIYGPGRNAFSNLEKGTARRLIKANQVFNRIRVEDIGACAKFLSDRRLGGIYNVTDDE
FT                   PTAPQDIIVEAARLMGVEPPPEQPFETAELTPMARSFYGENKRVSNAKLRSLGFLFRYP
FT                   EYRMSLAELWASGRWRG"
FT   gene            complement(440271..441428)
FT                   /locus_tag="Arad_0528"
FT   CDS_pept        complement(440271..441428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0528"
FT                   /product="iron-sulfur cluster binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25195"
FT                   /db_xref="GOA:B9J7M3"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7M3"
FT                   /protein_id="ACM25195.1"
FT                   /translation="MPEDRAAEKESRRRHSLTAFLRAEARAQGFDLCRITRPDAIPEAS
FT                   VRLDQFLEQGYHGTMTWMEETRERRGDPRMLWSDVRSVAVFGLNYGPDEDPRTILEKPD
FT                   KAAISVYARNRDYHDVIKGRLKEIATRFAARSQQDVKVFVDTAPVMEKPLAAAAGLGWQ
FT                   GKHTNLVSRTHGSWLFLGSMFTTADLEPDQAEIDHCGSCRACLDACPTAAFPAPYQLDA
FT                   RRCISYLTIEHKGPIDPLLRPLIGNRIYGCDDCLAACPWNKFASSASEMKLIAREDLKE
FT                   PSIAFLLELDDAAFRAFFSGSPVKRIGRDRFVRNVLIAAGNSDDRTLIEACRRLSADPS
FT                   PVVRGMAVWALSRLMTAGEFLAFAAERTDEPDADVRAEWKLAGVA"
FT   gene            complement(441441..442133)
FT                   /gene="gstch2"
FT                   /locus_tag="Arad_0530"
FT   CDS_pept        complement(441441..442133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gstch2"
FT                   /locus_tag="Arad_0530"
FT                   /product="glutathione S-transferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25196"
FT                   /db_xref="GOA:B9J7M4"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7M4"
FT                   /protein_id="ACM25196.1"
FT                   /translation="MPTLYHHSMSSPSRFVRLILTEYGYQTELIEEQTWEKRRDFLALN
FT                   PAGTLPVYVDDSMRALCGATVISEYLDETHGVLKRDRRLLAEDPFQRAEIRRLTEWFMQ
FT                   KMEQDVTRPLVRERVYKLQMTADQGGGAPDSKLMRMARGNIRQHMKYLSWLAGSRQWLA
FT                   GDRLSYADLAAAASISVLDYLGEIDWAESPVVKEWYQRMKSRPSFRPILAERVRAITPV
FT                   SHYADLDF"
FT   gene            442286..443086
FT                   /locus_tag="Arad_0531"
FT   CDS_pept        442286..443086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0531"
FT                   /product="undecaprenol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25197"
FT                   /db_xref="GOA:B9J7M5"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7M5"
FT                   /protein_id="ACM25197.1"
FT                   /translation="MAEQIIIALVLGLVEGLTEFIPVSSTGHLILIGHFLGFKSAGTFE
FT                   VLIQLGAILAILLVYFNRLVQIAKALPVSVKARHFVLAVLFGFLPAAIIGALAHDFIKG
FT                   VLFETPILICISLILGGIVLLVIDRIEFKPKYTSAYDFSWPMAIKIGFFQCLAMIPGTS
FT                   RSGSTIVGALLLGADKRSAAEFSFFLAMPTMVGAFTLDLWKSRNDLSFADGQLIVIGFV
FT                   AAFITALFVVRALLDFVSRRGYAPFAWWRIGVGILGLIGLYTVG"
FT   gene            complement(443603..444583)
FT                   /locus_tag="Arad_0534"
FT   CDS_pept        complement(443603..444583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0534"
FT                   /product="NADH dehydrogenase/NADH dehydrogenase
FT                   (ubiquinone) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25198"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7M6"
FT                   /protein_id="ACM25198.1"
FT                   /translation="MTLSNLPPLVTVFGGSGFIGRHVVRALAKRGYRIRVAVRRPDLAG
FT                   YLQPQGNLGQISIVQANLRYRNSIDRAVEGAQHVVNCVGILAESGRNTFDAVQEFGAKA
FT                   IAEAARGVGASLTHVSALGANANSPSAYARTKGRAEAAIFSIKPDAVILRPSIVFGPED
FT                   GFFNKFADMSRSAPFLPLIGGGKTKFQPVYVEDVAEAVARGVDGKLKAGTIYELGGPEV
FT                   LSFRECLETTLAVINRKKPLVSIPFGLASLIGSVASLVPLITPPITSDQVTLLKSDNVV
FT                   SKEAEAEGRTLKGIGLLPTLLISVLPSYLVRYRPQGQFTGSGKAA"
FT   gene            complement(444695..444982)
FT                   /locus_tag="Arad_0535"
FT   CDS_pept        complement(444695..444982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0535"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25199"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7M7"
FT                   /protein_id="ACM25199.1"
FT                   /translation="MAKGYWIARVDVHDTERYKDYVAAAKPAFERYGANFLARGGAFTP
FT                   LEGQARSRNVVIEFPSLQHAVDCYNSPEYQIAAKIRQEVADAEMVVVEGA"
FT   gene            complement(445006..445698)
FT                   /gene="pyrF"
FT                   /locus_tag="Arad_0538"
FT   CDS_pept        complement(445006..445698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrF"
FT                   /locus_tag="Arad_0538"
FT                   /product="orotidine 5'-phosphate decarboxylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25200"
FT                   /db_xref="GOA:B9J7M8"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J7M8"
FT                   /protein_id="ACM25200.1"
FT                   /translation="MTARDRLIVGLDVPNLQEAEKVVSALGDDILYYKIGYQLAFAGGL
FT                   EFARDLAKDGKKIFLDMKLLDIDNTVASGVENIVKMGMSMLTLHAYPKAMKAAVAAAKG
FT                   SDLCLLGVTVLTSMDEEDLIAAGYEYDPHTLVLRRAEQALLAGMGGIVCSAEEASAVRK
FT                   IIGPDMALVTPGIRPAGSDKGDQKRVMTPAEGIRAGSSHLVVARPIVKAADPREAARAI
FT                   LAEMDAAL"
FT   gene            complement(445700..446287)
FT                   /locus_tag="Arad_0539"
FT   CDS_pept        complement(445700..446287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0539"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25201"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7M9"
FT                   /protein_id="ACM25201.1"
FT                   /translation="MFALYITHPQVRIDPTVPVPEWGLSEIGAARAQLAATRDWAGKLG
FT                   LIVSSAERKAIETAEALATASGAAVEIIEATHENDRSATGFLAPPEFEKAADWFFAHPH
FT                   ESFKGWERAIDAQTRIVSEVEAVLSRHDPRAPIAFVGHGGVGTLLKCHLEGKPIARQGD
FT                   QPAGGGNLFVFDLAKRVISCDWTPMENWQGWA"
FT   gene            complement(446377..446970)
FT                   /locus_tag="Arad_0541"
FT   CDS_pept        complement(446377..446970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0541"
FT                   /product="phosphatidylethanolamine
FT                   N-methyltransferase/phosphatidyl-N-methylethanolamine
FT                   N-methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25202"
FT                   /db_xref="GOA:B9J7N0"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7N0"
FT                   /protein_id="ACM25202.1"
FT                   /translation="MALRLKERLGKKFDEEIRFFKGMMQGPKTVGSIVPTSSITARKMA
FT                   SVINLQSGLPVLELGPGTGAITKAILARGVEPQNLVAIEYSTDFYNHLVRRYAGVNFIN
FT                   GDAFDLDTTLGVLRGQTFDSVISGIPLLNFPMKARVNLLESLLDRMPPGRPVVQISYGP
FT                   VSPIIARPDRYHIQHFDFIVRNIPPAQLWIYRRG"
FT   gene            complement(447135..448253)
FT                   /gene="dnaN"
FT                   /locus_tag="Arad_0542"
FT   CDS_pept        complement(447135..448253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="Arad_0542"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25203"
FT                   /db_xref="GOA:B9J7N1"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7N1"
FT                   /protein_id="ACM25203.1"
FT                   /translation="MRITIERSNLLKSLNHVHRVVERRNTIPILSNVLLKAEGANLDMK
FT                   ATDLDLEITEATPANVEQAGATTVPAHLLYDIVRKLPDGSEVLLATNPDGGSMTVASGR
FT                   SKFSLQCLPESDFPDLTAGSFSHSFKLKAADLKMLIDRTQFAISTEETRYYLNGIFFHT
FT                   IESEGDLKLRAVATDGHRLARADVSAPSGSEGMPGIIIPRKTVGELQKLVDSPDVIVTV
FT                   EVSDAKIRTTIGSIVMTSKLIDGTFPDYQRVIPTNNDKEMRVDCQSFAQAVDRVSTISS
FT                   ERGRAVKLALSDGQLLLTVNNPDSGSATEEVAVGYDTDAMEIGFNAKYLLDITAQLSGD
FT                   AAIFLLADAGSPTLIRDTAGDDALYVLMPMRV"
FT   gene            448516..449424
FT                   /locus_tag="Arad_0543"
FT   CDS_pept        448516..449424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0543"
FT                   /product="methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25204"
FT                   /db_xref="GOA:B9J7N2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7N2"
FT                   /protein_id="ACM25204.1"
FT                   /translation="MNEDHSSGGARSFRLHNHTVPARPLEPALYLVATPIGNLGDITLR
FT                   ALETLAGADVLACEDTRVTRVLLDRYGIQNRPYAYHEYNADEVGPRLLQALEAGRSVAL
FT                   VSDAGTPLVSDPGYRLAQQAIEAGYRVVPIPGASAPLAALVGSGLPNDAFLFAGFLPTK
FT                   DKGKRDRLAELATVPATLIFFESPHRIAATLAAAADVLGAERPAAVGRELTKTFEEFRR
FT                   GTLAELAAFYETVDNVKGEIVWLAGPPQEVITPEADIEAMLRDLSKTMPTAKAAAEAAR
FT                   LTGLPRKDLYQRLLDMKAQHE"
FT   gene            449431..449802
FT                   /locus_tag="Arad_0545"
FT   CDS_pept        449431..449802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0545"
FT                   /product="endonuclease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25205"
FT                   /db_xref="GOA:B9J7N3"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7N3"
FT                   /protein_id="ACM25205.1"
FT                   /translation="MSGETGGKLKRQKAWRRGHVSEYLAAAFLLFKGYRILAIRHRTKL
FT                   GEIDIIARKGDLAVFVEVKARRGEQEAVDAVSFSAQKRIRAASDLWLARQPDYALLSQR
FT                   YDIVAILPGRWPRHFQDAF"
FT   gene            449907..450902
FT                   /locus_tag="Arad_0546"
FT   CDS_pept        449907..450902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0546"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25206"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7N4"
FT                   /protein_id="ACM25206.1"
FT                   /translation="MIRSTVSAFAVPSQEERQSFISLEKTPPIHAATLASLACMNTVRV
FT                   GGTAGQGRPLAFPFTVAAWNLERCLFPIESAAKLKATDAPLVLLSEMDEGMARTGQGDP
FT                   TATIAGELGMNYACGVEFLELSLGSEIERSFCKDNFNEKGFHGNALMASTALKDVFLFR
FT                   LPGEAVWFKDSNEQPRVGERCAIGAVVETEAGPFVAVSVHLESVATVAYRERQMAALIT
FT                   AVEAYAPGLPILIGGDLNTGNHTGGDFRTDTLFAMAEGRGFECHGGPLDQTSTRPSLIT
FT                   RFPDRTMKLDWFLSRGLKIGESYLVSSLDADGKPLSDHDMIVCTIEGFAA"
FT   gene            450981..451502
FT                   /locus_tag="Arad_0547"
FT   CDS_pept        450981..451502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0547"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25207"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7N5"
FT                   /protein_id="ACM25207.1"
FT                   /translation="MELGDCMVLRLMLASMAAFAARAVPVVTALPQSKNFVAGAAGEME
FT                   MKPSPIEPSWVVAGAPVARLAEHSRGQDDAALTALWDCTAGEFHWHFGWDETVMILEGE
FT                   VHITTEDGVERLLGAGDVAYFAGGTWATWRIDRYVRKVAFCRKPFPKPLTMAYRLRNLV
FT                   RQGGAQGIAA"
FT   gene            451575..452522
FT                   /gene="gshB"
FT                   /locus_tag="Arad_0549"
FT   CDS_pept        451575..452522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshB"
FT                   /locus_tag="Arad_0549"
FT                   /product="glutathione synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25208"
FT                   /db_xref="GOA:B9J7N6"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7N6"
FT                   /protein_id="ACM25208.1"
FT                   /translation="MAKIKNVAVQMDHVQGINIAGDSTFAMSLEAQNRGYKLFHYTPER
FT                   LSMRDGRVYASVEPMILRDVKGDHFELGEPERVDLSTMDVVLLRQDPPFDMAYITSTHL
FT                   LERIHPKTLVVNDPAWVRNSPEKIFVTEFADLMPKTLITRDAGEIRRFREEMGDIILKP
FT                   LYGNGGAGVFHSTRDDRNLSSLLEMFGQLFREPFIAQQYLPDVRKGDKRIILVDGEPVG
FT                   AINRVPAEHDSRSNMHVGGRAEATELTAREQEICARIGPSLKARGFLLVGIDVIGDYMT
FT                   EINVTSPTGIREVKRFGGADIASLLWDAIEAKRA"
FT   gene            452707..454238
FT                   /pseudo
FT                   /locus_tag="Arad_0550"
FT                   /note="Mg-chelatase protein; Frameshift (pseudogene)"
FT   gene            complement(454309..455277)
FT                   /gene="cysK1"
FT                   /locus_tag="Arad_0552"
FT   CDS_pept        complement(454309..455277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK1"
FT                   /locus_tag="Arad_0552"
FT                   /product="cysteine synthase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25209"
FT                   /db_xref="GOA:B9J7N7"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7N7"
FT                   /protein_id="ACM25209.1"
FT                   /translation="MSDTRKPGRGRVYASITETIGDTPLVRLDKLAKEKGVKANLLAKL
FT                   EFFNPIASVKDRIGVAMIESLEAQGKITPGRSVLIEPTSGNTGIALAFAAAAKGYKLIL
FT                   TMPETMSIERRKMLALLGAELVLTEGAKGMKGAIAKAEELASTLPDAVIPQQFENPANP
FT                   EIHRKTTAEEIWNDTDGKVDIFVSGIGTGGTITGVGQVLKARNPGIKVIAVEPADSPVL
FT                   SGGNPGPHKIQGIGAGFAPKILDTHVYDEVVTVTNDEAFQLARLVARLEGVPVGISSGA
FT                   ALTAAIKVGQRPENEGKTIVVIIPSFAERYLSTVLFEGLGG"
FT   gene            complement(455414..456031)
FT                   /locus_tag="Arad_0553"
FT   CDS_pept        complement(455414..456031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0553"
FT                   /product="amino acid efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25210"
FT                   /db_xref="GOA:B9J7N8"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7N8"
FT                   /protein_id="ACM25210.1"
FT                   /translation="MTLAALLTYSGALFIAAAIPGPGVIAVVARALGSGFRETFFMGLG
FT                   LVLGDMIYLTAIILGLAFLAQTFTEVFVVIKVAGALYLAYIAWKLWTTGLISTDVTAKK
FT                   STSAGMSFLSGLLVTLGNPKTMLFYVALVPTLIDIDSIGLHDYAALLAVTFVVLLAVFV
FT                   PYMLLASRARGFLKNPKALQVLNRAAAGVLAGTAAFIATRAA"
FT   gene            456176..456733
FT                   /locus_tag="Arad_0554"
FT   CDS_pept        456176..456733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0554"
FT                   /product="isochorismatase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25211"
FT                   /db_xref="GOA:B9J7N9"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7N9"
FT                   /protein_id="ACM25211.1"
FT                   /translation="MSSALLLIDLQNAVLTGLGTPARQPAIDAALETVVSKLAALKRVA
FT                   RAAGIPSFIVQHDGHGAHRLAKRGEGWQLRREIAPEAGDVVVHKTSCDSFFGTDLEQRL
FT                   RAKGITRLIIGGCMTQFCVDTTARRAVSLGFDVTLISDGHTTADMGKLSFEAIVSHHNM
FT                   LLDGFDAGPHEIKLVPTAQIAF"
FT   gene            456757..457389
FT                   /locus_tag="Arad_0555"
FT   CDS_pept        456757..457389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0555"
FT                   /product="amino acid efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25212"
FT                   /db_xref="GOA:B9J7P0"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7P0"
FT                   /protein_id="ACM25212.1"
FT                   /translation="MPHLTSMIAFALIALGMVLTPGPNMIYLVSRSISQGPAAGLISLG
FT                   GVAGGFVFYMLSAAFGITAFVFAVPFAYDALRLAGAVYLAWLAWNALKPGGRTAFQVRD
FT                   LPKDSKRRLFTMGLVTSLLNPKIAILYLSLLPQFIDPAAGSVFTQSIILGFTQIVISLT
FT                   FNAIFALTAGSIAMFFARRPAFMLVQRWLMGTVLAGLAVRMAVEAQR"
FT   gene            457389..458015
FT                   /locus_tag="Arad_0556"
FT   CDS_pept        457389..458015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0556"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25213"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7P1"
FT                   /protein_id="ACM25213.1"
FT                   /translation="MRMAPQQFAVGLLCLASFCGSTSMAMAADGATQTIVFLRHGEKPE
FT                   AGLGQLSCQGLNRALALPPVLTRLFGKPAAIFAPDPSKQKDDSGTSYDYVRPLATIEPT
FT                   AIALSLPVDTSFGYDDVDGLKAALEKPDYRGKLVFVAWEHKQIVDLARRLMTDNGGDAK
FT                   AVPKWHGKDFDGLYVVRITRNGSSANIAFERLTEGLDGQSESCPN"
FT   gene            complement(458131..458433)
FT                   /locus_tag="Arad_0557"
FT   CDS_pept        complement(458131..458433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0557"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25214"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7P2"
FT                   /protein_id="ACM25214.1"
FT                   /translation="MITCYLRYTIDPYKLAEFEHYAKLWIPLVNRLGGTHHGYFLPHES
FT                   ANNIALALFSFPSLADYETYRQRMAEDAECRAAFAYAEETRCILSYERSFMRPVF"
FT   gene            complement(458430..459344)
FT                   /locus_tag="Arad_0558"
FT   CDS_pept        complement(458430..459344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0558"
FT                   /product="transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25215"
FT                   /db_xref="GOA:B9J7P3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7P3"
FT                   /protein_id="ACM25215.1"
FT                   /translation="MNEIRRGTVEMTAAMLISGTIGWFVLMSGQPVTGVVFWRCLIGAL
FT                   TLLVICGAMGLLRPGILSLRTFAIAVGGGVAIVLNWLLLFAAYSHASISIATTVYNTQP
FT                   FMLLGLGALFLGEKITLTKLFWLGLAFAGMIIIVEGKSAQTGTAGSYLIGILLSLSAAF
FT                   FYALAAIAAKWLKGTPPHLIALIQVSTGILMLAPFTDFSDLPQGAGGWSIVATMGIVHT
FT                   GLMYVLLYGAIQKLPTHLTGALSFIYPIAAIVVDRFAFGHVLGITQIVGAVIILAAAAG
FT                   MNLGWTIPLPRPKSGHLPKEAAE"
FT   gene            459453..459917
FT                   /locus_tag="Arad_0559"
FT   CDS_pept        459453..459917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0559"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25216"
FT                   /db_xref="GOA:B9J7P4"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7P4"
FT                   /protein_id="ACM25216.1"
FT                   /translation="MGVPNTAIELDAIDQRMLEALARNARISLKELAEVAGLSSPSAAE
FT                   RLRRLEERGVIAAFTLDIAPEAIGYSLQAIVRIRPLPGQLHVVQRLIQETPEFIECDKV
FT                   TGEDCFIGRLVVRSMGDLDGILDKITERAETNTSMIKATPVKRRLPPLSR"
FT   gene            complement(459914..460807)
FT                   /locus_tag="Arad_0560"
FT   CDS_pept        complement(459914..460807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0560"
FT                   /product="acetyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25217"
FT                   /db_xref="GOA:B9J7P5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7P5"
FT                   /protein_id="ACM25217.1"
FT                   /translation="MLDLAGQRGLTFRQDYFDDPSAWKGLVDLLHDTFSIDISIQDQFG
FT                   DPDPSSMPFGYFDGDGRCVANFSAFSMPMIINGRAIKAAGYQSGAVRPEWRERGLYRDL
FT                   MQRAFARTSAEGYELDLLLTDKPALYERYGFRSLPQHVFIAQMPKVQKSDSIARQLSLE
FT                   APDDLHLIKTLLQNRQPVSARFAVIRQTEMFLLNACFNPAIRLTALGDETVIAWTFDGA
FT                   TFWLLDVAGTAIPSLATILCALDLEPDRIEICFSPDRLDCDVSLGPYEGYTMLMARGQA
FT                   ADDIAGPIMLSPMAEF"
FT   gene            complement(460807..461277)
FT                   /gene="dut"
FT                   /locus_tag="Arad_0561"
FT   CDS_pept        complement(460807..461277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="Arad_0561"
FT                   /product="deoxyuridine 5'triphosphate nucleotidohydrolase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25218"
FT                   /db_xref="GOA:B9J7P6"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J7P6"
FT                   /protein_id="ACM25218.1"
FT                   /translation="MTIHTDTRPTLNLIRLAHGRGLDLPAYETKGAAGMDLRAAIEDGT
FT                   TLTLAPGKRALVPSGFIFEIPEGFEAQIRPRSGLAFKNGITCLNSPGTVDSDYRGEVKV
FT                   LLINHGDEPFEITRGMRIAQVVIAPVTQVRVAEITEVSDTARGAGGFGSTGV"
FT   gene            461369..462952
FT                   /gene="prfC"
FT                   /locus_tag="Arad_0562"
FT   CDS_pept        461369..462952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfC"
FT                   /locus_tag="Arad_0562"
FT                   /product="peptide chain release factor 3"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25219"
FT                   /db_xref="GOA:B9J7P7"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7P7"
FT                   /protein_id="ACM25219.1"
FT                   /translation="MAESLAEAVSRRRTFAIIAHPDAGKTTLTEKLLLFGGAIQLAGEV
FT                   KAKKDRIQTRSDWMKIERERGISVVTSVMTFEYEGNVFNILDTPGHEDFADDTYRTLTA
FT                   VDAAVMVIDAAKGIEPRTLKLFEVCRMRDIPIITFINKMDRESRDPFEILDEVEEKLAL
FT                   DTAPITWPIGRAKSFCGSYHLADNTVRGSDTEVAPTPVNGPQAVAGRLPENERQGFIDE
FT                   TELAIEACRPFDRESFLEGHMTPVFFGSALRNYGVRDLINALGEFAPPPRDQVADIRTV
FT                   HATDDKMTAFVFKIQANMDPNHRDRIAFARICSGKLERGMKARLSRTGKQLGLTAPQFF
FT                   FASQRQLADTAYAGDVVGIPNHGTLRIGDTLTEGESLVFQGVPNFSPEILRRVRLEDAM
FT                   KAKKLKEALQQMAEEGVVQLFSPEDGSPAIVGVVGALQLDVLKERLMAEYGLPVSFEMS
FT                   RFSVCRWISADQPADLDKFLTARRGDIARDLDGDPVFLAQDGFSLRYEAERYPAIKMVA
FT                   IKEYHAFKAA"
FT   gene            complement(462984..463781)
FT                   /locus_tag="Arad_0563"
FT   CDS_pept        complement(462984..463781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0563"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25220"
FT                   /db_xref="GOA:B9J7P8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7P8"
FT                   /protein_id="ACM25220.1"
FT                   /translation="MPNELGPQLRAWRGTRGKSQLDLSLDTGISQRQISFIESGRSTPG
FT                   RHNLLHLAEVLDVPLRERNSLLLAAGYAPIYAEGNFDDREMQGLTKALKRMLRQHEPFP
FT                   AVVMDRYWNVVMTNDATPRFFNCFVDMAGRAAPRNLLHLMFDPEGMRPFIPDWEQTAKS
FT                   LLGRVFRESIGRVIDARTKELIDSLLAYPDVNAEWKTSVAADNTPMIPLSFMKDGQLLR
FT                   FFSLVTTVGTAQMITAQELRVECMFPLDEATEIHYAELMNAAQ"
FT   gene            complement(463880..464269)
FT                   /locus_tag="Arad_0564"
FT   CDS_pept        complement(463880..464269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0564"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25221"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7P9"
FT                   /protein_id="ACM25221.1"
FT                   /translation="MTTMSFTKKDAPQWLLSFWREIDDKTFGEGFNCLTEGATCNLGVA
FT                   DWKGRDTIRENLRAFIDTGFTALHDVTEYWDGGSLKVFRGTVTMTPDDRTQPVVSPVMT
FT                   HFFYMDEVEPTKVRHWYGSVGPIAF"
FT   gene            complement(464462..465355)
FT                   /locus_tag="Arad_0565"
FT   CDS_pept        complement(464462..465355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0565"
FT                   /product="thioredoxin reductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25222"
FT                   /db_xref="GOA:B9J7Q0"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7Q0"
FT                   /protein_id="ACM25222.1"
FT                   /translation="MYFDVIIIGGSYAGMSAGLQLARARRDILVVDADERRNRFAKSSH
FT                   GFLGQDGRDPGLIAADAREQLQRYPTVHWLNAKAQSAKRIEAGFSVTVGAGELLKGKRL
FT                   ILATGVVDRLPAIPGLQERWGKSVFHCPYCHGYELDQGRIGVIASSELSMHHALMLPDW
FT                   GTTTLFTNGAFVPDADQSSQLRARSVTIETAPVREIRGDRADVVLEDGRIIAMDGLFTL
FT                   TQTSVPAPWAEQLGCAFEDGPVGRFISTDAMKQTTAKGVFACGDAARAAGSVALSVGDG
FT                   ALAGTAAHRSLMFDND"
FT   gene            465529..465987
FT                   /locus_tag="Arad_0566"
FT   CDS_pept        465529..465987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0566"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25223"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7Q1"
FT                   /protein_id="ACM25223.1"
FT                   /translation="MRHDTRLSRMLHVLIHMDRHEGAATSETIAAMLGTNAVVVRRTMA
FT                   GLRDQGYVRSEKGHGGGWVLAQPLREITLLDIHNALGAPQLFSIGLAGDNPNCVIEQAV
FT                   NASLAEAMSEGEAILLAKFAKVTLAALAEQSSERWALASNCASAIEDF"
FT   gene            complement(466241..467119)
FT                   /locus_tag="Arad_0567"
FT   CDS_pept        complement(466241..467119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0567"
FT                   /product="oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25224"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7Q2"
FT                   /protein_id="ACM25224.1"
FT                   /translation="MSSIDHSGTFTLGDRTVKRLGYGAMQLAGPGVFGPPRDHDAAVAV
FT                   LREAVASGVNHIDTSDFYGPHVTNEIIREALHPYPDDLVIVTKISARRGTDGSWIPAMS
FT                   REELTQAVHDNLRNLGLDVLDVVNLRSMLDVHGPVEGSLEAPLTVLAELQQKGLVRHVG
FT                   LSNVTPTQIADGRKICDIVCVQNFYNLAHRNDDALIDALAREGTAYVPFFPLGGFSPLQ
FT                   SSTLSDVAERLGATPMQVALAWLLRHAPNILLIPGTSSVAHLRENLKAPELHLPDDALA
FT                   QLDGVAKASTT"
FT   gene            467237..468166
FT                   /locus_tag="Arad_0568"
FT   CDS_pept        467237..468166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0568"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25225"
FT                   /db_xref="GOA:B9J7Q3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7Q3"
FT                   /protein_id="ACM25225.1"
FT                   /translation="MSAFVAVARAKGFREGARLSGKSPSGLSEAVRRLEAELGVRLLNR
FT                   TTRSVVPTEAGERLLERLGPALSEMEAAFDVVNGFRDRPAGTLRLNVPISAARLVLPDI
FT                   VPRFLAAYPDIQLEIIAEDSFVDVLAAGCDAGIRYDERLEQDMIAIPIGPRTQRFATAA
FT                   SPSYLDLHGRPEHPSELINHACLRGRFSSGLMPPCEFERDGEIVRITPTGPLIVSIGGA
FT                   TDLVVAAAIAGTGIVYLFEEWLRPHLDSGALEPVLEPWWQSFSGPFLYYPGRRLVPAPL
FT                   RAFIDFITTSAKPPNTLAPEGGNHGPRE"
FT   gene            468150..468680
FT                   /locus_tag="Arad_0569"
FT   CDS_pept        468150..468680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0569"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25226"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7Q4"
FT                   /protein_id="ACM25226.1"
FT                   /translation="MVRENEIRENEVAVEPPAATDAGLVFIGRISTPWTSRMETPRQGR
FT                   HDGPLCRIELFEPWVPALKGVEAFERLEILYWLDRSRRDLVLQSPANSGKVHGTFSLRS
FT                   PVRPNPIGTSIVKLEAVEGATLLVRGLDCLDGTPLLDLKPDRTLFKPIAPPQPGDFQTG
FT                   DGETAHYCQKRET"
FT   gene            complement(468677..468892)
FT                   /locus_tag="Arad_0570"
FT   CDS_pept        complement(468677..468892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0570"
FT                   /product="molybdo-pterin binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25227"
FT                   /db_xref="GOA:B9J7Q5"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7Q5"
FT                   /protein_id="ACM25227.1"
FT                   /translation="MSMKISARNRLKGKVVEVTKGATTAHVRIDIGNGSIVTSSITNEA
FT                   VDELGLTVGADAYAVIKASDVMVAVD"
FT   gene            complement(468952..470466)
FT                   /gene="betC"
FT                   /locus_tag="Arad_0571"
FT   CDS_pept        complement(468952..470466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betC"
FT                   /locus_tag="Arad_0571"
FT                   /product="choline sulfatase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25228"
FT                   /db_xref="GOA:B9J7Q6"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017785"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="InterPro:IPR025863"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7Q6"
FT                   /protein_id="ACM25228.1"
FT                   /translation="MARPNILILMVDQFNGTLFPDGPADFLHAPVLKVLAERSVRFANS
FT                   YTASPLCAPARASFMSGQLPSRTRVYDNAAEFASDIPTFAHHLRAAGYQTALSGKMHFV
FT                   GPDQMHGFEERLTTDIYPADFGWTPDYTKPGERIDWWYHNLGSVTGAGVAEITNQMEYD
FT                   DEVTYHATRKLLDLSRGHDERPWCLTVSFTHPHDPYVARRRFWDLYEDCPALDPEVGEI
FT                   PFDQQDQHSQRLMKASDHAAFDITPEQVRRARRGYFANISYVDEKIGEILDALERGRMA
FT                   DNTIVLFVSDHGDMLGERGLWFKMNFFEGSARVPLTIAAPGWPARRIDQPVSTLDVTPT
FT                   LAGLAGIDIASLRQWTDGEDLAPLALGTGSRGPVPMEYAAEGSEAPLVGLRDGHYKLIL
FT                   CDKDLPLLFNLEADPKELTNLAGDPGHAEILARLTAQAMQRWNLAAFDAAVRESQARRW
FT                   VVYAALRNGAYYPWDYQPLQKASERYMRNHMDLNVLEENQRFPRGE"
FT   gene            470606..471508
FT                   /locus_tag="Arad_0572"
FT   CDS_pept        470606..471508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0572"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25229"
FT                   /db_xref="GOA:B9J7Q7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017786"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7Q7"
FT                   /protein_id="ACM25229.1"
FT                   /translation="MAERPVDLGWLRIFVEVARSGSLSSAAASLGLTQPAVSYQIRRIE
FT                   EQMGVTLFHRQHRGVELSSEGRRLLEIAEKAVGGVDSLVHGFRAEAERPMVRLRTDYAF
FT                   SALWLIPRMHRFRLVYPELDIQIVATQRQERGQSDSGDVAVVFGTRQEFGPEAVLLLPE
FT                   KVAPVCAQGFIDKYGPFEDPGHLARATLVHLDTDTPSPWFDWKSYFAELGISRDTYAGH
FT                   GDLRFNTYSLVVQAAIGEQGLALGWMGLVDQLLAGRMLVTAGPMLEAPDRGYWLLPPKS
FT                   PGMHAGRLTEWLLMEPAAK"
FT   gene            complement(471486..472901)
FT                   /gene="otsA"
FT                   /locus_tag="Arad_0573"
FT   CDS_pept        complement(471486..472901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="otsA"
FT                   /locus_tag="Arad_0573"
FT                   /product="alpha,alpha-trehalose-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25230"
FT                   /db_xref="GOA:B9J7Q8"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="InterPro:IPR012766"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7Q8"
FT                   /protein_id="ACM25230.1"
FT                   /translation="MSRLIVISNRVSVPDKKGNAAGGLAVALRAALEEHGGIWMGWSGN
FT                   SSGDKEPEPLVMTDHGNITYALTDLTQTDVEEYYQGFANRVLWPICHYRLDLAEYGRKE
FT                   MDGYFRVNRFFAHRLAPLIQPDDVIWVHDYHLIPLAAELRQMGLKNRIGFFLHIPWPPA
FT                   DVLAIMPVHQEIMRSLSAYDLLGFQTDHDLENFASCLKREEIGDEIGPGLFSAHGRTFR
FT                   GGAYSIGIETAAFADFARKAASHSMVRKARQSIEGRDLIIGVDRLDYSKGITQRIEAFE
FT                   RFLGDNPAYQNRVTYLQVTPKSRSEVPEYEAMQQAVAEQAGRVNGAIGTVDWVPIRYIN
FT                   RSISRPVLAGLYRLGRIGLVTPLRDGMNLVAKEYVAAQDPDDPGVLVLSRFAGAARELK
FT                   GALLVNPYDIEATANAMARGLTMPLEERQRRWRGMMDHLLEHDVARWCNDFLKDLTEEA
FT                   KPPVNQVTLRLVP"
FT   gene            complement(472947..473741)
FT                   /gene="otsB"
FT                   /locus_tag="Arad_0574"
FT   CDS_pept        complement(472947..473741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="otsB"
FT                   /locus_tag="Arad_0574"
FT                   /product="trehalose-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25231"
FT                   /db_xref="GOA:B9J7Q9"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7Q9"
FT                   /protein_id="ACM25231.1"
FT                   /translation="MTYKEQPEQGEAEPAPSKEPALTALSLYPDQWALFLDIDGTLLDL
FT                   AETPEAIVVPPSLPYALQALSRKLGGALAVVTGRSVAFVDPLFAPFHFPVAGLHGAERR
FT                   DAAGRLRRALIPPAFQEMKSAIAREAEAWPGALVEDKGAAIAVHYRQAPEREAEIAEAM
FT                   QRYLEEAGPDWALQRGKSVVEICPARAGKGYAVEAFLDEEPFIGRKPLTIGDDVTDEAM
FT                   FAAANRLGGQSVRVGPPNGKTLARASISSPARLRDILASLAA"
FT   gene            474362..475177
FT                   /locus_tag="Arad_0575"
FT   CDS_pept        474362..475177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0575"
FT                   /product="glutamine amidotransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25232"
FT                   /db_xref="GOA:B9J7R0"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7R0"
FT                   /protein_id="ACM25232.1"
FT                   /translation="MCRWAAYRGDPLYLEELVSSPAHSLIEQSHCATRAKTATNGDGFG
FT                   IAWYGDRPEPGRYRDILPAWSDCNLKSLARQIRSPLFLAHVRAATGGGTRRDNCHPFVH
FT                   ENWAFQHNGQISNFDRLRRPMEAMLDDHLFQARSGTTDSELMFLLALQFGLVTNPVAAI
FT                   SETISFVEGLSVHLTGSALVRFTAAFSDGKSLHAVRYATDRKAPTLYASPVGSGYCLVS
FT                   EPLNDDVDAWTEIPDGSSVLIDDMGVHITPFQPEKRSLAAPQTAAAIPA"
FT   gene            complement(475164..476375)
FT                   /gene="coaBC"
FT                   /locus_tag="Arad_0576"
FT   CDS_pept        complement(475164..476375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaBC"
FT                   /locus_tag="Arad_0576"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25233"
FT                   /db_xref="GOA:B9J7R1"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7R1"
FT                   /protein_id="ACM25233.1"
FT                   /translation="MVLAGKRILLIISGGIAAYKSLDLIRRLRERGAAVRPVMTSGAQQ
FT                   FVTPLAVGALAADHVFTDLFSRQDEQDVGHIRLARDCDLVLIAPATADLLAKMANGLAD
FT                   DLASTVLLATDRPVLVAPAMNPKMWAHAATKRNVEILRGDGIRFVGPMVGEMAESKEAG
FT                   AGRMAEPLEIVAAVEMRLDDGARPLAGRKAVVTSGPTHEPIDPVRYIANRSSGRQGHAI
FT                   ASALAALGADVTLVSGPVTIPDPTGMRVVHVERADEMRDAVLSALPADIAVMVAAVADW
FT                   KVASAADQKIKKHPGESIPTLALTENPDILKTVGHHTQRPKLVIGFAAETQDVESNAKA
FT                   KLERKGADIIVANDVSPSTGIMGGTRNRVKIVRHDGVEQWPDLDKDEVAARLAALIAEQ
FT                   FRQG"
FT   gene            476545..476991
FT                   /locus_tag="Arad_0577"
FT   CDS_pept        476545..476991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0577"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25234"
FT                   /db_xref="GOA:B9J7R2"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7R2"
FT                   /protein_id="ACM25234.1"
FT                   /translation="MKVAMIALPILAAAMPAFAERAYSPEEQKNKEIVLDFYQKALNDK
FT                   DFDTASKYLGKYIQHNPLAADGPEGLRGFIEFLKKNYPHSKSEITRVMVDGDYVILRVH
FT                   AIREPGDRGSAIVDIFRVENNKIEEHWDSVQPIPEKSMNTNTMF"
FT   gene            complement(477054..477818)
FT                   /locus_tag="Arad_0578"
FT   CDS_pept        complement(477054..477818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0578"
FT                   /product="oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25235"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7R3"
FT                   /protein_id="ACM25235.1"
FT                   /translation="MNRLNGKVAIVTGASSGIGRATAKLFAAEGAKVIVGARRGAELEI
FT                   LVADIKATGGDAAALAGDVRSEDYHKALVALAVERYGRLDIAFNNAGTLGEAGLSTEVS
FT                   EAGFAEALAINLTASFLAAKHQIGEMIKHGGGSVIFTSTFVGHTVGFPGVAAYAASKSG
FT                   LIGLTQTLAAEFGPQNVRVNAILPGAVDTDMYREMNDTPDKQAFVTNLHALKRVSRPEE
FT                   IARSVLYLASDDASFVTGTASLVDGGVSITRT"
FT   gene            477938..478843
FT                   /locus_tag="Arad_0579"
FT   CDS_pept        477938..478843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0579"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25236"
FT                   /db_xref="GOA:B9J7R4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7R4"
FT                   /protein_id="ACM25236.1"
FT                   /translation="MLKIEGLTAFVTVAEAGSISEAARRLRLSKSVVSERLAEMEKTLG
FT                   ATLLHRTTRKLTLTEDGTVFLERATRIVREVREAAADLAERRGTLAGPLRIAAPVTFGR
FT                   MHLGPVLYPFLAAHPEIELTLELDDRRVDAASDGYDAIIRHGLIADSRLVAWPLARSRR
FT                   LLVASPDYLRQHGMPASPSDLENHRGIFYTNRGIADWRFQGPEGAVIVRGKLALGINNG
FT                   DVSRDAAIAGLGIALLPAFIAGPSVNEGLLVDIDVGCRPEPEFVFMAHPEGRNPSAKLR
FT                   AIADHLKKAFGDPPYWDTLG"
FT   gene            complement(478844..479719)
FT                   /locus_tag="Arad_0580"
FT   CDS_pept        complement(478844..479719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0580"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25237"
FT                   /db_xref="GOA:B9J7R5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037410"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7R5"
FT                   /protein_id="ACM25237.1"
FT                   /translation="MELRHIRYFLALADEGNFTRAAAKLGIGQPPLSQQIRDLENEVGA
FT                   ALFHRVPHGAELTAAGEAFQVEAKLAVDAAEKAKLAAQRANRGEIGRLSLGFTASSAFN
FT                   TIVTSTIREFRNRWPQVRLSLTEMNTNALTERLMRGEIDAAFIRPGLEDPRNVRLKRFD
FT                   DEPMLIALPAHHPLAEKDRVPIAALAHEPFILFPRMVGLSLYDDIAAACRDAGFELLVT
FT                   QEAPQIPSVVNLVAANLGVSIVPASIAQIKLDGVTYRPIDGPPLVARLGLAVLKAQRSP
FT                   VTANLMSLIA"
FT   gene            479805..481100
FT                   /locus_tag="Arad_0581"
FT   CDS_pept        479805..481100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0581"
FT                   /product="transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25238"
FT                   /db_xref="GOA:B9J7R6"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7R6"
FT                   /protein_id="ACM25238.1"
FT                   /translation="MCALMSRAVQTEDLTISEVPSRPELKLVDTEPQSEARQFLTRGTP
FT                   AFRRATIALFLSGFATFSLLYCVQPLMPIFAEDFGVTPAASSLSLSLSTGFLAFAIFCA
FT                   AAVSESLGRRSLMFVSLLGAALCTIACAVAPNWQTLLVFRALEGFLLGGVPAVAMTYLA
FT                   EEIDPRGLGGAMGLYIAGNAFGGMAGRVVTGTIAEFLTWRPALAAVGVLGLIAATGFLF
FT                   LLPPSRNFTPRKGFDAAFHIRAWAGHFRNPALPLLFAIGFLIMGSFVTVYNYAGFRLVA
FT                   DPYDLNQTELGLIFTAYLFGIVASWAAGILGDRIGHFVVLPAGVLVTALGAAVTLATPL
FT                   PLVILGIILVTIGFFVTHSVASALVGRLASGAKGHASSLYLLAYYLGSSIAGSVGGYFW
FT                   LADGWSAVVAFILAMLAACLVSAFAVARLARR"
FT   gene            481123..481524
FT                   /locus_tag="Arad_0582"
FT   CDS_pept        481123..481524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0582"
FT                   /product="biphenyl-2,3-diol 1,2-dioxygenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25239"
FT                   /db_xref="GOA:B9J7R7"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7R7"
FT                   /protein_id="ACM25239.1"
FT                   /translation="MIRIDHLDHLVLTVASIEESCAFYARVLGMGVEIFGEGRKALTFG
FT                   NQKINLHRAGHEFEPKAKRPIPGSADLCFISETPLDDVIAHLTAEGIHIEEGPVRRTGA
FT                   TGPILSVYFRDPDDNLIEVSNYLAVSDGL"
FT   gene            complement(481521..481916)
FT                   /locus_tag="Arad_0583"
FT   CDS_pept        complement(481521..481916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0583"
FT                   /product="PilT protein, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25240"
FT                   /db_xref="GOA:B9J7R8"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7R8"
FT                   /protein_id="ACM25240.1"
FT                   /translation="MKYLLDSNAVIALMKGHSGFVAEIRKHKPQDFAIPAIVAHELFYG
FT                   AYKGQRVADNLARVDALQFETLDFDREDARKAGEIRAALAILGTPIGAYDVLIAGQAVA
FT                   RDLILVTHNVREFQRVKNLRFEDWETV"
FT   gene            complement(481913..482155)
FT                   /locus_tag="Arad_0584"
FT   CDS_pept        complement(481913..482155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0584"
FT                   /product="SpoVT/AbrB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25241"
FT                   /db_xref="GOA:B9J7R9"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7R9"
FT                   /protein_id="ACM25241.1"
FT                   /translation="MDTAKIFWSGRSQAVRLPKEFRFDTDAVRIRRQGQAIILEPIVED
FT                   WDWLETVTGPVDQDFAEAATEQPVEQERPELDIFK"
FT   gene            complement(482224..482907)
FT                   /locus_tag="Arad_0585"
FT   CDS_pept        complement(482224..482907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0585"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25242"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7S0"
FT                   /protein_id="ACM25242.1"
FT                   /translation="MPVIPWTLLDTAKIPNGGGELRLKQRGQEFSIMLGTNELMNSRLS
FT                   GSERALATLSCEKIKDRTAPHILIGGLGMGFTLRAALGELGGDAKVTVAELVPAVVAWA
FT                   RGPMAAVFDNCLDDPRVAIHEGDVRPLIRASKAAYDAILLDVDNGPDGITHEANDGLYD
FT                   FKGLRAAHDALRPGGVLAVWSSGPDRDFTRRLRDTGFTAEEINTRANGKSGARHVIWLA
FT                   AKAGR"
FT   gene            complement(482972..484633)
FT                   /gene="hutU"
FT                   /locus_tag="Arad_0586"
FT   CDS_pept        complement(482972..484633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutU"
FT                   /locus_tag="Arad_0586"
FT                   /product="urocanate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25243"
FT                   /db_xref="GOA:B9J7S1"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="InterPro:IPR035085"
FT                   /db_xref="InterPro:IPR035400"
FT                   /db_xref="InterPro:IPR035401"
FT                   /db_xref="InterPro:IPR036190"
FT                   /db_xref="InterPro:IPR038364"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7S1"
FT                   /protein_id="ACM25243.1"
FT                   /translation="MPKANPRHPKFPIPGGPVLRAKGWRQEALLRLLENVLSVGEDPDN
FT                   LIVYAALGKAARNWAAHKGIVKALTEMEEDQTLLIQSGKPIGLVRTHAKAPLVIMANCN
FT                   IVGQWAKAEVFYELQRKGLICWGGLTAGAWQYIGSQGVIQGTYEIFMRIAERRFGGDLL
FT                   GRFVLTAGLGGMGGAQPLAGRMAGAAILCVDIDAERAKKRQEIGYLQEIAPNLDAALAM
FT                   IDAAVKDKRALSVGLVGNAAEIYPEIARRGIVPDIVTDQTSAHDLVYGYVPKGMSLAQV
FT                   KDLRDDGQGQLMAASRASIVEHVKAMLDFQKKGAEVFDNGNLIRTQAKEGGVANAFDIP
FT                   IFTEAYLRPLFARAIGPFRWMALSGEESDIARIDDLLLEMFPDNKIITNWIRLAREHVP
FT                   FEGLPARIAWLGHGERTDLARRVNELVASGELKGPVAFSRDHLDAGAMAHPNIMTERMK
FT                   DGSDAIADWPLIDAMMLCASMADLVVVHSGGGGYAGYMTSCGVTVVADGTAEADERLDH
FT                   ALTNDTALGVMRYADAGYEEALDEVAKKDVPYIRLG"
FT   gene            complement(485002..486102)
FT                   /locus_tag="Arad_0588"
FT   CDS_pept        complement(485002..486102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0588"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25244"
FT                   /db_xref="InterPro:IPR010318"
FT                   /db_xref="InterPro:IPR027479"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7S2"
FT                   /protein_id="ACM25244.1"
FT                   /translation="MGRILVAKDVEAAVKGGSVYAAGGGGWADHGRMLGYAAVNVGKPE
FT                   LVSIDELNDNDWIATAAAIGAPASTTPWEMQGVDYVKAVQLLQDELGEKLSGLIIGQNG
FT                   KSSTLNGWLPSAILGTKVVDAVGDIRAHPTGDMGSIGMAGSPEQMIQTAVGGNRAENRY
FT                   IELVVKGATAKISPILRAASDQSGGFIASCRNPLRASYVRTHAALGGISMALALGEAII
FT                   DAEKKGGSAVIDAICKTTGGHILAEGVIARKDVIYTKEAFDIGTITVGAGDKAVTMHVM
FT                   NEYMAVEDTDGKRLATFPSVITTLSPEGEPLSVGQLHEGMHVFILHVPMDIIPLSASVL
FT                   DPTVYPSVEKAMRIEIAKYALAGKRG"
FT   gene            complement(486107..487381)
FT                   /locus_tag="Arad_0590"
FT   CDS_pept        complement(486107..487381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0590"
FT                   /product="N-carbamoyl-L-amino acid amidohydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25245"
FT                   /db_xref="GOA:B9J7S3"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7S3"
FT                   /protein_id="ACM25245.1"
FT                   /translation="MNQPKRNLPVNADRIAEDIDALAKITEPDHPWTRRAFSPLFLEGR
FT                   AYIDARMKAAGLETRMDAAGNLIGRRAGAKPGLGTILVGSHSDTVPDGGRFDGIAGTIA
FT                   ALEVARSLKDQDIQLDHDLEIVDFLAEEVSIFGVSCIGSRGMTGQLPEAWLRRVSGDRN
FT                   LAQGIAEVGGDPATLLAQKRPDLTGFLELHIEQGPILEAENKDIGIVTAIAGITRIEIT
FT                   VEGRADHAGTTPMGRRADALVAASQLVLDIRSQATEQAKTPGHFAATVGEFRIEPNAAN
FT                   VVPSKVVLLIDGRAEIRGDMEQFLAWIDGAVQKIATAYGVTIKPPVRVSDNFPTPGDAG
FT                   LLETLERACETVGAKHRRMASGAGHDTAWVAKVAPAAMIFVPCKEGRSHCADEWAENND
FT                   IAMGAAVLFEAVRDMDKNLQKTSQE"
FT   gene            complement(487381..488784)
FT                   /locus_tag="Arad_0591"
FT   CDS_pept        complement(487381..488784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0591"
FT                   /product="allantoinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25246"
FT                   /db_xref="GOA:B9J7S4"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7S4"
FT                   /protein_id="ACM25246.1"
FT                   /translation="MGMADFDLVLQGTMVLPDRIVEEGYVAVRNGKIAEIGIGVPPQAR
FT                   ERHLLGKALILPGAIDAQVHSLSQKDQEDFVWSTRSAAAGGVTTIVDMPYDEGNLVCSA
FT                   EAVKKKVDHASPQARVDFALYGTVDPEEGPARIREMVEAGVAAFKFSTFGTDPKRFPRI
FT                   PPALLDACFAAIAPTGLTAGVHNEDDEAVRTYMEQVKASGVTDYRAHGLSRPPITELLA
FT                   MHTIFETGANTGCPAHVVHCSLGRGYDIARAYRRDGFEATVECCIHYLTLDEENDVKRL
FT                   GGKAKINPPIRPRAEVETLWRKVAEGNVWLVSTDHVSWSENRKTNPDMLANASGVPGLE
FT                   VMVPLFVKGALERGVSLTWAARLMAENPAKHFRLDHIKGALTPGKDADIVVLEPRETIY
FT                   DAASSGNNIVGWSPYNGIRLPWTVSATYLRGKQITDGNKVLAEPGSGKFVRPLPRQIIA
FT                   GQNIAGETA"
FT   gene            complement(488794..490377)
FT                   /gene="hutHch"
FT                   /locus_tag="Arad_0592"
FT   CDS_pept        complement(488794..490377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutHch"
FT                   /locus_tag="Arad_0592"
FT                   /product="histidine ammonia-lyase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25247"
FT                   /db_xref="GOA:B9J7S5"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7S5"
FT                   /protein_id="ACM25247.1"
FT                   /translation="MERQKAGIELTGHPLGFSDLVRIGAGVAMPTASESGMARVHAARE
FT                   VLESTIQSGMPVYGSTTGVGAMKDVEWSPEDLDTFNLGLVRAHHFGTGAPFSMSVVRNA
FT                   MAIRVNTALTGQVGCSPGLIDAYLQLLHTDVIPVVRRTGSIGCADIGLMGQIGAVLTGV
FT                   GEAVYRGRRMQAADAFTAAGIEPVKMLPRDSLASLSVNAVSFAAAAETTRNAASSIRVL
FT                   LATSMMAAGALGASRDPWYAVRHVGTAREALIGAWLCNASDEWPWPIATHVQDPLSLRM
FT                   IAQVYGAVIENLLTAGHKILAATGRSDDNPVIVDGRVMTSGGSLPLDVTILLEAAVICM
FT                   AHAARNAFNHCVLLGNGQRRGLPVNLVPEGKIATGFGPIIKLAGEIFSRVLSMSNPVSA
FT                   QSLVVAAGMEDEAAFLPLVIERFDRQMRALKRLAALEALLSAQAIDILGDKPEGVARML
FT                   YDVVRKHADFYEVDRPLSAEVEAIEEELGSEAFVSEMIAQQPILAYDDFFALGSLERVE
FT                   ERLYRDTVTI"
FT   gene            490601..490933
FT                   /locus_tag="Arad_0593"
FT   CDS_pept        490601..490933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0593"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25248"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7S6"
FT                   /protein_id="ACM25248.1"
FT                   /translation="MKIPELAFTTTNWDEVPATRHEGESGHALWRTLNIGDIRIRVVEY
FT                   TPGYVADHWCDRGHVIYVLEGELISELKDGRVSVLTKGMGYQVSDFGDAAHRSSTETGA
FT                   KLFIVD"
FT   gene            complement(490995..492569)
FT                   /gene="ubiB"
FT                   /locus_tag="Arad_0594"
FT   CDS_pept        complement(490995..492569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiB"
FT                   /locus_tag="Arad_0594"
FT                   /product="2-polyprenylphenol 6-hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25249"
FT                   /db_xref="GOA:B9J7S7"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7S7"
FT                   /protein_id="ACM25249.1"
FT                   /translation="MSAFNAYFSLLRVGWVLVREGVVISLPSEGLPPSVSLAKSFVGMF
FT                   ARKRAKSQARSDRLAKAVERLGPSYVKIGQFLATRPDVVGVDMANDLSQLQDSMAFFPH
FT                   AAAKSSIEGSLGRTIDELYVSFGEPIAAASIAQVHPAEVETPEGRKRVAVKVIRPGVRQ
FT                   RFVNDIQAMYLVSHLQERFLPSSRRLRPVEVTRTLEQTTKVEMDLRLEAAALSEIAENT
FT                   EKDPGFRVPKVDWERTGRDVITMEWIDGVKMSDVEGLKAAGHDLNTLADTLIQSFLRHT
FT                   LRDGFFHADMHPGNLFVDATGMIVAVDMGIVGRLGKKERRFLAEILYGFITRDYIRVAE
FT                   VHFEAGYVPAHHNTESFAQAIRAIGEPIHGQPAETISMGKLLTLLFEVTELFDMETRPE
FT                   LVMLQKTMVVVEGVSRMLNPRFNMWKASEPVVGDWIRTNLGPKRIVTDLKDGLKAAVKL
FT                   AEAIPEIAAKTEKFHHELLHMSENGVRFDPQTAEAIGKAEAKHSRSGRLALWIIALSLL
FT                   YLAWHLS"
FT   gene            complement(492632..493408)
FT                   /gene="ubiE"
FT                   /locus_tag="Arad_0595"
FT   CDS_pept        complement(492632..493408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="Arad_0595"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25250"
FT                   /db_xref="GOA:B9J7S8"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J7S8"
FT                   /protein_id="ACM25250.1"
FT                   /translation="MAESRTSADGGMETSYGFREVADGEKQGLVNEVFHKVAKRYDIMN
FT                   DVMSMGLHRAWKDAMISALNPRKDPSYKVLDVAGGTGDIAFRIVEASNRLAHATVLDIN
FT                   GSMLGVGAERAAKKKLTDNLTFVEANAEELPFEPNSFDAYTIAFGIRNVPRIDVALKEA
FT                   YRVLKRGGRLLVLEFSEVDLPLLDRVYEAWSFNAIPQFGKAITGDAEPYQYLVESIRKF
FT                   PNQQDFATMIREAGFSRVNFTNYTGGIAALHSGWKL"
FT   gene            493707..494546
FT                   /gene="mutM"
FT                   /locus_tag="Arad_0597"
FT   CDS_pept        493707..494546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="Arad_0597"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25251"
FT                   /db_xref="GOA:B9J7S9"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7S9"
FT                   /protein_id="ACM25251.1"
FT                   /translation="MEGAVLAALELRRNDLRFPFPAEFSRLASGRGITSLSRRAKYLLI
FT                   DLDDGMTIIAHLGMSGSFRVETGAVAETPGEFHHPRSKDEKHDHVIFHLTGANGPARVI
FT                   YNDPRRFGFMDIARRADLGSHPSFRDLGPEPTGNTLSADYLAERFSGKAQPLKSALLDQ
FT                   KNIAGLGNIYVCEALWRSHLSPVRAAGSLVTQAGRPSEELLRLVEAIREVIADAIAAGG
FT                   SSLRDHIQTDGSLGYFQHSFSVYDREAQPCGTPGCGGTVARIVQSGRSSFYCASCQT"
FT   gene            494580..495353
FT                   /gene="fadB1"
FT                   /locus_tag="Arad_0598"
FT   CDS_pept        494580..495353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadB1"
FT                   /locus_tag="Arad_0598"
FT                   /product="enoyl-CoA hydratase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25252"
FT                   /db_xref="GOA:B9J7T0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7T0"
FT                   /protein_id="ACM25252.1"
FT                   /translation="MAYETLIVETHGAVGLIRLNRPQALNALNSTVLTELRQAYAAFHA
FT                   DDAIGAIVLTGSEKAFAAGADIKEMQPLDFADVYKGDLMSGWDEIAKARKPVIAAVSGF
FT                   ALGGGCELAMMCDFIIAADTAKFGQPEITLGIIPGMGGSQRLTRAVGKAKAMDLVLTGR
FT                   MMDAAEAERSGLVSRIVPADKLIDEALAAAAKIASLSRPSVLMAKEAVNRALETTLEEG
FT                   LRFERRLFHSLFATEDQKEGMAAFIEKRKPVFKNR"
FT   gene            495546..495821
FT                   /gene="rpsT"
FT                   /locus_tag="Arad_0600"
FT   CDS_pept        495546..495821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="Arad_0600"
FT                   /product="ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25253"
FT                   /db_xref="GOA:B9J7T1"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J7T1"
FT                   /protein_id="ACM25253.1"
FT                   /translation="MANTSSAKKATRKIARRTEVNKARRSRVRTFVRQVEEAIASGDAT
FT                   LAKEAFLAAQPELARAATKGVLHANTASRKVSRLAKRVKALSAPTA"
FT   gene            496696..498246
FT                   /gene="dnaA"
FT                   /locus_tag="Arad_0601"
FT   CDS_pept        496696..498246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="Arad_0601"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25254"
FT                   /db_xref="GOA:B9J7T2"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7T2"
FT                   /protein_id="ACM25254.1"
FT                   /translation="MQINTRTTGALENGDNAPQAFSAVCLEAGEKGEMQHNVLFERVSA
FT                   RLKAQVGPDVYASWFARLKLHSVSKSVVRLTVPTTFLKSWINNRYLDLITSLFQAEDAE
FT                   VLKVEILVRTATRHAAKPCADEQVVVPDSTAVAPIRRTTAQPAGQIVAHAVSAAAAARP
FT                   ATMGSPLFGSPLDSRFTFDTYVEGSSNRVSLAAAKTIAEAGSGAVRFNPLFVHSTVGLG
FT                   KTHLLQAIANAAVQNPRNLRVVYLTAEYFMWRFATAIRDNDALTLKDSLRNIDLLIIDD
FT                   MQFLQGKMIQHEFCHLLNMLLDSAKQVVVAADRAPWELESLDPRVRSRLQGGVAIEVEA
FT                   PDYEMRLEILKRRLEAARLEDPSLEIPAELLSHVARNVTASGRELEGAFNQLIFRRSFE
FT                   PNLTVERVDELLAHLVGSGEPRRVRIEDIQRIVARHYNVSRQELVSNRRTRVIVKPRQI
FT                   AMYLSKTLTPRSFPEIGRRFGGRDHTTVLHAVRKIEELISGDSKLSHEIELLKRLINE"
FT   gene            498389..499471
FT                   /locus_tag="Arad_0603"
FT   CDS_pept        498389..499471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0603"
FT                   /product="dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25255"
FT                   /db_xref="GOA:B9J7T3"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR032095"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7T3"
FT                   /protein_id="ACM25255.1"
FT                   /translation="MGFDRIAVLGLGKVGRLAATLLHESGFAVTGVDARLPAETLPFAC
FT                   ETGDVSDPALIGNLFSRVDAVLSCLPFHLNAALAKLAHDAGIHYFDLTEDVPTTNGIIE
FT                   LAKSARGLMAPQCGLAPGFIGIVGASLADGFDRCRSIRMRVGALPQNPTGLLGYAFNWS
FT                   PEGVVNEYLNDCEVIEGGVRKLVSPMEWHETLYVNGVKLEAFTTSGGLGTMCATMLGRV
FT                   ENLDYKTIRYPGHMELMNFFFHELLMRDRRKLAGEILTEAKPPVDDDVVYVHVSAEGTI
FT                   NGNLRRKEFVRAYYPIEIAGESRTAISWTTSASVVAVIELVRAGRLPSTGFLHQEHIPL
FT                   DMFLETRTGSLFKGGATHLG"
FT   gene            complement(499477..500373)
FT                   /gene="ampR"
FT                   /locus_tag="Arad_0605"
FT   CDS_pept        complement(499477..500373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampR"
FT                   /locus_tag="Arad_0605"
FT                   /product="transcriptional regulator protein (activator)"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25256"
FT                   /db_xref="GOA:B9J7T4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7T4"
FT                   /protein_id="ACM25256.1"
FT                   /translation="MDQLPSLSALRAFEASARHLSMTLAARELHVTPGAVSLQVRDLET
FT                   ALGVRLFERRARSLALTAEGADYFATLRTAFRLIREATTALTMRARDTVLTVTCTAGFA
FT                   THWLVPRLLRFEQAHPDIDLRISASYRTMDFQRDGIDIAIRHGLGGYEGLASERLLDDQ
FT                   YVPVCTPEIAAALGTSPPADALASLTLIHDVYRRDWQLWLEAAGATKVDATRGPIFTDG
FT                   MGAYHAMKAGLGIALMRRSFIEQELVDGTLVAPFPIGLASTLAYHLVYPPAALERPAIA
FT                   AFRAWLFSEVSRTTPPV"
FT   gene            500540..501448
FT                   /locus_tag="Arad_0606"
FT   CDS_pept        500540..501448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0606"
FT                   /product="permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25257"
FT                   /db_xref="GOA:B9J7T5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7T5"
FT                   /protein_id="ACM25257.1"
FT                   /translation="MGAAEWGMLLGLSVLWGGSFLFNGILVHELPPFTIVTARVALAAV
FT                   ALHVIVRMTGQAMPRDRQAWAAFFGMGFLNNVIPFLLIVWGQTHIASGLASILNATTPL
FT                   FAVVVAHFLTADEKMTGNRLIGVIVGFAGVALMIGPSVLSSLGSNVLAQLAVLGAAFTY
FT                   SLAGIFGRRFRRMGLAPIIPAAGQVTASTILLLPVALFVDHPWTLALPSTETWLALAGL
FT                   AILSTAIAYVLFFRILATAGATNLMLVTFLIPVSAILLGALFLGEQLQLKHFIGMAMIA
FT                   VGLAAIDGRLFTLSSRGRVGT"
FT   gene            complement(501554..502732)
FT                   /gene="hemNch"
FT                   /locus_tag="Arad_0608"
FT   CDS_pept        complement(501554..502732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemNch"
FT                   /locus_tag="Arad_0608"
FT                   /product="coproporphyrinogen III oxidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25258"
FT                   /db_xref="GOA:B9J7T6"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7T6"
FT                   /protein_id="ACM25258.1"
FT                   /translation="MTHEAQLLPDTGEPGFGVYVHWPFCAAKCPYCDFNSHVRHQPVDQ
FT                   ERFTAAFLKEMASMRAIGGPKTVTSIFLGGGTPSLMKPETVGAVLDGIAKHWHVPDGIE
FT                   ITMEANPSSVEAERFRGYRAAGVNRVSMGVQALNDRDLKFLGRLHNVADALKAIKLARD
FT                   IFPRMSFDLIYARPNQTVEEWERELKEAISYAVDHLSLYQLTIEEGTPFYGLHKAGKLI
FT                   VPDGDQSALLYEATQEITEREGMPAYEVSNHARPGAESRHNLTYWRYGDYAGIGPGAHG
FT                   RLTLGPKKLATATERKPEAWLELVERDGHGIADQEMLGDDEQADELLLMGLRLKEGIDL
FT                   VRWQQLSGREPDQAREEFLLEHGFIERLGNSRLRCTPAGMLILDSVVADLAR"
FT   gene            complement(502767..503411)
FT                   /gene="rdgB"
FT                   /locus_tag="Arad_0609"
FT   CDS_pept        complement(502767..503411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdgB"
FT                   /locus_tag="Arad_0609"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25259"
FT                   /db_xref="GOA:B9J7T7"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7T7"
FT                   /protein_id="ACM25259.1"
FT                   /translation="MRKLETKTIVVASHNAGKIREIEDLIGPFGFTAKSAADLNFIEPD
FT                   ETGTTFEENATIKALASANASGLPALSDDSGLVIDALGGDPGVYTANWAETADGTRDFA
FT                   MAMQKVETALEKVGATTPESRTARFVSVLCLAWPDGHTELFRGEVEGTVAWPPRGTQGF
FT                   GYDPIFQPKGYETTFGEMSAEEKHGWKPGDAQALSHRARAFKLFVETCLEA"
FT   gene            complement(503423..503836)
FT                   /locus_tag="Arad_0610"
FT   CDS_pept        complement(503423..503836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0610"
FT                   /product="lactoylglutathione lyase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25260"
FT                   /db_xref="GOA:B9J7T8"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B9J7T8"
FT                   /protein_id="ACM25260.1"
FT                   /translation="MNPSLEGILETAVYADDLDAAEAFYGGILGLEKIARGGNRHVFYR
FT                   CGPGVLLIFNSAETVKPPEPGALPVPPHGTTGHGHVCFRVSGNNIEATAERLKAAGVVI
FT                   EADFHWPNGGRSIYFRDPAGNSLECAEPRIWGI"
FT   gene            complement(503856..504572)
FT                   /gene="rph"
FT                   /locus_tag="Arad_0611"
FT   CDS_pept        complement(503856..504572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="Arad_0611"
FT                   /product="ribonuclease PH"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25261"
FT                   /db_xref="GOA:B9J7T9"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J7T9"
FT                   /protein_id="ACM25261.1"
FT                   /translation="MRPSGRKTDQMRKVSFERNFSKHAEGSCLVKFGDTHVLCTASLEE
FT                   KTPPWLRNSGKGWVTAEYGMLPRATGERMKREAASGKQGGRTQEIQRLIGRSLRAVVDL
FT                   KELGERQITIDCDVIQADGGTRTASITGAWIALYDCLKWMESRNMIKVERVLKDHIAAI
FT                   SCGIFASQPVIDLDYLEDSSAETDANFVMTGKGGIVEIQGTAEGTPFSEEEFTTLMHLA
FT                   KNGIAELVELQKQAIA"
FT   gene            504745..505833
FT                   /gene="hrcA"
FT                   /locus_tag="Arad_0612"
FT   CDS_pept        504745..505833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrcA"
FT                   /locus_tag="Arad_0612"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25262"
FT                   /db_xref="GOA:B9J7U0"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J7U0"
FT                   /protein_id="ACM25262.1"
FT                   /translation="MGFTTSSVTDAIAALDERSKEIFRRIVEGYLENGEPLGSRNLSRL
FT                   LPMSLSPASVRNVMSDLEELGLIYSPHISAGRLPTQIGLRFFVDAFMQVGDLSAEDRAT
FT                   IDRQVRGSNRDQPMESVMTEASRMLSGISRGAGLVITSKNDPVLKHVEFIRLEPTKALA
FT                   VLVGDHDQVENRIIELPAGITSSQLTEAANFLNAHMTGQTLPDLRRQLLTLKESVRHEL
FT                   DTLSHELVERGIAVWSGGEDEGKPTQLIVRGHANLLTEVGGAEDLDRLRLLFDDLEKKD
FT                   SLIEILNLAESGPGVRIFIGSENKLFSLSGSSLIVAPYRDDDDRIIGAVGVIGPTRLNY
FT                   ARIVPMVDYTAQLFSRMSRPGL"
FT   gene            complement(505908..506342)
FT                   /locus_tag="Arad_0613"
FT   CDS_pept        complement(505908..506342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0613"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25263"
FT                   /db_xref="GOA:B9J876"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:B9J876"
FT                   /protein_id="ACM25263.1"
FT                   /translation="MSNGKSHSGKCFCGAVEIAVSGEPAAMGYCHCDSCREWSAGPVNA
FT                   FSLWPPQAVHVTKGADHVSSYQRSATSVRKWCEICGGHLLTEHPLWGVTDVYAAIIPTL
FT                   DFQPALHVNYENTVLHLRDGLPKQKDMPAEMGGSGTLLPD"
FT   gene            506562..507188
FT                   /gene="grpE"
FT                   /locus_tag="Arad_0614"
FT   CDS_pept        506562..507188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="Arad_0614"
FT                   /product="molecular chaperone heat shock protein (hsp-70)"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25264"
FT                   /db_xref="GOA:B9J877"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:B9J877"
FT                   /protein_id="ACM25264.1"
FT                   /translation="MTDETTKTGPDATAADLAQDVADTVETTAETQEPDPVELLKAENS
FT                   DLRDRYLRLAADMDNLRRRTEREIKDAKSYSVAGFARDMLAVSDNLRRTLDAIPAELRD
FT                   DAGLKTLIEGVEMTERSMLSALERHGVRQIEPVGQKFDPNFHQAMFEVPNSEVPNNTVV
FT                   QVVQAGFVIGERVLRPAMVGVAKGGPKLAEVSELGSNSPFDEKDA"
FT   gene            complement(507279..507743)
FT                   /gene="ptsN"
FT                   /locus_tag="Arad_0616"
FT   CDS_pept        complement(507279..507743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsN"
FT                   /locus_tag="Arad_0616"
FT                   /product="PTS IIA-like nitrogen-regulatory protein PtsN"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25265"
FT                   /db_xref="GOA:B9J878"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:B9J878"
FT                   /protein_id="ACM25265.1"
FT                   /translation="MALADLLHQDAIIPALRANSKKQLLQELAAKASKLTGLPEREIFD
FT                   VVLQRERLGSTGVGNGIAIPHGKLNSIKSIIGIFARLEASVDFEALDDQPVDLVFLLLA
FT                   PEGAGADHLKALSRIARVLRDQDLVAKLRATDSASAIYAFLNEEQASNAA"
FT   gene            complement(507832..508407)
FT                   /locus_tag="Arad_0618"
FT   CDS_pept        complement(507832..508407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0618"
FT                   /product="sigma 54 modulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25266"
FT                   /db_xref="GOA:B9J879"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:B9J879"
FT                   /protein_id="ACM25266.1"
FT                   /translation="MSVRVSGKHMEIGDSFRQRIEDQIGMAVTKYFDGGYSGQVTVQKS
FT                   SSRFTADCKLHLDSGVVLHAAGEAMDPQLAFDAASARIEKRLRRYKRKLKDHQAASHAN
FT                   GHIEVAYTVMDGMSDDDEEIAADFAPAIVAESTKQLKTMSVATAVMALDMTDEPLLLFR
FT                   SPGKDHLNIVYRRQDGNIGWIDAANIKS"
FT   gene            complement(508660..510078)
FT                   /gene="rpoN"
FT                   /locus_tag="Arad_0619"
FT   CDS_pept        complement(508660..510078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoN"
FT                   /locus_tag="Arad_0619"
FT                   /product="RNA polymerase sigma-54 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25267"
FT                   /db_xref="GOA:B9J880"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:B9J880"
FT                   /protein_id="ACM25267.1"
FT                   /translation="MLEFTSNDEDIGNGSEREAKDERYDAAEESRGDDGADHNSGDLKS
FT                   DWYESENTGHADRLNDELDTNFSNVYPDDSTAQRADAPELLSQWKSMPGGEAGESYDLD
FT                   DFVAGQISLRDHLNEQIPFSLPAMADRLIAQHFVDQLDDCGYLQVDLRETADRLGTTLG
FT                   DVERVLDVLQQLDPPGVFARSLSECLAIQLRQKDRFDPAMERLIQNLELLARRDFATLK
FT                   RLCGVDEEDLLDMMGEIRQLNPKPGSGFETGISEAITPDIVVRPASDGSWLVELNPDTL
FT                   PRVLVNQSYFASVTKTSQDHAFLSECLQNANWLTRSLDQRAKTIMKVASEIVRQQDAFL
FT                   IHGVDHLRPLNLKTVADAIKMHESTVSRVTSNKYMLTPRGLFELKYFFTVSISAVEGGD
FT                   SHSAEAVRHKIRLLISHESPDTVLSDDDIVDTLKKGGIELARRTVAKYREAMNIPSSVQ
FT                   RRREKRAIAKVASF"
FT   gene            complement(510413..511225)
FT                   /locus_tag="Arad_0620"
FT   CDS_pept        complement(510413..511225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0620"
FT                   /product="amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25268"
FT                   /db_xref="GOA:B9J881"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="UniProtKB/TrEMBL:B9J881"
FT                   /protein_id="ACM25268.1"
FT                   /translation="MTTSTTSPLPGATGLPSAASGSPTADKARYQGTLIARGLTKTYRT
FT                   RRVVNGVSLVVRRGEAVGLLGPNGAGKTTCFYMITGLVPVDEGTIEIDGNNVTSMPMYR
FT                   RARLGVGYLPQEASIFRGLTVEENIRAVLEVHEKDKQKREHKIDELLEEFHIRNLRTVP
FT                   AIALSGGERRRLEIARALATDPTFMLLDEPFAGVDPISVADIQNLVHHLTARGIGVLIT
FT                   DHNVRETLGLIDRAYIIHAGEVLTHGRANDIVSNPEVRKLYLGDNFSL"
FT   gene            complement(511239..511907)
FT                   /gene="yhbN"
FT                   /locus_tag="Arad_0622"
FT   CDS_pept        complement(511239..511907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhbN"
FT                   /locus_tag="Arad_0622"
FT                   /product="cell envelope biogenesis protein YhbN"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25269"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:B9J882"
FT                   /protein_id="ACM25269.1"
FT                   /translation="MINDWQHSLFNSNLRKAGLLCAFGALAFLAAPGADAQTTTTSKMP
FT                   GLALSSDQPIQIESDKLEIHDAESQAVFTGNVKVVQGTTTMQAGKMTVFYKKKQPAADA
FT                   AAKPATDNPVAKAAKEQNQSLVSGDANIDHILVTNKVYLVSGTQTATADDGSFDMANQL
FT                   AVLKGQKVVLTDGPNVFTGCQLTVHMATGEAQLDACGGRVQIQLDPKSQQVQQQQQKKN
FT                   "
FT   gene            complement(511904..512590)
FT                   /locus_tag="Arad_0623"
FT   CDS_pept        complement(511904..512590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0623"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25270"
FT                   /db_xref="GOA:B9J883"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="UniProtKB/TrEMBL:B9J883"
FT                   /protein_id="ACM25270.1"
FT                   /translation="MLNTIETTGQAIGSELERNAYKDAIFHSTRVRKLKLFLPLAALIV
FT                   SLIFIAVSLVRAYLPENIQIEGARIEDGKVVMERPAIAGRNKDGINYSMLAEKALQDIK
FT                   NPNMITLKSIKASMPVNSDVIAHVTAESADFDRQADTLKLTDPFTILMDNGLRAEFRTA
FT                   FLDVKKGDLSSQDQVAIYRGGMSVVAQSLKMTDKGSVIEFDGQVRMNIDPTTLHNKASE
FT                   QRPGGS"
FT   gene            512921..513877
FT                   /gene="sppA"
FT                   /locus_tag="Arad_0624"
FT   CDS_pept        512921..513877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sppA"
FT                   /locus_tag="Arad_0624"
FT                   /product="proteinase IV protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25271"
FT                   /db_xref="GOA:B9J884"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B9J884"
FT                   /protein_id="ACM25271.1"
FT                   /translation="MDSSAIADRRQLRRKLGFWRIIAVLLLVGLGFALYRFFAADLPDT
FT                   RGPQIARVAISGLIQDDSELLERLKKIKDNDQVKALIVSISSTGGTTYGGERIFKAIRA
FT                   VAAKKPVVSDIRTVAASAGYMIATAGDDIVAGDTSITGSIGVIFQYPQAKDLLDKLGVS
FT                   LEDIKSSPMKAEPSPFHPPSEDAKNMIRNMVMDSYGWFVDLVADRRKLPREEVLKLADG
FT                   SIFTGRQALQNKLIDTLGGEDEIRAYLDTRKVNKDLPIVDWKAENKTSSFFWPGAASWL
FT                   LNLFGYDDFVKGEGFQKMMTEKLFLDGLLSVWQGAAN"
FT   gene            513905..514213
FT                   /gene="ihfB"
FT                   /locus_tag="Arad_0625"
FT   CDS_pept        513905..514213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ihfB"
FT                   /locus_tag="Arad_0625"
FT                   /product="integration host factor, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25272"
FT                   /db_xref="GOA:B9J885"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005685"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J885"
FT                   /protein_id="ACM25272.1"
FT                   /translation="MIKSELVQIVAARNPHLYHRDVENIVNAVLDEITDALAAGNRVEL
FT                   RGFGAFSVKNRPSRSGRNPRTGDTVFVEEKWVPFFKTGKELRERLNPGAGDEDDDDN"
FT   gene            514371..514703
FT                   /locus_tag="Arad_0626"
FT   CDS_pept        514371..514703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0626"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25273"
FT                   /db_xref="GOA:B9J886"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:B9J886"
FT                   /protein_id="ACM25273.1"
FT                   /translation="MTKKIINLLILLPLGIILIVFCVANRQSATLALNPFRPEDQVLSL
FT                   HAPLFVLLFVALILGMIVGAAVTWVNQGKHRKRARNQSREAVHWHAEADKHRSRAEQIT
FT                   GQLPSK"
FT   gene            515022..516752
FT                   /gene="mcpY"
FT                   /locus_tag="Arad_0628"
FT   CDS_pept        515022..516752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcpY"
FT                   /locus_tag="Arad_0628"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25274"
FT                   /db_xref="GOA:B9J887"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B9J887"
FT                   /protein_id="ACM25274.1"
FT                   /translation="MKAISLNFGSDSAGVLAAMDKSLAIIEFDVTGKILTANANFCRTI
FT                   GYELPEIVGQQHRMFVAPAEVSSPDYSEFWAKLGRGEFDRRQYKRIGKGGREIWIEASY
FT                   NPIFKYGKPYKVVKVATDITAEKLKSIEDAGKLNALSRSQAVIEFTPDGRVLAANANFL
FT                   ATMGYELSEIDGKHHSLFCDGTYAASESYRQFWQRLAKGEFIADEFMRIGKGGRRIFIQ
FT                   ASYNPIFDMDNRVFKVVKFATDVTGRVNNVEQLGGALKRMSDGDLTQHLDIPFIPTLDK
FT                   LRLDFNGAVGKLRDAMRSVAEAAGAISAGAQKIHVATDDISMRSEQQAMSVEETAAALE
FT                   EITTTIADSSHNAEDAGQLVRDTRDTAIRSGMVVRSAIDAMARIKSSSEEISNIIGVID
FT                   EIAFQTNLLALNAGIEAARAGDAGKGFAVVAQEVRELAQRSAKAAKEIGGLIALSQGHV
FT                   KSGVALVAETGTTLQTIESQVEQANKNVSAIVEVAKEQAVTLREVNGAVTILDRGTQQN
FT                   TALVQESAVAARSLSAEADELFELLKLFTLEARVASSSATQGPAAISKNGDWPFRRLAG
FT                   "
FT   gene            complement(516762..517211)
FT                   /locus_tag="Arad_0629"
FT   CDS_pept        complement(516762..517211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0629"
FT                   /product="acetyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25275"
FT                   /db_xref="GOA:B9J888"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9J888"
FT                   /protein_id="ACM25275.1"
FT                   /translation="MTSEANQWTIRPAREQDTDSLAEIYLGVRRQTFIWVDPVRFHRED
FT                   FAAHTQGEHIFVCEDSSGTIAGFLTLWEPDDFIHMLYILPAFQGSGAGKALLAALPDWP
FT                   RRRYRLKCLVRNTRAIAFYRAIGFKIVGDGASPEGDYKDMQLSGD"
FT   gene            complement(517232..517684)
FT                   /locus_tag="Arad_0630"
FT   CDS_pept        complement(517232..517684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0630"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25276"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B9J889"
FT                   /protein_id="ACM25276.1"
FT                   /translation="MDMTGEERIAAPRDAVWAALNDPDILKQCIPGCQSLERISPTQLT
FT                   ATVKLKIGPVSASFNGEVTLSNINAPESYTISGEGKGGIAGFAKGGADVVLKEDGDETI
FT                   LQYEAKAQVGGKIAQLGSRLVDSSAKKLAQQFFADFTAAINGQAST"
FT   gene            517797..518954
FT                   /locus_tag="Arad_0631"
FT   CDS_pept        517797..518954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0631"
FT                   /product="SAM-dependent methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25277"
FT                   /db_xref="GOA:B9J890"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9J890"
FT                   /protein_id="ACM25277.1"
FT                   /translation="MAKHRESRPGQRAAGGASAKSPRDARREAPVKAGKPPAKPARDAG
FT                   PRPAAVARDRGERTVEPRDAAPVPAAPERPMIVRSGERPVERVPVILESLGAGDFHLID
FT                   TGNGLKLEQYGPYRIVRPEAQALWQPSLAPHVWDNADSIFTGDTDEDGMGRWRFPREAL
FT                   GETWPLKLLGVDFLGRFTAFRHVGVFPEQIVHWAWMKQQVEAANRPLKVLNLFGYTGVA
FT                   SLVAAAAGAEVTHVDASKKAIGWARENQALGRMEKLPIRWICEDAMKFILREERRGNKY
FT                   DIILTDPPKFGRGPNGEVWHLFEHLPSMLDICREILSPKALGLVLTAYSIRASFYSIHE
FT                   LMRETMRGAGGVVESGELVIREAGLDGKTPGRALSTSLFSRWVPK"
FT   gene            518951..519811
FT                   /gene="spoU"
FT                   /locus_tag="Arad_0632"
FT   CDS_pept        518951..519811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoU"
FT                   /locus_tag="Arad_0632"
FT                   /product="rRNA methylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25278"
FT                   /db_xref="GOA:B9J891"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:B9J891"
FT                   /protein_id="ACM25278.1"
FT                   /translation="MNQDYRNDGPRKVGQVKEVTSLANPIIKDIKALTNKKSREESGAF
FT                   LAEGLKLVIDALELGWTIRTLVYAKAAKGKPLVEQVAAKTVAAGGLVLEVSEKVIASIT
FT                   RRDNPQMVVGIFDQRWRPLRDVRPKAGETWVALDRVRDPGNLGTIIRTADAAGASGVIL
FT                   VGETTDPFSLETVRATMGSVFAVPVVKATPEEFLAWKKTAGVSVVATHLAGAVDYRTID
FT                   YKKKPVVLLMGNEQSGLPDALAKEADALARIPQAGRADSLNLAVATAVMLFEARRHLLT
FT                   LSETR"
FT   gene            519808..520326
FT                   /gene="lspA"
FT                   /locus_tag="Arad_0633"
FT   CDS_pept        519808..520326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="Arad_0633"
FT                   /product="signal peptidase II"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25279"
FT                   /db_xref="GOA:B9J892"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:B9J892"
FT                   /protein_id="ACM25279.1"
FT                   /translation="MTDSDINDQAAAKPALFSRPLPILIFIIIAVILDQAVKIMVDHWL
FT                   PLQEMVPVIPMLALYRTYNLGVAFSMLSGMDGWFIVGMRLVIVAFVIWLWRRTPDHRWI
FT                   AHLGFALIIAGALGNLIDRFLYGHVIDYVLFHTETWSFAVFNLADSFITIGAGCVILDE
FT                   LLSPKKANT"
FT   gene            520382..522685
FT                   /locus_tag="Arad_0634"
FT   CDS_pept        520382..522685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0634"
FT                   /product="two-component sensor histidine kinase/response
FT                   regulator hybrid protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25280"
FT                   /db_xref="GOA:B9J893"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B9J893"
FT                   /protein_id="ACM25280.1"
FT                   /translation="MSTLANLQEKLVAAIADDQTGPRERPVIDAPRLDADPIGILPPVE
FT                   QVTSNPPVFSQWLQRHWLNGGGLIAGVLLLLVGYAGGLPALAGLLGLIALAIVIAGVAA
FT                   KQKTGRKIIADAPPLSEHEHDRLWESNESTSLFATIHDALGDITVTRCIERRIIHANAT
FT                   FRRLTGKANPEGLTLEEAGLVFRAVTESQRQDAEISTPEGPRIFAWHDVMFRDPVSGRL
FT                   SIQSVARDVTEERQAARLREDARLKAEYNSAAKSRLLATVSHEIRTPLSGILGMNHLLA
FT                   QTPLTLEQANYLTGIRQSGNALVQLVEDLLDFSTIEVNRFQLRPRAEMLRPLLEGVVEM
FT                   LAHRAHEKGIEIAATVAADVPETMEFDPARLRQVLFNVIGNAVKFTQTGGVLIRAGLDG
FT                   GNLLISVRDSGPGMTEEEQARIFGEFEQAGNVLDKSAGTGLGLAISARILREFGGALSV
FT                   ASERGNGSEFTIRFPVSLVAGEDAPGRRDDLLKGSRILLLAPEGAASTAIAETIRTLGG
FT                   RCRLIGPDDIENLSLCAPEGEGGPLTDLIVDHRMAPWYFREGNELAASGLRKIFLVNPE
FT                   ERNTHPLDLFDAWLIRPLREQSLIDVLSGRMRGMEKRDVLIDNPPGFGLMAPEATDIAF
FT                   NVLLGEDDPVNAMLVRAMLTKAGHKVRLVEDFTGLLARVEKGESRPDIIVTDLTMPGGD
FT                   GVTVLAQLRAQERKAGLSPLPVIVLTADSRDAIRRQVLLAGADAVIVKPVDPRCLITTV
FT                   QSLSKLAFERARNE"
FT   gene            522909..523787
FT                   /locus_tag="Arad_0636"
FT   CDS_pept        522909..523787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0636"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25281"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9J894"
FT                   /protein_id="ACM25281.1"
FT                   /translation="MSIEILNREAQGEMVQSSKATIAPVASDVFGRIGNLETRLARTAR
FT                   EIDAAQAVRYRVFVEEMNAQLPADAMRRQRDVDSYDSICDHLLVLDQSLEGDTEDQIVG
FT                   TYRLLRQEVAMANGGFYSSSEFDIGALMARHPDKQFMELGRSCVLPAYRNKRTVELLWQ
FT                   GNWAYAVKHGMGAMFGCASFPGVRPEQHALALSFLYHNVVAKDEWSVGALPSLARTMDL
FT                   MPVEAINSKKALMALPPLIKGYLRLGAMVGSDAVVDHAFNTTDVLIVLPIASISDRYVN
FT                   YYGAATGRFAS"
FT   gene            complement(523825..525234)
FT                   /gene="cyaH"
FT                   /locus_tag="Arad_0637"
FT   CDS_pept        complement(523825..525234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyaH"
FT                   /locus_tag="Arad_0637"
FT                   /product="adenylate/guanylate cyclase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25282"
FT                   /db_xref="GOA:B9J895"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B9J895"
FT                   /protein_id="ACM25282.1"
FT                   /translation="MSEARSLFGVLRHSARPDIVDAIERLVLEAPDRKLNRVNALAFAV
FT                   EHGFDEEQVINAFLHASRLGLFEISWNVLCPGCGGVLDANTSLKTVQSETYNCSLCAAG
FT                   YEPTLDEMVEVTFTVSPRVRHIEAHNPHELSPLEYFRQIYWGSGVDLPDEGYEAKVEQF
FT                   VLESLELPAGEKAVVSLQLPAEFVIIFEPVTHAAQFLDVKGEPSKERQTVSLVFDRLHR
FT                   HSDPITLRPGPLRILIENHTEVRALPSICVANDALHALLSRRRPFLTAKQLLSNQTFRD
FT                   IHRTDTIDVDQRLKITSLTFLFTDLRGSTELYERVGDLAAFDLVRTHFGILHEIVAAEA
FT                   GAVVKTIGDAVMATFPTPDRALIAAMRMREAMISLNSERGNDDLLLKIGIHEGPCIAVS
FT                   LNERQDYFGQTVNIASRVQHLATSREIFATGSVLDNPRAAAFLTMHDLKPESHHVSLRG
FT                   ITDEIDIFAIP"
FT   gene            complement(525314..527599)
FT                   /gene="pta"
FT                   /locus_tag="Arad_0638"
FT   CDS_pept        complement(525314..527599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pta"
FT                   /locus_tag="Arad_0638"
FT                   /product="phosphate acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25283"
FT                   /db_xref="GOA:B9J896"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:B9J896"
FT                   /protein_id="ACM25283.1"
FT                   /translation="MPDTSSTSRPGAGITDQEALDFHKQGRPGKLEINPTKPMATQRDL
FT                   SLAYSPGVAVPVKAIAADPATAYDYTARGNMVAVISNGTAILGLGNLGALASKPVMEGK
FT                   AVLFKRFADVDSIDLEIDTENVDEFINCVRYLGPSFGGINLEDIKAPDCFIIEQRLREL
FT                   MDIPVFHDDQHGTAIIAAAGLINALELTGRDLKTTKLVCNGAGAAAIACVELIKAMGFN
FT                   PENVVLCDTKGVIYQGRSEGMNQWKSAHAVKTDKRTLEEAMKGADVVFGLSQKGAFSAE
FT                   MIRSMADRPIIFAMANPDPEITPEEVARIRDDAIMATGRSDYPNQVNNVLGFPYIFRGA
FT                   LDVRASTINDEMKIAAVKALASLAREDVPDDVVAAYQGARPRFGAQYIIPVPFDPRLIS
FT                   AIPVAVAQAAIESGVARRAIPDMAAYARELSARRDPIASTLSQLYERVRQRPKRIVFAE
FT                   AEEEQVMRAALSYANQELGTAILLGREDLIHATAERAGIDLNRPGLEIVNARISKRVDA
FT                   YIDYLYARLQRKGYLHRDVTRLIHNDRNHFAACMVALGDADGMVTGVTRNYSTALEDVR
FT                   RCIDAKPGHRVVGVSLVLARGRTVFVADTAVHDMPTAQELADIAEEAAGFARRMGYEPR
FT                   VAMLAYSTFGHPSGERSERVREAVSILDKRYVHFEFDGEMAADVALNRKIMESQYPFSR
FT                   LSGPANVLVMPAFHSAAISTKMLQELGGSTVIGPLLVGLDKPVQITSMGAKDSDIVNMA
FT                   AIAAYGAG"
FT   gene            527796..530453
FT                   /gene="mutS"
FT                   /locus_tag="Arad_0639"
FT   CDS_pept        527796..530453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutS"
FT                   /locus_tag="Arad_0639"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25284"
FT                   /db_xref="GOA:B9J897"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:B9J897"
FT                   /protein_id="ACM25284.1"
FT                   /translation="MMEQYIEIKANNPGSLLFYRMGDFYELFFEDAVDASRALGITLTK
FT                   RGQHMGQDIPMCGVPVHAADDYLQKLISLGFRVAVCEQIEDPAEAKKRGGKSVVRRDVV
FT                   RLVTPGTITEEKLLSPSESNYLMALTRIRGGTEPQLALAWIDISTGVFRLAETEASRLL
FT                   ADILRIDPRELILPDTMFHDPDLKPVFDVLGRTAVPQPGVLFDSASAEGRITRYFGVST
FT                   LDGFGTFTRAELAAASAAVAYVEKTQIAERPPLGMPERESGASTLFIDPATRANLELVR
FT                   TLSGDRNGSLLKAIDRTVTGGGARLLAERLMSPLTDPIRVNERLDSIGFLTEEPSLCSD
FT                   LRTALKHVPDMPRALSRLALDRGGPRDLWAIRQGLGAAADIARMLGSALLPEELEAALA
FT                   GLRSLPADLEALLAEMLADELPLLKRDGGFLREGANAELDEVRALRDQSRRVIAGLQLQ
FT                   YAEETGIKSLKIKHNNVLGYFIEVTAGNAGPMTDSAEAKARFIHRQTMANAMRFTTTEL
FT                   ADLESRIANAADKALTIELAAFDRMVAAVVAEAEAIKAGARALSVIDVAAGLALLAEEQ
FT                   AYCRPVVDASRMFAIEGGRHPVVEQALRRQAGGPFVANNCDLSPTSDGKDGAIWLLTGP
FT                   NMGGKSTFLRQNALIAILAQMGSFVPATSAYIGIVDRLFSRVGASDDLARGRSTFMVEM
FT                   VETAAILNQATDRSLVILDEIGRGTATFDGLSIAWASVEHLHEANRCRGLFATHFHELT
FT                   VLSEKLERLSNATMRVKEWDGDVIFLHEVGPGAADRSYGIQVARLAGLPVSVVARARDV
FT                   LTRLEDADRKNPASQLIDDLPLFQVAVRREEAGGRRGPSKVEEALKALDLDDLTPRAAL
FT                   DALYELKKTLNKAG"
FT   gene            complement(530415..530798)
FT                   /locus_tag="Arad_0641"
FT   CDS_pept        complement(530415..530798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0641"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25285"
FT                   /db_xref="UniProtKB/TrEMBL:B9J898"
FT                   /protein_id="ACM25285.1"
FT                   /translation="MSTQKSAVLGLRHHKRPSQLVYAMQYVSRLGTDLRHHFPLAFPIA
FT                   GLGDCRGDIGNPAAGEGDVEKPTVGLAVGRFPLAADLAARRYRRKAVGENADLGKKIFD
FT                   MHPIILGNRLLSAGLVQGLFQFV"
FT   gene            530932..533847
FT                   /gene="glnD"
FT                   /locus_tag="Arad_0642"
FT   CDS_pept        530932..533847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnD"
FT                   /locus_tag="Arad_0642"
FT                   /product="protein-P-II uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25286"
FT                   /db_xref="GOA:B9J899"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:B9J899"
FT                   /protein_id="ACM25286.1"
FT                   /translation="MQTKRQARRQLAAVSEQDSGRPSMVKHDIDFSVILDVPALRAECE
FT                   TLAKRHEDKKDERSALLALLKKASQEGRENARRLLSQDGGGLDCAHRISWLQDQIITVL
FT                   YDFTVSHVYPKQKGSFTVTAVGGYGRDTLAPGSDIDLLFLFQPKPAEETHKAVEFILYM
FT                   LWDMGFKVGHATRTVEECMREAKSDMTVRTAILETRYICGNEPLAHELETRFDKEIVTN
FT                   TGPEFIAAKLAERDERHRKAGDTRYLVEPNVKEGKGGLRDLHTLFWISKYYYHVRDPVE
FT                   LVKLGVLSKQEYRLFEKAEDFLWAVRCHMHFLTGKAEERLSFDIQREIAEALGYHARPG
FT                   LSAVERFMKHYFLVAKDVGDLTRILCAALEDQQAKATPGLTGVISRFAHRSRKIPGTIE
FT                   FVEDRGRIALANPDVFKRDPVSLIRLFFVADINGLEFHPDALKRVTRSLGLIDNDLREN
FT                   EEANRLFLAILTSKRDPALILRRMNEAGVLGRFILEFGKIVSMMQFNMYHHYTVDEHLI
FT                   RAVEVLSEIDKGKAEDIHPLVNKLMPGIEDRDALYVAVLLHDIAKGREEDHSEAGAKVA
FT                   RKLCPRFGLSPKQTELVVWLIAEHLTMSMVAQTRDLTDRKTIIDFADRVQSLDRLKMLL
FT                   ILTVCDIRAVGPGVWNGWKGQLLRTLYYETELLLAGGFSEVSRKERAEAAAKALEAALD
FT                   DWGQKARKAYVKLHYQPYLLSVPLEDQIRHTRFIRQTDKSGQVLATMVRTDSFHAITEI
FT                   TVLSPDHPRLLTVIAGACAAAGANIVDAQIFTTADGRALDTIHVSREFTDDADELRRAG
FT                   TIGRMIEDVLAGRKRLPEVIATRTKNRRKNKAFVIPPSVTISNSLSNKFTVIEVECLDR
FT                   TGLLSEITSVLSDLSLDIHSARITTFGEKVIDSFYVTDLVGQKISNENKRANITARLKP
FT                   VMAGEEDEMRERMPSGMIAPASTRSLNSEKPNTEKKAGSAV"
FT   gene            533844..535445
FT                   /gene="mviN"
FT                   /locus_tag="Arad_0643"
FT   CDS_pept        533844..535445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mviN"
FT                   /locus_tag="Arad_0643"
FT                   /product="integral membrane protein MviN"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25287"
FT                   /db_xref="GOA:B9J8A0"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8A0"
FT                   /protein_id="ACM25287.1"
FT                   /translation="MSLVKKFITVGGATLGSRIFGFARETLMAAALGTGPMADVFYAAF
FT                   RFPNLFRRLFAEGAFNAAFVPLFAKEIEANGIEGAKRFSEEVFGVLFSVLFLITVVMEL
FT                   CMPLIVRWIIAPGFADDPEKFSITVRLAAVMFPYLMCMSLTAMMSGMLNSLHHFFAAAV
FT                   APIFLNVVMIGALFYSLYFGAVPLETAWYLSWGVLAAGILQLLVVYIGVRYAGINIGFR
FT                   WPHFTPNVKRLLILAIPAAVTGGITQINQMIGQAIASSREGAIAALQYADRIYQLPLGV
FT                   VGVAVGVVLLPELARSLKSGHLKEAGNLQNRSIEFVLFLTLPAAMALWVLSDDIIRVLY
FT                   ERRAFHQENTLIVGSILAIYGLGLPAFVLIKALQPGFYAREDTKTPMRFSGVAVATNCA
FT                   IALSLFPYMGAPGIAVAEATAGWISTVLLFTTLLRRGHLTWEWALARRAALLLVSAGVM
FT                   TAMVVYLQHRWEPYLATGASLLTKVGTLGLLIGISMLVYFAVAFLIGGADIGMIRRNVK
FT                   RKPRAPAPDAEVVNGE"
FT   gene            535582..536391
FT                   /locus_tag="Arad_0644"
FT   CDS_pept        535582..536391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0644"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25288"
FT                   /db_xref="InterPro:IPR015315"
FT                   /db_xref="InterPro:IPR035948"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8A1"
FT                   /protein_id="ACM25288.1"
FT                   /translation="MGVLGWLRSVVGIRGRRDETYVPSVEGSPTDLEMQSALHTLQQMV
FT                   RLAVFGEIGGEKPQKDNRAASWWGGNFLGKEGEVVPVCEKSGRLMHPLVQIRVDELPEI
FT                   PPALSKLALLTIWMDLEDIPLDDAENGKGFAVRTYPSTAGLVPIGPGYRESADLPTFPV
FT                   LWRATALEQPSWDDIAFKIPDGVARSNQSEWFFESQYATETNKYQRTCPVKLGGWPTWI
FT                   QGENWPEDAEFYLQIDSTDKGRFYVGDSGSIYLFQTPSGWVIRSDFY"
FT   gene            536544..536936
FT                   /locus_tag="Arad_0645"
FT   CDS_pept        536544..536936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0645"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25289"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8A2"
FT                   /protein_id="ACM25289.1"
FT                   /translation="MPQSLFLITLVVDDYDRAKTFYCDCLGFDCLQDEPQPEGKRWIVV
FT                   KPKGGEGAALLLAQAADDGQRAAIGNQAGGRVGFFLKTDDFARDHAAMVAKGVRFLEEP
FT                   RHEVYGTVAVFADPYGNTWDLIQHSS"
FT   gene            537049..538113
FT                   /gene="trpS"
FT                   /locus_tag="Arad_0647"
FT   CDS_pept        537049..538113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="Arad_0647"
FT                   /product="tryptophanyl-tRNA synthetase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25290"
FT                   /db_xref="GOA:B9J8A3"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8A3"
FT                   /protein_id="ACM25290.1"
FT                   /translation="MTEFKPLVFSGVQPTGNLHLGNYLGAIRKFVALQENNDCMYCVVD
FT                   MHALTAQLVHEDMRSQTRSITAAFLAAGIDPEKHIVFNQSTVPQHAELAWIFNCVARIG
FT                   WMNRMTQFKDKAGKDREQASLGLYAYPSLMAADILLYRATHVPVGDDQKQHLELTRDIA
FT                   MKFNLDFMEHIRRSGYGIDITVGDEPVHAYFPMVEPLIDGPAPRVMSLRDGTKKMSKSD
FT                   ASDLSRINLLDDEENISKKIRKAKTDPDGLPSEIAGLAGRPEADNLVGIYAALADTSKA
FT                   DVLSEFGGQQFSVFKPALVDLAVQVLSPITGEMRRLMADPGHIDAVLRDGGARARARAE
FT                   VTMNQVRDIVGFIY"
FT   gene            538187..538678
FT                   /locus_tag="Arad_0648"
FT   CDS_pept        538187..538678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0648"
FT                   /product="universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25291"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8A4"
FT                   /protein_id="ACM25291.1"
FT                   /translation="MVSKRLSRLEGHRRKFMAVIDGTPECQRAVHYAGRRAKNSNGGLV
FT                   LLYVIPEGDFQQWLGVEEIMRAEAREEAEATTAKAAQIVRENIGIDPEIVIREGSAAEQ
FT                   INAMIEEDRDIALLVLAAGSAKEGPGPLVSSIAGRAAAFPIPVTVLPDTLTNEEIDALS
FT                   "
FT   gene            538798..539364
FT                   /gene="nifUch1"
FT                   /locus_tag="Arad_0649"
FT   CDS_pept        538798..539364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifUch1"
FT                   /locus_tag="Arad_0649"
FT                   /product="nitrogen fixation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25292"
FT                   /db_xref="GOA:B9J8A5"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035433"
FT                   /db_xref="InterPro:IPR036498"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8A5"
FT                   /protein_id="ACM25292.1"
FT                   /translation="MFIQTEATPNPATLKFLPGKVVMESGTAEFRSADEAEVSPLAARL
FT                   FDIPGVSGVYFGYDFISVSKDDQEWQHLKPAILGSIMEHFMSGKPVMGAASVLSEAQDA
FT                   SGEFFDEGDATIVLTIKELLETRVRPAVAQDGGDITFRGFRDGKVYLNMKGSCAGCPSS
FT                   TATLKHGIQNLLRHFVPEVQEVEAV"
FT   gene            539513..540046
FT                   /locus_tag="Arad_0651"
FT   CDS_pept        539513..540046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0651"
FT                   /product="O-sialoglycoprotein endopeptidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25293"
FT                   /db_xref="GOA:B9J8A6"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8A6"
FT                   /protein_id="ACM25293.1"
FT                   /translation="MNVVDAALAKAEIALSGVERIVVTVGPGSFTGIRIGVAAARGFAL
FT                   SLNIPAIGITTLEVMAASAREQSPGQSVLAAIDAKREEIYLQSFGADGCPLDEARAVTI
FT                   DEARAIAGAFDGIVTGTAVARLSDAPPAERPDAFPIAVVARLGAAKLVSDKPKPLYLRG
FT                   PDARPQAGYAVARL"
FT   gene            540049..540543
FT                   /gene="rimI"
FT                   /locus_tag="Arad_0652"
FT   CDS_pept        540049..540543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimI"
FT                   /locus_tag="Arad_0652"
FT                   /product="ribosomal-protein-alanine N-acetyltransferase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25294"
FT                   /db_xref="GOA:B9J8A7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8A7"
FT                   /protein_id="ACM25294.1"
FT                   /translation="MLESYLTLKAEYEIVPMQLRDCIEVAALHGERFARVWGDTEFEDL
FT                   LSQDTTFGFVARQTNAILKKPLPGFVLARHVAGEAEILTIAVSAKLGRTGLGWRLMQAA
FT                   LREARNRGGETMFLEVDGVNQPAIGLYRKLGFETVGERKAYYVDENGAKSTALVMRRVL
FT                   R"
FT   gene            540582..541010
FT                   /gene="fur"
FT                   /locus_tag="Arad_0653"
FT   CDS_pept        540582..541010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fur"
FT                   /locus_tag="Arad_0653"
FT                   /product="ferric uptake regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25295"
FT                   /db_xref="GOA:B9J8A8"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8A8"
FT                   /protein_id="ACM25295.1"
FT                   /translation="MIDPVKSLEELCAERGMRMTEQRKVIARIIESSEDHPDVEELYRR
FT                   SVKVDAKISISTVYRTVKLFEDAGLLARHDFRDGRSRYETVPEEHHDHLIDLKSGEVIE
FT                   FHSPEIEALQERIAREHGFKLVDHRLELYGIPLKKDER"
FT   gene            541041..541838
FT                   /gene="olsA"
FT                   /locus_tag="Arad_0654"
FT   CDS_pept        541041..541838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="olsA"
FT                   /locus_tag="Arad_0654"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase
FT                   (phospholipid/glycerol acyltransferase) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25296"
FT                   /db_xref="GOA:B9J8A9"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8A9"
FT                   /protein_id="ACM25296.1"
FT                   /translation="MVTWLRVGCAVIVIFAVSLVMLPLQILCLRFDWKLRRYLPRYWHR
FT                   IVCYWLGVRIHVVGQPESRRPLMLAANHSSWLDILVLSSVADVAFIAKSEVRDWPIFGQ
FT                   FAQWQKSVFIEREQKRKTGDQVNEIAERMANGEIMVLFPEGTTSDGNRLLEVKSSLFGA
FT                   AAAALPKTPDAVVHVQPVAVAYTRIHGIAMGRYYRPIAAWPGDIELVPHLKDIVACGAI
FT                   DVDVCFGEAVEYRADTKRKDVSATVARRIRNMLASRLLGREIA"
FT   gene            541899..543311
FT                   /locus_tag="Arad_0656"
FT   CDS_pept        541899..543311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0656"
FT                   /product="2-methylthioadenine synthetase (miaB-like)
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25297"
FT                   /db_xref="GOA:B9J8B0"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8B0"
FT                   /protein_id="ACM25297.1"
FT                   /translation="MTKDSLTLDAPEPTALQLGIRDGSNSRKVFIKTYGCQMNVYDSTR
FT                   MSDALARDGYEPTEDMEEADLVLLNTCHIREKAAEKVYSALGRLRDMKKRKAADGREMM
FT                   IGVTGCVAQAEGEEILRRAPAVDVVIGPQTYHRLPDALRRAKEGQRVVDTEYALEDKFE
FT                   HLPTPERSKIRARGVTAFLTVQEGCDKFCTFCVVPYTRGSEVSRSVAQIVEEAEKLVDG
FT                   GVREITLLGQNVNAWHGAGPKGEAWSLGDLLYRLSEIPGLARLRYTTSHPRDMDDRLIS
FT                   AHRDLRTLMPYLHLPVQSGSNRILKAMNRRHTAAEYFALIEKIRAARPDIALSGDFIVG
FT                   FPGETEQDFADTLRLVEEVNYAQAFSFKYSTRPGTPGAELKDQVPEEIKAERLERLQAL
FT                   LLKQQHAFADACVGKVVDVLLEKPGRMPGQLIGRSPWLQSVNIDAKASQIGDIINVRIT
FT                   GTSTNSLFAELL"
FT   gene            543341..544405
FT                   /gene="phoH"
FT                   /locus_tag="Arad_0657"
FT   CDS_pept        543341..544405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoH"
FT                   /locus_tag="Arad_0657"
FT                   /product="phosphate starvation inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25298"
FT                   /db_xref="GOA:B9J8B1"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8B1"
FT                   /protein_id="ACM25298.1"
FT                   /translation="MNGQELVSSSSRQPRIASDANHFILTFENNRFASELFGQFDQNLK
FT                   LLEERLGIDARARGNSVVITGDVSATNQARRTLDYLYDKLQKGGNVERSDVEGAIRMAV
FT                   AADDQLTLPTMEKKAKLTMAQISTRKKTIIARTPTQDAYMRALERSEMVFGVGPAGTGK
FT                   TYLAVAHACQLLERGAVEKIILSRPAVEAGERLGFLPGDMKEKVDPYLRPLYDALYDMM
FT                   PADKVERAITAGVIEIAPLAFMRGRTLANAVVILDEAQNTTAMQMKMFLTRLGDNGRMI
FT                   ITGDPSQVDLPRGIKSGLVEALDLLTGVEGITIVRFKDVDVVRHPLVARIVRAYDATYA
FT                   VPAVGGGGEADPQI"
FT   gene            544402..544911
FT                   /locus_tag="Arad_0658"
FT   CDS_pept        544402..544911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0658"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25299"
FT                   /db_xref="GOA:B9J8B2"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8B2"
FT                   /protein_id="ACM25299.1"
FT                   /translation="MMAELDIQISVEEGDWPSEDVLQALAERVLGVAAAYLKKNEKQPF
FT                   PKTALEVSLVFTDDAAIREINAEWREQDKATNVLSFPAFPLVPGGKPGPMLGDIIIARE
FT                   TVEREAVELEKSFDDHLTHLMVHGFLHLFGYDHMNNSEAERMEGLETRILAGLGLSDPY
FT                   AGQDPI"
FT   gene            544937..546103
FT                   /locus_tag="Arad_0659"
FT   CDS_pept        544937..546103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0659"
FT                   /product="hemolysin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25300"
FT                   /db_xref="GOA:B9J8B3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8B3"
FT                   /protein_id="ACM25300.1"
FT                   /translation="MSDFTTRPASEAKDGADTASSDEAGSSSNGKRSQSSFWARAARIL
FT                   RPAQGSARLREDLADALIAGATDDDAFSPDERAMLHNILRFREVRVEDVMVPRADIEAV
FT                   DQNITIGELMILFEESGRSRMPVYAETLDDPRGMVHIRDLLSYVAKQARNKRRAGNGKA
FT                   AAASAATPAEKPARSAKPNFDLSRVDLQKTLAEAGIIRKILFVPPSMLASDLLRRMQVN
FT                   RTQMALVIDEYGGTDGLASHEDIVEMVVGDIDDEHDDDEVMFKRVSEDVFVADARVELE
FT                   EIAAAIGSDFDISEQVDEVDTLGGLIFSALGRIPVRGEVVQALPGFEFHILDADPRRIK
FT                   KVRITRKRHAARRRPTKADGEGGGLDRDLPSPDTISEGSSAERNAASQ"
FT   gene            546183..547784
FT                   /gene="lnt"
FT                   /locus_tag="Arad_0660"
FT   CDS_pept        546183..547784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lnt"
FT                   /locus_tag="Arad_0660"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25301"
FT                   /db_xref="GOA:B9J8B4"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J8B4"
FT                   /protein_id="ACM25301.1"
FT                   /translation="MERLSGKVILVWGFKRALLAILAGAIGVLALPPFGFFAAMFVSFT
FT                   LLVWLLDGAAAGPDSGFLGRLWPAFTTGWLFGFGYFVAGLWWLGHALLIDADQFAWALP
FT                   LAILGLPAFLAIFYGVAAVLARLLWSDGMGRIAALAFGFGLLEWLRSFLFTGFPWNAIG
FT                   YGAMPIPLMMQSAHVIGVLGVTVLAVFVFAAPALLGTRQGRVPGIGLAVLIAAAHFAYG
FT                   YYALNLPALPPAAGKAAPVVRIVQPAIDQEAKMDTAADRNAIFDKHLSLSVQPPVNGGK
FT                   RPDIIVWPETAIPFILTDNQDALTRIADQLDDDQILITGAVRVEDMGPGVEPRYYNSVY
FT                   VIDGRGQIIGASDKTHLVPFGEYVPFENILGYLGIENVVELPGGFSAAASRQLLTLPDG
FT                   IKLYPLICYEIIFPNEMTPEIRQADAILNVTNDAWFGDTPGPYQHFLQARVRAVEQGLP
FT                   LIRSANTGVSAYVDAHGRLISGIDFNEQGFVDSTLSGATVSRIDDSVRKTYFWLIIGIV
FT                   GMIAVISRMGFISRVN"
FT   gene            547938..548357
FT                   /locus_tag="Arad_0661"
FT   CDS_pept        547938..548357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0661"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25302"
FT                   /db_xref="GOA:B9J8B5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8B5"
FT                   /protein_id="ACM25302.1"
FT                   /translation="MIENKKKPNPIDIHVGSRIRLRRTMLGMSQEKLGESLGITFQQIQ
FT                   KYEKGTNRVGASRLQNISSILNVPVSFFFEDAPGDHTTTAGGLAEASSSNYVVDFLSSS
FT                   EGLQLNRAFVKISDGKVRRKVVELVKALAAEADAE"
FT   gene            548546..549799
FT                   /gene="metK"
FT                   /locus_tag="Arad_0663"
FT   CDS_pept        548546..549799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="Arad_0663"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25303"
FT                   /db_xref="GOA:B9J8B6"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8B6"
FT                   /protein_id="ACM25303.1"
FT                   /translation="MRANYLFTSESVAEGHPDKVCDRISDEIVDLVYREAAKTGINPWG
FT                   VRIACETLATTNRVVIAGEVRLPPSLMKKDKDGNDVINPSKFKAAARRAIKDIGYEQDG
FT                   FHWKKARIDVLLHSQSADIAQGVDSASDQQGDEGAGDQGIMFGYACRETPDLMPAPIYY
FT                   SHKILQLLATARKKGDGDVAKLGPDAKSQVTVRYVDGKPFEATSIVLSTQHLDESWDSK
FT                   KVRAVVEPYIREALGELKIAHDCKWYINPTGKFVIGGPDGDAGLTGRKIIVDTYGGAAP
FT                   HGGGAFSGKDTTKVDRSAAYAARYLAKNVVAASLADRCTIQLSYAIGVAQPLSIYVDLH
FT                   GTGNGVTEDQVEEAIRKNMDLSPTGIRRHLDLNKPIYAKTSAYGHFGRKAGRDGSFSWE
FT                   RTDLVKALKESVKIQEAA"
FT   gene            549796..550497
FT                   /gene="trmB"
FT                   /locus_tag="Arad_0665"
FT   CDS_pept        549796..550497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmB"
FT                   /locus_tag="Arad_0665"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25304"
FT                   /db_xref="GOA:B9J8B7"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8B7"
FT                   /protein_id="ACM25304.1"
FT                   /translation="MIDTERRSRATEAFFGRRKGKALRGQQAEKLETLLPRYLVDLSTP
FT                   APLPLNDLFPVPTERLRLEIGFGGGEHLIHRALEQSTTGFIGVEPFVNSMQKLLASIDE
FT                   TGARNIRVYNDDATQLLDWLPDACLDQIDLLYPDPWPKKKHWKRRFVSQVNLERFHRVL
FT                   KPGARFCFASDIDTYVNWTLQHCHAHGGFEWTAQNAADWLTPYEGWPSTRYEAKARREG
FT                   RSSAYLTFKKV"
FT   gene            complement(550667..550927)
FT                   /locus_tag="Arad_0666"
FT   CDS_pept        complement(550667..550927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0666"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25305"
FT                   /db_xref="InterPro:IPR009531"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8B8"
FT                   /protein_id="ACM25305.1"
FT                   /translation="MLMREATARLTQSELAHLGSGEVAYIRKIRSEEVSRCFPEAPSDI
FT                   DPDVDLWALFGADGTPILLTDNRSSTFYKAAEDELKTVSLH"
FT   gene            complement(550973..551404)
FT                   /gene="hsp"
FT                   /locus_tag="Arad_0667"
FT   CDS_pept        complement(550973..551404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsp"
FT                   /locus_tag="Arad_0667"
FT                   /product="molecular chaperone small heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25306"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8B9"
FT                   /protein_id="ACM25306.1"
FT                   /translation="MSRTTPFASPLLLGFDTMEKTLERISKASDGYPPYNIERMRPDRI
FT                   SGEPERLRITLAVAGFSEDELDITTEENQLLIRGRQVEQEERDYLYRGIAARQFQRVFV
FT                   LADGMQVLGAVLKNGLLSVDLIRPEPARMVKKINISVSQ"
FT   gene            551634..552578
FT                   /gene="iunH1"
FT                   /locus_tag="Arad_0668"
FT   CDS_pept        551634..552578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iunH1"
FT                   /locus_tag="Arad_0668"
FT                   /product="inosine-uridine preferring nucleoside hydrolase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25307"
FT                   /db_xref="GOA:B9J8C0"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8C0"
FT                   /protein_id="ACM25307.1"
FT                   /translation="MTEPRKIIIDTDPGQDDAAAILLAFGSREELEVLGITTVAGNVPL
FT                   ALTSRNARIVCELCNRRDVKVFAGADAPIKRKLVTAEHVHGKTGLDGPELPEPTMALQP
FT                   GHAVDFIIETLRSEPQGAVTLCTLGPLTNIALAFQKAPDIVGRVRELVMMGGGFFEGGN
FT                   ITPAAEFNIYVDPEAADVVFRSGVPIVMMPLDVTHQLLTRKDRVARIAAIGSAPAKAMV
FT                   EMLEFFERFDIEKYGSDGGPLHDPTVVAYLLKPELFKGRDCNVEIEITSELTVGMTVVD
FT                   WWHVTDRKHNAKVMRDVDADGFFALLTERFARI"
FT   gene            complement(552655..555000)
FT                   /gene="mcpX1"
FT                   /locus_tag="Arad_0669"
FT   CDS_pept        complement(552655..555000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcpX1"
FT                   /locus_tag="Arad_0669"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25308"
FT                   /db_xref="GOA:B9J8C1"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8C1"
FT                   /protein_id="ACM25308.1"
FT                   /translation="MMSIFRMKSLAAKLILVTGLAIALVLFVSNFLLISQTRDRVQTLT
FT                   MDQANSEAKSISNEIAANVGELASAARSMAAVIGRGHEGHTFDRKGIINILKANVEQNA
FT                   FAFGSWFCEQLGTFDGKTTELAGNKDQGVNDKGAFTPYWSKTKDGGIQYSTFDNDYTAA
FT                   WWKLAADSGKGAITPPYMAEGTEVPTTMSSIAYPVMSGGKMIGVSGVDISLASLSTKLQ
FT                   NLHPFGSGRVLLVSQDNKWLVAPSKELLMKDYKGDGADVIKAALTSSTAGLLKNLADGS
FT                   GEAFDRVVYPFAVPGLNATWVVLVDVPHSAIEAPVRDQTYMMIIGGILVLAAVMLALYA
FT                   AVRRFVQKPLSGLVASVNSLSAGNYGEPVTGQTGTDEIGSVAKALEGFRFGLADAKRLE
FT                   TEADDQRRAAEGERYRSETERGETVALQRRIVTILGQSLAELSKGNLGHRIAEEFPGEY
FT                   ASLKQDFNEALASLEETVHTMNLSVGNIGNGTGEISNSASDLARRTEQQAASLEQTAAA
FT                   LNQLTAQVNSSAENARTAASSVNAASEDAGRSGEIVQKAIASMQGIEQSSQEVSRIISV
FT                   IDEIAFQTNLLALNAGVEAARAGEAGRGFAVVAQEVRELAQRSANAAKEIKTLINTSAG
FT                   QVKEGVDLVGHTGNALHKIAEQVMEINSLIRQISASASEQAIGLKEINAAVNQMDQVTQ
FT                   QNAAMVEETTAASVALNDEAQTLRALVARFRTSHGGQDNASALRAAAQQMRTPAQAHRT
FT                   SPAAAPTRKARPQTQGANALARDDWEEF"
FT   gene            complement(555228..556127)
FT                   /gene="rbsK"
FT                   /locus_tag="Arad_0670"
FT   CDS_pept        complement(555228..556127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsK"
FT                   /locus_tag="Arad_0670"
FT                   /product="ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25309"
FT                   /db_xref="GOA:B9J8C2"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8C2"
FT                   /protein_id="ACM25309.1"
FT                   /translation="MITIFGSINMDLIATTDRLPKPGETVAGNGFSTAAGGKGANQALA
FT                   ARRAGSTVRLTGAVGNDGFAEPALALLDAAGTDLSTVAHVSEPTGTALILVGGDGENMI
FT                   AVVPGANGTKTAEDATAVVDALSASDTLMLQFEIPVAAVETALTAAKAKGVRTVLNLAP
FT                   LIPEAARLGRLADIVIANETEFELLAGQDNMSASDREAALIRLHAETGQTLIVTLGGDG
FT                   VIAIRNGELSRAKGLVIEPVDTVGAGDTFCGYFAASLDQGLDFHASLRRAAVAGSLACL
FT                   KPGAQPAIPVASDVVARL"
FT   gene            complement(556230..557426)
FT                   /locus_tag="Arad_0672"
FT   CDS_pept        complement(556230..557426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0672"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25310"
FT                   /db_xref="GOA:B9J8C3"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8C3"
FT                   /protein_id="ACM25310.1"
FT                   /translation="MSFTLFGQAIPAVPALTGLIILLLIIVIVLVINGRRRQSEEDMLR
FT                   AEDAEHNMAAILRAQTEMQGRLAAMTEVFGSRQAELNQAIGQRLDGMSQRVTATIGEQT
FT                   RSTHENLRRLQERLAVIDAAQTNIQSLAKDVVGLQAILSNKQTRGAFGQARMETIIADG
FT                   LPMGAYAFQPTLSNGSRPDCTIRMPNGSPPLVIDAKFPLEAWNAIRNATAAGPEHGKVA
FT                   AQQFRRDLEVHIRDIAEKYLIQGETQDTAFLFVPSESIFAEIHENFEAIVQKAQRSRIV
FT                   IVSPSLLMLSIQVIQAVLKDQRMREQAHVIQGEVAHLMDDLSRLDERVRKLQGHFAMAQ
FT                   KDVDMIVTSADKLARRGERIEALEFETVVEPAKPAAEDRPKPIDNRTGQLKLRVVDED"
FT   gene            557613..558128
FT                   /gene="def"
FT                   /locus_tag="Arad_0674"
FT   CDS_pept        557613..558128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="Arad_0674"
FT                   /product="peptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25311"
FT                   /db_xref="GOA:B9J8C4"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8C4"
FT                   /protein_id="ACM25311.1"
FT                   /translation="MTIKPLIILPDPLLRQASKPIERVDTEILRLADDMLETMYDAPGI
FT                   GLAAVQIGVARRMLVIDVAREGEDKQPLVFINPEVVASSDERSVYEEGCLSIPDYYAEV
FT                   ERPARVTVKHIDRDGKEQLIEADGLLATCLQHEIDHLNGVLFIDYISRLKREMVIKKFT
FT                   KAAKSKAL"
FT   gene            558524..558943
FT                   /gene="stdB"
FT                   /locus_tag="Arad_0677"
FT   CDS_pept        558524..558943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stdB"
FT                   /locus_tag="Arad_0677"
FT                   /product="plasmid stability protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25312"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8C5"
FT                   /protein_id="ACM25312.1"
FT                   /translation="MIVLDTNVISELQGRLYSDRILSWLDAQDAEAVFLTTITIGEVRF
FT                   GLELLVEGKRKAGLLSELEAIEAEFTGRILVFSPNAAHHYGVISAQRHKIGRRMETKDA
FT                   MIAAICLAHGATLATRNTKDFEGLDLRLVNPFEGG"
FT   gene            558966..559913
FT                   /gene="fmt"
FT                   /locus_tag="Arad_0679"
FT   CDS_pept        558966..559913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="Arad_0679"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25313"
FT                   /db_xref="GOA:B9J8C6"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J8C6"
FT                   /protein_id="ACM25313.1"
FT                   /translation="MSLSIIFMGTPEFSVPTLRSLIDAGHKIRAVYTQPPRPGGRRGLD
FT                   LQKSPVHQAAELLGLPVFTPVNFKDQEERQRFRELDADVAVVVAYGLLLPEAILTGTRL
FT                   GCYNGHASLLPRWRGAAPIQRAIMAGDKKTGMMVMKMDKGLDTGPVALTREVEIGGTMT
FT                   AGELHDKLMQAGAKAMAEAMNKLEYNELPLTEQPAEGVVYAAKIDKGETRIDFSKPAAD
FT                   VHNHIRGLSPFPGAWFEMEIAGKPERVKVLGSELAEGERAVGEVLSDDLAIACGSGAVR
FT                   LTKLQKAGGKPMAAADFLRGTPVAAGTILALGPV"
FT   gene            559910..560710
FT                   /gene="truA"
FT                   /locus_tag="Arad_0680"
FT   CDS_pept        559910..560710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="Arad_0680"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25314"
FT                   /db_xref="GOA:B9J8C7"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8C7"
FT                   /protein_id="ACM25314.1"
FT                   /translation="MMPRYRMTVEYDGIPYVGWQRQNNGPSVQGAIERAILSLTGETAS
FT                   VRGAGRTDSGVHAVGQVTHADLSKEWKPHTLRNALNAHLRLAGDRVAILNVMEVDASFD
FT                   ARFSAIRRHYLYRIIVRRAPLALEAGRAWWVAKDMDHEVMHTAAQTLVGRHDFTTFRSV
FT                   HCQANSPVRTLDRLDVTRSGELIEIRATAQSFLHNQIRSFAGTLKLAGEGKWTPDDVRT
FT                   ALEARDRKACGPVAPPDGLYFMQVDYRDDAGSAPPIPDDESDDS"
FT   gene            560836..562554
FT                   /locus_tag="Arad_0682"
FT   CDS_pept        560836..562554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0682"
FT                   /product="malate:quinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25315"
FT                   /db_xref="GOA:B9J8C8"
FT                   /db_xref="InterPro:IPR006231"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8C8"
FT                   /protein_id="ACM25315.1"
FT                   /translation="MPNNPKSIKTRAERSSTIEMSRRQLLGSAAASAAAFSLPALPSWA
FT                   APAERAVDVLLVGGGIMSATLGVLLTELEPSWTIEMLERLDDVALESSNGWNNAGTGHS
FT                   ALAELNYTPQDENGTVHISKAVEINESFQISRQFFAHQVDVGVLKNPRSFINSTPHMSF
FT                   VWGDKNTDFLEKRHQALKASPLFSGMKFSRDHDEIAKWVPLMMEGRDRSQNIAATWCPL
FT                   GTDVNFGEITRQYVAHLKSQSTFKLHTSSEVHAIERNEDGTWRVTYADTKDGSSKGTIN
FT                   AKFLFLGAGGAALPLLQMSGIPEGDDYAGFPVGGSFLVCDNPDVTSLHLAKAYGQASTG
FT                   APPMSVPHLDTRMLDGKRVVLFGPFATFSTKFLKEGSYLDLPASVTLDNIWPMIRVALD
FT                   EFSLVEYLAGQLMLSDENRLAALREYFPHAKAEDWRLWQAGQRVQIIKRDEEKGGVLKL
FT                   GTEIVASKDGSIAALLGASPGASTAPPIMLDLLKKVFAERLATAEWQEKIHNIVPSYGV
FT                   KLNETPEVLAKEWAATAGRLQLAIASPAIDASALAKPDGTSAPNGAVKHVPDMAL"
FT   gene            complement(562736..563335)
FT                   /locus_tag="Arad_0683"
FT   CDS_pept        complement(562736..563335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0683"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25316"
FT                   /db_xref="GOA:B9J8C9"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8C9"
FT                   /protein_id="ACM25316.1"
FT                   /translation="MPSFKEVQYYLAGLWLLLRMDARGFQYLDISDRGMLRSFWAILWS
FT                   LPSIGISWLWWQQAYLTAMPPETSTGMAFFLRLALVEAASWLTPLVLAGVLLMIFRFGD
FT                   KFAPVVVVVNWLGLPTSYLNALLIALLAFIPGASGLVAILWLGLMMAIVFSLARMLRMI
FT                   CGTHPLFIGTLTLVLLIPTMLLTDFLQRFLGIYPPG"
FT   gene            complement(563322..564515)
FT                   /gene="dapE2"
FT                   /locus_tag="Arad_0684"
FT   CDS_pept        complement(563322..564515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapE2"
FT                   /locus_tag="Arad_0684"
FT                   /product="succinyl-diaminopimelate desuccinylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25317"
FT                   /db_xref="GOA:B9J8D0"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR005941"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J8D0"
FT                   /protein_id="ACM25317.1"
FT                   /translation="MTATDPVANLQTLIRCASVTPAEGGALTALADMLLPLGFKVERMT
FT                   ASEAGTPDIENLYARLGTEGPHLMFAGHTDVVPVGDAASWSHPPFAADIAGGELFGRGA
FT                   VDMKGGIACFAAAVARHIEKHGPPAGSISFLITGDEEGPAINGTVKLLQWAAERGEQWD
FT                   ASLVGEPTNPDQLGDMIKIGRRGSISGFITVHGVQGHAAYPHLADNPVRSIVKLTEALL
FT                   DPPFDAGTDNFQPSNLEVTTIDVGNAATNVIPAKATAAFNIRFNDTWTVETLRAEILAR
FT                   LDAAAADQTLRPGREPTKYDITWSDRPSQVFLTRNNALIASLSSAVENVTGHTPKLSTT
FT                   GGTSDARFIKDYCPVVEFGLVGQTMHMVDERVAVADLETLTEIYETFIQRWFANAEL"
FT   gene            complement(564685..565542)
FT                   /gene="dapD"
FT                   /locus_tag="Arad_0685"
FT   CDS_pept        complement(564685..565542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapD"
FT                   /locus_tag="Arad_0685"
FT                   /product="2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25318"
FT                   /db_xref="GOA:B9J8D1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J8D1"
FT                   /protein_id="ACM25318.1"
FT                   /translation="MSATDLASLENAIEAAFENRDNVNVSTRGEVRDAVETALNLLDSG
FT                   KVRVAERGSDGNWTVNQWLKKAVLLSFRLNDMQIVDGGPGGSTWWDKVPSKFEGWGENR
FT                   FREAGFRAVPNAVVRRSAYIAPNAILMPSFVNLGAYVGEGTMVDTWATVGSCAQIGKHV
FT                   HLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIIREGSVLGMGVFIGKSTKIV
FT                   DRATGEITYGEVPPYSVVVAGALPNGNTMANGQPAPSLYCAVIVKRVDEKTRSKTGINE
FT                   LLRD"
FT   gene            565756..566628
FT                   /locus_tag="Arad_0687"
FT   CDS_pept        565756..566628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0687"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25319"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8D2"
FT                   /protein_id="ACM25319.1"
FT                   /translation="MSKAKNGRLRRKDGVWDPLKTSSADKQRAESVPKTPQSMSPSYRL
FT                   AYADEDFLCREELRPIRLQLELLKTEMYLTERGIKSTVVMFGGARIPAPGTSAWAARNE
FT                   VQRANLEAASVYYEEARKFARLCSRYSAGFDFHEYVVVTGGGPGVMEAGNRGASEEGAP
FT                   SIGLNIVLPHEQAPNVYVTPELSFNFHYFAIRKMHFMVRAKAIAVFPGGFGTLDELFEC
FT                   LTLIQTGRMERLPLILFGEKFWRDIINFDALAEFGTIAPDDVKLISFVDTAEDAWKIVS
FT                   DFYEHDNGH"
FT   gene            566740..567402
FT                   /locus_tag="Arad_0690"
FT   CDS_pept        566740..567402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25320"
FT                   /db_xref="GOA:B9J8D3"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8D3"
FT                   /protein_id="ACM25320.1"
FT                   /translation="MVTVHAVEELVGGVFGFLLADLAVFILVDAVEQHHATHQSGFVHE
FT                   AAAMSVMTRAVVTLVVVVLSLVALGLIVLGLVVGLIVIALGVCGLPFLDALLTIGAHFT
FT                   GGDLAIVVGVDLIEDLVDAGLDFILGDLRVARLAELLQHANIDDFRRKARTVSTIPAIS
FT                   AVVAALCGKAALRGSADQECCGKARQKKFFPVHRFSFRVEDWSNDTAGGQKRPIKHL"
FT   gene            complement(567441..568145)
FT                   /locus_tag="Arad_0691"
FT   CDS_pept        complement(567441..568145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0691"
FT                   /product="hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25321"
FT                   /db_xref="GOA:B9J8D4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010237"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8D4"
FT                   /protein_id="ACM25321.1"
FT                   /translation="MTQTKTQPSPADFSDIRDWVFDLDNTLYPHHVDLFAQIDKNMTAY
FT                   VSTLLQMERDEARKLQKQYYLEHGTTLQGLMIHHRIDPNDFLEKAHAIDYSALMPQPEL
FT                   AAAIKALPGRKFIFTNGSVSHAQATAGALGILDHFDDIFDIVAADYVPKPAGSTYDKFM
FT                   SLNRVDTKRAVMFEDLPRNLTVPKALGMKTVLLVPQNLEGTVVEWWEKTTGEDEHIDYV
FT                   TDDLTAFLKTLV"
FT   gene            568367..569137
FT                   /locus_tag="Arad_0692"
FT   CDS_pept        568367..569137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0692"
FT                   /product="carboxyphosphonoenolpyruvate phosphonomutase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25322"
FT                   /db_xref="GOA:B9J8D5"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8D5"
FT                   /protein_id="ACM25322.1"
FT                   /translation="MSQVEKAEGFARLHRKGDPLVLFNIWDAGSAKAVTEAGAKALATG
FT                   SWSVAAANGFGDGEAVPLSLLAVITRLISVTSPLPVSVDFEGGYALEPDAVATNVEKIM
FT                   DHGAIGINFEDQVIGGRGVHPIETQVPRIRAIREMATRREMPFFINARTDLFLQESDTA
FT                   HHQLLLDEAYRRADAFAEAGASGFFAPGLVDAELIEALCDRSPLPVNIMVRPATPDNIT
FT                   MAGLGVSRISYGPAPYRSVMGMLKSEAQALYQQD"
FT   gene            complement(569138..570034)
FT                   /locus_tag="Arad_0693"
FT   CDS_pept        complement(569138..570034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0693"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25323"
FT                   /db_xref="GOA:B9J8D6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037410"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8D6"
FT                   /protein_id="ACM25323.1"
FT                   /translation="MELRHIRYFLAVAEELNFTRAARRIGIGQPPLSNQIRDLEEEIGA
FT                   PLFRRLPHGAELTEAGQVFLREARAILTRAGQAKALALRAARGELGRLRVGFTGSAAFS
FT                   PIVPSSVRSFRRTYPEIDLTLEEAHTTRLLERLDAEELDAVFIRPGRTGPPGFRSHVLG
FT                   EESMVIALPSSHPLAEADTLPLSTLSDEPFVLFPRAAGPSLFDEIIAACRRAGFEPILG
FT                   QIAPQITSIANLIAVELGVSVVPLAVAEIQVPGVSYIPISGDGPVARLALATRRDECSA
FT                   VVRNFIARVLATKAELG"
FT   gene            570185..571027
FT                   /locus_tag="Arad_0694"
FT   CDS_pept        570185..571027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0694"
FT                   /product="short-chain dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25324"
FT                   /db_xref="GOA:B9J8D7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8D7"
FT                   /protein_id="ACM25324.1"
FT                   /translation="MNSIESKLFLITGVSSGFGRAFAEAALAAGHRVAGTVRNASGQEQ
FT                   FEALAPGRAKAILLNVTDFTAIEPAIARIEAELGPIDVLINNAGYGHEGTLEESPLDEM
FT                   RRQFDVNVFGAVAMIKAVLPFMRRRRAGHIINITSMGGFITMPGIAYYCGSKFALEGIS
FT                   EVLAKEVKDFGIKVTAVAPGSFRTDWAGRSMVRSGRSIADYDALFDPIRKAREEKNGNQ
FT                   AGDPQKAAAAILALVASDNPPVHLLLGTDALNLVRGKIAALSEEITAWENLTRSTDFG"
FT   gene            complement(571091..571978)
FT                   /gene="argB"
FT                   /locus_tag="Arad_0695"
FT   CDS_pept        complement(571091..571978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="Arad_0695"
FT                   /product="acetylglutamate kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25325"
FT                   /db_xref="GOA:B9J8D8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J8D8"
FT                   /protein_id="ACM25325.1"
FT                   /translation="MSEAQSELQASLLAKALPYMQRYENKTIVVKYGGHAMGNAELGKA
FT                   FAADIALLKQSGVNPIVVHGGGPQIGAMLTKMGIESKFEGGLRVTDQKTVEIVEMVLAG
FT                   SINKEIVALINQTGEWAIGLCGKDGNMVFAEKAHKTIKDPDSNIERVLDLGFVGEVVEV
FT                   DRTLLDLLAKSEMIPVIAPVAPGRDGATYNINADTFAGAIAGALSATRLLFLTDVPGVL
FT                   DKQGQLIKELSVAQAHALIADGTISGGMIPKVETCIDAIKAGVQGVVILNGKTAHSVLL
FT                   EIFTEHGAGTLIVP"
FT   gene            572160..572699
FT                   /gene="sigK"
FT                   /locus_tag="Arad_0696"
FT   CDS_pept        572160..572699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigK"
FT                   /locus_tag="Arad_0696"
FT                   /product="RNA polymerase sigma factor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25326"
FT                   /db_xref="GOA:B9J8D9"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8D9"
FT                   /protein_id="ACM25326.1"
FT                   /translation="MANEEIETLIGRVAMRDQKAFAALYRRTSPKLYAVCLRILRSKTD
FT                   AEEVLQEVYVKIWQRAERFRASEGPAMPWLTTIARNQSIDAIRARKPVADEIDSAYDLA
FT                   DTEPGPEEQAIVKGEGRRIDRCMEELEAGRAQAVRSAYVEGLSYQELAEQYSVPLNTMR
FT                   TWLRRSLIRLRECLDR"
FT   gene            572696..573406
FT                   /locus_tag="Arad_0697"
FT   CDS_pept        572696..573406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0697"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25327"
FT                   /db_xref="GOA:B9J8E0"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8E0"
FT                   /protein_id="ACM25327.1"
FT                   /translation="MSSSDQSKGGRSRDEVLAGEYVLGVLSLEDRQKVERRMRSDRQFA
FT                   AIVSRWEQNLSGFNDDYEMVAPPASVFPKVEKRVFGETAFGAHVWGSLLLWRSVAFGSL
FT                   FLAIGVLMFTVTNNTSQPSPGKQLSASLAGQNSPINLLANYDATNGLLRVTPVAAGQPQ
FT                   EKSLELWLIRGSDPAEALGILPQTGEGEIVLPSELHSKLTEGAIIAVSVEPFGGSPTGK
FT                   PTGNVIASGTIRLP"
FT   gene            573516..574073
FT                   /locus_tag="Arad_0698"
FT   CDS_pept        573516..574073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0698"
FT                   /product="transforming growth factor-induced protein (and
FT                   secreted protein MPB70)"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25328"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8E1"
FT                   /protein_id="ACM25328.1"
FT                   /translation="MIKTVIRIAAVAATLSAATGLAYAKDPMVGGAPMFASKNIIQNAV
FT                   NSKDHTTLVAAVKAAGLVDTLEGKGPFTVFAPTNAAFKKLPPGTVETLLRPENKATLTK
FT                   ILTCHVVAGDDMAATIAKMATGNGGEYDLKTVGGCVIKATEKGGKLTLVDEAGGTAHIT
FT                   IADVKQSNGVIHVVDKVLLPKM"
FT   gene            complement(574147..574806)
FT                   /gene="cgpA"
FT                   /locus_tag="Arad_0699"
FT   CDS_pept        complement(574147..574806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cgpA"
FT                   /locus_tag="Arad_0699"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25329"
FT                   /db_xref="GOA:B9J8E2"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J8E2"
FT                   /protein_id="ACM25329.1"
FT                   /translation="MAEQTTKDDKPLFGRPWIFIRGVPAMKFLPPEGPLEVAFAGRSNV
FT                   GKSSLINALVGHKGLARTSNTPGRTQELNYFVPDGFSGEGGDLPPMALVDMPGYGYAEA
FT                   PKEQVDAWTKLVFDYLRGRTTLKRVYVLIDSRHGIKKNDEEVLALLDKAAVSYQIVLTK
FT                   TDKIKEAGLPKLLADTAEKIRKRPAAYPGILSTSSEKGDGLEEVRQAIRLTVGIPF"
FT   gene            574964..575809
FT                   /locus_tag="Arad_0700"
FT   CDS_pept        574964..575809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0700"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25330"
FT                   /db_xref="GOA:B9J8E3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8E3"
FT                   /protein_id="ACM25330.1"
FT                   /translation="MLLFGLMKTSTEENYRRRIARVIEAIMVEPSAPHSIESLAAIAHF
FT                   SPFHFHRLYRALTGESIAATIRRVRLAQAAHRLAGRTVSVTETALDAGYDSSQSFARAF
FT                   RNLTGLSPTDFQMQQQSITTSLPPVTIADRQPVTVFGVRHDGPLTTIPHSYRRLRQWSS
FT                   ERGIAWNDVARIGVCYGDPDQGDGFRYFAGLILSNDAVAMDGLERCDVPGGRYARHRLI
FT                   GPYALISPTFQTLFGGWLPQSGLEPDDRPALEIYLNHPRHVADSELATDLLIPLRDAAE
FT                   "
FT   gene            575854..576828
FT                   /locus_tag="Arad_0701"
FT   CDS_pept        575854..576828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0701"
FT                   /product="dienelactone hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25331"
FT                   /db_xref="GOA:B9J8E4"
FT                   /db_xref="InterPro:IPR005065"
FT                   /db_xref="InterPro:IPR016986"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8E4"
FT                   /protein_id="ACM25331.1"
FT                   /translation="MHFTKFLCFIVVCLTATWAHAAGLKSFEVPADASGPALRVLIWSP
FT                   CAVAPADITLGPIVVSGVRNCPIVGDNLPLVVISHGHAGSSLGHHDTAETLADAGFVVV
FT                   ALNHPRDNFSDMSQSGDISVFVERPTDIKRLIDFMLNASPEAAKIDPSRIGFFGFSRGG
FT                   YTGLVLAGAIPDFHDPHVSCPEPAPICGQIRRNELPTQPLTQDARIKALVIADPFSFFS
FT                   TKDSLKNVKAPVQLWGSQYGGDGVLPENVIALTGDLPAKPEFHVVSNAAHFAFLAPCSP
FT                   ALTQSLPEICKDANGFDRVAFHKSFDADVLSFFRRHLIEAGKP"
FT   gene            complement(576937..578739)
FT                   /gene="yidC"
FT                   /locus_tag="Arad_0703"
FT   CDS_pept        complement(576937..578739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yidC"
FT                   /locus_tag="Arad_0703"
FT                   /product="preprotein translocase 60 kD membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25332"
FT                   /db_xref="GOA:B9J8E5"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8E5"
FT                   /protein_id="ACM25332.1"
FT                   /translation="MENKRNYFIAIALSVLIVLAWQFFYMNPRLEAQRKAEQAAKLQQQ
FT                   TQQAQTTQNPAAGATVDGAAPSSGQSAPTTLTHDQSVAKSAASRVAIDTPALSGSINLE
FT                   GARFDDLQLKAYHETVDKSSPIITLFSPADTKDGYFTELGYVGSDATGAVPGPSTVWTL
FT                   ASGSKLTDSTPVTLSYTNDKGITFTRTVSVDERYMFTITDKIANSGQAPVSLSSYGRVT
FT                   RYNKPTTPSAYVLHEGFIGVIGDDGLIETKYTAAEKEAVNPAKATGGWLGITDKYWAAT
FT                   IVPPQSGAYDAHFSHFADGQPRYQADYKQDAVTVAPGQSQELKSLVFAGAKEVPVIDRY
FT                   ETSYSIPKFDRLIDWGWFYFITKPMFKLMDFFFRYFGNFGVAILCTTIVVKGLFFPLAS
FT                   KQYASMANMKRMQPKMEELKAKFGDDRMGLQQATMQLYKEEKINPIAGCWPVLLQIPIF
FT                   FSLYKVIYITIEMRHAPFFGWIQDLSAPDPTSIVNLFGLLPFTAPTILHLGVWPLIMGI
FT                   TMFLQMRMNPTPPDPTQAMIFNWMPLVFMFMLASFPAGLVIYWAWNNTLSVIQQSIIMK
FT                   RHGVKVELFDNMKGLFKRKPAPSK"
FT   gene            complement(578739..579152)
FT                   /gene="rnpA"
FT                   /locus_tag="Arad_0704"
FT   CDS_pept        complement(578739..579152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnpA"
FT                   /locus_tag="Arad_0704"
FT                   /product="ribonuclease P protein component"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25333"
FT                   /db_xref="GOA:B9J8E6"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8E6"
FT                   /protein_id="ACM25333.1"
FT                   /translation="MPEKMAGELTNERSKKTVGRLKSRPQFLAVRQGEKRKGSLFLIEA
FT                   LDRKLTDAEPRVGFTVTKKHGNAVERNRMRRRLKEAVRLHAGFAMQPGHDYVVVARREV
FT                   LTASFEKLANELVQRIETRPKHRRPETDRSRKV"
FT   gene            579716..581713
FT                   /gene="mcpT"
FT                   /locus_tag="Arad_0705"
FT   CDS_pept        579716..581713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcpT"
FT                   /locus_tag="Arad_0705"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25334"
FT                   /db_xref="GOA:B9J8E7"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8E7"
FT                   /protein_id="ACM25334.1"
FT                   /translation="MSLKIRGKINLLVCVMAGAALLIGVTALYAVHRYERQMRAYEQAA
FT                   SRAYQGEHLNRVVTAVVMEARGIYASAAAKDAKGFADGLMKDLDEIDSTFAIWLPMVPE
FT                   AQKAEFAKLQDRAQEFRTFRSETVRLALSDGPDAASKQGNNDANRANRKAFQAEIDAVV
FT                   KADKAELATIGAEIDAFHQTVLWAVLGITVLGIAAGAGLGTYIGTVHLSRPIRKVTETI
FT                   KQVADGNFDVEVPFAGRADEIGEMAAAVDIFKQNGKTVQRMNAEETTMRARNDELQSDM
FT                   SIVVAAAAAGDFSRRIDKDYEDVNLNRFAGNINELLVSVDTGTSEVRRVIASLADGDLT
FT                   QTMQGEFQGAFAELQQNVNATLMTLKSTMREVRETTGSINANTSELGHASDDLSRRTEQ
FT                   QAAALEETSAALDEITAVVQSSTERAREASVMVTDAKEDAARSGTVVRNAVDAMGRIEQ
FT                   ASGEISQIIGVIDEIAFQTNLLALNAGVEAARAGDAGKGFAVVAQEVRELAQRSATAAK
FT                   DIKALISKSGSEVQVGVKLVQATGEALATIEARVLKINDHIHSIATAAREQATGLTEVN
FT                   KAVNQMDEVTQRNAAMVEETSAATHRLSEEADGLVRLVSRFKVDTDTVVASAPVSARAE
FT                   THRAVASPAHRMIGKIASAFGGGAAATQEF"
FT   gene            581738..581881
FT                   /locus_tag="Arad_0706"
FT   CDS_pept        581738..581881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0706"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25335"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8E8"
FT                   /protein_id="ACM25335.1"
FT                   /translation="MRECAFSAPVTANLAVCHGSDWKTRRNPLLSAFDMSSSDRFAAKR
FT                   DS"
FT   gene            581883..583403
FT                   /gene="regM"
FT                   /locus_tag="Arad_0708"
FT   CDS_pept        581883..583403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="regM"
FT                   /locus_tag="Arad_0708"
FT                   /product="two-component sensor histidine kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25336"
FT                   /db_xref="GOA:B9J8E9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8E9"
FT                   /protein_id="ACM25336.1"
FT                   /translation="MDSEQDRNLGTANKAEARGHARFCRPTGIFGGLSGKLLILTIFFI
FT                   LLAEVLIFVPSVANMRLRWLEDRLNTAAAAATVIDGLQPVELPRALQKETLMATGTRAI
FT                   VLRKDGTSRLLATAEMPASVDEQYDLSNVSLPTAMRDALDTLLFGGNRIIRVFGPVGGD
FT                   AGTGIEVVLKDTRLRNAMLAYSGSVFLMSILISLFTATLIFFAINRMMIGPIRRLTDSM
FT                   QAYSDDPEDPSRVLVPDEGRDELAVAGRHLASMQSQLQKTLKQQKNLAALGLAVSKINH
FT                   DMRNILSAAQLMSDRLVDVDDPMVKRFAPKLLRTIDRAVGYTTEVLSYGQTSESAPRRR
FT                   RVHLHELIDEVRDILAIDPDGGIEFVEQVSQDLVVDADSEQLFRVIHNLCRNAHQALVA
FT                   FGDAEPDSIRRITVSGHRIGSVVGITVDDTGPGMPQKARENLFTAFRGSARSGGTGLGL
FT                   AIARELVLAHGGTIALVEKPAAGTQFRIEIPDRPVSLDDYRSRSAHES"
FT   gene            583528..583601
FT                   /locus_tag="Arad_5007"
FT   tRNA            583528..583601
FT                   /locus_tag="Arad_5007"
FT                   /product="tRNA-Arg"
FT   gene            583966..584322
FT                   /locus_tag="Arad_0710"
FT   CDS_pept        583966..584322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25337"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8F0"
FT                   /protein_id="ACM25337.1"
FT                   /translation="MMTTHPAMAQSEDEMKACVDRSEGVTSEMLKCGQVEIDKFDARLN
FT                   AAYNILTDRKHGAERLRLQGEQRAWLKHHLQEAHRLAADPNDGSAALLVSQGFELDDLT
FT                   ARTLELEKRVGQNR"
FT   gene            complement(584375..585796)
FT                   /locus_tag="Arad_0712"
FT   CDS_pept        complement(584375..585796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0712"
FT                   /product="transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25338"
FT                   /db_xref="GOA:B9J8F1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8F1"
FT                   /protein_id="ACM25338.1"
FT                   /translation="MSTLSHTSTSQAPMSAGARGALLVLCGAIFLEGIDVAMLNVALPA
FT                   IRAELGLSTTMLSAVVSSYVLGYAGFMLLGGRAADIFGKRRVFLSALAVFIAFSGLGGF
FT                   ATEGWMLLTARFVTGIASAFMTPAGLALIMTNFPEGPQRNKAVLIYAGTAAGGFSLGLV
FT                   AGGLLSAIDWRWVFFAPVILASLIFILTPRLVADDHQRDHSQRFDMLGAVILAGAMLTA
FT                   AYGVTRLEDPKHGLEWTLAAFAASAILWIAFIAIQRKVAMPLVRLGILRSPSLVRANLS
FT                   ALFFAGSFFGFQFLVSLYLQELMGWTSLQTSLALLAIGADAILAPTVTPWLVNRFGNIK
FT                   VIFGGVLLAALSYAWFLQVSLDWTYGAMFPSMILLGLAFSLAYGPLTILATDGIDESEQ
FT                   GLASGLVNTAFQFGAALGLSAASAVGVLALGAETDADSRLEALRLALLVPVVATVIGLA
FT                   VTATGLGPWRKAAHG"
FT   gene            585909..586334
FT                   /locus_tag="Arad_0713"
FT   CDS_pept        585909..586334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0713"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25339"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8F2"
FT                   /protein_id="ACM25339.1"
FT                   /translation="MEEGTSNSPSDCSSTDEGYDILQWDQREGCEVRQILDRIADKWSL
FT                   LVIALLEKRTLRFTELKRSIDGVSQRMLTNTLRHLERDGIVERTVFPVVPPRVEYRLTS
FT                   LGCTLHETIQSLVNWTENNQREIIEARIRYDAWERDR"
FT   gene            586735..587610
FT                   /locus_tag="Arad_0714"
FT   CDS_pept        586735..587610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0714"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0714"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25340"
FT                   /db_xref="InterPro:IPR041307"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8F3"
FT                   /protein_id="ACM25340.1"
FT                   /translation="MLRGRAVERWLLISNCNTYALARSLQLLSDSFDLDCVDVWQFKRE
FT                   MADYAEKIPKYDRLIINPIAELMGYDFSSVENLYKIPNLEFDAYHPDFCFACARGERIY
FT                   KPLAANQSMIILAAFQAGLSVEKTRRLFRRDIYEQSGFFSRWEPARDRLISTFAVFGMD
FT                   MTNPFRRWTRGESFMHSLAHPKAHPILDVARTFLRNRGIETNKTDLVPFDTIVNGVCLP
FT                   VYPEIGELFGVRGSYMFKVFGEYKLISLEKLIELSFEAYSDYGADEITVEPGYLTRFNR
FT                   VKQAIAEADA"
FT   gene            587607..588665
FT                   /locus_tag="Arad_0715"
FT   CDS_pept        587607..588665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0715"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0715"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25341"
FT                   /db_xref="InterPro:IPR014982"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8F4"
FT                   /protein_id="ACM25341.1"
FT                   /translation="MSNPYSTINDYQLWRRSVARVETHMFDPIVNPRFKIDRQVKVATA
FT                   GSCFAQHISRQIQRIGFHYFIAEKGEHLSDAERSKRNFGVFSARYGNIYTARQLLQLFD
FT                   EVFEGREPAEKAWLRKDGRFVDPYRPQIEPDGYESPDAVVEARRSHLAAVRSVFLDSDV
FT                   LVFTLGLTESWRSKADGSVFPLAPGVTAGSFDPNRYEFVNFTVEEVDRHLSLFLKKLKE
FT                   VNPRVKVLLTVSPVPLVATYENRNVLVSTTYSKAVLRVVAEQMLSRFDWVDYFPSYEII
FT                   TGSYAGGLYYEDDYREVNHLGVAHVMRCFVRNYVSQPSKEAEPKAVMLPPPPETEYQTV
FT                   VCDEREIEMLRP"
FT   gene            588735..589595
FT                   /locus_tag="Arad_0716"
FT   CDS_pept        588735..589595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0716"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0716"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25342"
FT                   /db_xref="InterPro:IPR041307"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8F5"
FT                   /protein_id="ACM25342.1"
FT                   /translation="MEAWLIISNAQTFGLANSMRLLTNDVKIDHVDVWTLRASLDHFVQ
FT                   TIPTYDRIVIHPQIEHGYYDFSSVEKLSRIPSIQFDAYHPDICFVGARGQLINGPMGAY
FT                   HSMIALAAFRAGLSAERTRALFRRDIFERSGFFSRWESERKQLLESFAAHGLDISESFR
FT                   AWSRRESFMYGIDHSKARPIRDIARVFLRQCGIETNQTDIVPADVIMAGCCFPVYPEVA
FT                   EVLGVEGSYMFKPHQDYRLISLEKFIEHSFALYGKYSPEEILPGPLFTERYDRVRSIVA
FT                   EENLQ"
FT   gene            complement(589598..591154)
FT                   /locus_tag="Arad_0717"
FT   CDS_pept        complement(589598..591154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0717"
FT                   /product="multidrug transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25343"
FT                   /db_xref="GOA:B9J8F6"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8F6"
FT                   /protein_id="ACM25343.1"
FT                   /translation="MTARNQQAAPQPTLSESGPPDRREIRAVILGLMIVLGLAAIDQSI
FT                   VATALPRIVSDLGGVTHLSWVVSAYVLASTSTMPLYGKLSDQYGRKPMIYAAILIFLLG
FT                   SILSGMAQTLLQLIIFRAIQGIGAGGLMPLAQIIIGDLVPPARRGRSQGSIAAVFAVCS
FT                   VIGPVVGGVITDLLSWHWIFYVNLPIGAVALVMIGRAMKRPHQARSRRIDYLGAALLTA
FT                   CTTGLLLVLALGGNEWPWNSPEIIGLSAASLILTVLFVFHVRRESEPVLPPDLFRNRLF
FT                   VIACLVLALTFMGMLGASLFFPLFFQMVMGVSPSQSGLLTGPLMVGFVISSMFNGRVLL
FT                   QRSGRYKPAQLFGLGLATTAFAVLTWAAAESLGFAVIEPSIFALGLGLGLVMPTMTIAV
FT                   QNALPLAHRGVGTATLAFFRSLGGLIGVTGSGAILAYRVQQATGASGSLDMSSLTESGL
FT                   KQLATASPEAHAAAIALYRHAIAMTFATGTVIVALALIALLFLPELPLRADHGEGARPQ
FT                   R"
FT   gene            complement(591151..591600)
FT                   /locus_tag="Arad_0718"
FT   CDS_pept        complement(591151..591600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0718"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0718"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25344"
FT                   /db_xref="GOA:B9J8F7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8F7"
FT                   /protein_id="ACM25344.1"
FT                   /translation="MYETGHANDIEEAMALAEALRPALHRLHRQLKRETGDTGISPLQA
FT                   LLLVGIIRQPGIGVAELARQEKLRGPTISGHIKAMEREGLVARAAPDPQDRRRNGLIAT
FT                   DKGWTLIKSIKQRRTDWLASELAKLSPEARAAIRAAIGPLGAIGQ"
FT   gene            591739..592245
FT                   /locus_tag="Arad_0719"
FT   CDS_pept        591739..592245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0719"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0719"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25345"
FT                   /db_xref="GOA:B9J8F8"
FT                   /db_xref="InterPro:IPR012413"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8F8"
FT                   /protein_id="ACM25345.1"
FT                   /translation="MTVRRLLSAVSATALSVLLAVSSINPVAAGPIQPLPQPLALQTNG
FT                   ALQTTGQANGVTEVQYRHHRPHYRPHYRPHHRPYYRPGYHHRPGYWQGHRGYRYARPGY
FT                   RRYNDGWWYPMAAFTAGAIVGGAVARPSHGSAHVRWCANRYRSYRASDNTYQPTNGPRR
FT                   QCVVR"
FT   gene            complement(592293..593240)
FT                   /locus_tag="Arad_0720"
FT   CDS_pept        complement(592293..593240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0720"
FT                   /product="oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0720"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25346"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8F9"
FT                   /protein_id="ACM25346.1"
FT                   /translation="MPDWTVKDIPSQTGRTAVITGATSGIGYEAAKALAGAGARVIIAS
FT                   RNERKGAEVLAEIRAAAPGADIAFEPLDLASLVSVARAATRIAASAPRIDLLINNAGIM
FT                   AIPDRHETEDGFEMQMGANYIGHFALTMRLLPKLLAAKSPRVVTVSSLAHRSGKINFDD
FT                   LHWEESYSAWRAYCQSKLATLMFSLELDRIARAEGWNLTSTAAHPGYAITGLQSTGPRM
FT                   GRNRAGWLELVGKAIEPILSHSAAGGALPTLFAATSPIAEGGVMYGPDGFYELKGSPVR
FT                   AKIVPYAQNNAIWRRLWEVSEQLTGLKMPVPAIA"
FT   gene            593468..594166
FT                   /gene="pmtA"
FT                   /locus_tag="Arad_0721"
FT   CDS_pept        593468..594166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmtA"
FT                   /locus_tag="Arad_0721"
FT                   /product="phospholipid N-methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0721"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25347"
FT                   /db_xref="GOA:B9J8G0"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8G0"
FT                   /protein_id="ACM25347.1"
FT                   /translation="MTTKTTCSDFVQFFRSWVSDPMRVAAIAPSGERLARLMTQEIEPL
FT                   DGPVLELGPGTGVFTRALLARGVSECDLTLIEFGEEFVAPLRGRFPQARVVQMDAAQLG
FT                   QCGLFADTPFGAVVSGLPLLSMPPEKIAAIVGGAFATMKPGGSFYQFTYGPRCPVPRLI
FT                   LDRLGLKATRVGGTVRNIPPAGVYRISRGKPLELSIDGSEYRSTNENAGIAAYAAEAGA
FT                   ADMGRPEAGA"
FT   gene            594178..594831
FT                   /locus_tag="Arad_0722"
FT   CDS_pept        594178..594831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0722"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0722"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25348"
FT                   /db_xref="GOA:B9J8G1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8G1"
FT                   /protein_id="ACM25348.1"
FT                   /translation="MTDVQEIDGAVKEGRRERKRRQTRERIEAAALALFLERGFDGTTI
FT                   EDITEAADVSKRSFFDYFPSKEEVVFAWQDNFADELADAVAAQPKDASIVAVIEGALTS
FT                   ALLAAMADPQSLAIGALIHDTPVLSARHQLKYAKLETKLTDALYARSGGGEGELLHLRL
FT                   LSAIVVSAVRIGGERWNERPQDLPLQDFAQRLFGELWTTLADLGALVRQRSLDR"
FT   gene            complement(594834..595763)
FT                   /locus_tag="Arad_0723"
FT   CDS_pept        complement(594834..595763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0723"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0723"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25349"
FT                   /db_xref="GOA:B9J8G2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8G2"
FT                   /protein_id="ACM25349.1"
FT                   /translation="MRQDMLDGLVTFVTVAEEKSFSAAAVRLGVSPSAVSQSISKLEGR
FT                   MRLALFNRTTRSVSLTEAGLRYLERVVPAVHDLTAAAQELGEAVDKPAGLLRINVARSG
FT                   YMIALQPILRDFLDTYPDIELEVRIEGSLVDIVGQGFDAGVRFGDLVQRDMVTVKIGPA
FT                   ISAHIIAAPGYLGRYGIPRHPRDLLHHNCISFRHSSSGQIERWEFEKDGEKIELAVNGR
FT                   LILNDSAALTQAALDGIGIAYMINGYIDRFLDDGRLVRILSDWSPSLAGLALYYPDRRR
FT                   VPAKLRALIDFLRQRRQVEPPQTAGAFT"
FT   gene            595896..596744
FT                   /locus_tag="Arad_0724"
FT   CDS_pept        595896..596744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0724"
FT                   /product="short-chain dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0724"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25350"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8G3"
FT                   /protein_id="ACM25350.1"
FT                   /translation="MSDTKSDAKTLFITGVSTGFGRALAEAALAGGHKVVGTLRRQVDR
FT                   VEFEALKPGSAFGKLLDVTDTAAIAPVVAEVEKEIGAIDVLVNNAGYGHEGLLEESTID
FT                   DLRRQFEVNVFGPVALIQAVLPYMRKRRAGHILNITSMGGIVTFPGLSVYHGSKFALEG
FT                   ISESLGKEVKSLGIHVTAVEPGGFRTDWAGRSMVRAERSISDYDEIFEPWRQRRLERSG
FT                   KQPGDPKKAAQVMLQLIASENPPTHLLLGRDAISLVREKLGLLKTEFDAWEQVSASTDF
FT                   E"
FT   gene            596785..597666
FT                   /locus_tag="Arad_0725"
FT   CDS_pept        596785..597666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0725"
FT                   /product="oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0725"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25351"
FT                   /db_xref="GOA:B9J8G4"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8G4"
FT                   /protein_id="ACM25351.1"
FT                   /translation="MSDLNAAKSGQFKIGGDLTVNRLGFGAMRVTGYGIWGEPDDHDES
FT                   IRTLKRLPELGIDFIDTADSYGPDVSERLIKEALYPYDKKVVVATKGGLTRTGPGEWIP
FT                   VGRPEYLIQQAHKSLRNLGLEQIDLWQLHRIDPKVPAAEQFDAIKSLLDAKIIRHAGLS
FT                   EVSVADIDAASKYFKVATVQNRYNLIDRTSEDVLDYCEKHTIGFIPWFPLASGELAKEG
FT                   SLLDTIAKNHGAAPSQIALAWVLKRSPVMLPIPGTSKVKHLEENTAAVNITLSDEEFAA
FT                   LDAEGKKAFAAA"
FT   gene            598187..599503
FT                   /locus_tag="Arad_0727"
FT   CDS_pept        598187..599503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0727"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0727"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25352"
FT                   /db_xref="InterPro:IPR010297"
FT                   /db_xref="InterPro:IPR014586"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8G5"
FT                   /protein_id="ACM25352.1"
FT                   /translation="MRLGVMQRMEDAGQWGRTIFRAIAVVAALSLTACGRPVGVMQPIA
FT                   ENVPGTTKVELMVATTRLPDKDPAILFSGERGTGLKVDAVSISIPPEANRKVGQVQWPS
FT                   KLPGDPLKNFVTTAVRPLPTEADVHSWLRPHLPKNKRVLIFVHGFNNTYEDAVYRFAQI
FT                   VHDSHADVAPVVFTWPSRASIFDYAYDKESTNYSRDALEEMLHRAASDPAVGDITVMAH
FT                   SMGTWLAVEALRQMAIRDGRVAPKITNVILASPDLDVDVFGQQFAALGKDKPHFTLFVS
FT                   RDDRALSLSRRISGNVDRLGQIDPTAEPYRSELEKQGITVLDLTKLKTGDGLNHGKFAE
FT                   SPEVVRLIGDRLIAGQTITDSDVGIGDAVGAVALGAAQTVGSAASAAVSAPIAIFDPRT
FT                   RRNYGEQLRRVGASAGNTVGSVGDSVTTTSSNVGAALNQ"
FT   gene            599755..600861
FT                   /locus_tag="Arad_0729"
FT   CDS_pept        599755..600861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0729"
FT                   /product="D-amino acid dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0729"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25353"
FT                   /db_xref="GOA:B9J8G6"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8G6"
FT                   /protein_id="ACM25353.1"
FT                   /translation="MASIALDFAAGSGPSTWAKIPRWLLDPEGPVWLRPSYAPKMLPWF
FT                   LRFIAAGRPSRLREIEDAGMSLSRHALGDFRAMLDTLGAPDLMTEEGCLAIYETESEFA
FT                   GDRAHIELLRRYGLEHKILSGAEIRDYEPALSPDIAKAVLLPDNKSIRDPYQLVLKLVE
FT                   AARALGTTFVSGTVRTVERQAKGVVAVLFEDGRRLEANDVVLAAGVRTRFIASALGEPI
FT                   PLETERGYHTQIMKPGIAMRYSIIWPHRAFMVTPTAGGIRVGGNVELAGLDAPPDFRRP
FT                   RVLVRHAQRALPGLQVEDAKDWMGHRPALPDTIPIISPSSRVSGVWYATGHGHLGLTFS
FT                   ATTARLMADMMTGMTPEVDMTPFRINRY"
FT   gene            600872..601582
FT                   /locus_tag="Arad_0730"
FT   CDS_pept        600872..601582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0730"
FT                   /product="oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0730"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25354"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8G7"
FT                   /protein_id="ACM25354.1"
FT                   /translation="MSETEKPVALITGGGRGMGEAIARELAAGGYRLALMSPSESCEKL
FT                   AAELGGVASRGVAEKAEDIQAIFDLTMKSYGRIDAVVNHTGHPPKGDLLDITDENWTLG
FT                   SDMMILSLVRMARLVTPVMQKQGKGAFVNITTFAAYEPTLVFPVSCTYRAAAGAFTKLY
FT                   SDRYAADNIRMNCILPGYIDSLNHKPETADKVPMKRIGLMSEIAKTAAFLLSDGAGYIT
FT                   GQNIRVDGGVTRHV"
FT   gene            601597..602634
FT                   /locus_tag="Arad_0731"
FT   CDS_pept        601597..602634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0731"
FT                   /product="proline racemase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0731"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25355"
FT                   /db_xref="GOA:B9J8G8"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="PDB:4Q2H"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J8G8"
FT                   /protein_id="ACM25355.1"
FT                   /translation="MRWKRTIQLLDVHCEGEIGRVAIGGVPKIPGNTVAEQLHWLNTDP
FT                   KGEELRRFLVLEPRGAPIGSVNLLLPARHPDADAAFIILQPDQAHASSGSNSICVTTAL
FT                   LESGIVEMKEPETVVTLETAAGLVRATATCRDGRCEKVRLTMVPSFVHELDVGIDTPQW
FT                   GRIKLDLCYGGIFYALVDVGQIGLTIGKANAASLVQAGMVLKELINRTVPVVHPEIPAI
FT                   SGVAYVMFRDIDADGAIRTCTTMWPGRADRSPCGTGNSANLATLHARGKARVGDVFKSR
FT                   SIIGSEFEVGLQAETEVAGKPAIIPTITGRGFTFGLSQVALDPFDPMANGFALTDVWGP
FT                   LAGDI"
FT   gene            complement(602638..603066)
FT                   /gene="fucUch1"
FT                   /locus_tag="Arad_0732"
FT   CDS_pept        complement(602638..603066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fucUch1"
FT                   /locus_tag="Arad_0732"
FT                   /product="fucose dissimilation pathway protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0732"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25356"
FT                   /db_xref="GOA:B9J8G9"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8G9"
FT                   /protein_id="ACM25356.1"
FT                   /translation="MKGIDPLLSPELLATLRAMGHGDEIALVDGNYPGLEHARRLIRLD
FT                   GHGVVRVLDAILSVLPIDDFVPQAIFRATVRQDRDAIDPVHAEMIEVCARHVPDIKVVP
FT                   LLPADFYERVKQTHALVQTSEPRLYGNIILRKGVIYPG"
FT   gene            complement(603053..604300)
FT                   /gene="frcR"
FT                   /locus_tag="Arad_0734"
FT   CDS_pept        complement(603053..604300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frcR"
FT                   /locus_tag="Arad_0734"
FT                   /product="sugar transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0734"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25357"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8H0"
FT                   /protein_id="ACM25357.1"
FT                   /translation="MSPPQDPEETPTSPLILDPSGGANQVRVRAHNERLVLSLVRRHGA
FT                   LSKADIARRSGLSAQTVSVIMRALEKDGLLSRGEPVRGRVGQPSIPMRLNPDAVLSFGV
FT                   KIGRRSADLVLMDFVGQIRMQLHQIYPYPLPQDILSFVTSGIQELESRLNTEERGRLAG
FT                   LGIAAPFELWNWAEEVGAPDGAMEVWRGVDLQAEIAARVPYPVYLQNDATSACGAELVF
FT                   GVGPHYPDFVYFFIGSFLGGGIVLNSSIFVGRTGTAGALGPLPVRGRNGETLQLLEIAS
FT                   IFVLENLLRDHGFDPQPLWYSADNWIDFGEPLEIWIQETAKALAQAIVAAASVIDFSAA
FT                   VIDGGFPNWVRERVVRATIKEAAELDLQGVVMPEIIEGMVGPQARAIGGASLPIFARYL
FT                   IDQNILFKEIEHAEGH"
FT   gene            604553..605578
FT                   /gene="frcB"
FT                   /locus_tag="Arad_0735"
FT   CDS_pept        604553..605578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frcB"
FT                   /locus_tag="Arad_0735"
FT                   /product="fructose ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0735"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25358"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8H1"
FT                   /protein_id="ACM25358.1"
FT                   /translation="MKKSVISAALAALAIGVAFAAPAKAADVSACLITKTDTNPFFVKM
FT                   KEGATAKAKELGVTLKSYAGKIDGDSESQVAAIESCIASGAKGILITASDTKGIVSSVK
FT                   KARDAGLLVIALDTPLEPADAADATFATDNLLAGKLIGEWANKTLGDKAKDAKIGFLDL
FT                   TPSQPSVDVLRDQGFMIGFGIDPKDPNKIGDETDPRIVGHDVTNGNEEGGRKAMENLLQ
FT                   KDSSINVIHTINEPAAVGAYQALKAVGLEKQVLIVSVDGGCPGVKSVKEGVIGATSQQY
FT                   PLMMAALGVEAIKKFADTGEKPKPTEGKSFFDTGVSLVTDKPVSGLKSIDTKEGTAKCW
FT                   G"
FT   gene            605757..606821
FT                   /gene="frcC"
FT                   /locus_tag="Arad_0736"
FT   CDS_pept        605757..606821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frcC"
FT                   /locus_tag="Arad_0736"
FT                   /product="fructose ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0736"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25359"
FT                   /db_xref="GOA:B9J8H2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8H2"
FT                   /protein_id="ACM25359.1"
FT                   /translation="MTGAQEFERVLDGSDKNVASFEHQDVSLLKRMQHFLHSTPAAVPL
FT                   IVLVMAIIIFGFAIGGRFFSAYTLTLILQQIAIVGILAAAQTLVILTAGIDLSIGVIMV
FT                   ISSVVMGNVAVTYGLPTPVAIIAGMAAGGLCGLLNGFLVANMKLPPFIVTLGTWNIVMA
FT                   TNFIYSANETIRDTDVDEKAPLLHLFAVSFRLGGAVLTLGVIAMVLLVVGLWYILNHTA
FT                   WGRHVYAVGDDPEAAKLSGIQTKKVLLAVYGVSGLIAAFAAWVSIGRNGSVSPSSAVTD
FT                   FNLQAITATVIGGISLFGGRGSILGTLFGAMIVGVVSMGLNMLGADPQWKVLLTGVLII
FT                   GAVAIDQWIRKVSA"
FT   gene            606797..607603
FT                   /gene="frcA"
FT                   /locus_tag="Arad_0738"
FT   CDS_pept        606797..607603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frcA"
FT                   /locus_tag="Arad_0738"
FT                   /product="fructose ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0738"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25360"
FT                   /db_xref="GOA:B9J8H3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8H3"
FT                   /protein_id="ACM25360.1"
FT                   /translation="MDQKGIGMTTTGEPLLTARGLVKRYGRVTALDNADFDLYPGEILA
FT                   VIGDNGAGKSSLIKAISGAVTPDEGEIKLEGKAVHFRSPMEAREAGIETVYQNLALSPA
FT                   LSIADNMFLGREIRKPGVLGSVFRMLDRPAMEKRARDKLTELGLMTIQNINQAVETLSG
FT                   GQRQGVAVARAAAFGSKVVIMDEPTAALGVKESRKVLELILDVRSRGLPIVLISHNMPH
FT                   VFEVADRIHIHRLGRRLTVINPKEYTMSDAVAFMTGAKAPPETVAA"
FT   gene            607600..608232
FT                   /gene="frcK"
FT                   /locus_tag="Arad_0739"
FT   CDS_pept        607600..608232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frcK"
FT                   /locus_tag="Arad_0739"
FT                   /product="pantothenate kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0739"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25361"
FT                   /db_xref="GOA:B9J8H4"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8H4"
FT                   /protein_id="ACM25361.1"
FT                   /translation="MSSTLEDIAGEIIARAGDTRRFLVAIAGPPGAGKSTLADKVAEAL
FT                   RAKGESAEVLPMDGFHMDNAVLIEKGLLKRKGVPESFDVRAFLDIVKAVRAADQEVLVP
FT                   VFDRSRELAIASARIVSPDHRFIVIEGNYLLLSQGKWAELEGMFDYSIMLAPPMEVLEQ
FT                   RLWDRWKGYELDDEAAREKVYGNDLPNGRLILENRRPADATVDIVQD"
FT   gene            608329..609369
FT                   /gene="pyrC"
FT                   /locus_tag="Arad_0740"
FT   CDS_pept        608329..609369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrC"
FT                   /locus_tag="Arad_0740"
FT                   /product="dihydroorotase, homodimeric type"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0740"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25362"
FT                   /db_xref="GOA:B9J8H5"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J8H5"
FT                   /protein_id="ACM25362.1"
FT                   /translation="MQKLTIRRPDDWHLHLRDGAMLEGVIGDTSRHFARAIIMPNLVPP
FT                   VVTTADATAYRERILKALPAGDRFQPLMTLYLTEHTNPDDVEEGKKSGLITAVKLYPAG
FT                   ATTNSHGGVRNLDKAMPTLERMAKIGLPLCVHGEVTTPEVDIFDREAVFIETVLDPLRQ
FT                   RLPELKVTMEHVTTSDGIDYIKSAKANLAGSITTHHLIINRNAILVGGIRPHYYCLPVA
FT                   KRESHRLALRAAATSGDSRFFLGTDSAPHVDPLKECACGCAGIYTSINTMSCLAHVFEQ
FT                   DGALDKLEAFASLNGPAWYGLAPNEERITLIRRVESVTFPEKIETGAGTVTVFDPMFPL
FT                   HWDVEG"
FT   gene            complement(609382..609858)
FT                   /locus_tag="Arad_0741"
FT   CDS_pept        complement(609382..609858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0741"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0741"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25363"
FT                   /db_xref="GOA:B9J8H6"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8H6"
FT                   /protein_id="ACM25363.1"
FT                   /translation="MVPITNIALIAAALGSGLIAGIFFAFSTFIMQAFARLPAEQGIAA
FT                   MQSINTTILRSPFMVVFLLTLALSVFIAVMAIVHWRGGVSILMLAGAALYIVTTFVSTI
FT                   VFNVPLNDALDKVDGRTAEAAELWATYLSDWTRWNHLRTAASLLASCAFVRALF"
FT   gene            610051..610749
FT                   /gene="pyrE"
FT                   /locus_tag="Arad_0742"
FT   CDS_pept        610051..610749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="Arad_0742"
FT                   /product="orotate phosphoribosyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0742"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25364"
FT                   /db_xref="GOA:B9J8H7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J8H7"
FT                   /protein_id="ACM25364.1"
FT                   /translation="MTQMTFSDRAVMAELVAKMLWEIKAVHFSADKPYKLASGMASPVY
FT                   IDCRKLISYPRVRSTVMDFAASLIMRDAGFEQFDCVAGGETAGIPFAAFLAERLNLPMI
FT                   YVRKQPKGHGRNSQIEGHMPDGARVLVIEDLTTAGGSMFTFIDAIRAAGGIVDHGMALF
FT                   YYGIFPEAEARFANGKVRLHHIATWRNVLAVAKEQKLFDDKTLEEVEAFLNAPLAWSGR
FT                   NGGVAELATK"
FT   gene            610826..611752
FT                   /gene="frk"
FT                   /locus_tag="Arad_0743"
FT   CDS_pept        610826..611752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frk"
FT                   /locus_tag="Arad_0743"
FT                   /product="fructokinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0743"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25365"
FT                   /db_xref="GOA:B9J8H8"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8H8"
FT                   /protein_id="ACM25365.1"
FT                   /translation="MILCCGEALIDMLPRETTLGEKAFAPYAGGAIFNTAIALGRLGVP
FT                   TGFFTGIADDMMGEILRETLGAAKVDYSYCAIAPRPSTIAFVKLVNGQATYAFYDEGSA
FT                   GRMITEADLPTLGDDCEALHFGAISLIPDPCGATYEALMKREYQSRVISLDPNIRPGFI
FT                   KDKQAHMGRISRMAAMSDILKFSDEDLEWFGIAGNHDELAAHWLNQGAKLVVVTKGAEG
FT                   ATGYTKSLKVSVPSERVTVVDTVGAGDTFDAGILASLKMNNLLTKAQVATLDEKALRDA
FT                   LALGAKAAAVTVSRAGANPPWASEIGL"
FT   gene            complement(612040..613665)
FT                   /gene="pgi"
FT                   /locus_tag="Arad_0744"
FT   CDS_pept        complement(612040..613665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgi"
FT                   /locus_tag="Arad_0744"
FT                   /product="glucose-6-phosphate isomerase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0744"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25366"
FT                   /db_xref="GOA:B9J8H9"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J8H9"
FT                   /protein_id="ACM25366.1"
FT                   /translation="MNALVDQLKSTAAASKATDIRAAFAADPKRFSRFSASFDDLLMDY
FT                   SKTAVNDEILTLLEKLATEGGVAAKREEMFSGVAINFTEDRAVLHTALRNRSNTPVLVD
FT                   GKDVMPDVNGVLAAMGKFADGIRSGTLKGATGKAITDVINIGIGGSDLGPVMATLALAP
FT                   FHDGPRSYFVSNIDGAHIADILKLVSPETTLFIIASKTFTTIETMTNAQTARNFIAKAL
FT                   GEAAVQHHFAAVSTALDKVAAFGIDSARVFGFWDWVGGRYSIWSAIGLPLMIAVGPENF
FT                   GKFLDGAHAMDNHFRKAPFKENLPMLLGLIGFYHRNVLGYTTRAILPYDQRLSRFPAYL
FT                   QQLDMESNGKGVTIDGTPVEGNSGPVVWGEPGTNGQHAFYQLIHQGTSIIPAEFMIAAN
FT                   GFEPDLRHQHELLIANCLAQSEALMKGRTFEEAKAQLTSKGMDDKKADFIAPHRVFTGN
FT                   RPSITFVYDKLTPFALGRLIALYEHRVFVEGVLFRINSFDQWGVELGKELATGLLPVVE
FT                   GKESAAGHDSSTQGLVAALSKLEK"
FT   gene            complement(613840..615537)
FT                   /gene="fadD"
FT                   /locus_tag="Arad_0745"
FT   CDS_pept        complement(613840..615537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD"
FT                   /locus_tag="Arad_0745"
FT                   /product="long-chain acyl-CoA synthetase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0745"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25367"
FT                   /db_xref="GOA:B9J8I0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8I0"
FT                   /protein_id="ACM25367.1"
FT                   /translation="MNSVSAPSDGPVVNKIWLTSYPDMVPADLPPLEHASLAELLEESC
FT                   ARYADRPAFTSMGKSITYRDLDIQTRKIGAWLQSLGLQKGDRVAVMMPNVLQNPIAVYG
FT                   ILRAGFVVVNVNPLYTPRELEHQLRDCGAKAIFVLENFAHTVEQVLTHTDVRHVVVTAL
FT                   GDMLGLKGHIVNFIVRKVKKLVPAWSIPGHHSFAAVLAAGARLSLKPAELTHSDIAFLQ
FT                   YTGGTTGVAKGAILTHANLLANQLQLQLWLATAYIAKKRPEQLNFVCALPLYHIFALTV
FT                   NSLMGVSIGAHNVLIANPRDIPAFIKELGKYKFDMFPGLNTLFNALMNNPEFPKLDLSQ
FT                   TGTLAGGMAVQRPVAERWQKMTGAWITEGYGLSETSPVASANRFDSSDFTGTIGLPLSG
FT                   TDFDIRDENGNSLPPGEVGEICIRGPQVMAGYWKQPAETARVMTPDGFFRSGDMGFMNE
FT                   RGYTKIVDRKKDMILVSGFNVYPNEIEEVAAMHPGILEAAAVGVPDEHSGEAVKLFVVK
FT                   KDPALTEADVKAHCAANLTNYKRPRFIEFRTELPKSNVGKILRKELRG"
FT   gene            complement(615706..616242)
FT                   /locus_tag="Arad_0747"
FT   CDS_pept        complement(615706..616242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0747"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0747"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25368"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8I1"
FT                   /protein_id="ACM25368.1"
FT                   /translation="MAVILVGEDIVLAQETAGFLDVAFGHVNAITIDIGIVAQLFPRQP
FT                   VVFLTNAEEAAEAQDDERDTSIAFFQHQALDMTDLLAIRTEHLGPLDPVAGDQHRHILD
FT                   VEVTAHGIGTLFMHARTSLWIRFTYVGASDPPPFFQGDTMLRWVFAHGPLTRSSRKSSS
FT                   PFLKIVKKGLTPRDC"
FT   gene            complement(616345..616731)
FT                   /gene="gloA"
FT                   /locus_tag="Arad_0748"
FT   CDS_pept        complement(616345..616731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gloA"
FT                   /locus_tag="Arad_0748"
FT                   /product="lactoylglutathione lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0748"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25369"
FT                   /db_xref="GOA:B9J8I2"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8I2"
FT                   /protein_id="ACM25369.1"
FT                   /translation="MIHSMIRVLDEARSIDFYGKAFGLAVVDRIVFPTFTLIYLSNAET
FT                   GFELELTVNQGRVEPYPLGEGYGHLAVSVDELRDEHALFSSLGLNPGKITELNRDGKLF
FT                   GLFFFVTDPDGYKIEVVQRHGRFQ"
FT   gene            616946..617329
FT                   /locus_tag="Arad_0750"
FT   CDS_pept        616946..617329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0750"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0750"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25370"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8I3"
FT                   /protein_id="ACM25370.1"
FT                   /translation="MYYAILAYHEEGVVESWSKEEDAALMTELLEVNDRLVAEKSLGPA
FT                   ARLGPPQGAVTLRGKGAGLVIDGPFAETKEQLLGFYVVDFPTLDAAVAAARDLRRVNPT
FT                   AVYEIRPISLYLPGAPLSSGEGG"
FT   gene            complement(617382..618131)
FT                   /locus_tag="Arad_0751"
FT   CDS_pept        complement(617382..618131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0751"
FT                   /product="proline/glycine betaine ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0751"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25371"
FT                   /db_xref="GOA:B9J8I4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8I4"
FT                   /protein_id="ACM25371.1"
FT                   /translation="MRFLATNLFRLLALALLLVLLFRPEWLIPILAPLTKFGASPIYTQ
FT                   NSLPSLALSHMELILISIAASGILAVLGGIFVTRKSGADFLPLSRAIANAGQTFPPVAV
FT                   LALAISTTGFGAVPTLIALFLYALLPIFENTVAGLQQVPATVLDAADGMGMNGWQRLFR
FT                   VELPLALPLIIEGLKIATVINIGTATIGSTVAAKGLGEVIIAGLINDNTAFILQGGLIV
FT                   GLMAVLIYDGMELIEHTVTRKIGVQGQ"
FT   gene            complement(618128..619066)
FT                   /locus_tag="Arad_0752"
FT   CDS_pept        complement(618128..619066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0752"
FT                   /product="proline/glycine betaine ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0752"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25372"
FT                   /db_xref="GOA:B9J8I5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8I5"
FT                   /protein_id="ACM25372.1"
FT                   /translation="MIELKGVTKRYGNATVVDNVSMSMEKGTITVIVGTSGSGKSTLMR
FT                   MINRLVPISDGHISVGGQDVMDVPATELRRRIGYAIQGHGLFPHRTVAQNIATVPELLG
FT                   WDRARINGRVEELLNLFHLDPGIFAAKYPSQLSGGQQQRVGVARALAAEPELLLMDEPF
FT                   GALDPVIRGKAQDDLLAIQKQFGTTVILVTHDMDEAFHLGDQIAVMSNGKLLQCSEPEK
FT                   ILTEPADPFVQQLTGTSDRALKLMSLLPLKGSMQPPRPGLGYSLPQTLNLRDALAEMIW
FT                   QGADEAAVEDDSKVLVGSISMQHLIELGRKA"
FT   gene            complement(619072..620157)
FT                   /locus_tag="Arad_0753"
FT   CDS_pept        complement(619072..620157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0753"
FT                   /product="proline/glycine betaine ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0753"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25373"
FT                   /db_xref="GOA:B9J8I6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8I6"
FT                   /protein_id="ACM25373.1"
FT                   /translation="MPFIIVKANRIAAGKPQLLIQLLAQPSALALLALLVATALAALFL
FT                   RNQLARLGIATLTIAFLIITLGLVSTAATPAGSTVARITPGGAFWVLLAVIGLVISDAL
FT                   VKLRLSPWLRVGSLALYAALLGVIFKSGLLDNLSIMKEYANNTDKFWNEGLGHVFLALG
FT                   SVAIAIILALPLGIFCYWQPRLRAVVLRALSLVQTIPSLALFGILMLPLGYIAAHVPFA
FT                   ATIGVKGIGTAPALVALVIYSLLPIVANTVVGLAGVDPSVRDAAAGMGLTRRQILTRID
FT                   LPLAFPVILTGIRIVLVQAIGLVTVAALIGGGGFGIFIFQGIGQTANDLVLLGAVPTVF
FT                   LAFSSAVILDAVIDSIRGQRA"
FT   gene            complement(620323..621231)
FT                   /locus_tag="Arad_0755"
FT   CDS_pept        complement(620323..621231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0755"
FT                   /product="glycine betaine ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0755"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25374"
FT                   /db_xref="GOA:B9J8I7"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8I7"
FT                   /protein_id="ACM25374.1"
FT                   /translation="MFKKLALAATLAALLASGASAADVVVSSKIDTEGTLLGNIILAAL
FT                   NANGIKAQDRIALGTTPVVRKAITAGEIDIYAEYTGNAGFFFNKADDAAWKDLQKGYDL
FT                   AKKLDYDANKIVWLTPSPANNTWAIAVRNDVAGPAKLKTMSDFGKWVAGGGPVKLAASS
FT                   EFVNSPAALPAFQTTYSFQIKPDQEVVLSGGDTAATIKAAADQTNGVNTAMVYGTDGAI
FT                   EAAELTVLEDDKSVQPVYAPTPIVREAVLKANPKIEEVLAPIFKGLTADVLRKLNGRIQ
FT                   VDGEPAKAVAESYLKDGGFLK"
FT   gene            621665..622855
FT                   /locus_tag="Arad_0756"
FT   CDS_pept        621665..622855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0756"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0756"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25375"
FT                   /db_xref="GOA:B9J8I8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8I8"
FT                   /protein_id="ACM25375.1"
FT                   /translation="MYLGALFIADTVFSIGSVRETARRLSLSASTVSGALRRLETDLAI
FT                   KLVERASGELATLLASAKVKKGLQPILAGMRALSALTKEPPTPEDYAQWAARLPLKIAT
FT                   IERFLEVADQGSINRAARRLRLGQPQLSLQIANLEDLFGCRLFERQAQGSMLTEAGREV
FT                   QAILAGIAEAWDEMKATSDERFQRVARAVRIGSIIPTGSESWVARSLASLVARWNSSGN
FT                   RNMLSLMLMTADDLREALRSGRIDVAIVDSVFGLDAFDHMELLATDMVAIAPPGSTERT
FT                   VAALVDNHPLCVPSPRTGIGNAAMAFGYDSGDRRRFRGRDITSADSLPVIVDLVANHGY
FT                   VSFLGRVSAMPIADKVRIVDPDEVLPLSYYLAHNGRKASIDACRLIRQAVRELVAE"
FT   gene            622877..623299
FT                   /locus_tag="Arad_0757"
FT   CDS_pept        622877..623299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0757"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0757"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25376"
FT                   /db_xref="GOA:B9J8I9"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8I9"
FT                   /protein_id="ACM25376.1"
FT                   /translation="MASPSGCPVGDLEPCLRLKRYSSARVNAGNDAILGSARCRRPGGL
FT                   RLRRRVMRIIATALLALGILALPVTNADAHRRHYHHWHHRHGPSVMIAPGFFGVYVGPS
FT                   YGHRYYYRDRYWRGDDWEYRRWHRHYWRDRYYDPWD"
FT   gene            complement(623399..623698)
FT                   /locus_tag="Arad_0759"
FT   CDS_pept        complement(623399..623698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0759"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0759"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25377"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8J0"
FT                   /protein_id="ACM25377.1"
FT                   /translation="MIHVLAILTAKPGKRAEVLEAFQANVPAVHAEDGCIEYTAVVDVE
FT                   GADPAFGPDTFVVVEKWENLAALKAHAAAAHMAAYGEQVKDLMAARAVHVLNPA"
FT   gene            623964..624170
FT                   /locus_tag="Arad_0760"
FT   CDS_pept        623964..624170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0760"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25378"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8J1"
FT                   /protein_id="ACM25378.1"
FT                   /translation="MRRGFCSRQFILGRRIHHAVVAKAVSIIAKAIPSSAMMDLSAPVR
FT                   GRVRHIPVVSMVPQVLRIQIPWK"
FT   gene            complement(624384..624456)
FT                   /locus_tag="Arad_5048"
FT   tRNA            complement(624384..624456)
FT                   /locus_tag="Arad_5048"
FT                   /product="tRNA-Thr"
FT   gene            complement(624595..625563)
FT                   /locus_tag="Arad_0761"
FT   CDS_pept        complement(624595..625563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0761"
FT                   /product="dioxygenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0761"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25379"
FT                   /db_xref="GOA:B9J8J2"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8J2"
FT                   /protein_id="ACM25379.1"
FT                   /translation="MMFMALPAILTERLRLPVVASPLFIISHPALTLAQCKAGVVGAFP
FT                   ALNARPESQLDEWLAMITEDLAAHDAAHPERPSAPFAVNQIVHTSNKRLEHDLMLCVKY
FT                   KVPIVISSLGAVPEVNAAVHSYGGVVLHDIINNRHANSAIRKGADGLIAVATGAGGHAG
FT                   QLSPFALVQEIREWFDGPLLLAGAIANGGAILAAQAMGADMAYIGSPFIATEEARAADA
FT                   YKQAIVESAAADIVYSNFFTGIHGNYLKPSILAAGMDPDNLPEADPSKMDFETATTGAK
FT                   AWKDIWGSGQGIGVVKAVEPVAALVDRLEAEYRQARIRLAL"
FT   gene            625719..627089
FT                   /locus_tag="Arad_0762"
FT   CDS_pept        625719..627089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0762"
FT                   /product="regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0762"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25380"
FT                   /db_xref="GOA:B9J8J3"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8J3"
FT                   /protein_id="ACM25380.1"
FT                   /translation="MSAGDLQRLAHCQAGRYRFWLANGKENGRLASRVCGRIASESKGP
FT                   DVSGLEAAIRNALERSDRANPETRARVYQSARQALEAGLRKQDVTDINVISAQRQRLEE
FT                   TIRAIESEERAHPPQTPAPIEPEAPHIPSVTSPQHAQQQPMQQEPAMSVRGDTRDHHPV
FT                   AAPAPVAAEPRAPEGDFGDMGAGPADHLGADSDARQAAPAPATTRSMNFKPERAAVRRK
FT                   PRKFFSRLLVFCILLACLGVGAWWVKTSGVFMTAAQRDTSVRNPPAHVDSQDFDGSSND
FT                   EDASSDDDNSGPVNPGLAVIDPQNSFSEEWIEILKPTDAAKVVSGAQAKAENVSENEGP
FT                   AVRLTSASNGSDGDVTVEVPASVLQQLAGKSSTVALTLQSTSDTPTQITVECDFGSLGN
FT                   CGRHRFNVTRQKTDALFQVRYDRSLAPTASGHLIINSDLDGKARGVNVYAIRVLPGQ"
FT   gene            complement(627103..627984)
FT                   /locus_tag="Arad_0763"
FT   CDS_pept        complement(627103..627984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0763"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0763"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25381"
FT                   /db_xref="GOA:B9J8J4"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8J4"
FT                   /protein_id="ACM25381.1"
FT                   /translation="MAEEVESRAVELDVHGKMRIFDVDDPVLPAWIEDEALGSDGYPYK
FT                   KKLKDEEYLEELEKLQIELIKVQFWLQSTGKRVMALFEGRDAAGKGGSIAATSAHMNPR
FT                   LARVVALTKPTDREAGQWYFQRYVAQFPTAGEFVLFDRSWYNRAGVEPVMGFCTPKQYE
FT                   QFLKQAPRMERLIVQDGILFFKFYLDIGREMQLKRFHDRRHDPRAVWKLSSMDIAALTK
FT                   WKDYSEKRDRMLKDTHTDYAPWTVIRANDKRRARLNLIRHILLTLDYDGKDAKAIGEID
FT                   GKILGSGAQVLK"
FT   gene            628224..629486
FT                   /gene="phoR"
FT                   /locus_tag="Arad_0764"
FT   CDS_pept        628224..629486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoR"
FT                   /locus_tag="Arad_0764"
FT                   /product="phosphate regulon sensor kinase PhoR"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0764"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25382"
FT                   /db_xref="GOA:B9J8J5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8J5"
FT                   /protein_id="ACM25382.1"
FT                   /translation="MHLQDEWSFLRKLAARLRQEAAILILATLIASLALIEGINTAVVF
FT                   WIWMIAVIVALTRAPLIEKIEPQSPAGPAPTDPDALLSMVSAGLSALDMPVLIVDREAS
FT                   VVAQNSAADKAFGAFPLNAHISAKLRSPGVLDMVRETIATNAPNQIEHSERLPSERVYI
FT                   VRIAPIDLPETEIEPGTFFVLSFRDISELRHIDRMRSDFVANASHELRTPLASLRGFIE
FT                   TIQGPAKADLKAQQRFLGIMFDQTTRMSRLVDDLLSLSRLELKSHIAPDQKVDLVPLLG
FT                   HVRDALLPLAGDLDVTINLHLPPGKVEVLGDRDELVQVFENLIENACKYGQEGKMVEVS
FT                   LLNEPGQAVEVIVSDRGPGIPAEHVPRLTERFYRVNVEDSRSKKGTGLGLAIVKHILTR
FT                   HRARLIVKSEVGKGTDFTVRF"
FT   gene            629674..630708
FT                   /gene="pstS"
FT                   /locus_tag="Arad_0766"
FT   CDS_pept        629674..630708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstS"
FT                   /locus_tag="Arad_0766"
FT                   /product="phosphate ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0766"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25383"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8J6"
FT                   /protein_id="ACM25383.1"
FT                   /translation="MNALKSSIAALVASVTFAGAAMARDQIQISGSSTVFPYAKIVAET
FT                   FGETFTNYKTPVVESGGSGAGLKEFCKGVGPDSIDIANSSRPIKGSEVDACKAAGVADI
FT                   QQVKIGYDGIVFAYDKSNPDIRFVPTDLYKALAAEVVVNGKLVANPYKKWSEINPALPD
FT                   FEIAAYIPGEKHGTREVFEEKVLAAGCKDSGALDVIKAAVPDAGKQAEKCIAVRKDGVA
FT                   VDIDGDYPETLARINANKHGVGVFGLYFYQNNADKLKVATVGGIVPSGQTIADGTYPVS
FT                   RPLFFYVKKAHLGVIPGLKEYVDFFTSDQMIGPDSPLAEYGLVPAPDAERDQIRKDVAN
FT                   GKIM"
FT   gene            630721..632274
FT                   /gene="pstC"
FT                   /locus_tag="Arad_0768"
FT   CDS_pept        630721..632274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstC"
FT                   /locus_tag="Arad_0768"
FT                   /product="phosphate ABC transporter, permease protein PstC"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0768"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25384"
FT                   /db_xref="GOA:B9J8J7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR022182"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8J7"
FT                   /protein_id="ACM25384.1"
FT                   /translation="MPAGAVTRAGVCREIGREMGQGMGMSVSLLLSCLSIIGASAFVLG
FT                   RTRAAALSGGRSSVLHSRLGYHGAYVAIWAVLPALALICAWLVISPQVIDDVVVKSFPE
FT                   EVKTLPEAELNLSYGVVRSIAHGMRLLDNQELAAVAAGAVDLQLMLAQKGVPLAVRPTG
FT                   YMVDAANKYNGMRHVSRVVMSAAAIILSVLCAIHGLRAIAPRFRARNRVEQVVLGGLIV
FT                   ASSIAVLTTLGIAASMLSEAARFFNMVPAAEFFFGTVWDPRFTGAGAQTSGTFGLIPLL
FT                   AGTLYISFVAMLVAVPVGLFAAIYMAEYASARVRSLAKPMLEVLAGIPTIVYGFFALVT
FT                   VGPFLRDISADINGLLTGNYASFIEAQSVLTAGFVMGVMLIPYVSSLSDDIIMAVPRSL
FT                   RDGSLGLGATRSETVKRVLLPAALPGIVGALLMTASRALGETMIVVLAAGVAARMQFDP
FT                   FEPMTTVTVKIVNQLTGDLEFTSPQTLVAFALGITLFCLTLCLNVYALYIVRRYREQYE
FT                   "
FT   gene            632271..633605
FT                   /gene="pstA"
FT                   /locus_tag="Arad_0769"
FT   CDS_pept        632271..633605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstA"
FT                   /locus_tag="Arad_0769"
FT                   /product="phosphate ABC transporter, permease protein PstA"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0769"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25385"
FT                   /db_xref="GOA:B9J8J8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR024573"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8J8"
FT                   /protein_id="ACM25385.1"
FT                   /translation="MSDLVCSAKPPIPRGLTPGAPARRDIGIKRRYAAERRFRAYGIAA
FT                   VTFGLVFLIALVSSVVRHGYTAFVQTSITLPIEFVEKVIDPTGKRASDPKVLIAANYPV
FT                   LVRDALVKALGIDPADRALVREATAMVSDSARSMLRDKVMADPSIIGKTVKITLLADAN
FT                   IDSANKGQIDLTANEADRKVSDRQLGWMRQLAASGALHKAFNSGLFLSGNSSRPEAAGL
FT                   GVALIGSLYLMLTVLVLALPVGVAASIYLEEFAPKNRLTDLIEVNINNLAAVPSIVYGL
FT                   LGLSVFINVMGLPRSASLVGGLVLSLMTLPMIIIATRSALRAVPPSIRSAALGLGASRM
FT                   QVVFHHVLPLAMPGILTGTILGLAHALGETAPLLLIGMVAFVASYPTSPLDPATALPVQ
FT                   IYMWASEAERAFVERTSGAIIVLLFFLVAMNIGAILLRRRFERRW"
FT   gene            633620..634435
FT                   /gene="pstB"
FT                   /locus_tag="Arad_0770"
FT   CDS_pept        633620..634435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="Arad_0770"
FT                   /product="phosphate ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0770"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25386"
FT                   /db_xref="GOA:B9J8J9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8J9"
FT                   /protein_id="ACM25386.1"
FT                   /translation="MNMMTEAAGEKALARKMTTIPYKMIGQDVSVYYGDKRALFGVDLN
FT                   IRVNTVTALIGPSGCGKSTFLRCLNRMNDTIDTCRVTGKITLDDKDVYDSAIDVVELRA
FT                   RVGMVFQKPNPFPKSIYENVAYGPRIHGLHRSKADLDHIVETSLQKAGLWGEVKDRLLE
FT                   AGTSLSGGQQQRLCIARAVAVSPEVILMDEPCSALDPIATAKVEELIHELRENFTIVIV
FT                   THSMQQAARVSQRTAMFHLGHLVEENDTDKMFTNPDDFRTQDYIMGRFG"
FT   gene            634487..635200
FT                   /gene="phoU"
FT                   /locus_tag="Arad_0771"
FT   CDS_pept        634487..635200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoU"
FT                   /locus_tag="Arad_0771"
FT                   /product="phosphate transport system regulatory protein
FT                   PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0771"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25387"
FT                   /db_xref="GOA:B9J8K0"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8K0"
FT                   /protein_id="ACM25387.1"
FT                   /translation="MVSTHILSAYDEDLKFLTRRIAEMGGLAEQMVSDSVRALVHGDAA
FT                   LAQKVISDDVVLDHAEREVGDKAIVTIARRQPMAADLREIMGSIRIAADLERVGDLGKN
FT                   TAKRVIAVQGHGVPRRLARGIEHLSELALSQLKEVLDVYTTRSPDKAVSIRERDEEIDA
FT                   MYTSLFREMLTYMMEDPRNITTCTHLLFCAKNIERIGDHATNIAETIYYMATGSQPEGE
FT                   RPKDDTANTVGAVTE"
FT   gene            635281..635916
FT                   /gene="phoB"
FT                   /locus_tag="Arad_0772"
FT   CDS_pept        635281..635916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoB"
FT                   /locus_tag="Arad_0772"
FT                   /product="phosphate regulon transcriptional regulatory
FT                   protein PhoB"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0772"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25388"
FT                   /db_xref="GOA:B9J8K1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011879"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8K1"
FT                   /protein_id="ACM25388.1"
FT                   /translation="MLRYNLEAEGFEVDTILRGDEAELRLQERIPDLLILDWMLPGVSG
FT                   IELCRRLRMRPETERLPIIMLTARGEESERVRGLSTGADDYVVKPFSTPELMARVKAML
FT                   RRARPEVLSTVLRCGDIELDRETHRVHRKSREVRLGPTEFRLLEFLMASPSRVFSRSQL
FT                   LDGVWGHDIYVDERTVDVHVGRLRKALNFSNMQDVIRTVRGAGYSMEA"
FT   gene            complement(636004..636540)
FT                   /locus_tag="Arad_0773"
FT   CDS_pept        complement(636004..636540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0773"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0773"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25389"
FT                   /db_xref="InterPro:IPR011681"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8K2"
FT                   /protein_id="ACM25389.1"
FT                   /translation="MNWTDERVEKLKKLWSEGLSASQIAAQLGGVSRNAVIGKVHRLSL
FT                   PGRAKAGGTATAARAQKRNTSAPRAPNYASRVATRTVTRQQGATMLKEEVEIDTVNEIE
FT                   YRPAANVVVPISRRLGLTELTERTCKWPVGDPLKDDFHFCGNDSPDASPYCGYHQRLAY
FT                   QPVHERRRPAAQPRG"
FT   gene            636968..638167
FT                   /gene="argD1"
FT                   /locus_tag="Arad_0775"
FT   CDS_pept        636968..638167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argD1"
FT                   /locus_tag="Arad_0775"
FT                   /product="diaminobutyrate--pyruvate aminotransferase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0775"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25390"
FT                   /db_xref="GOA:B9J8K3"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8K3"
FT                   /protein_id="ACM25390.1"
FT                   /translation="MAETAPLYDTYMRAPLRFERGEGVWLFTETGERYLDFAAGVAVNS
FT                   LGHAHPHLVAELKAQADKVWHLSNLYEVPGQEKLSKRLTEATFADKVFFTNSGAEALEC
FT                   AIKTARRYQFSKGHPEKFHIITFEGAFHGRTIATIAAGGQEKYLEGFGPKAPGFDQVPF
FT                   GDLDAVRAAVTDATAGILIEPVQGEGGIRPATNEFLRGLRQICDEHGLLLILDEVQCGV
FT                   GRTGKLFAHEWSGVTPDIMAVAKGIGGGFPLGACLATAEAASGMKAGTHGSTYGGNPLA
FT                   MAVGNAVLDIVLADGFLDHVRDIALVFRQGLASLQDRFPDIIEDIRGEGLMLGIKAAIP
FT                   QAELLQAIRAEYLLGVPAGDNVIRLLPPLVVTAEEAREGIARIERAAESVRAARIKKSA
FT                   "
FT   gene            638335..639252
FT                   /gene="argF"
FT                   /locus_tag="Arad_0776"
FT   CDS_pept        638335..639252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argF"
FT                   /locus_tag="Arad_0776"
FT                   /product="ornithine carbamoyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0776"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25391"
FT                   /db_xref="GOA:B9J8K4"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8K4"
FT                   /protein_id="ACM25391.1"
FT                   /translation="MASPKHFLDLSAVAAADLRSIIDDAIVRKRALKAGTADKPLAGKM
FT                   LAMIFEKPSTRTRVSFDVGMRQLGGETLFLSGTEMQLGRAETIGDTAKVLSRYVDAIMI
FT                   RTTEHSRLLELAEHATVPVINALTDDTHPCQIMADIMTFEEHRGPIKGKTIAWTGDGNN
FT                   VLHSLIEGAARFDYRMNMAVPLGSEPKDHYLNWARNQGAEIMLSHDADRAVAGVDCVVT
FT                   DTWVSMNQEHRARGHNVFQPYQVNQALMAQAGKDALFMHCLPAHRGEEVTDEVIDGPQS
FT                   VVFDEAENRLHAQKSILAWCLGAI"
FT   gene            639302..640291
FT                   /gene="hsp33"
FT                   /locus_tag="Arad_0778"
FT   CDS_pept        639302..640291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsp33"
FT                   /locus_tag="Arad_0778"
FT                   /product="33K chaperonin (heat shock protein 33) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0778"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25392"
FT                   /db_xref="GOA:B9J8K5"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8K5"
FT                   /protein_id="ACM25392.1"
FT                   /translation="MAESAASLGQFDFAGDDHVVPFQVEGLDVRGRAVQLGPLLDTILA
FT                   RHNYPAPVARLLAEAVVLTVLLGTSLKFEGKFTVQTKGDGPVDLLVADFATPENVRAYA
FT                   RFDEEALAKAVAAGETEPEQLLGKGVLAFTIDQGRYSQPYQGIVALDGASLEEIAGTYF
FT                   RQSEQIPTRVRLGAAELFDRDEAGKPRHRWRAGGLIAQFLPEALERMRQPDLHGGDGDS
FT                   NPRHHVEDDAWEEARSLVETIDADELTDPQVGTERLLFRLFHERGVRVYEPKAVFDRCT
FT                   CSRDKLKGVLQGFSAEEIEVSQENGEIAVTCEFCSTTYRFEVSEVRDA"
FT   gene            complement(640298..640708)
FT                   /gene="apaG"
FT                   /locus_tag="Arad_0779"
FT   CDS_pept        complement(640298..640708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaG"
FT                   /locus_tag="Arad_0779"
FT                   /product="protein affecting Mg2+/Co2+ transport"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0779"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25393"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8K6"
FT                   /protein_id="ACM25393.1"
FT                   /translation="MTKVSGMYRALTRDIEVVVEPFYLEEQSDPDDDRYVWGYRIIISN
FT                   HSTLNVRLVTRYWHITDQNGLVDEVTGPGVVGEQPRLGPGDTYEYSSGCPLDTPSGMMF
FT                   GHYQMETDDGELFHVKIPAFSLDTPNLLRTLN"
FT   gene            complement(641012..642196)
FT                   /gene="metZ"
FT                   /locus_tag="Arad_0780"
FT   CDS_pept        complement(641012..642196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metZ"
FT                   /locus_tag="Arad_0780"
FT                   /product="O-succinylhomoserine sulfhydrylase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0780"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25394"
FT                   /db_xref="GOA:B9J8K7"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006234"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8K7"
FT                   /protein_id="ACM25394.1"
FT                   /translation="MSKTWRPATQLVHSGTLRSQFGETSEAIYLTQGFVYDTSEAAEAR
FT                   FKGETDGFIYARYGSPTNDMFEKRMCALEGAEDARATASGMAAVTAAILCQLTAGDHIV
FT                   AARALFGSCRWVVETLAPKYGIECTLVDGRFAENWEKAIRPTTKVFFLESPTNPTLEVV
FT                   DIAAVAKLANQIGAKVVVDNVFATPLFQKPLELGAHIVVYSATKHIDGQGRSLGGVILS
FT                   DKQWIDENLQDYFRHTGPAMSPFTAWTLLKGIETLPLRVAQQTANAAKIADFLAEQGKV
FT                   AKVIYPGRKDHPQADIIAKQMTGGSTLVAFELKGGKEAAFKLQNALEIVRISNNLGDSK
FT                   SLITHPATTTHKNLTDEARAELGISPGTVRFSAGIEDGDDLVEDFARALAQVSA"
FT   misc_binding    complement(642241..642319)
FT                   /bound_moiety="S-adenosyl methione"
FT                   /note="SAM riboswitch (alpha-proteobacteria); predicted by
FT                   Infernal"
FT   gene            642395..643486
FT                   /gene="dcd"
FT                   /locus_tag="Arad_0783"
FT   CDS_pept        642395..643486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcd"
FT                   /locus_tag="Arad_0783"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0783"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25395"
FT                   /db_xref="GOA:B9J8K8"
FT                   /db_xref="InterPro:IPR010550"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8K8"
FT                   /protein_id="ACM25395.1"
FT                   /translation="MARNTGILADRAIATLFEAGRLTSERELDDDQIQPASLDLRLGAH
FT                   AFRVRASFMPGPSHLVADKLDRLKLHVIDLSEGAVLETGCVYIVPLMERLDLPADMSAS
FT                   ANPKSSTGRLDIFTRVITDRAQEFDKIPAGYSGPLYLEISPRTFPIVVRRGSRLSQIRF
FT                   RVGQALLNEPELMALHANETLVASKQPNVNGGGIALSIDLAGDKEGLIGYRGKHHTAVV
FT                   DVDKKAQHDIYDFWEPLYSRGRTELILDPDEFYILVSREAVHVPPHYAAEMTPFDPLVG
FT                   EFRVHYAGFFDPGFGHAPAGGRGSRAVLEVRSHEVPFILEDGQIVGRLVYEHMLEQPTS
FT                   LYGSGLGSNYQAQGLKLSKHFRL"
FT   gene            643545..643615
FT                   /locus_tag="Arad_5008"
FT   tRNA            643545..643615
FT                   /locus_tag="Arad_5008"
FT                   /product="tRNA-Gly"
FT   gene            643785..644372
FT                   /locus_tag="Arad_0784"
FT   CDS_pept        643785..644372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0784"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0784"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25396"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8Z4"
FT                   /protein_id="ACM25396.1"
FT                   /translation="MLSFASFYRLKAIFTRGVLRISRRTKVPRGTTIIWKDGRVSIGAR
FT                   AFIRRGVVIDAQRGSIEIGDHVSLNDYAILLGRGGITIGNDVRIAAHAMVVSFDHNFDD
FT                   VTQPIRMQGVTKKPVVIEDDVWIGAGAKILGGSHIAKGCVIGANAVVKGKTVPYGIYVG
FT                   APAKLVRRRGDQGDVRPAKLELLPPPKRIAGR"
FT   gene            644525..645400
FT                   /locus_tag="Arad_0785"
FT   CDS_pept        644525..645400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0785"
FT                   /product="amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0785"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25397"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8Z5"
FT                   /protein_id="ACM25397.1"
FT                   /translation="MRVCLSSLISVARSLTGAVLMAASCAMPVVAQQAPPSGLPVLFDA
FT                   RERLPKPDLSTLVRLRFLTSVDFPPFNFADQNGKLSGFHVDLAREICDELGISDKCQIQ
FT                   ALPFEELQGALSASQGDAVIAGVAVTPELRKSFAFSRPFLMLPARFVRNLKAPIDGRTA
FT                   AALAGHSVGVVKGTTHEAMLAAFFPAIKLVPFDDKDALLAAVKDGKVDAGFADGLQLSF
FT                   WVSSPSAEKCCALFDGPYLSQQFLGEGMTIMLREQDADLTAAINHALATLSRNGRLQEI
FT                   YLRYFPYGLY"
FT   gene            complement(645410..645823)
FT                   /locus_tag="Arad_0786"
FT   CDS_pept        complement(645410..645823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0786"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0786"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25398"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8Z6"
FT                   /protein_id="ACM25398.1"
FT                   /translation="MNKPLSAQEALIYVMVMASAVDRTMNDREMTRIGELIHALPVFKG
FT                   FDDEKLIDVSRDCARLLAGSEGLDIVLETVRDTLPPRLYDTAYALAVEVASADLSVKAE
FT                   ELRLLSLLRDRLDLGKLTCAAIERSAIARYRKG"
FT   gene            complement(645906..647093)
FT                   /locus_tag="Arad_0787"
FT   CDS_pept        complement(645906..647093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0787"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0787"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25399"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8Z7"
FT                   /protein_id="ACM25399.1"
FT                   /translation="MRRNVWLAGVAGVVVGSWLTLVAVQVNEHGFHLPGRAASKAEAEN
FT                   HSATAAAPIEVAQADVAPAQTLTDTAPKKTLPITAGTVIAAATVMADSATAQTTVPAAT
FT                   KSEPPAATLTSAPAVAPVVAAEDTAKDAVIVPADQDKSSTAKPAMELQGTSPAQLTQSE
FT                   TAPATAPEAQPAPKNTTDADGTKTEAPEIKKAEPEQAAPFPAPADQADRAAAAAARRTV
FT                   PMTPSTQQASPGDSQTPSDDQKQAGGTEPVELVRPSSDRAGMLTVGNRSVQLSGIIPTD
FT                   IGRMCAGSDGKSWPCGTAARTAFRMYLRGRIIDCDLPSATWQGTMTGHCRYVRIDLSEW
FT                   LVRFGWAEPEAGSPLEAAAEQAKQQKRGIYGDDPRKGRKSTLAPAPAKEDPLNPI"
FT   gene            complement(647109..647774)
FT                   /locus_tag="Arad_0788"
FT   CDS_pept        complement(647109..647774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0788"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0788"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25400"
FT                   /db_xref="GOA:B9J8Z8"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8Z8"
FT                   /protein_id="ACM25400.1"
FT                   /translation="MLSHEQIWSAIDKLAERYALTPSGLARRAGLDPTSFNKSKRLGQD
FT                   GRLRWPSTESIAKVLGATGASMEQFLGILRPVERGDGNADHASSPPASSIPLLGFAQAG
FT                   SGGFFDDGGFPAGQGWDMVEFPAAPGQKGGVYALEVQGESMLPLYRDGDVLIVEPGAQI
FT                   RRSDRVVVKTREGEVMAKVLLRQSAKSIELLSLNPEHPNRSFDLADVEWIARIIWASQ"
FT   gene            complement(647913..648341)
FT                   /locus_tag="Arad_0789"
FT   CDS_pept        complement(647913..648341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0789"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0789"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25401"
FT                   /db_xref="UniProtKB/TrEMBL:B9J8Z9"
FT                   /protein_id="ACM25401.1"
FT                   /translation="MTKEIVTGLAALLLPATLLLSVPSQAAEPDATRFQLERSGDHFIR
FT                   LDKQTGAMSICQDQSGNLVCRMAADERAAYDDELDRLSDRVTKLEKTASAGGGSTLPSD
FT                   ADVDRTLGIMQKFMRGFMGMAKEFQNEEPDNKALPQKT"
FT   gene            648448..648804
FT                   /locus_tag="Arad_0790"
FT   CDS_pept        648448..648804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0790"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0790"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25402"
FT                   /db_xref="InterPro:IPR009297"
FT                   /db_xref="UniProtKB/TrEMBL:B9J900"
FT                   /protein_id="ACM25402.1"
FT                   /translation="MMTAMPVVYKIVPDTLWQQARQTGVFHGASIDLTDGFIHLSTAKQ
FT                   SKETAARYFAGQQGLLLVAIDGDALGDRLVFEPSRGGALFPHLYAPLPLSAVLWAKPLP
FT                   LGPDGAHVFPEISE"
FT   gene            648801..649889
FT                   /gene="pyrD"
FT                   /locus_tag="Arad_0791"
FT   CDS_pept        648801..649889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrD"
FT                   /locus_tag="Arad_0791"
FT                   /product="dihydroorotate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0791"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25403"
FT                   /db_xref="GOA:B9J901"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J901"
FT                   /protein_id="ACM25403.1"
FT                   /translation="MIGSFRDLGRRGLFLLDPETAHGMSIAALKSGLVPTCRVSNDPRL
FT                   RQIVAGLDFANPLGMAAGYDKNAEVPEALLKLGFGFTEIGTVTPKPQPGNPRPRIFRLV
FT                   EDEGVINRLGFNNEGHEAALRRLQPIRGNGIIGVNIGANKDSADRIADYVAGIRRFYSV
FT                   ARYFTANISSPNTPGLRDLQARESLSALLSAVLAARDDEAAKAGKKIPVFLKIAPDLTE
FT                   EGMDDIAAEVLAHALDGLIVSNTTLSRDGLKDQVQAKEAGGLSGKPVFERSTVVLAKMR
FT                   RRVGAALPIIGVGGVSSAETALEKIRAGADLVQLYSCMVYEGPGLPGRVVAGLSKLLDR
FT                   ERVASIRELRDSRLDYWADRKV"
FT   gene            complement(649865..651214)
FT                   /gene="dinF"
FT                   /locus_tag="Arad_0792"
FT   CDS_pept        complement(649865..651214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinF"
FT                   /locus_tag="Arad_0792"
FT                   /product="DNA-damage-inducible F protein (Na+ driven
FT                   multidrug efflux pump)"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0792"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25404"
FT                   /db_xref="GOA:B9J902"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B9J902"
FT                   /protein_id="ACM25404.1"
FT                   /translation="MDQQARGGKVLPFDVTHRLVLSIALPMTLGFITTPLLGIVGTAVV
FT                   GQLGQPDALAGLAIGAMLFDLIFSSFNFLRASTTGLTAQAYGRHDRHEQQAIFWRALLS
FT                   ALACGILIVLLSPVLLWLGIKLMGPEGGVAEATRTYFSIRMLAGPMALANYAILGFVLG
FT                   RGQGRIGLLLQTVINGVNIVLALVLGLWLSWGVAGVAWGTLIGEAAGTLTGLAIVLKSF
FT                   SGEPRPSRAELLSPAKLKQLFALNRDILIRTFVLLGAFTLMTRIGNSFGAVTLAANAVV
FT                   MNFLLLSAYYLDGLANAAEQITGRSIGANYRPAFERGLKLTGLWSFGLALAAALFFFAA
FT                   GPALIRLLTTSEDVRAAAGAYLPWAAISGLTGALAFLMDGVYIGATWSSAMRNRMLLSF
FT                   AGYLITLAILVPTLRNHGLWMAINAFLLFRGLLLIIGLKKRVDQTFRSAQ"
FT   gene            complement(651232..651735)
FT                   /locus_tag="Arad_0793"
FT   CDS_pept        complement(651232..651735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0793"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0793"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25405"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:B9J903"
FT                   /protein_id="ACM25405.1"
FT                   /translation="MISPNTSFARRHALRLTGLALAAIVTSCATAPSHLSNILASDQTA
FT                   SALPLVNALRAKNGLPPLQMDTAASSAAIYQARRMADAGKMEHLIGIGDNFGTRVKSSG
FT                   VKLPAAENIAEGQKSVDAAVTAWINSPKHLHNMLGKYDGLGVALAYTPSSGGRPYWSMV
FT                   LSSN"
FT   gene            complement(651737..651991)
FT                   /locus_tag="Arad_0795"
FT   CDS_pept        complement(651737..651991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0795"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0795"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25406"
FT                   /db_xref="GOA:B9J904"
FT                   /db_xref="UniProtKB/TrEMBL:B9J904"
FT                   /protein_id="ACM25406.1"
FT                   /translation="MNKFLGDSPGRTLVKLIIVSLIVGFTMKFFGWRPLDFLYGVRRFL
FT                   LDLWHSGFAALGEFGDYLVLGATLVIPLFILLRLFNYRR"
FT   gene            652171..653115
FT                   /locus_tag="Arad_0796"
FT   CDS_pept        652171..653115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0796"
FT                   /product="methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0796"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25407"
FT                   /db_xref="GOA:B9J905"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9J905"
FT                   /protein_id="ACM25407.1"
FT                   /translation="MLPSQLSSGDVIADRRADYAKMLAESGEPASAAELMEQALELAPS
FT                   WAAGWFNLAIYREKAGNVEGAVAALNEVLTLDEGDVFGARLKLAVLGAAELPEQPPSRY
FT                   VERLFDDYADRFETSLVEKLGYTVPQKLAALIADTADIPARFYLAVDLGCGTGLFGPEI
FT                   RARVDRLEGFDLSKGMLTKAAEKGVYDHLGQADLSLAPSLSGVFDNGLVPARADLITAA
FT                   DVLMYLGNLQGVMAIVAELAAPEAVFAFSVEDAQEAEGYLLRDSLRFAHSEAYVRALLA
FT                   DHGFVVHNLARSVIRMDGGKPVHGILFVTRKTA"
FT   gene            653188..653856
FT                   /locus_tag="Arad_0797"
FT   CDS_pept        653188..653856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0797"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0797"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25408"
FT                   /db_xref="GOA:B9J906"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="UniProtKB/TrEMBL:B9J906"
FT                   /protein_id="ACM25408.1"
FT                   /translation="MAESRKQRESIMASLKSAFGVWNTSATRHSLVEDIQGILSGSLIS
FT                   SLGLFCLSSAGLLTGSTAGIAFLLHYAIGVNFGVAFFVVNLPFFYLSWKQLGRAFTIKT
FT                   FIAIALTSLLTNLQPQLFEIAHINAFWSALLGGVLLGFGLLALYRHRASLGGVGILGIY
FT                   LQERFGIRAGLVQLAVDMCVLAVAFTVTTPFVVICSVLGAVALNLFVAINHRSDRYIAF
FT                   "
FT   gene            complement(653869..654060)
FT                   /locus_tag="Arad_0798"
FT   CDS_pept        complement(653869..654060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0798"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0798"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25409"
FT                   /db_xref="InterPro:IPR021232"
FT                   /db_xref="UniProtKB/TrEMBL:B9J907"
FT                   /protein_id="ACM25409.1"
FT                   /translation="MAISPLHETAKIFQFPIKARTIPVGQRSHVNLNPDIGPRVAVVDF
FT                   DSWYHEAAIADADTTRKQ"
FT   gene            654503..655543
FT                   /gene="glnII"
FT                   /locus_tag="Arad_0799"
FT   CDS_pept        654503..655543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnII"
FT                   /locus_tag="Arad_0799"
FT                   /product="glutamine synthetase II protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0799"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25410"
FT                   /db_xref="GOA:B9J908"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:B9J908"
FT                   /protein_id="ACM25410.1"
FT                   /translation="MTKFKLEYIWLDGYTPVPNLRGKTQIKEFNDFPTLEQLPLWGFDG
FT                   SSTLQAEGRSSDCVLKPVAIYPDPARTNGALVMCEVMMPDGVTPHPSNSRATILDDEDA
FT                   WFGFEQEYFFYKDGRPLGFPEAGYPAPQGPYYTGVGYSNVGDVAREIVEEHLDLCLEAG
FT                   INHEGINAEVAKGQWEFQIFGKGSKRAADQIWMARYLLQRLTEKYGIDIEFHCKPLGDT
FT                   DWNGSGMHCNFSTKFMREVGGKAYFEALMAQFDKNLDAHIAVYGPDNDKRLTGKHETAP
FT                   WNKFSYGVADRGASIRVPHSFVKNDYKGYLEDRRPNSQGDPYQIASQVLKTISEVPTEG
FT                   FASAAA"
FT   gene            complement(655915..656376)
FT                   /locus_tag="Arad_0800"
FT   CDS_pept        complement(655915..656376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0800"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0800"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25411"
FT                   /db_xref="GOA:B9J909"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B9J909"
FT                   /protein_id="ACM25411.1"
FT                   /translation="MQARFNFAKASPEAYKAVAALENYVQISGLERRFIHLIKLRASQI
FT                   NGCAYCVDMHVKESRHDGLSEQWINLMCVWRESPVYDARERALLGWVDAVTKIAETGAP
FT                   DADFEVLKQHFSEEEIVKITVAIGTINVWNRLAVGFRSQHPIDAASKAA"
FT   gene            complement(656400..656900)
FT                   /locus_tag="Arad_0802"
FT   CDS_pept        complement(656400..656900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0802"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0802"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25412"
FT                   /db_xref="GOA:B9J910"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J910"
FT                   /protein_id="ACM25412.1"
FT                   /translation="MKLGEGVEQAIHSVAVLAGLSEGSVLSAAAIAEFHGVSVSYLLKH
FT                   LQALSGAGILDTVPGPKGGYRLARLPKDISLLDIVLAVEGPAPAFRCAEIRQRGPNSLP
FT                   GKYFTKPCGISAAMLAAERVYRAELAKTAIADILADLAESDDGSIAARGCAFLALNERR
FT                   TNR"
FT   gene            656998..659508
FT                   /gene="lhr"
FT                   /locus_tag="Arad_0803"
FT   CDS_pept        656998..659508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lhr"
FT                   /locus_tag="Arad_0803"
FT                   /product="ATP-dependent RNA/DNA helicase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0803"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25413"
FT                   /db_xref="GOA:B9J911"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR026362"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9J911"
FT                   /protein_id="ACM25413.1"
FT                   /translation="MDQIDSESHLALPAPFIRWFAEKGWQPRAHQLELLARAEAGESTL
FT                   LIAPTGAGKTLAGFLPSLTDLTRRGKIPPGSAFTGIHTLYISPLKALAVDIERNLMKPV
FT                   TEMGLPVSVENRTGDTPSGKRQRQKLNPPDILLTTPEQVALLLANREAERFFKDLKYIV
FT                   LDELHSLVTSKRGHMLSLGLARIRELAPRVQTIGLSATVAEPMDLQKWLVAQEEGAERH
FT                   AGLVMVEGGAKPDISILATDERIPWSGHSAKYAIPDIYRELKEHRTTLLFVNTRSQAEM
FT                   LFQELWSANDDNLPIALHHGSLDVGQRRKVEAAMAANRLRAVVATSTLDLGIDWGDVDL
FT                   VIHVGAPKGASRLAQRIGRANHRMDEPSKAILVPANRFEVMECQAALDANYVGAQDTPP
FT                   VGAGALDVLAQHILGMACAEPFDMLELYDEVRSASPYADLSWETFERIVDFVATGGYAL
FT                   RTYERYARIRKTPEGRWRVSNPQVAQQYRLNLGTIVEEAMLNIRMVKRNALGSLGRGGA
FT                   SLGKVEEYFLEQLSPGDTFLFSGKVLRFEGIRENECLASQAFSMDPKIPSYAGGKFPLS
FT                   TYLADQVRSMIADPDRWRRLPDQVRDWLEIQKDKSMLPKRDELLIETFPRGSRAYMVAY
FT                   PFEGRLAHQTLGMLLTRRLERAGAKPMGFVATDYSLGIWGLEDLGVMIANGHLSLSDLF
FT                   DEDMLGDDLEAWLDESFLLKRTFRNCAVIAGLIERRHPGKEKTGRQVTVSADLIYDVLR
FT                   SHEPDHILMQATRQDAATGLLDIGRLGDMLKRIKGHITHRALDHISPLAVPVMLEIGKV
FT                   PVPGEAHDVLLAEAADDLIREAME"
FT   gene            659580..660308
FT                   /locus_tag="Arad_0804"
FT   CDS_pept        659580..660308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0804"
FT                   /product="phosphoesterase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0804"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25414"
FT                   /db_xref="GOA:B9J912"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR024173"
FT                   /db_xref="InterPro:IPR026336"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B9J912"
FT                   /protein_id="ACM25414.1"
FT                   /translation="MMNRLALAREMNGLTPASGVETIVHGVAAVCDPLGALYLPDAGIL
FT                   VVSDLHLEKGAAFARRGMLLPPYDTLATLTVLAAVISRYDPKLVVSLGDNFHDRVGSAH
FT                   LPEAFRSLIVTMARGREWIWINGNHDPDGTVDLPGRSVDEMHYGGLTFRHEPKLGRQAG
FT                   EIAGHLHPSATVRRREKSVRRPCFATDGARLLMPAFGIMTGGLDLRHKAMTGLFDRENL
FT                   IAHLLGRDRIYSVRFGNLSA"
FT   gene            complement(660305..660865)
FT                   /locus_tag="Arad_0805"
FT   CDS_pept        complement(660305..660865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0805"
FT                   /product="pyrimidine reductase protein (dihydrofolate
FT                   reductase family)"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0805"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25415"
FT                   /db_xref="GOA:B9J913"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:B9J913"
FT                   /protein_id="ACM25415.1"
FT                   /translation="MRKLVVWNLMTLDGYFEGTKPWDLDFHMLAWGDELERYATDLGRE
FT                   GDLLIFGRKTYEGMAAYWQTATETPDIAAYMNGIAKIAASRTMGKAEWNNTRVVSDIAA
FT                   EVKKLKEEPGKIMFVFGSAEVTDVLLKAGLVDEIRICLVPVVLGAGNPHFKPAGEQRPM
FT                   KLIDSRPLKTGAVILRYEPVKTA"
FT   gene            660978..661481
FT                   /locus_tag="Arad_0806"
FT   CDS_pept        660978..661481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0806"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0806"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25416"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J914"
FT                   /protein_id="ACM25416.1"
FT                   /translation="MDAPHRSGCPINLTLEILGDRWSLIIIRDIMFGNRRHFRELLQNS
FT                   QEGIASNILADRLKRLVERGLLTRDDDPTHKQKAIYSLTEMAIELVPLFAHMGAWGRKH
FT                   LPVSEELSIRAELLEDGGPALWEDFMEELRARHLGKVLPPGTPSVLGRLTEAYLEVVAR
FT                   KKSA"
FT   gene            complement(661482..662291)
FT                   /locus_tag="Arad_0807"
FT   CDS_pept        complement(661482..662291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0807"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0807"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25417"
FT                   /db_xref="GOA:B9J915"
FT                   /db_xref="InterPro:IPR019088"
FT                   /db_xref="UniProtKB/TrEMBL:B9J915"
FT                   /protein_id="ACM25417.1"
FT                   /translation="MRRYSLILAASLLLAPFSAKAQVLLDQPTTSTTVRETMEIGTSTS
FT                   EIAITSDFTGADLTIFGALSNTDQLLLAIGQYDIVVVLEGPRENATVRKKERVFGIWIN
FT                   TRSMTFEHVPQAYSLSSTRAVDNITAPLELNDRGIGTDHIPLIPVGFVGSGADVPEFRQ
FT                   AFRRLQQSGGLYESDPAGVRFVSSSLFKATLRLPANVPNGVHTVRAYLFKSGKFIGEKA
FT                   LPLRVIKTGIEQTITDAAHGQPIAYGMFSVLLAVITGWTASFVFRKR"
FT   gene            complement(662288..663214)
FT                   /locus_tag="Arad_0808"
FT   CDS_pept        complement(662288..663214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0808"
FT                   /product="permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0808"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25418"
FT                   /db_xref="GOA:B9J916"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B9J916"
FT                   /protein_id="ACM25418.1"
FT                   /translation="MTIYLPIAELSVNIFIILGMGAAVGFLSGMFGVGGGFLITPLLIF
FT                   YNIPPVVAVATGANQVVASSISGAITHFRRGTLDMKLGSVLLIGGLSGATVGIWIFSLL
FT                   RRIGQLDLFISLLYVVFLGTIGGLMLWESLNAMRRAARNEPAAPRRPGHHSWVHRLPLK
FT                   MRFKKSKIYLSVIPVIALGFGIGILTSVMGVGGGFIMVPAMIYLLRIPTNVVVGTSLFQ
FT                   IIFVTAYTTIVQAATNYSVDIVLAFLLMVAGVIGAQYGVRVGQKLRGEQLRALLGLLVL
FT                   AVGLRLLIALVVTPADIYSVVLEGSGR"
FT   gene            663507..663893
FT                   /locus_tag="Arad_0810"
FT   CDS_pept        663507..663893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0810"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25419"
FT                   /db_xref="UniProtKB/TrEMBL:B9J917"
FT                   /protein_id="ACM25419.1"
FT                   /translation="MRKLAISILVAGISVASIAVAQADRSVMIAKQYGVATGLAANCPN
FT                   LTLNESKVDAFLDAEGIHRVDRVEGSPFYETVSEAIKSADDMIRQSAAGKKNDSKGKQV
FT                   FACKTLLEVVHRNDSVLKGFLDPK"
FT   gene            complement(663906..667583)
FT                   /locus_tag="Arad_0812"
FT   CDS_pept        complement(663906..667583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0812"
FT                   /product="hemagglutinin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0812"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25420"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:B9J918"
FT                   /protein_id="ACM25420.1"
FT                   /translation="MSGSRSNPTGTGDWTSLDALSRTIEGLEARIEGLMGTAAAQDTRQ
FT                   RVAGGYGAVPERRVMPERTPLPERAPRTEREAYASRPYERPLRTERAETELRSDPLAEI
FT                   RQRQRMLEASRERMHPRREDSAVAEQPLGRRVADHHAPRPPLPSALRPTAESSVDIAQA
FT                   LVNLRQDLKRDIAESVTREVSALRAEIRDIRDNTEDKHFAADVREDMARLADSISQLAV
FT                   HPGKPETTGLKAEFDELRSLMDGLAREESLHHVERQVQAIDTAGLQDEVVSLAYRLDDI
FT                   KQHLGSMSDSPTVRALENKLLTIATAMESLGGMMKPQDQAMQRLEGRISGIADQIDTMS
FT                   RDTTRQQPSDDLSNRLEALAMRIDDLGNSKTVARLEERLDQLSQLMERSQRAVPQPELI
FT                   NYLADISRKIDALDHGSVDHVLAERLDYLARRIDEMESHPVQSVAGLDDGAVRQLEGRL
FT                   SDIAARLEVSTAAPPTDTLALRHLEEQIAHLSTLLMSEPRPGADHMPVDFDRRMSAIEE
FT                   YMTTNDEYVIEAARHAAEAVVEAYSREGNFGNGAHASDMSAMTALAEDLRHLEDLSRSS
FT                   DERTHRTFEALHDTLLQIADRLDHMEHRRPAAAMPAASFESDVFAEAEAPPIKPPLAAP
FT                   QQAGPIIRTIAPAEPQPSGEVAVTQAIDAATKAEIKAAAKKDGVKPGLLASLGKRFFTP
FT                   EKAEPIFTPDRPVIEPAPSIDPIDMMPAEEANELIEPGSGAPDIKKILERVRASQNAAR
FT                   SGNAKQPSENERADYIAAARRAAQAAAMEVDQTQRSAPAAKSDDKKRGAFSRFRRPILL
FT                   AVGAALLAIMAFPLVNTLTRGQKAPTEISVHTSATDAAQTPTSNAQATASAPASQAPAT
FT                   QASTDSTAGTAQPSPAVAPTSDHLTTAAPLDGNQTSEALMPAGSTAPVQQTTAFAPTDA
FT                   AATTTPASAAITVPDGMQPPTLVAAAKSGDPVALFEIGARYTDGRGVTADLKQAASWYQ
FT                   LAADKGYAPAQYRLASMYEKGNGLDRDLAKAKSYYEQAANQGNASAMHNLAVLDASGTA
FT                   GPQDYPTAANWFIKAANLGVSDSQFNLAILYARGNGVKQDLQESYKWFAIAAKGGDKDA
FT                   AQKRDEVANAMKPDALEGARAKVDLWKVQPLDAGANGTNIPDEWTTGKGVNTASVDMKK
FT                   AIRNIQAILNNNGFDAGAPDGSMGEKTVAALKSFQKSVGLPQDGKVTDKLVKELLARNN
FT                   "
FT   gene            668063..669859
FT                   /gene="acd1"
FT                   /locus_tag="Arad_0813"
FT   CDS_pept        668063..669859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acd1"
FT                   /locus_tag="Arad_0813"
FT                   /product="acyl-CoA dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0813"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25421"
FT                   /db_xref="GOA:B9J919"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B9J919"
FT                   /protein_id="ACM25421.1"
FT                   /translation="MPVYKAPVTDTLFVLNDVLGLERYNNLPGFAEASPDMIEAIVGEA
FT                   AKLAEEVLFPLNYSGDQEGCVRHDDATVSTPKGFKQGYQAYCEGGWIGLAVPEEFGGQG
FT                   LPYTLHAAVGEYTSAANMSLMMYPGLTQGAIAAILVHGSDEQKRTYLPKMVEGTWSGTM
FT                   NLTEPHCGTDLGLLRTKAVPQGDGSYKISGQKIFISAGEHDMTDNIVHLVLARIEGAPE
FT                   GTKGISLFIVPKFMVKEDGSLGARNPVSCGAIEHKMGIHGNATCVMNYDEATGFLIGAE
FT                   NRGLNAMFVMMNEARLGVGLQGLSIAEIAYQNAAAYARDRIQGRSLSGPKAPDKKADPI
FT                   IVHPDIRRTLMTIRAFNEAGRAFLLWTALKSDIAHRSQDEKERQAADDILGLATPILKG
FT                   VLTDKGFDHAVMAQQVFGGHGYIEEHGMSQYVRDARITMIYEGANGIQALDLVGRKLAL
FT                   NGGRAVMALFKEIGDFCEENRNDEQLGFFTKHLKKGLNDAQAATMWFMQNAMAKPDNAG
FT                   AGSTDYMHLFGLVVLGYMWAKMAKAAQDGLANGDTAREDYLKNKLVTARFYMERIMPET
FT                   ALRKVRIEAGADTMMELAAEAF"
FT   gene            669895..671103
FT                   /gene="fadA"
FT                   /locus_tag="Arad_0815"
FT   CDS_pept        669895..671103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadA"
FT                   /locus_tag="Arad_0815"
FT                   /product="acyl-CoA thiolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0815"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25422"
FT                   /db_xref="GOA:B9J920"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B9J920"
FT                   /protein_id="ACM25422.1"
FT                   /translation="MTEVFIYDHVRTPRGRGKKDGSLHEVPSVRLAAKTLEAIRDRNGL
FT                   DTGTVDDIIMGCVDPVLDAGAVIPKAAAFEAGYSTTAPGMQISRFCASGLDAVNFGAAK
FT                   IAQGADDIVIAGGVESMSRVGLGMSGGAWFMDPSVNFPAYFMPQGVSADLIATKYGFSR
FT                   DDVDAYAVESQKRAANAWEKGYFKNSVVPVKDINGLTILDRDEHMRPGTDMQALASLNP
FT                   SFQMPGEMGGFEAVGIQAHPEIERINYVHHAGNSSGIVDGAAAVLLGSKAGGESMGLKP
FT                   RGRIKAFANIGSDPALMLTGPVDVTEKLLKRTGMSLADIDLFELNEAFAAVVLRYMQAF
FT                   DISHDKINVNGGAIAMGHPLGATGAMILGTVLDELERRDLNVALVTLCIGAGMGTATIV
FT                   ERV"
FT   gene            671118..673328
FT                   /gene="fadB2"
FT                   /locus_tag="Arad_0816"
FT   CDS_pept        671118..673328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadB2"
FT                   /locus_tag="Arad_0816"
FT                   /product="enoyl-CoA hydratase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0816"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25423"
FT                   /db_xref="GOA:B9J921"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9J921"
FT                   /protein_id="ACM25423.1"
FT                   /translation="MAYTNFTIETDADGIALVTWDMPGKSMNVFTSEVMDELNAIIDAT
FT                   VADAAVKGVVFTSSKSSFSGGADLSMIKSMFSFYQDEKAKEPAGAAQKLFDLVGRMTGL
FT                   FRKLETCGKPWVSAINGTCMGGAFELSLACHGRVASSAKSVKIALPEVKVGIFPGAGGT
FT                   QRVSRLTDAQSALQMMTTGQSLTAVRAKAMNLVHQVVEPDQLIPAAKQMIKDGLKPVAP
FT                   WDEKGFKAPGGGIWTPASAQLWPAAPAILRRETSGNYPAALAILKCVYEGLQVPFDTGL
FT                   KIEQRYFTQVLQTTEAYSMIRSLFISMQELGKGARRPAGQLKTVLKKVGVVGAGFMGAS
FT                   IAYVTAAAGLSVTLIDRDLEAAGKGKSVGEGLVKDAVGKGRMTQEDGAALLSRITPSAT
FT                   YADLSDADLVIEAVFEDREVKKAVIEAVEAVLPEGAIFASNTSTLPISGLAKNSKRPAD
FT                   FIGVHFFSPVEKMMLTEVILGKETGDRALAVALDYVAAIKKTPIVVNDTRGFFVNRCVF
FT                   RYIHEAYDMLIEGVPATMIENAAKMAGMPVGPLALNDEVAIDLSLKILKATVADLGEKA
FT                   VDPRHMQLISRLVEGEGRLGRKNSKGFYDYPPKPAKKSLWLGLKDLYPQKKADEIDVAV
FT                   LKQRFLATIALEAARTMEEGIVTDPREADVGSILGFGFAPYTGGALSYIDGMGVKAFVS
FT                   LCETLAKTYGPHFAPTALLKDMAAKGETFYGRFDPYSVKAAA"
FT   gene            complement(673446..674657)
FT                   /locus_tag="Arad_0817"
FT   CDS_pept        complement(673446..674657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0817"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0817"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25424"
FT                   /db_xref="GOA:B9J922"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9J922"
FT                   /protein_id="ACM25424.1"
FT                   /translation="MTPIESTANSQTPLGRRLAPLFYAATSATFFAASSAPTPLYRIYQ
FT                   QAFAFSPVLITVIFAVYAFALLVSLLIVGSISDHLGRRPVIFVSLLLNMVAMALFLMAD
FT                   GPNWLIAARIVQGFATGAAASSIGAALVDLDPTKGSVTNSIAPLTGMAIGALGTSALVQ
FT                   YAPAPMFLVYAVTLVLLVAQAILIWAIPETTRRRAGLLASLKPEVTVPPQARRTLLALT
FT                   PINIAVWALAGFYLSLVPSLVSTTTGSTAPLVGGSVVAALTVSAATTVFLLRKKIAATT
FT                   LTFGISTMTLGILTIVAGVHIAQVPILIAGTLIAGAGLGTNFLAAVRSIMPLAKPDERA
FT                   GLLSAYYIQSYLSFSLPAILAGFLSKAVGYTETTDIYAVAILLLVGSGVLALRAGRKKM
FT                   VASV"
FT   gene            674798..675364
FT                   /locus_tag="Arad_0818"
FT   CDS_pept        674798..675364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0818"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0818"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25425"
FT                   /db_xref="GOA:B9J923"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B9J923"
FT                   /protein_id="ACM25425.1"
FT                   /translation="MGSKDNPRPGGRSARVQAAVHQAVRDMLAVMDRAEVTIPLIAQRA
FT                   NVTPSTIYRRWGDLQELLADVAASRLQPEMEPAETGSVYEDLQAWVEQYADEMSSGAGR
FT                   EMTRDILSVPDTANAEKCSGYTQQQLRVLIARAQARGEPFPTLTELMDYVISPIMYRIL
FT                   FEQPPNAECVRRLISRVISTAAAKS"
FT   gene            675615..676040
FT                   /gene="mscL"
FT                   /locus_tag="Arad_0821"
FT   CDS_pept        675615..676040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscL"
FT                   /locus_tag="Arad_0821"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0821"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25426"
FT                   /db_xref="GOA:B9J924"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J924"
FT                   /protein_id="ACM25426.1"
FT                   /translation="MLNEFKAFIAKGNVMDLAVGVIIGGAFGGIVKSLVDDIIMPIVGA
FT                   IFGGFDFSNYFLGLSSAVNAPTLAGARAQGAVLAYGSFITVLINFLILAWIIFLMVKGV
FT                   NTLRAQVERKDNKVAEAAPPPADVQLLTEIRDLLAKR"
FT   gene            676188..677354
FT                   /gene="aspB1"
FT                   /locus_tag="Arad_0823"
FT   CDS_pept        676188..677354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspB1"
FT                   /locus_tag="Arad_0823"
FT                   /product="aspartate transaminase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0823"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25427"
FT                   /db_xref="GOA:B9J925"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9J925"
FT                   /protein_id="ACM25427.1"
FT                   /translation="MSILNSLSPRALAAPESGIVEVVNYARGRDGLLPLWVGEGDLPTP
FT                   DFINRAAMASLNAGETFYTWQRGIPELRQALSAYYARHFDVSLPMENFYVTGSGMQAIQ
FT                   LSVQAITSPGDEMIYFSPAWPNIAAALEIAGARSVGVPLQFENGKWTLDLERLKAAITP
FT                   RTKGLFINTPSNPTGWTATHKDLSDILALAREHGLWIMADEIYALYYYAGGRAPSFLDI
FT                   KEADDKILFVNSFSKNWSMTGWRVGWIVAPAEIGQVMENLVQYSTSGVAQFMQKGAVAA
FT                   LNEGDDFVRSNIAKATRSRDILCDALLATNRVQTLKPDGALYAFLKIDGVTDSRKAAID
FT                   IVDKTGVGLAPGTAFGQGGELFLRACFLRDPAQVEDAAERLSRYVLSL"
FT   gene            677580..678614
FT                   /gene="galE"
FT                   /locus_tag="Arad_0826"
FT   CDS_pept        677580..678614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="Arad_0826"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0826"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25428"
FT                   /db_xref="GOA:B9J926"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9J926"
FT                   /protein_id="ACM25428.1"
FT                   /translation="MTVLVTGGAGYIGSHMVWRLLDAGEDVVVVDRLSTGFRWAVPSAA
FT                   RFYLGDAADETLLQTIFAENDIDAIIHFAGSSVVPASIEDPLGYYENNTGKTRTLMSAA
FT                   IRAGIRHFVFSSTAAVYGSQPADRPVKESAPLLPETPYGQSKLMSELMLRDAATAYDFR
FT                   YVALRYFNVAGADPQGRAGQSTDGATHLVKVACEAALGRRRQVEIYGTDYPTHDGTGVR
FT                   DYIHVSDLVDAHLMALRHLRDGGRPLVANCGYGVGYSVLDVLNMVMRVHGRAFRIHMAP
FT                   RRPGDTASVVADATLAHRELGWTPKYNCMETIVRSSLEWELQLADRSGFDASGLRKVFA
FT                   APSL"
FT   gene            complement(678625..679542)
FT                   /locus_tag="Arad_0827"
FT   CDS_pept        complement(678625..679542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0827"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0827"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25429"
FT                   /db_xref="GOA:B9J927"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J927"
FT                   /protein_id="ACM25429.1"
FT                   /translation="MKSAPHFTWDDLQFFLAVARTGQLSTAARQLRSSHATVSRRIDRL
FT                   EFALKVKLFERNPRGYVLTGMGQRFIDTAERMEQETERLRADLTVGSAAQRGVVRISAP
FT                   EGISNFFFTTMLPEFTARYPNISLELVTIQQIMSLSRKEADIVVVLDPPKAGPYFTEKL
FT                   TDYHLQVYGSRDYLANHPPVESRNDLPDHAFVGYIEDMIFAPGLDYLGDIHPRIKPQFQ
FT                   SSSIFAQLTATKNGLGLCVLPYFIACRHPDLQMVLPDDVDLKRHYWITCHRDLRQSPRV
FT                   RTVIDFLMEAVHRNAPAFLGHGSA"
FT   gene            679714..680922
FT                   /locus_tag="Arad_0828"
FT   CDS_pept        679714..680922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0828"
FT                   /product="branched-chain amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0828"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25430"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9J928"
FT                   /protein_id="ACM25430.1"
FT                   /translation="MRKSLIASLALLLASGTAAFAAGASDGVVKIGILNDQSGVYADFG
FT                   GKSSVEAAKMAAEDFGGKVLGVPIEIINADHQNKPDIASNIARQWYDQDKVDAIMELTT
FT                   SSVALAVQAVAKEKKKIDIVTGAATTDLTGKQCSPYGFHWAYDTHALAVGTGGALVKQG
FT                   GDTWFFLTADYAFGYSLEQQTGDYVKASGGKILGSVRHPLSTNDFSSFLLQAQSSGAKV
FT                   IGLANAGLDTANAIKQASEFGITQGGQHLAALLFTLAEVHGLGLQAAQGLTLTEGYYWN
FT                   LDDKSREFGKRFFARTGKMPNMIHAGTYSAVLQYLKAVQKAGTDDTEAVAKELHEMPVD
FT                   DVFGRGGTVGANGRMIHDMYLLQVKKPEESKEPWDYYNVLATIPGKEAYIDPAKSGCDL
FT                   VKP"
FT   gene            680939..681721
FT                   /locus_tag="Arad_0830"
FT   CDS_pept        680939..681721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0830"
FT                   /product="branched-chain amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0830"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25431"
FT                   /db_xref="GOA:B9J929"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:B9J929"
FT                   /protein_id="ACM25431.1"
FT                   /translation="MAIPATKQQEVPRVVLSARGLRRDFGGFTAVKNVDLDVHDASVHA
FT                   LIGPNGAGKTTVFNLLTKFLQPTHGTITLLGTDITRTKPDKVARMGLVRSFQISAVFPH
FT                   LTVLDNVRVALQRSNNLAHQFWLPVSALASLDDRAEQLLAAVGLTKERDAVAADLSYGR
FT                   KRVLEIATTLALDPKVLLLDEPMAGMGLEDVNTVSAIIREVARTRAVLMVEHNLSVVAN
FT                   ICHHVTVLQRGEILAAGDYATVSQDPRVREAYMGTEED"
FT   gene            681724..682425
FT                   /locus_tag="Arad_0832"
FT   CDS_pept        681724..682425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0832"
FT                   /product="branched-chain amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0832"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25432"
FT                   /db_xref="GOA:B9J930"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9J930"
FT                   /protein_id="ACM25432.1"
FT                   /translation="MAALLEVQGLNAWYGESHILHGVDMNVAEGETITILGRNGVGKTT
FT                   TLRTIVGIVRARKGRIAFAGADMMQVPLHKTAHKGIGFVPEERGIFSTLTVHENLMLPP
FT                   VVAAGGMTVDEIFELFPNLHERRNSPGTKLSGGEQQMLAMARILRTGVRMLLLDEPTEG
FT                   LAPVIVQRIGEVLRKLRERGMTILLVEQNFRFASRIADRFYLMDHGQMVAEFPVGELPE
FT                   RMGMLHKVLGV"
FT   gene            682430..683317
FT                   /locus_tag="Arad_0833"
FT   CDS_pept        682430..683317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0833"
FT                   /product="branched-chain amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0833"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25433"
FT                   /db_xref="GOA:B9J931"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9J931"
FT                   /protein_id="ACM25433.1"
FT                   /translation="MTTIFGIPLQALLGQLLIGLINGSFYALLSLGLAIIFGMLRVINF
FT                   AHGAFYMLGAFTAYLLLAYAGIGYWPVLVLAPLIVGLFGAVVERLCLRQLYTIDPLYGL
FT                   LFTFGMALTIEGTFRYLYGSSGQPYAVPSALAGAKNIGFMFLPVYRGWVVVASLVVCIG
FT                   TWLLIEKTKLGAYLRAATENSVLVQVFGVNVPVLLTLTYGFGVALAAFAGVLAAPIYQV
FT                   SPLMGSNMIIIVFAVVVVGGMGSIMGAIVTGYMLGVAEGLTKVFYPEASNIVIFVIMAI
FT                   VLLLRPAGLFGRDV"
FT   gene            683314..684303
FT                   /locus_tag="Arad_0834"
FT   CDS_pept        683314..684303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0834"
FT                   /product="branched-chain amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0834"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25434"
FT                   /db_xref="GOA:B9J932"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9J932"
FT                   /protein_id="ACM25434.1"
FT                   /translation="MTMTDITSPKSSTRPALTVQKLLLVAGLVVLIWVPFFIYPIFVMK
FT                   VLCFALFACAFNLLLGYTGLLSFGHATFFGGAAYFTAHAVKEWGLPPELGILIGVGGAA
FT                   LLGLIMGFVAIRRQGIYFSMITLALSYMFYFFCLQAEFTKGEDGIQSVPRGYLLGILDL
FT                   NNAFNMYYFVLAVFIISVLIIWRFINSPFGMILKSIRENEQRAISLGYSVARYKLGAFV
FT                   MSAALAGLAGAVKALVFQFATLTDVAWQMSGEVILMTLLGGIGTLIGPLFGAGLVATLE
FT                   NYLATSDFPVTIITGIVFMVCVLLFRRGIIGEFYASRLGRKLGFEYRR"
FT   gene            684315..685910
FT                   /locus_tag="Arad_0835"
FT   CDS_pept        684315..685910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0835"
FT                   /product="alcohol dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0835"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25435"
FT                   /db_xref="GOA:B9J933"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9J933"
FT                   /protein_id="ACM25435.1"
FT                   /translation="MDRFDYIIIGAGSAGCVLANRLSADRNTRVLLLEAGGNDNYHWIH
FT                   IPVGYLYCINNPRTDWCFTTTPEEGLNGRALNYPRGKVLGGCSSINGMIYMRGQARDYD
FT                   LWRQLGCAGWGWDDVLPYFVKSEDHHRGKDEMHGAGGEWRVEKARVRWAVLDAFQAAAR
FT                   EAGIPETADFNRGDNEGSGYFDVNQRSGIRWNTSKAFLRPALKQGNLSVLTKAQVRRLI
FT                   IEGDAVTGVEFQHDGVAKRAYATRETVLSAGSIGSPQILELSGIGRGEVLSEAGIEVVR
FT                   EVKAVGENLQDHLQLRMAYKVTGVPTLNEKATSMFGKAAIGLEYLVRRSGPMAMAPSQL
FT                   GIFTRSGPDKETPDLQYHVQPVSLDKFGDPVHPFPAITASVCNLRPESRGSVHIRSPDF
FT                   AMQPAISPNYLSASRDREIAVRSIRLTRRIVAQPSFARFRPEEFKPGPSYQTDADLDRA
FT                   AGDIGTTIFHPVGTCRMGGDPLSVVDPRLRFRALARLRIADASVMPSITSGNTNSPTIM
FT                   IAEKAAEMILADNR"
FT   gene            685950..687008
FT                   /locus_tag="Arad_0836"
FT   CDS_pept        685950..687008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0836"
FT                   /product="enoyl-CoA hydratase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0836"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25436"
FT                   /db_xref="GOA:B9J934"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR032259"
FT                   /db_xref="UniProtKB/TrEMBL:B9J934"
FT                   /protein_id="ACM25436.1"
FT                   /translation="MDSTDEVIIERRGSAGLIRLNRPQALNSLTLPMIRAIATALDDFA
FT                   ADPSIASVIIKGEGERAFCAGGDIRLLHQSGKEKSDGAETFWREEFRLNHAIAHYPKPY
FT                   VALMDGITMGGGVGLSAHGSHRVVTERTRLAMPETGIGYFPDVGATWLLSHMPGETGTW
FT                   MGLTGLAINAADAIHAELADHSIASSDLLVLIETIAALPSAALPTDVHRAIAGLALDAG
FT                   ESRLAANRDAIDRALAHDTVEDILQGLAREPGDFAAETAEAIRTRSPTSLKLTLRLLRA
FT                   GRASASLAECLNRELGACLGILYNPDFYEGVRAAVIDKDRNPKWLPASLADVDAAAIER
FT                   FFVPAQPPLFAA"
FT   gene            687031..687912
FT                   /gene="mmsB"
FT                   /locus_tag="Arad_0837"
FT   CDS_pept        687031..687912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmsB"
FT                   /locus_tag="Arad_0837"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0837"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25437"
FT                   /db_xref="GOA:B9J935"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011548"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9J935"
FT                   /protein_id="ACM25437.1"
FT                   /translation="MTRIAFIGLGNMGGPMAANLVKAGHAVIGFDLSHDMLKAAEATGV
FT                   KAASVLTEALADAEAVITMLPKGQHVLTVWTDILRSVPKGTLLIDSSTIDVDSARKAHA
FT                   MAGDVGCLSLDAPVSGGTGGAAAGTLTFMAGGSSESFAAAKPLLEVMGKKIVHCGDAGA
FT                   GQAAKICNNMILGISMIGVCEAFVLGEKLGLSHQALFDVASTSSGQCWSINTYCPVPGP
FT                   VPTSPANNDYKPGFAAALMLKDLRLSQEAALSSGASTPLGAEAAQLFALFEKQGNGGRD
FT                   FSAIIEMFRELN"
FT   gene            complement(687915..689984)
FT                   /gene="uvrD1"
FT                   /locus_tag="Arad_0838"
FT   CDS_pept        complement(687915..689984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrD1"
FT                   /locus_tag="Arad_0838"
FT                   /product="ATP-dependent DNA helicase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0838"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25438"
FT                   /db_xref="GOA:B9J936"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:B9J936"
FT                   /protein_id="ACM25438.1"
FT                   /translation="MSAAYLEKLNPEQRLAVEHGTTVEGSHIAGPLLVIAGAGSGKTNT
FT                   LAHRVAHLIVKGADPRRILLMTFSRRAAAEMGRRVERICREVLGANAGIMADALAWTGT
FT                   FHGIGARLLRDYAEQIGLDPAFTIHDREDSADLMNLIRHDLGFSKLESRFPTKGTCLAI
FT                   YSRAVNSEAPLEEMLRDFFPWCATWDKQLRDLFAAYVEAKQAQNVLDYDDLLLYWAHML
FT                   HEPLIAEDIGGRFDHVLVDEYQDTNRLQSSILLALKPDGQGLTVVGDDAQSIYSFRAAT
FT                   VRNILDFPTAFTPSANIVTLDRNYRSTQPILAAANAVIDLASERFTKNLRTERQSAERP
FT                   RLVTVRDEADQARYIADQVLENRESGAKLKQQAVLFRTSSHSGPLEIELTRRNIPFVKF
FT                   GGLKFLDSAHVKDMLAALRFAQNPRDRVAGFRLMQLLPGVGPSTAQRVLDHIGEEASPM
FT                   AALAEFPAPPRSGEDWTGFVATMQELKSGKAGWPAEIGLVRQWYEPHLERAHEDASTRL
FT                   ADLIQLEQIAGGYGSRERFLTELTLDPPDATSDQAGVPLLDEDYLILSTIHSAKGQEWT
FT                   KVFLLNVVDGCIPADLAVGSSAEIEEERRLLYVAMTRAKDGLDLVIPQRFFTHGQHAQG
FT                   DRHIFASRTRFIPVTLLQFFEVCGWPQARSDSPAAIQARQARVDVGARMRGMWR"
FT   gene            690248..691120
FT                   /locus_tag="Arad_0839"
FT   CDS_pept        690248..691120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0839"
FT                   /product="calcium-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0839"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25439"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:B9J937"
FT                   /protein_id="ACM25439.1"
FT                   /translation="MNETIATGLRQPGGPVGLPDGRVALVEMGDSRRCLSVIAANGTRH
FT                   EVCRPGGLPSGLAVDGNNCFWVAGGPENSLVRLSPEGRTLQVIEGGSDGPFLYPNDLAF
FT                   GPDGLLYMTDSGVRASDLHEGSDINPDFFRAPYNGRVYQIDPGEGRVLRVLATGLLHAS
FT                   GIAFGSDGRLYYSETLTGKIHRQVVGARQELFAQVIPTPAVTALRGPAGMAFDRDGVLY
FT                   CALYGLGEVCLIDPAGKITGRIRTNGMRPGNIAFTPDGKYVLISEQENGALERIVAPRP
FT                   GLPLHMPSI"
FT   gene            complement(691193..693751)
FT                   /gene="secD"
FT                   /locus_tag="Arad_0841"
FT   CDS_pept        complement(691193..693751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="Arad_0841"
FT                   /product="protein-export membrane protein SecD"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0841"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25440"
FT                   /db_xref="GOA:B9J938"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:B9J938"
FT                   /protein_id="ACM25440.1"
FT                   /translation="MRTSRWLVALYSVIIVLGFLVALPNVLPQSTLSKIPNWLPHSQVP
FT                   LGLDLRGGSYLVLEVDEKDLTNGRLQSLQQDSRRVLRDKNILTRSIVRNGDQIVVTLTD
FT                   PTQSGDAVTQLQTLANTITSGLSAGQSDLTIAPNAGAITMSFSKAGIASNVDSAVQQSL
FT                   EVIRKRVDQVGVAEPTIQRVGPNRVLVQLPGAQDPSRLRELLGSTAKMSFHLLADNVDP
FT                   NNPGPGVTILKDEQGQSYPVLDRIELSGDRLTDARVSFDPNTHEPLVTFRFDSAGANRF
FT                   AEITRENVGKPFAIVLDNKVLSAPNIREPITGGSGQISGNFTADSATTLAALLRAGALP
FT                   AKLTVIEERTVGADLGADAIQKGIYSGLVGFVLVAAFIFVLYGAWGILANVALLIHTIL
FT                   TFSALTLVGATLTLPGIAGIVLGIGLAVDANVLINERIREETRKGRGAFAAIDNGFRKA
FT                   YSTIIDGNMTALIAAAILFYFGSGPVRGFAVTMGLGLIISMFTSVAFVRVVMIAITRRR
FT                   KLKVLNIRPLIPFSPYDKHIHFMKARFFGVTVSAILSIASVVLFIHPGLNYGVDFRGGI
FT                   QMSVKTKDAADLSTFREGLNTLGLGEISLQSFGDNNSILVRAQRQDGGEEAQTAAVTKL
FT                   KAEITKIDPAATIEGTDVIGPKVSGELAWAGILSVVIASLAMLVYIWVRFEWPFAVGAI
FT                   VTLVLDVTKAIGFFAITGLDFNLTAIAAILTLVGYSVNDKVVVYDRMRENMRLYKSMPL
FT                   RDIIDKSINETLARSLYTNATAFLALVPMAIWGGSAVSSFAIPMVFGILVAGASSIFIA
FT                   APILLFLGDWRRRHAKPVANDAAPADGKSGKDNKQIPAAE"
FT   gene            complement(693845..694264)
FT                   /locus_tag="Arad_0842"
FT   CDS_pept        complement(693845..694264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0842"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0842"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25441"
FT                   /db_xref="GOA:B9J939"
FT                   /db_xref="UniProtKB/TrEMBL:B9J939"
FT                   /protein_id="ACM25441.1"
FT                   /translation="MNPFEFGAADNEENDERTHHAGTRVIASLFVAFFAYLGLALGGGI
FT                   NLAARADAEAFSSGRDSQPLYIAQRDPLRGMVVADRSALPKATWHDIGPITLAAIPSFG
FT                   RLIDPWQPRDRGDVTRPEIFTFRAYLARAPPASFV"
FT   gene            complement(694280..696133)
FT                   /locus_tag="Arad_0843"
FT   CDS_pept        complement(694280..696133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0843"
FT                   /product="potassium-efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0843"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25442"
FT                   /db_xref="GOA:B9J940"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B9J940"
FT                   /protein_id="ACM25442.1"
FT                   /translation="MPHDTPLISTIVMGLVLAFIFGAIANRFKLPPLVGYLIAGVLAGP
FT                   HTPGFVADQGLAPELAEIGVILLMFGVGLHFSLKDLLSVRGIAVPGAIVQIGFATLLGW
FT                   GLGALMGWPLGGSLVFGLALSVASTVVLLKALQERRLIETERGKIAVGWLIVEDLAMVL
FT                   ALVLIPAAASISGDGHGAVEPLSAGINRLFGLDMGLTGIIAMTLFKVAAFVGLMLVVGR
FT                   RVIPWILHRIAHTGSRELFRLGVLAIALGVAFGAAKLFGVSLALGAFFAGMILAESELS
FT                   HRAAQESLPLRDAFAVLFFVSVGMLFDPNILIENPLPLLATVFIIVIGKSAAAFFIVLA
FT                   FRKPMSTALIISASLAQIGEFSFILAALGVELGLLPSEGRDLILGGAIISIILNPLVFF
FT                   ACDWLRKRLDGKRPSEVPEVVEPAAQAEQPSASEAPAAAAEQPAPAAIDEEERTVTLTG
FT                   HAILIGYGRVGSIVGENLKSSGTPFVVIEDAEKRIAELKQAGIETIYGNAASAKTLGYA
FT                   NIAEARSLVIAIPNTFEACSAAEQARAINPSILIVARAHSDAEIDVLKQYGADTVIMGE
FT                   REIALGMVDRLAQVHHDRPHYEDAERPDIMTEPSEPAPTKE"
FT   gene            complement(696485..697981)
FT                   /locus_tag="Arad_0844"
FT   CDS_pept        complement(696485..697981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0844"
FT                   /product="glycosyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0844"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25443"
FT                   /db_xref="GOA:B9J941"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:B9J941"
FT                   /protein_id="ACM25443.1"
FT                   /translation="MSDTTNSESSHQRLSLRLALAIIFGITLWRVIMLVFNRTDLFVDE
FT                   AQYWFWGQNLDFGYYSKPPMIAWVIRFFNAISGSDSTFWIRVSAPLFHLATALMLMLTT
FT                   RRLFAGDTGEEIAPWVGVIFVTLPAASLSAVLVSTDTIQILFVTIAIWAFLGLTRRSSL
FT                   LEALILGASLGIAFLTKYSVLFLLPGVGIAMLTLRSARIAWRDVFIAAIVGAIVVFPNL
FT                   WWNFAHDAATVRHTESIARWNGGGNSGGLVQHLLGGLGFLGAQFGVVGPVIFYAMLWAV
FT                   WRLIRGKSDDREKLLIWLSVPVVAMITLQALFAKAYANWAVAAYAAGTILAVWILYRLT
FT                   KKGLVVSLIIGAVVAFLLPVLTVLAYDIKLPNGDLVMKRYVGRSAISLEVADIATKANL
FT                   PDIVSSDRDILADLFYTLKGKPYRIHARNFGGFPKSYYEQNFSLPSNTTADVLYVDDGP
FT                   LDCTAGRSELIKSWSPEFGYKKGKTIYAYRVSPACLTPAP"
FT   gene            698716..700359
FT                   /gene="mcpE"
FT                   /locus_tag="Arad_0845"
FT   CDS_pept        698716..700359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcpE"
FT                   /locus_tag="Arad_0845"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0845"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25444"
FT                   /db_xref="GOA:B9J942"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR039379"
FT                   /db_xref="UniProtKB/TrEMBL:B9J942"
FT                   /protein_id="ACM25444.1"
FT                   /translation="MAQDSPSDQAGRTQAGSLRDRLRFAGLAAEQCEIVRRNRPMLETH
FT                   LKAGLRDLFHRFQTFPDAARNFASESQLERLQDLQSSHWDVLTDARFDSLYAERVKVLS
FT                   DSESKMGLDPRWHVAGHGVVLEHILAGIVEEMGGRAVLPGTKRRARELSELVKAAVRLV
FT                   MVDVEIAVSLRFNELRLNHQRALADQRAADQAEVAGLFADVIQGLAERDLTVRMPADAP
FT                   PAYTELVEALNAALDDIQQQFTALSVGVQAAEATTNAIARDSRSLAQDSTEQSKGLATS
FT                   ARQLAELAEQIGGNATSTRSAERAAASTRVAVEDSGQVVGQAISAMADIETSAEKIGQI
FT                   IGVIDEIAFQTNLLALNAGIEAARAGDSGRGFAVVAQEVRALAQRSADAAREIKVLVTG
FT                   TKAQVDAGVRMVGRTQEAIGSIVRQVTDINDAISGIAAATDEQAAGLRSVTVEIGSLSE
FT                   RASAAGSLAGRSQEGADHLHDTILDLGRTIREFRLERERRHAVAPRSAVGAQRLPAPRR
FT                   DDVFGLRQDDDVEFDFPPRRAAAGGERNAY"
FT   gene            700422..700718
FT                   /locus_tag="Arad_0847"
FT   CDS_pept        700422..700718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0847"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0847"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25445"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B9J943"
FT                   /protein_id="ACM25445.1"
FT                   /translation="MASRKGEKTVSLAAVLDLNEASALRGKLMGLRGSNVAIDASSVER
FT                   IGALCIQVIMAAAKTWDEDKLSFTFSKVSDAFQKTLQMIGIDIDHLLAKEIRQ"
FT   gene            700715..701080
FT                   /gene="cheY1"
FT                   /locus_tag="Arad_0848"
FT   CDS_pept        700715..701080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheY1"
FT                   /locus_tag="Arad_0848"
FT                   /product="chemotaxis two-component response regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0848"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25446"
FT                   /db_xref="GOA:B9J944"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B9J944"
FT                   /protein_id="ACM25446.1"
FT                   /translation="MKKKVLTVDDSRTIRNMLLVTLNNAGFETIQAEDGIEGLEVLEEA
FT                   NPDVIVTDINMPRLDGFGFIEGVRRNDKYRAIPILVLTTESDAEKKNRARQAGATGWIV
FT                   KPFDPAKLIDAIERVTA"
FT   gene            701157..703388
FT                   /gene="cheA"
FT                   /locus_tag="Arad_0850"
FT   CDS_pept        701157..703388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheA"
FT                   /locus_tag="Arad_0850"
FT                   /product="chemotaxis two-component sensor histidine kinase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0850"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25447"
FT                   /db_xref="GOA:B9J945"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:B9J945"
FT                   /protein_id="ACM25447.1"
FT                   /translation="MESGLLKMNDGDRDPETVNAVFRAVHSIKGGAGAFGLDDLVSFAH
FT                   VFETTLDCVRSNKLEPTQDVLKVMLKAADVLADLTNVARDGGSVDPARSRGLVKELEAL
FT                   AHGELPSASAAVEAAPKQAKPVALAPAPVEVAPAATDDSGFQPIPFSFDDDFGADEAPV
FT                   AMPEYQVSFKPRADLYAKGNDATLLLRDLARIGELSVHCNMDALPGLDEIDAEGAYFAW
FT                   TISVRTDKGEDAIRTVFEFAEWDCELDVRRIEDAASKGDDELPMVPVPFDLSALDDDGA
FT                   GQAAEVVEQAPQPANDVAAAVAAAETVSNIAQLAAARVEKKEAAAAAASAAAQNNAAAA
FT                   GVGQTIRVDLDRVDRLINLVGELVINQAMLSQSVIENDNNGTSSINMGLEELQQLTREI
FT                   QDSVMAIRAQPVKPVFQRMSRIVREIADMTGKSIRLITEGENTEVDKTVIDKLAEPLTH
FT                   MIRNAVDHGVETPEKRAALGKNPEGTVRLTAKHRSGRILIELADDGAGINREKVRQKAI
FT                   DNDLIAADANLSDEEIDNLIFLPGFSTADKISDISGRGVGMDVVKRSIQALGGRINITS
FT                   KPGHGSVFTMSLPLTLAVLDGMVVTVAGQTLVVPLTAIVETLQPEAAAIHSFGANHRLI
FT                   SIRNSFCPLVDVGRILNFRATQADPVEGVALLVESEGGGQRALMVDAIQGQRQVVIKSL
FT                   EANYTHVPGIAAATILGDGRVALILDVDAVVGASRGQSLKAEISYAAVG"
FT   gene            703393..703860
FT                   /gene="cheW1"
FT                   /locus_tag="Arad_0851"
FT   CDS_pept        703393..703860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheW1"
FT                   /locus_tag="Arad_0851"
FT                   /product="chemotaxis signal transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0851"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25448"
FT                   /db_xref="GOA:B9J946"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:B9J946"
FT                   /protein_id="ACM25448.1"
FT                   /translation="MSDAIKSLTHGARELIAFRIGDQEFCVDIMSVREIRGWTPATAMP
FT                   HSPGYMLGVINLRGAVLPIVDLSARLGMGRAEPTVRHVIIVAQVKRKVVGLLVDAVSDI
FT                   LTVTDDTIQPTPEVSSDYERQFARGVLAIDRRMICLIELETLFPEHESQAA"
FT   gene            703857..704765
FT                   /gene="cheRch1"
FT                   /locus_tag="Arad_0852"
FT   CDS_pept        703857..704765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheRch1"
FT                   /locus_tag="Arad_0852"
FT                   /product="chemotaxis methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0852"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25449"
FT                   /db_xref="GOA:B9J947"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:B9J947"
FT                   /protein_id="ACM25449.1"
FT                   /translation="MSVMGAIDLRVSPDEVLASGEYPLTRRDLSEIAAMIYSDAGISLN
FT                   ETKASLVYSRLSKHIRALGLPGFRDYCQLVSSPAGAVQRREMLSHLTTNFTRFFRENHH
FT                   FDHLRDEVLPGLLARAKAGGRVRIWSAACSDGQEPYSIALTVLSLMPNAADLDFRILAT
FT                   DIDPKILGLARAGAYDEAALETVSPAMRKQWFQEVEIQGRRKFQIDDRVKRLITFNELN
FT                   LLAQWPFKGSFDVIFCRNVVIYFDEPTQTKIWSRFAGQLQDNGHLYIGHSERVAGDAKH
FT                   LFDNIGITTYRHIGKHGGRKP"
FT   gene            704762..705805
FT                   /gene="cheBch1"
FT                   /locus_tag="Arad_0853"
FT   CDS_pept        704762..705805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheBch1"
FT                   /locus_tag="Arad_0853"
FT                   /product="protein-glutamate methylesterase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0853"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25450"
FT                   /db_xref="GOA:B9J948"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:B9J948"
FT                   /protein_id="ACM25450.1"
FT                   /translation="MSAPARVLVVDDSPTMRGLITAVLRSDPEVDVIGQAGDALEARAA
FT                   IKALNPDVVTLDIEMPNMNGLDFLEKIMTLRPMPVIMVSTMTHRGAEATLAALEIGAFD
FT                   CVGKPVPGEPRPFGDLAEKVKAAARSQRQYVKPAASHAPPPAVADFRVGRKIVAIGSST
FT                   GGVEALIAVLQKFPANCPPTVITQHMPPSFTRSFAERLNRLCAPVVQEASDGARLEIGK
FT                   IYLAPGGERHLQVASSSAPHCRLVEGGPVNGHRPSVDVLFDSVAELAGRNAVGVILTGM
FT                   GRDGAAGLLKMRHAGARTIGQNEKTCVVYGMPRVAFELGAVEQQFPLNAIGEEILKVTA
FT                   ARKEGSE"
FT   gene            705805..706194
FT                   /gene="cheY2"
FT                   /locus_tag="Arad_0854"
FT   CDS_pept        705805..706194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheY2"
FT                   /locus_tag="Arad_0854"
FT                   /product="chemotaxis two-component response regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0854"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25451"
FT                   /db_xref="GOA:B9J949"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B9J949"
FT                   /protein_id="ACM25451.1"
FT                   /translation="MSLAEKIKVLIVDDQVTSRLLLSDALTQLGFKQITAAGDGEQGMK
FT                   IMQQQPHHLVISDFNMPKMDGLGLLQAVRTNPATKKAAFIILTAQGDRALVQKAAQLGA
FT                   NNVLAKPFTIEKMKAAIEAVFGALK"
FT   gene            706191..706745
FT                   /gene="cheD"
FT                   /locus_tag="Arad_0855"
FT   CDS_pept        706191..706745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheD"
FT                   /locus_tag="Arad_0855"
FT                   /product="chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0855"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25452"
FT                   /db_xref="GOA:B9J950"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J950"
FT                   /protein_id="ACM25452.1"
FT                   /translation="MILEATARRVHIIQGEYKVIGDPEVVLATILGSCVAACLRDPVAG
FT                   VGGMNHFLLPGMASSPTSGGDATRYGVHLMELLINGLLKQGARRDRLEAKVFGGAKTIA
FT                   TFSNVGEQNAAFAMQFLRDEGIPVVSSSTGGEHGRKVEYWPVSGRARQYPLTGAETQKT
FT                   VALEQRPVAAPKPVDNAIEFF"
FT   gene            706763..707152
FT                   /locus_tag="Arad_0856"
FT   CDS_pept        706763..707152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0856"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0856"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25453"
FT                   /db_xref="UniProtKB/TrEMBL:B9J951"
FT                   /protein_id="ACM25453.1"
FT                   /translation="MTNIQRADMTAMQETLPAILMRIVAELHDIAYLIERIEPQLLDLS
FT                   GVNVLESPDAMKVMQGIDLAVQKTRGIAEFIDTITGDMPDGWMVDVATALSLVKLTEMQ
FT                   KALGGSQRHGHSQPLAKAAGDFDFF"
FT   gene            707320..708999
FT                   /gene="fliF"
FT                   /locus_tag="Arad_0858"
FT   CDS_pept        707320..708999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliF"
FT                   /locus_tag="Arad_0858"
FT                   /product="flagellar M-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0858"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25454"
FT                   /db_xref="GOA:B9J952"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:B9J952"
FT                   /protein_id="ACM25454.1"
FT                   /translation="MNLLNQLVPLFRNLQNLGRTRLLTLAGVGILSVALVLFAALYVNK
FT                   PAQETLYVGLDATDLNQISIALAEAKINFQVGADGTSLTVPTGMTGKARALLAERGLPN
FT                   STNAGYELFDNVGSLGLTSFMQEVTRVRALEGEIGRTITSISGISAARVHIVMQDVGNF
FT                   RKADQKPTASVMIRANAEAARKAAQAIRHLVASAVPGLEVDDVTILDSTGQLLASGDDQ
FT                   SNGALNRNLGIVQNVQGEIASNIDKALAPFLGMDNFRSSVTAQLNTDSQQVQETTYDPE
FT                   SKVERSVRTTKEAQKSQQRQSDTAATVEQNIPQAAPQAGGNGPTSNDQTDKREEQTNYE
FT                   INSKTTATVRNSYRIEKLSVAVVVNRGRIAQMVGQPADPAKVDAYIAEMQKIVATAAGL
FT                   DPSRGDVVTVNAMDFLDTQLLDDNASGLNIMDVLSRNIAGIINSLAFVAVAVLIIWLGF
FT                   RPLIRSLGGGANGTALPDAAGLELPDFAPGAVGGPGAALMDGFGSDFGFDSTDDLLTMG
FT                   EDNSTFNRRVKEGPERRLSRMVEISEERAAKILRKWAVDKAA"
FT   gene            709526..710263
FT                   /locus_tag="Arad_0859"
FT   CDS_pept        709526..710263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0859"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0859"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25455"
FT                   /db_xref="GOA:B9J953"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B9J953"
FT                   /protein_id="ACM25455.1"
FT                   /translation="MDMQISQASKGDKDARAAAPSSAMSRDQLILQLTAVAGPAYLQSG
FT                   LRVLTDYVGASHYLLARCDLIQESGLDFVVSSDWPFDLVRRLASELTNGYGRAGELEKS
FT                   MSLFQPVFAFLPDDVEPPEGVSRHYCALTFNVGRTRFSLMLLARDSLLLSPERLRDVGL
FT                   LAGYFASFTRSVEGKLERDFDLTERELECLFWIAEGKTSDEIAMILGISRNTINNYITS
FT                   VMRKTATKTRSEAIAFAVRNNLV"
FT   gene            710275..711021
FT                   /locus_tag="Arad_0860"
FT   CDS_pept        710275..711021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0860"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0860"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25456"
FT                   /db_xref="GOA:B9J954"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B9J954"
FT                   /protein_id="ACM25456.1"
FT                   /translation="MRYQPGKATDMSGETKLSRLHRISGRSDLFPKLVSMQKLIDAQNF
FT                   ALYRLSGSGLPSKQRLVCELENWGSANPVMNKAFVEAYGEAMIEHIEKSLLPLMWNGRD
FT                   SDSTAETPDFAAFTQRLKPHLLPFAGVAFPVRLGSVGNGYVVFTAKFMDVASDMIVELH
FT                   GRSCQIMMELLSLDERRSPAAEALSEREIACLQLAGDGRISEEIAEKLGLSVHTVNAYL
FT                   GSATIKLDSVNRIQAIAKAIRFGYIS"
FT   gene            complement(711079..711516)
FT                   /locus_tag="Arad_0861"
FT   CDS_pept        complement(711079..711516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0861"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0861"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25457"
FT                   /db_xref="UniProtKB/TrEMBL:B9J955"
FT                   /protein_id="ACM25457.1"
FT                   /translation="MKKCPYSAQRERILAEAISPVASELRLLDAADLISLLRFERYGNL
FT                   ADLVASAAELYFLPGIVNFGLGGDYKLDWSGPAEVTIDLEIKPRGVTIYAKLALADHHA
FT                   GIEINHIAFEKAAADPDENTALLARSLKDARYAIGSATQAA"
FT   gene            complement(711522..712598)
FT                   /gene="flhB"
FT                   /locus_tag="Arad_0863"
FT   CDS_pept        complement(711522..712598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhB"
FT                   /locus_tag="Arad_0863"
FT                   /product="flagellar biosynthesis transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0863"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25458"
FT                   /db_xref="GOA:B9J956"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:B9J956"
FT                   /protein_id="ACM25458.1"
FT                   /translation="MADEDKDSKTEKPTEKKLRDTMEKGNVPHSREATIFASMLATVIY
FT                   VTFFLPERMGRMGEVLRDLFEKPDQWKLETGPDALSLFTRIGWEVGNLVLPAIVLFFIF
FT                   GIGSSMFQNLPTPVLDRIQPKFSRISPVSGWNRIFSTSGLVEFGKSLAKIVVVSIIMFF
FT                   VLRGQFFHAIDSLASDPQTIFVRLSTIVQRILMIVLLATAVVGIADVLWSRHHWFDQLK
FT                   MTKQEIKDEFKQSQGDPIVKSRQRSVARDRARRRMIKQVPRATLVIANPTHFAVALRYV
FT                   REEGDAPVVVAKGQDLIALKIREIAEANGIPVFEDPPLARSMFAQVSVDSVIPSVFYKA
FT                   VAELIHRIYAQSNRTRVR"
FT   gene            complement(712692..713690)
FT                   /gene="fliG"
FT                   /locus_tag="Arad_0864"
FT   CDS_pept        complement(712692..713690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliG"
FT                   /locus_tag="Arad_0864"
FT                   /product="flagellar motor switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0864"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25459"
FT                   /db_xref="GOA:B9J957"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:B9J957"
FT                   /protein_id="ACM25459.1"
FT                   /translation="MSQAEKAAAVLLAMGKQVAGRLLKYFTQHELQLIIASAQSLRLIP
FT                   PDELAQLVAEFEDLFTEGAGLMDNAKAIESILEEGLTPDEVDSLLGRRTAFQAYEASIW
FT                   DRLGEADPAFVAKFFLREHPQTIAYMLSMMPSSFGAKILLQLPEAQRADIMNRTVNLKD
FT                   VSPKAAQIIENRVQGLMTEIEAERNASGSTKVAELMNELDKPQVDTLLTSLETLSKESV
FT                   DKVRPKIFLFDDLMLMPQQSRVLLLNDIASDIITMALRGSTMDIREIVLASISPRQRRM
FT                   IESDLQVPSNGVNAREIAVARRAIAQEAIRLSNSGQIELKAKDTTPVEKAA"
FT   gene            complement(713859..714398)
FT                   /gene="fliN"
FT                   /locus_tag="Arad_0867"
FT   CDS_pept        complement(713859..714398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliN"
FT                   /locus_tag="Arad_0867"
FT                   /product="flagellar motor switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0867"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25460"
FT                   /db_xref="GOA:B9J958"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR012826"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:B9J958"
FT                   /protein_id="ACM25460.1"
FT                   /translation="MATKTTQKSSEDSLEIASSDAALDEAIDGLRGVLKKDTDGVAPDF
FT                   DLDAFGAEPATGLSAFGDEFGGDDAGSAFGAGDFGGPSAFAETAAPGSALSANLDLIMD
FT                   IPIDVQIVLGSSRMQVSGLMNLTEGAIIALDKRIGEPVEITVNGRCIGRGEITVLEHDD
FT                   TRFGIKLIELSNNKAK"
FT   gene            complement(714463..715407)
FT                   /gene="fliM"
FT                   /locus_tag="Arad_0870"
FT   CDS_pept        complement(714463..715407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliM"
FT                   /locus_tag="Arad_0870"
FT                   /product="flagellar C-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0870"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25461"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:B9J959"
FT                   /protein_id="ACM25461.1"
FT                   /translation="MSQQSTHPKQTMDPVLFAKLTGGLGDPATLAKLGTAFGQVYAEFL
FT                   PDIIKSETGLDVSVGYAGCRSGLMSELVAGIGSNCALVNGSLRNWSQNFLLGCGTGFVM
FT                   TLMEHLLGAQPETIDSPAARPLSVIELDLSVMVFDKIANVLRSAVNATGGFEPYLDPPY
FT                   NIEDRPTPVAGQTDDFAAAIAMTISLGKTVSEIVVIVPQYELLRTVVSAPRAKNPSAST
FT                   GAWAEQLNEQVRRSQVTLEARIRLQSLTLDTISRLAVGDVIPFMDTSDVQVEVSANSKD
FT                   LYVCEFGRSGENYTVRVKDTVNSDDELLRHLMN"
FT   gene            complement(715413..716285)
FT                   /gene="motA"
FT                   /locus_tag="Arad_0871"
FT   CDS_pept        complement(715413..716285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motA"
FT                   /locus_tag="Arad_0871"
FT                   /product="chemotaxis motility protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0871"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25462"
FT                   /db_xref="GOA:B9J960"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR022522"
FT                   /db_xref="UniProtKB/TrEMBL:B9J960"
FT                   /protein_id="ACM25462.1"
FT                   /translation="MNIIIGFVVTCGCIIGSFMAMGGDVNALFQPFEFVIIAGAGIGGF
FT                   IMANPMKVLKDSGKALGEAFRHAVPKERDYLDTLGVLYALMRDLRTKSRNEIEAHIDNP
FT                   DESVIFQAAPTVLKNRDLTAFICDYVRLIIIGNARSHEIEALMDEEINTIQHDKMKPYH
FT                   AITIMGDSFPAIGIVAAVLGVIKAMSHINESPEVLGHLIGSALVGTFLGIILSYSVCAP
FT                   LVSQIKIVRNKQHRLYVIVKQTLLAYMNGSVPQVALEYGRKTISSYERPSIDAVEQEMM
FT                   NPGGESKAA"
FT   gene            716515..717249
FT                   /gene="flgF"
FT                   /locus_tag="Arad_0873"
FT   CDS_pept        716515..717249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgF"
FT                   /locus_tag="Arad_0873"
FT                   /product="flagellar basal-body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0873"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25463"
FT                   /db_xref="GOA:B9J961"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012836"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:B9J961"
FT                   /protein_id="ACM25463.1"
FT                   /translation="MQSGIYVSLSSQMALERRLTTVADNMANVNTTGFRGTEVKFNQVL
FT                   SNTENKLNAKVAFVSQGNDYLSTSNGELQNTGNLLDFAVKGEAWFGLNTPAGLVLTRDG
FT                   RFTMTDSGALVSARGYPVLDPGGAPIQLDPTGGAPTVSSNGTITQNDKQVGQIGLYTSD
FT                   VSKGFLRYNNSGVLPTDTPQPVIDRSNIGVAQGYLENSNVNGLREMTELIEVSRAFDNI
FT                   TSLTNSSESTLSEAIKTLGGSQ"
FT   gene            717262..718650
FT                   /gene="fliI"
FT                   /locus_tag="Arad_0875"
FT   CDS_pept        717262..718650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliI"
FT                   /locus_tag="Arad_0875"
FT                   /product="H(+)-transporting ATP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0875"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25464"
FT                   /db_xref="GOA:B9J962"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022426"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:B9J962"
FT                   /protein_id="ACM25464.1"
FT                   /translation="MFEDRMPEGALSPRLPHMAALAEHYAMTENAVAHGGHVRTIAAGH
FT                   YTVAGLSRHVRLGEFVAHRSATGVHLGEVVRVEPELTYVCPIEPGEPIGIHDTVIRKGA
FT                   FRIAPSESWCGRTINSLGEPIDGLGPLTAGTQPRSISNTAPPSMTRKRVETGFKTGVRA
FT                   IDIFSPLCLGQRLGIFAGSGVGKSTLLSMLARADAFDKVVIALVGERGREVREFIEDTL
FT                   GTHMQKSVAVVATSDESPMLRKMAPLSAITIAEHFRDQGDNVLLIVDSVTRFAHAIREV
FT                   ATASGEPPIARGYPASVFTELPRLLERAGPGPEGTGTITAIISILVDGDNHNDPIADST
FT                   RGILDGHIVLQRSLAEEGRYPPIDPLASVSRLARKAWTPDQEKLVSRLKALVHRYEETR
FT                   DLRLIGGYRQGADADLDIAVRQVPIIYEILKQTPGERPSADAFTDLATALKNGAVAITP
FT                   AKRG"
FT   gene            718652..719197
FT                   /locus_tag="Arad_0876"
FT   CDS_pept        718652..719197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0876"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0876"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25465"
FT                   /db_xref="GOA:B9J963"
FT                   /db_xref="UniProtKB/TrEMBL:B9J963"
FT                   /protein_id="ACM25465.1"
FT                   /translation="MRETDADEPVAPPKPAKRRTVTDRALACTGLVLAGISAFFPWYVF
FT                   LNPDKFGIQVAEGDRTRDLPNWPGREIVSVSPLAMVNKNPGEPKDMIPDPLTTATVSSV
FT                   GREDDKGPPAEDQPFPGKSPFHLLHVANGRALIEDDNGMFVVRVGSLLPDNSRLATIEQ
FT                   RDGKWVIVTSTGDVYSHE"
FT   gene            719316..719708
FT                   /gene="flgB"
FT                   /locus_tag="Arad_0877"
FT   CDS_pept        719316..719708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgB"
FT                   /locus_tag="Arad_0877"
FT                   /product="flagellar basal-body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0877"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25466"
FT                   /db_xref="GOA:B9J964"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="UniProtKB/TrEMBL:B9J964"
FT                   /protein_id="ACM25466.1"
FT                   /translation="MQPIQLFDLASRQAEWLQTRQEVVAGNIANANTPKFRAKDVTPFQ
FT                   AVLDNQNVGMAKTNPAHLSGNEFSQSGDINVEEASLNQEIGVQESGNTVGLEDELAKSG
FT                   EIKRQYSLNTALVSSFHRMMLMTVKQ"
FT   gene            719725..720141
FT                   /gene="flgC"
FT                   /locus_tag="Arad_0879"
FT   CDS_pept        719725..720141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /locus_tag="Arad_0879"
FT                   /product="flagellar basal-body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0879"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25467"
FT                   /db_xref="GOA:B9J965"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:B9J965"
FT                   /protein_id="ACM25467.1"
FT                   /translation="MDPLSAALKIAGSGLEAQSTRLRVVSENIANARSTGDTPGADPYR
FT                   RKTVTFGAELDRANGVTTVGVKKMGEDTGKFVEQYDPDNPAADQKGYVKMPNVNILVEM
FT                   ADMREANRSYEANLQTVRQARDLISSTIDLLKNS"
FT   gene            720141..720491
FT                   /gene="fliE"
FT                   /locus_tag="Arad_0880"
FT   CDS_pept        720141..720491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliE"
FT                   /locus_tag="Arad_0880"
FT                   /product="flagellar hook-basal body protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0880"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25468"
FT                   /db_xref="GOA:B9J966"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J966"
FT                   /protein_id="ACM25468.1"
FT                   /translation="MIDAIKNVSSLSATRGLGSIATDLSSAASNAIASTPETAIGSSAV
FT                   GSFASVMSDVAKNTVSTLKEAENASFAGIKGTMSTREVVDKVMQADQTLQTAIALRDKM
FT                   VSAFLDITKMQI"
FT   gene            720590..721378
FT                   /gene="flgG"
FT                   /locus_tag="Arad_0881"
FT   CDS_pept        720590..721378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgG"
FT                   /locus_tag="Arad_0881"
FT                   /product="flagellar basal-body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0881"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25469"
FT                   /db_xref="GOA:B9J967"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:B9J967"
FT                   /protein_id="ACM25469.1"
FT                   /translation="MRALAIAATGMDAQQTNLEVIANNIANINTTGYKRSRAEFSDLLY
FT                   QTERAKGIANRPNQAVVPEGANIGLGVQTTAVRNIQIQGELSQTSNDLDVALVGRGWFQ
FT                   IQMPDGTTAYTRAGSFNKSDTGQMVTPDGNVLQPGITIPSNASNVVINQSGQVSATIGT
FT                   ATTPTVLGQLQIANFVNEAGLQPMGSNLFTQTPASGDPVVSDPNENGFAYMKQGYLESS
FT                   NVDPVKEITDLITAQRAYEMNSKVITTADDMAQIVSKNLK"
FT   gene            721397..721897
FT                   /gene="flgA"
FT                   /locus_tag="Arad_0882"
FT   CDS_pept        721397..721897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgA"
FT                   /locus_tag="Arad_0882"
FT                   /product="flagellar basal-body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0882"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25470"
FT                   /db_xref="GOA:B9J968"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="InterPro:IPR039246"
FT                   /db_xref="UniProtKB/TrEMBL:B9J968"
FT                   /protein_id="ACM25470.1"
FT                   /translation="MRFRRMKSLAMAWFAAAGLSVMFAPAFSAGATGVDGTGMGTAVVP
FT                   TEVIYPGDIIGSGQLEEVDVTNPNLSGDYARTIRDVTGRVSKRTLLPGRTISISALRQP
FT                   FAVTRGSNARLVMSMGSMTITAAGTPLDDGAVGDSVRARNLDSGIIVNGTVLENGTIRV
FT                   VSK"
FT   gene            721894..723012
FT                   /gene="flgI"
FT                   /locus_tag="Arad_0884"
FT   CDS_pept        721894..723012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgI"
FT                   /locus_tag="Arad_0884"
FT                   /product="flagellar basal-body P-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0884"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25471"
FT                   /db_xref="GOA:B9J969"
FT                   /db_xref="InterPro:IPR001782"
FT                   /db_xref="UniProtKB/TrEMBL:B9J969"
FT                   /protein_id="ACM25471.1"
FT                   /translation="MRSLRLFLAVLMALPSLIVSDPALAMQSRIKDIASLQAGRDNQLI
FT                   GYGLIVGLQGSGDGLRSSPFTEQSMRAMLQNLGISTQGGQSAAKNTAAVMVTANLPPFA
FT                   SPGSRIDVTVSSLGDATSLRGGTLIMTSLSGADGQIYAVAQGSVIVSGFQAQGAAASVT
FT                   EGTTTAGRVPGGAIIERELPSRFKDSVNLVLQLRNPDFSTSVRITDTVNAWATSRFGAP
FT                   IAEAKDSQEVAISKPKMADLTRLMADIENLAVQTDTPAKVVINERTGTIVIGADVRVSP
FT                   VAVSYGTLTVQVSENPQVIQPEPFSDGQTAIQDQTDITATKSGGGVAMLQGPDLKTLVS
FT                   GLNNIGVKPDGIIAILQGIKSAGALQAELVLQ"
FT   gene            723009..723548
FT                   /locus_tag="Arad_0885"
FT   CDS_pept        723009..723548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_0885"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0885"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25472"
FT                   /db_xref="UniProtKB/TrEMBL:B9J970"
FT                   /protein_id="ACM25472.1"
FT                   /translation="MILIAIARKMLNSCSAAMAALLLSVCAAAAQEAPKPIVDPASSQD
FT                   EIRQFCTNIADPARDQRYLLQKQELEKLQADVNQRIATMDQRKAEYEDWLKRRDDFLKS
FT                   ADTGLVDVYKNMKPDAAAASLDGVKVTIAAAIIMKLSPRQASLVLAEMDVQKAAAVTNI
FT                   MASASDPNTSKSKDPS"
FT   gene            723545..724261
FT                   /gene="flgH"
FT                   /locus_tag="Arad_0886"
FT   CDS_pept        723545..724261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgH"
FT                   /locus_tag="Arad_0886"
FT                   /product="flagellar L-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0886"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25473"
FT                   /db_xref="GOA:B9J971"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/TrEMBL:B9J971"
FT                   /protein_id="ACM25473.1"
FT                   /translation="MNMRLTATCAIVAVLAGCQSPQALKELGRAPAMSPIGSGLQYAQT
FT                   PQMSQYPKRPHQVAQGYSLWNDSQAALFKDARALNVGDILTVTIQINDKANWDNETNRN
FT                   RTNKSDMNWDISAKIFGWKPATNADATSGSDTSTDSKGKMQRSEQINLLVAAVVTGILE
FT                   NGNLMISGSQEVRMNQEIRILNVAGIVRPQDVTADNTISYDKIAEARISYGGRGRLTEI
FT                   QQPPVGQQAVDLLSPL"
FT   gene            724307..724801
FT                   /gene="fliL"
FT                   /locus_tag="Arad_0887"
FT   CDS_pept        724307..724801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliL"
FT                   /locus_tag="Arad_0887"
FT                   /product="flagellar biosynthesis transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0887"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25474"
FT                   /db_xref="GOA:B9J972"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:B9J972"
FT                   /protein_id="ACM25474.1"
FT                   /translation="MAEAADASANSKGSPLVMTIVGLLALTVLGGGGGWFLGTIVAPKI
FT                   KAATAAVQAATQTTGDEKQAIAPLESSNIVQLDPIITNLGYPSQNWIRLEIALVFKGQP
FT                   DAQLAQAIHEDVLAYVRTVSLQQIEGPRGLQYLRDDLQERVDLRSEGRVSKVMFRTFVI
FT                   E"
FT   gene            724798..725556
FT                   /gene="fliP"
FT                   /locus_tag="Arad_0889"
FT   CDS_pept        724798..725556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliP"
FT                   /locus_tag="Arad_0889"
FT                   /product="flagellar biosynthesis transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_0889"
FT                   /db_xref="EnsemblGenomes-Tr:ACM25475"
FT                   /db_xref="GOA:B9J973"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:B9J973"
FT                   /protein_id="ACM25475.1"
FT                   /translation="MIRLLLILSTLVFAILSPELAMAQQLSQQIPTDLLNTPVNGSVAA
FT                   WIIRTFGLLTILSIAPGILIMVTSFPRFIIAFSILRSGMGLATTPSNMILLSLALFMTF
FT                   YVMSPTFDQAWKDGAQPLLANQISEADAVMRIAEPFRTFMANNTRDKDIKLFVDLAQER
FT                   GQTVVIDNKIDYRVLIPAFMISEIRRGFEIGFLVVLPFLVIDLIVSTIVMAMGMMMLPP
FT                   TSISLPFKILFFVLIDGWNLLVGSLVRSFH"
FT   gene