(data stored in ACNUC7421 zone)

EMBL: CP000629

ID   CP000629; SV 1; circular; genomic DNA; STD; PRO; 2650913 BP.
XX
AC   CP000629;
XX
PR   Project:PRJNA13402;
XX
DT   30-JAN-2009 (Rel. 99, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Agrobacterium radiobacter K84 chromosome 2, complete sequence.
XX
KW   .
XX
OS   Agrobacterium radiobacter K84
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Rhizobiaceae;
OC   Rhizobium/Agrobacterium group; Agrobacterium;
OC   Agrobacterium tumefaciens complex.
XX
RN   [1]
RP   1-2650913
RX   DOI; 10.1128/JB.01779-08.
RX   PUBMED; 19251847.
RA   Slater S.C., Goldman B.S., Goodner B., Setubal J.C., Farrand S.K.,
RA   Nester E.W., Burr T.J., Banta L., Dickerman A.W., Paulsen I., Otten L.,
RA   Suen G., Welch R., Almeida N.F., Arnold F., Burton O.T., Du Z., Ewing A.,
RA   Godsy E., Heisel S., Houmiel K.L., Jhaveri J., Lu J., Miller N.M.,
RA   Norton S., Chen Q., Phoolcharoen W., Ohlin V., Ondrusek D., Pride N.,
RA   Stricklin S.L., Sun J., Wheeler C., Wilson L., Zhu H., Wood D.W.;
RT   "Genome sequences of three agrobacterium biovars help elucidate the
RT   evolution of multichromosome genomes in bacteria";
RL   J. Bacteriol. 191(8):2501-2511(2009).
XX
RN   [2]
RP   1-2650913
RG   Agrobacterium Consortium
RA   Setubal J., Wood D., Slater S., Nester E., Farrand S., Goldman B., Burr T.,
RA   Goodner B., Otten L., Dickerman A., Almeida N., Sun J., Jhaveri J.,
RA   Banta L., Houmiel K.;
RT   ;
RL   Submitted (14-MAR-2007) to the INSDC.
RL   Virginia Bioinformatics Institute, Virginia Tech, Washington Street, Box
RL   0477, Blacksburg, VA 24061, USA
XX
DR   MD5; ebc4e71242b5719b390d377499a7bb2e.
DR   BioSample; SAMN02602977.
DR   EnsemblGenomes-Gn; EBG00001276819.
DR   EnsemblGenomes-Gn; EBG00001276820.
DR   EnsemblGenomes-Gn; EBG00001276821.
DR   EnsemblGenomes-Gn; EBG00001276822.
DR   EnsemblGenomes-Gn; EBG00001276823.
DR   EnsemblGenomes-Gn; EBG00001276824.
DR   EnsemblGenomes-Gn; EBG00001276825.
DR   EnsemblGenomes-Gn; EBG00001276826.
DR   EnsemblGenomes-Tr; EBT00001808875.
DR   EnsemblGenomes-Tr; EBT00001808876.
DR   EnsemblGenomes-Tr; EBT00001808877.
DR   EnsemblGenomes-Tr; EBT00001808878.
DR   EnsemblGenomes-Tr; EBT00001808879.
DR   EnsemblGenomes-Tr; EBT00001808880.
DR   EnsemblGenomes-Tr; EBT00001808881.
DR   EnsemblGenomes-Tr; EBT00001808882.
DR   EuropePMC; PMC4054136; 24727275.
DR   EuropePMC; PMC5998023; 29899540.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00489; ctRNA_p42d.
DR   RFAM; RF00490; S-element.
DR   RFAM; RF00519; suhB.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01999; group-II-D1D4-2.
DR   StrainInfo; 114617; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2650913
FT                   /organism="Agrobacterium radiobacter K84"
FT                   /chromosome="2"
FT                   /strain="K84"
FT                   /isolate="ATCC BAA-868"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:311403"
FT                   /culture_collection="ATCC:BAA-868"
FT   gene            147..1322
FT                   /gene="repAa1"
FT                   /locus_tag="Arad_7000"
FT   CDS_pept        147..1322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repAa1"
FT                   /locus_tag="Arad_7000"
FT                   /product="plasmid partitioning protein RepAa1"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7000"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28591"
FT                   /db_xref="InterPro:IPR017818"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JL92"
FT                   /protein_id="ACM28591.1"
FT                   /translation="MTRHLSSLAFMQTFSAKLDTALGNLSLAQFPPHARRTMRKFTSPE
FT                   VAALLNVTEAYIRQVSLKEQGPTPEVANGRRLYTLEQILELRMHLAQNGRKKWMNPRRV
FT                   GEEQCQILAITNFKGGSSKTSTTIHLGHYLALRGYRVLAVDLDPQASLTSLHGSLPDFD
FT                   YRDGDTLYSAIRFEDPIPTEQVIHQTHIAGFDVICAGLELTEFETAVALEMRKSGGTSF
FT                   LLRVSQALEQVADRYDIILMDSAPSLNFLTLSSLTAATGVLIPVPAHMLDVDSTAKFLE
FT                   LAGSYMQILEQVGTSAQWDFAKFLITKFEPNDHPQANMTALMRQVFGEDLLLNSVIKST
FT                   AVADALTWKQSLYEVQRSRFSAPKTYDRAIESINAANAEIEELLSRAWGRE"
FT   gene            1307..2341
FT                   /gene="repBf2"
FT                   /locus_tag="Arad_7001"
FT   CDS_pept        1307..2341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repBf2"
FT                   /locus_tag="Arad_7001"
FT                   /product="plasmid partitioning protein RepBf2"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7001"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28592"
FT                   /db_xref="GOA:B9JL93"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR011111"
FT                   /db_xref="InterPro:IPR017819"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR037972"
FT                   /db_xref="UniProtKB/TrEMBL:B9JL93"
FT                   /protein_id="ACM28592.1"
FT                   /translation="MGTRMSRKDSKGMFANVLIGLGQDTPSVPAATTSPSPHLLKVAAG
FT                   VRQLQERGELADKLLQGADHIIQLDVDAVLPSSIRDRFDGAYDADRLQDLVQSMREHGQ
FT                   TTPGLVRPMPGEGSRFQIVFGRRRLAAAKLLGIKFRAIVRDLTDEQAIVIQGEENANRD
FT                   DLSFIEKCVFALSQEEAGFKREVICSSLATGKSHVSEMLQIAKVFPNTVLTRIGAAPET
FT                   GRRRWAQLAERWSANAKAQTVTDRLLEELTVQSLSSDDRFAAVLNAVSKAENAPTAPAD
FT                   RAQEVVSKGMTLAVVNYAKAGTKLTFTKAVPDDFVNYLLRRMEGLHEEYLDQSQQTAQN
FT                   KTKL"
FT   gene            2621..3730
FT                   /gene="repCa1"
FT                   /locus_tag="Arad_7003"
FT   CDS_pept        2621..3730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repCa1"
FT                   /locus_tag="Arad_7003"
FT                   /product="plasmid replication protein RepCa1"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7003"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28593"
FT                   /db_xref="InterPro:IPR005090"
FT                   /db_xref="InterPro:IPR021760"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JL94"
FT                   /protein_id="ACM28593.1"
FT                   /translation="MFRNVCEARPLLNISDRTLAVLNALLTFYPEKELSEDAGLVVFPS
FT                   NNQLAVRAHGITGTTLRRHLATLVEAGLILRKDSPNGKRFARKDGAGAVEDAYGFNLAP
FT                   LLARSEELADLAQQIAVEKKHLRQAKEKLTISRRDVRKLIGTAIEEGVPGNWQAIERHY
FT                   LSLVNTLPRAPTAVDIAPIAEEMEMLRNEIINLLETKLISEKSVANDVQNDRHIQNSNT
FT                   ESQIESEASPQAATAVEPDQSAEQISKPSQQPIKAYPLATVLRACPEITNYGPSGAIAS
FT                   WRELMTAAVVVRTMLGVTSSAYQDACDTMGPESTAVVMACLLEKAQHISSAGGYLRNLT
FT                   SRARRGEFSLAPMLMAQMRGRDAEARKAS"
FT   gene            3727..4374
FT                   /locus_tag="Arad_7004"
FT   CDS_pept        3727..4374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7004"
FT                   /product="Conserved Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7004"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28594"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JL95"
FT                   /protein_id="ACM28594.1"
FT                   /translation="MIIVIEGISAAGKTTWCRQHASKFFVQETYPELRPDRDHDAHGAA
FT                   LLWTDWNMRRWSEAVEIEREHQRAVCDTDPLKLHYIWGLWQIGETPESHWRYQMEATRD
FT                   ALQKCRLGFADLYLVKRIDPRVARQQREQDTVKMRSNFDLHARLQASLHVWYETLAIIL
FT                   PRRVEWALPDNLSVTETIDSSSEYRYSVEVFDRLIAGLPGASYGSKPITIDT"
FT   gene            4731..5699
FT                   /locus_tag="Arad_7005"
FT   CDS_pept        4731..5699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7005"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system protein, periplasmic component (substrate binding
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7005"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28595"
FT                   /db_xref="GOA:B9JL96"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:B9JL96"
FT                   /protein_id="ACM28595.1"
FT                   /translation="MGVFRSAMIGVVAALGFGLASAQAADLSEIRIDWATYNPVGLLLK
FT                   KEGLLEKEFAKDNISIRWVQSAGSNKALEFLNAGSIDFGSTAGAAALIARVNGNPIESI
FT                   YVFSRPEWTALVARADSPISTVQDLKGKTIAVTRGTDPHIFLVRALADAGLKQTDVKLV
FT                   LLQHADGKLALLRGDVDAWAGLDPLMAAAEVEDKAKLFYRKPENNTWGVLNTTETFATE
FT                   HPDIVKRVIAVYEQARADAIANPAALKAALVEAAKLPDDVIAKQLERTDISQSTIGDLQ
FT                   RDTISKAGIALQSAGVLPADVDIQKVTNELIDDRFAVGKTQ"
FT   gene            5717..6559
FT                   /gene="nrtB"
FT                   /locus_tag="Arad_7006"
FT   CDS_pept        5717..6559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrtB"
FT                   /locus_tag="Arad_7006"
FT                   /product="nitrate ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7006"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28596"
FT                   /db_xref="GOA:B9JL97"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JL97"
FT                   /protein_id="ACM28596.1"
FT                   /translation="MADLAGTGIETETKASRSVAASAFYGIGGRATVAIILPAIGLLFW
FT                   EVAVAAGWFSGRLMPPPSKVAATLWALSKSGELFTHIGITTVRVFFGFIIGAVTATIAG
FT                   AVTGYFGLARRLIDPSLQALRSIPSIAWVPLFILWFGIFEASKVALIAVGVFFPVYLGV
FT                   SGAILSVDRKIVEVGRIFRLSGFALVRRVMLPAVFPAYVTALRSGLGLGWMFVVAAEFM
FT                   GASEGLGYLLVDGQQMGKPDQIMAAIITFAVIGKLTDSLLLAVTAPFLTWQDSYRREG"
FT   gene            6564..7301
FT                   /locus_tag="Arad_7007"
FT   CDS_pept        6564..7301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7007"
FT                   /product="aliphatic sulphonate ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7007"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28597"
FT                   /db_xref="GOA:B9JL98"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JL98"
FT                   /protein_id="ACM28597.1"
FT                   /translation="MLTLRHLGKTYANGVRALEGFSLNLAPGEIVAVIGGSGCGKSTLL
FT                   RLISGLETPTRGTVELNGEPVVKPHPLINLIFQEPRLLPWLSVANNVGFGLAELEGDDR
FT                   RHQVEAALKKVGLAELGRRWPRELSGGQAQRVAIARALVTQPEVLLLDEPFSALDAFTR
FT                   ADLQDHLLDIWSETRPTLIIVTHDIDEALVLADRIIVMRPWPGRILDEIKIDLPRIRDR
FT                   ASEALEVGKRQLLLSLNTSLQPS"
FT   gene            complement(7326..8153)
FT                   /locus_tag="Arad_7008"
FT   CDS_pept        complement(7326..8153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7008"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7008"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28598"
FT                   /db_xref="GOA:B9JL99"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JL99"
FT                   /protein_id="ACM28598.1"
FT                   /translation="MDLRALHAFRMIAETGSITAAAARLGTVQSALSARIGQFEASIGE
FT                   TLFERLPRGIRLTAAGIRLLPYAERMERLTAEAMRAVRGRQPDLSGPFRLGAIEVVAAS
FT                   VLPATLSSFLGSHPEVDLHLRTGVSRELAASLDAGELDAAIIAEDVGRHGLASLSLDHM
FT                   PLALFQPADRAPETLEQAFAFGKGCVCRDRLEALVHRRRWNMRIVELGSVDAIFGCVAA
FT                   GLGVAVLPRMLGAGRVLESKPTGHLDLFLINRPEADAKARALAASYTPIEHSA"
FT   gene            8232..9137
FT                   /locus_tag="Arad_7009"
FT   CDS_pept        8232..9137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7009"
FT                   /product="epoxide hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7009"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28599"
FT                   /db_xref="GOA:B9JLA0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLA0"
FT                   /protein_id="ACM28599.1"
FT                   /translation="MSQFHSYQLAVTPILDIAFEEGGPRDGFPLILVHGWPDDVRTWDR
FT                   IVPQLQSAGFRTFVPYLRGVGPTRFRDPDAMRSGQLSALGRDVLDFAEALGLGRFGVIG
FT                   HDWGARAAYIAACLAPDRVACCVAMSVGWGTNNPDQPLSLRQSQNYWYHWLMALPRGEA
FT                   LVRNDRLVFTRYIWTIWNPDWAVPDEEFDATATSFGNPDWADVVLHSYRVRWDLADPDP
FT                   SYAALEDRLKADPIIHVPTLVLHGGSDPCNDVSTSDGKDEFFRAPYQRVVLPGLGHFPQ
FT                   REEPDAVLKHMMGFLSHQQS"
FT   gene            complement(9145..10344)
FT                   /locus_tag="Arad_7010"
FT   CDS_pept        complement(9145..10344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7010"
FT                   /product="efflux transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7010"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28600"
FT                   /db_xref="GOA:B9JLA1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLA1"
FT                   /protein_id="ACM28600.1"
FT                   /translation="MIPKLPRQLWLLAAIAFVNFLGFMVTPFLVLYLTSAVGLSIETAG
FT                   IILTVFGLGSIFGAWAGGHASDRIGSENVLILSFLASAATLLLIPALGDSMSIGAAVAI
FT                   MAFANGAFRPAYDACVVRLCPENERSQAYAIYVVAINVGAGMAAAMAGHLYARQPSLIF
FT                   FIDGLTSAVAAIAVLVFLDRSAPRHAAPAVKADTSKPAGLPYRNMEFILLCLAACVLDM
FT                   VGRQTSSTLPLFVTSYYGMTPEEYGNLLTLGHFVFAAAILPVSRWAKSKNHMTVVLIGM
FT                   MIVAVSFGALPLGGSVTALVTLYLLLTAGQLMFYPAIMAMVMGQAARSGGKSGAYMSFY
FT                   RTAQAAAGILAPAIGTFIYVHFSPTSLWLCCSVITVLCAILLAMRLMLRVSPDREALEP
FT                   "
FT   gene            10605..10724
FT                   /locus_tag="Arad_7011"
FT   CDS_pept        10605..10724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7011"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28601"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLA2"
FT                   /protein_id="ACM28601.1"
FT                   /translation="MSIENWRRPIESGSRSNRRQHINHRFGQANLTMLPFAGR"
FT   gene            10826..18721
FT                   /locus_tag="Arad_7012"
FT   CDS_pept        10826..18721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7012"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7012"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28602"
FT                   /db_xref="InterPro:IPR026664"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLA3"
FT                   /protein_id="ACM28602.1"
FT                   /translation="MTSIVSSLSTSQIRSLSTAAVAAWTTDDVASLSTKQINVLSSAQI
FT                   AALDTEDVEVLSSQQLSAISQTAIVGLTMDQLAVLTASDIESLSSLQIAAITTTQISAL
FT                   TTDQAEALSSSQVAALSSSQVAALSAADIATFSTGDMAAITNKAVSGLSTASIATLSTD
FT                   QIAALSTSSIASLTTTQVAALSTAQIAALTTAQVAALKTAQIAVMDTKGIAALSTAQIA
FT                   ALSTTAISSLTTSQIDVLSTAQAEALSSSQVKVLSSTQIAALGTDDIATFSTDDMAAIT
FT                   SKAVAGLGTGLLAALSTAQIAALSTSAITGLTTGQVVALSTEQVASLTTTQLGALKASQ
FT                   VAVMGTNDIAVLSTAQVAALSKTAIAGLTTTQIVALSTAQVAALTTTQLGALKASQVAV
FT                   MGTNDIAALSTAQVAALGTSAITGLTTSQIDALSTAQAEALTTIQVAVLSSTQIAALGT
FT                   DDIATFSTADMAAITSKAIAGLDTAGIAALSTDQIAALSKAGITGLTTDQIASLSTAQV
FT                   EVLKTTQIVVLSSKQIAVLGTDIVSSLSTAQVAALSTAGITGLTTDQIAALSTAQAEAL
FT                   SSSQVKALSSTQIAVLGADDIATFSTADMAAITSKAIAGLSTAAIATLSTDQIAALNTS
FT                   TVAGLTTAQIAALSTDQISALNTRIVAGLTTTQIVALSTAQVAALTTTQLSALKASQVA
FT                   VMETNDIAALSTVQIAALGTSAIAGLTTSQIDALTTAQAEALTTAQVKVLSSTQIAALG
FT                   TDDIATFSTDDIAAITSKAMSGLSASQIAALTTGQIAVLSTSAIAGLTTSQIAALTTGQ
FT                   AAALTTTQVVVLSSTQLSALGTDDIATFSTADIAAITSKAISGLSTSLITELSTAQIAA
FT                   LSTSAITGLTTSQIATLSSSQLAALNTAKVAVLSSKQVAALGTNVVASLSTAQVAALST
FT                   SGITGLTTDQVAALKTTQVEALTTIQAAALSSTQLTALGTDDIATFSTADIAAITGKAI
FT                   AGLSTAVIAALSTGQIAALSSAGVVGLSTDQISSLSTAQIAALTTARVGVLRAAQVAAL
FT                   ETEVVASLSTAQIAALSTAGITGLTTDQIDTLSTAQAEALTTAQVAALSSTQIAALETD
FT                   DIATFSTDDIAAISSKAMPGLSTAIIAALSADQLGALGTTGIAGLTTTQIDALSSGQIA
FT                   TLLTKQIAVLSATQVAALGTDIIASLSTTQIAALSASGVAGLTTSQIAALSTAQAEALT
FT                   TGQVAVLSSTQINALGADDIATFSTADIAAITSKAMSGLSTAVIAALSTDQIAALSASG
FT                   VAGLTTSQIAALSTAQIAAVTTGRVAALSSTQIAVLSTAVIAALSTAQVAALSASGIAG
FT                   LTTDQIAALSTAQAEALTTTQVAALSSTQIAALETDDLATFSTKDIAAIGSSAISGLST
FT                   AAIATLSTDQIAALSTAGIAGLSTEQINALSTGQIDALLTKQVAALSSTQVASLSTGIL
FT                   ASLSTAQIAALSASGITGLSTKQIAALSTAQAEALTTTQVGTLSSKQVGALSAEDIATF
FT                   STKDIAAIGSSVIVGLTTAVIASLSTAQIAALSTAGISGLSTAQIVALSTGQLEALTTA
FT                   QIAALNSTQLAALDTEDIATFSTKDIAALSSSAISGLSTAVIAALSTDQIAALSTSGVA
FT                   GLSTKQIVALSTVQAEALTTIQVGALSSTQLAALDTDDIATFSTADIAAIGSTAVSGLS
FT                   TAVIAALSTTQIAALSTAGVAGLSTKQIAALNTGQIDALLTKQVAVLGSTQVAALNTAV
FT                   VATLSTAQVAALSTSGIAGLTTAQIATLGTGQAATLSTAQIGALGSKQVAALTTADIAA
FT                   LSTTQIAALSTVGIAGLSATQIAALSTDQAEALTTTQVAVLSSTQVAALGADQLETFST
FT                   ADIAAISSSAITGLSTDTLAAFSTAQIAALGTAGIAGLSATQIAVLSTGQLEALTTVQV
FT                   GALGSKQIAALTTVDIAALSTTQIAALSTAGIAGLTTEQIAALSTDQAEALTTPQVAVL
FT                   SSTQIAALGTDDLETFSTADIAAISSSAIQGLTTGTIAALSTDQIEVLGTAGIAGLTTD
FT                   QIAALSTGQLEALTTAQIGALGSKQIAVLSTAGIAGLSTAQIAALSTAGIAGLTTDQVA
FT                   ALSTNQAEALTPTQVGALSSKQIVALGADDLDTFSTADIAAISSTAISGLSTETIAGLS
FT                   TLQIAALGTAGIAGLTTAQIAVLNSDQIDALTTAQIGALGSKQIAVLTTAEVVAFSTAD
FT                   IAAISSSAISGLSTAIIAALSTVQIAALSTAGITGLTTAQIAALNTDKVEALTTAQIGA
FT                   LSSKQVAALSAADIAALSTAQVAALSTAGVAGLSSAQVGALSVEQVEALSTTQIAALTS
FT                   TGVAGLTTADLATFSAADIAAISSSAIEGLSTDFIASFSTAEIAALGTASVAGLSSAQV
FT                   KALSIDQIEALSTTQIAALSSSGAAGLTTEDLGTFSTDELVAISSNAMPGLSTDFIVAL
FT                   STAQIAILTTSQVASLSYSQVAAMSTDQIVALSTTQVNALNALQLAALDTDDIALFSTD
FT                   FIVALNSSAIAGLSTRVIASLTTEQAEALTPSQVAGLTSAQVAALSTQELATFSTADIA
FT                   SFSSTGLAGLSTQDIAGLSSAQLGALMKSQMGYLSSDQIAAVISVYVGA"
FT   gene            18944..21058
FT                   /locus_tag="Arad_7013"
FT   CDS_pept        18944..21058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7013"
FT                   /product="glycosyltransferase TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7013"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28603"
FT                   /db_xref="GOA:B9JLA4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR029489"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLA4"
FT                   /protein_id="ACM28603.1"
FT                   /translation="MAATPAVKSWDVSMVTNEASALTPVPSVAGILELARTQRLSFTDL
FT                   FQFAEGRSAAGQKLEAAEVYKVWIAFNEGHPFLHLVYFNYSVTLRQLGDVAGSIHALRA
FT                   CLKLDPRFGPAHINLGRALEDSGIATQAILQWRSFVELTADSTADRLAHRLLALQHIGR
FT                   VMENAGLLEDAETTLWQAMELRPDKTEAGQHWSALRQRQCKWPTLVSSDHVSIRHLLDA
FT                   MSPLTLACFSDDPLFQLAKAYRYNKSFVGRPDTSGFTRKTPKQKTGTDQRLRVGYVSSD
FT                   LRDHAVGFALREVLELHDKRSVEIYAYYCGDPVQGDATQARMKAVVDCWRDIGVLNDAD
FT                   AARQIADDDIDILVDVNGYTKHARTKIFAYRPAPVVVNFCGYPGTMGSPFHHYIIADEH
FT                   IIPPENEIYFSEKVLRIACNQPIDRKRVIAERPSRAEAGLPEDVFVYACFNGMQKITQE
FT                   TFAHWMKILAGTTGSVLWLLTGGDDVDKRLLQLAENAGVAPERLIFAPKAPNAKHLARI
FT                   AVADLFLDTFPYGAHSTAGDALTMGLPVLTFPGKSFAARFCHSIVAAAGVPELICSNPE
FT                   DYIERAIGFANNPRSLREIRESLQAKRETSALRDIPALARRLEELFWQMQAECERGETP
FT                   VPDLSNLDIYYDIGVDLVQDNIAFSDDRAYRQAYRDKLVEWHDYAPVPHDRRLWTEEAA
FT                   VSTPHAAGKS"
FT   gene            21065..22231
FT                   /gene="glf"
FT                   /locus_tag="Arad_7014"
FT   CDS_pept        21065..22231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glf"
FT                   /locus_tag="Arad_7014"
FT                   /product="UDP-galactopyranose mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7014"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28604"
FT                   /db_xref="GOA:B9JLA5"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLA5"
FT                   /protein_id="ACM28604.1"
FT                   /translation="MPRIKKIAVVGAGLSGAVIGRELAMVGHEIDVFDTRNHIAGNCHT
FT                   ERDPATGVMVHVYGPHIFHTDDREVWDYVNLFQTFMPYKNRVKTTSSGQVYSLPINLHT
FT                   INQFFGKTLRPDEARAFIEERADKSITDPKTFEEQALRFVGNDLYEAFLKGYTQKQWGC
FT                   APTELPASILKRLPVRFNYDDNYFFHKYQGMPENGYTDMVGRILDHTNIEVHLETRFHS
FT                   GLAKDFDHIFYSGPLDGYFDYEYGRLGYRTLDFERFTHDGDYQGCAVMNYGDVSVPYTR
FT                   VTEHKHFSPWEDHAGSVCYREFSRACEPGDVPYYPIRLMEEKEQLAHYVTRALQEPSVT
FT                   FVGRLGTYRYLDMDVTIREALDTARLYLSVSADHTPMPAFLHPPLQTL"
FT   gene            complement(22272..23789)
FT                   /locus_tag="Arad_7015"
FT   CDS_pept        complement(22272..23789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7015"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7015"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28605"
FT                   /db_xref="GOA:B9JLA6"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLA6"
FT                   /protein_id="ACM28605.1"
FT                   /translation="MSTFDFLLQGLMIAAQPMNLLYALIGVTLGTAVGVLPGIGPALTV
FT                   ALLLPVTYKLDPAGSLIMFAGIYYGGMYGGSTTSILLNTPGESASIVTALEGNKMARAG
FT                   RGGPALATAAIGSFVAGLIATLGLAFIAPIIVKLALVFGPREYFALMVLAFVTVSSAFG
FT                   DSTLRGLTSLFIGFALAIIGIDQLTGQARMSFGVPDLLDGIEVTTLAVAMFAIGESLYI
FT                   AAQGNRGPDTIEAVKGSVWMTAQDWARSWKAWLRGTLIGFPIGAMPAGGAEIGTFLSYA
FT                   AEKRLTKYPEEFGKGAIEGVAGPEAANNASAAGTLVPLLTLGLPTTATAAIMLAGFQQY
FT                   GLQPGPLLFVTNPQLVWGLIASLLIANFMLLVLNLPLVGLWVKLLTIPKPWLYAGILLF
FT                   ATLGTIGANPSVYELGMLLAFGVLGYVMRIFGYPIAPVVVGLILGPLAEQQLRRALAIS
FT                   QGDVTVLFTSPISAVLLLIAAAALIVPLILRARGRGETLSKLAANED"
FT   gene            complement(23799..24290)
FT                   /locus_tag="Arad_7016"
FT   CDS_pept        complement(23799..24290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7016"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7016"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28606"
FT                   /db_xref="GOA:B9JLA7"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLA7"
FT                   /protein_id="ACM28606.1"
FT                   /translation="MTTGNSPTTQTRRPDRAALVIAAFLAALAGLIFWDSSRLAKIASY
FT                   SGIGPATIPFVIAGGLLFLSAWTVLAALRADFPVRERQEVAPVVWIVGGLAAQMLLLKP
FT                   LGFSIATGLLFAATAAAFGKRKLWISIPLGIALCLGVWLIFSGLLQLSLPAGPLEHLFW
FT                   "
FT   gene            complement(24287..25231)
FT                   /locus_tag="Arad_7017"
FT   CDS_pept        complement(24287..25231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7017"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7017"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28607"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLA8"
FT                   /protein_id="ACM28607.1"
FT                   /translation="MKQFFLASMLAGALALPAFAADYTIMAPANPGGGWDQTARSIQSV
FT                   MQQEGISRNVQVQNVPGAGGTIGLAQFASQASGNPNALIVGGYVMVGAILTNKSPVSLK
FT                   DVTPIARLTGEYEAIVVPAASPLKTMGDLVEALKKDPGSVSWAGGSAGGTDHIAVGLIA
FT                   KAAGVDPTKINYIAFSGGGEALAAILGSQVTAGISGYGEFESQVKSGALRLLAVSSGER
FT                   LDGIDAPTIKESGLDVVVENWRMIAAAPGLSDEQKAAVSSDVEKLAKSAGWQELLKTKG
FT                   WEDTYLAGDAFKEQLAKDISATEGVLKDIGLVQ"
FT   gene            complement(25488..26555)
FT                   /locus_tag="Arad_7019"
FT   CDS_pept        complement(25488..26555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7019"
FT                   /product="iron ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7019"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28608"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLA9"
FT                   /protein_id="ACM28608.1"
FT                   /translation="MRPLFVLLTICLNASLAAAEPVVFPALSGNEKAPEVIVYSSLDEP
FT                   LATPMIRGFQTANPDVAVRYEDMLTGEIYDRIVKETDAGGRTADFAFSSAMDLQVKLSN
FT                   DGYAQRSDLPMSGRWPEWANWRNTAYALTFEPAVFVYHKPSFTQEKPPSTRAELVDYLK
FT                   RHGNEVRGRIGTYDIERSGVGFLFMARDQEQFGDIWSVIQAMGAAGVKVYSTSTAILER
FT                   VSDGRFTLGYNILGSYAANWASRYPDVGIVLPRDYTVVMSRIGLVPQAAASPDLGKRYL
FT                   AFFMSKEGQTIMARELQIPAVSPDVAGANTANTMREMLGGQLRPVPVSPGLMVYLDQVK
FT                   RARLIARWNEALRLQ"
FT   gene            26738..27412
FT                   /locus_tag="Arad_7020"
FT   CDS_pept        26738..27412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7020"
FT                   /product="two-component response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7020"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28609"
FT                   /db_xref="GOA:B9JLB0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLB0"
FT                   /protein_id="ACM28609.1"
FT                   /translation="MRILLVEDNKALSEGLFAILRGTGYAVDAVGDGASANAAAAAETF
FT                   DLVILDLNLPEMDGLDVLRAMRARQNKAAVLILTARGTQEEKVRGLDLGADDYMIKPFD
FT                   ISEFEARVRVLLRRQAGLRASLVAYGNVSLDLNSRTFSANGVPIDIPARELGLLETLFM
FT                   RAGRVVAKEAIIQSLAAFDDDLSANAIEQYVSRLRKRLAPHGLTVRTARGIGYYLDKLA
FT                   DG"
FT   gene            27409..28800
FT                   /locus_tag="Arad_7021"
FT   CDS_pept        27409..28800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7021"
FT                   /product="two-component sensor histidine kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7021"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28610"
FT                   /db_xref="GOA:B9JLB1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLB1"
FT                   /protein_id="ACM28610.1"
FT                   /translation="MRAQSAYSLRRRLLAWLLIATVVIGVVALADTYREALTTANTVSD
FT                   RVLAGSALAIAERVVVAEDGTLEVDIPYVALEMLTSAAQDRVFYRVDGPPGRFITGYQN
FT                   LPSIADMKGQAAVYADHMFGGEPIRLAVLERSASTGINSVPFTVTVAETTIGRTQLTQA
FT                   ILLRSALRLLILILGAAIIVWIAVTVSLRPLYRLGDAIAERSPDDLHPIRQSAPSEVEG
FT                   LVETVNSFMVRLQSALDALRHFTGNAGHQLRTPLAIIRTQLALSARATSLDEAREAARK
FT                   GDEAVAHAERILAQLLLMAKVEAAASKEPQSQTTLDLVSLAQRITGDHVPGAGEAGIDL
FT                   GFEGEGSALIRAEPLLIGELLRNLIENAIAYAGRGTEVTVRVEAKGEVVCLDVEDNGTG
FT                   IPLDKRQSVRQRFARGGGGQAPGMGLGLPIVEEIAGLFGGSLTLGEGAGGKGLKASVIF
FT                   PGKLD"
FT   gene            complement(28939..30471)
FT                   /locus_tag="Arad_7022"
FT   CDS_pept        complement(28939..30471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7022"
FT                   /product="aldehyde dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7022"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28611"
FT                   /db_xref="GOA:B9JLB2"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLB2"
FT                   /protein_id="ACM28611.1"
FT                   /translation="MSTLDLASEVSKILTDLGVAADRYTGGTLAVTSPVTGAEIGRLRE
FT                   DSAADAKAAIDKAQDAFLAWRNVPAPKRGELVRLLGEELRAGKAALGRLVSIEVGKITS
FT                   EGLGEVQEMIDICDFAVGLSRQLYGLTIATERSEHRMMETWHPLGPIGIISAFNFPVAV
FT                   WSWNAALAMVCGNSTIWKPSEKTPLTALATQALFEKALKRFVAEGGDAPANLSTLIIGG
FT                   RDLGEILVDHPKVPLVSATGSTAMGRAVGPRLASRFARAILELGGNNAAIVSPTADLDL
FT                   TLRGVAFSAMGTAGQRCTTLRRLFVHESVYDQLVPRLQKAYGSVTIGNPLEQGTLVGPL
FT                   IDKQAFDRMQAALGEAKSAGGKVTGGERVENGSADAFYVRPALVEMPAQTGPVENETFA
FT                   PILYVMKYSDFDAVLALHNAVPQGLSSSIFTNDMREAEAFVSARGSDCGIANVNLGPSG
FT                   AEIGGAFGGEKETGGGRESGSDAWKAYMRRATNTINYGRTLPLAQGVKFDVE"
FT   gene            complement(30591..31874)
FT                   /locus_tag="Arad_7023"
FT   CDS_pept        complement(30591..31874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7023"
FT                   /product="oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7023"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28612"
FT                   /db_xref="GOA:B9JLB3"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLB3"
FT                   /protein_id="ACM28612.1"
FT                   /translation="MLNNPRSHGLWEKTAPAGPVTSALAGDVTADVVVVGGGYTGLSAA
FT                   LHLAEAGQSAVVLEAVEIGFGGAGRNVGLINGGMWVMPDDIPGVLGPVHGERTLDLLGG
FT                   APLLVREIVERYEIPCEIEKNGTLHLAVGADGLKELQERHRQWTARGAPVQLLSAEETA
FT                   RRVGSAAYAGSLFDPRAGTIQPLAYARGLAHAAIRAGTKIFTGSAVIATERQGDGWKVS
FT                   TAHGSVSAKWIVVATDAYSTGPWEQVRTEQVHLPYFNFATVPLGDNVRKSILPGREGCW
FT                   DTKEVLSSFRMDQAGRLVIGSIGALRNTGLAVHRSWARRSLKKLFPHLGDIAFENEWYG
FT                   KIGMTNDAVPRFHKFAENVIGFSGYNGRGIAPGTVFGKTIAHHILGDISEAELPLPLTA
FT                   PKDPSFRAAKELYYEAGAQLAHLTSDRF"
FT   gene            32141..33037
FT                   /locus_tag="Arad_7024"
FT   CDS_pept        32141..33037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7024"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7024"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28613"
FT                   /db_xref="GOA:B9JLB4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLB4"
FT                   /protein_id="ACM28613.1"
FT                   /translation="MGMNMITPRRFLPSLSLLSAFEAAARTGSVTVAARELDLTQSAVS
FT                   RQIKALEGQLGVELFVRERQTIRLTLAGDSYAREIREALRRISSASLDLRANPNGGTLN
FT                   VAILPTFGTRWLAPRLGDFLATNPGITINLVTRLSPFDFRLDSIDAAIHFGHPHWPGAE
FT                   LAFLMSERTMPACSPDFLARHRLVEPADFLQVPLLHLTTRPDAWEKWLAANGAPASGVR
FT                   GMLFDQFATAAQAAISGLGVALLPTFLIQEELKRGELVAASPNELESDERYYLACPFER
FT                   LAYPPLVRFREWIVNQR"
FT   gene            33195..33371
FT                   /locus_tag="Arad_7026"
FT   CDS_pept        33195..33371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7026"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28614"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLB5"
FT                   /protein_id="ACM28614.1"
FT                   /translation="MQEREAVRNEIPLHVVDRLESEWRSVQVERSSLGRAPKTDTVDRA
FT                   ATMPVGNLGTANS"
FT   gene            complement(33461..34318)
FT                   /gene="tauC"
FT                   /locus_tag="Arad_7028"
FT   CDS_pept        complement(33461..34318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauC"
FT                   /locus_tag="Arad_7028"
FT                   /product="taurine uptake ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7028"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28615"
FT                   /db_xref="GOA:B9JLB6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLB6"
FT                   /protein_id="ACM28615.1"
FT                   /translation="MSDITTFSTSSDMADDDNAGTNAAPVRAVDFRGGGFAPTPVRGMA
FT                   IAVFVILIALAEIGTRTGIVSNLTLPRPSAVLETFLQLWRTGLLWQHLLPSLQRLFVGA
FT                   TLGITAGISIGVCIGLFSHVRAGLVPLVAALFPIPKIALLPLFVIWFGIDETSKYALIA
FT                   FGTFTPTVVATYGAVDNVDRSLIRMGQSFGLSWWSIVRKIVLPGAFPAILSGLRVSISI
FT                   AIILLVAAEMLGAQFGVGAYILEAGSLYDLEKLFTGVAILSMMGLIVNFVIGQIERRFL
FT                   NWRG"
FT   gene            complement(34311..35078)
FT                   /locus_tag="Arad_7029"
FT   CDS_pept        complement(34311..35078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7029"
FT                   /product="nitrate/sulfonate ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7029"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28616"
FT                   /db_xref="GOA:B9JLB7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLB7"
FT                   /protein_id="ACM28616.1"
FT                   /translation="MDLKLKNISHRYGSVEVLKDISLDIPQGQIVCLIGPSGCGKSTLL
FT                   RFLGGLERPSSGEVLQIGNPPAGSLNPLTYVFQHFALLPWRTVEGNIKLVLEEHGIGKR
FT                   EMDAIVTDVLERTRLSEFRRTLPKQLSGGMRQRVAISRALAVRPAVMLMDEPLSALDSQ
FT                   TRELLMDDLISLWTRQPFTSVYVTHNLNEAVRLGHRVVVLSRRPGRIRDIVDIDIPLAD
FT                   RHLGDPVLEEKQKQLWELMREEAMAADKELVNV"
FT   gene            complement(35127..36149)
FT                   /locus_tag="Arad_7030"
FT   CDS_pept        complement(35127..36149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7030"
FT                   /product="nitrate/sulfonate/bicarbonate ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7030"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28617"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLB8"
FT                   /protein_id="ACM28617.1"
FT                   /translation="MTLTLNRRQALIGMGAVGAATAFGMPARAATRNLAVLHLASHAPS
FT                   FIAYERGYYKEVGLDIDLKFFEAAQPMAVAIASGDADFGVTAMSGGLISLAQKDAVKVI
FT                   GGALTEEKGTVGAIILASNKAYDAGLTDPSKLAGKSFGITTAGSSFHFMIHKIAQANNI
FT                   KLSDIQLRPLQKLGAIVGALSTGQIDAWAIQPNVAKQMLREGAAKQIGLVSDYAPNYQV
FT                   TTAFTSTKNAKNERELTEAFVKAYSKAIADYNAAFVDNKAADAERDDLAKIVHKYVESD
FT                   SPFETAKQNLIDGAMRINNGLALSLGSCVEQLEWFKSEGMVKEAITNEQLFDTSYVKTI
FT                   "
FT   gene            complement(36297..36467)
FT                   /locus_tag="Arad_7031"
FT   CDS_pept        complement(36297..36467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7031"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28618"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLB9"
FT                   /protein_id="ACM28618.1"
FT                   /translation="MYRHANTLFPDFEDRRIGTAAENVEDIGIGGGHLLPETAAEEVLG
FT                   ALLPFLEKIAR"
FT   gene            complement(36492..37187)
FT                   /locus_tag="Arad_7033"
FT   CDS_pept        complement(36492..37187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7033"
FT                   /product="Conserved Hypothetical Protein mll2483"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7033"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28619"
FT                   /db_xref="InterPro:IPR021255"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLC0"
FT                   /protein_id="ACM28619.1"
FT                   /translation="MAFIATAGLIGAVVFLALGIGLSGRDWAEARHLWGAMPSTCGSAA
FT                   STSQQVILPFTAVDRLVINLPASVRYQPGDKAEAIISGDPALLDHVRMEGGKLSLDCDP
FT                   GWIESRLDVSLSGPAIADWKLLGSGNLTLSQINQPLLRLSIRGSGSVAATGAADTVDLD
FT                   ISGSGAARLKNLTAKSAEIKVRGSGDVQLAAQADADVSISGSGNVELFGRPILRRSEIR
FT                   GSGRIRQVP"
FT   gene            complement(37234..37608)
FT                   /locus_tag="Arad_7034"
FT   CDS_pept        complement(37234..37608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7034"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7034"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28620"
FT                   /db_xref="GOA:B9JLC1"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLC1"
FT                   /protein_id="ACM28620.1"
FT                   /translation="MRRFEAHWSMSNMLAAAMALAGLAIVDILFLLPLLIVTVVITFGL
FT                   AIALVAIGAIGVKIIFTTLLFDFGGPIIGIIARLLIGAGLVSCLLGGGALLLMGLGAGI
FT                   RMLGHYARLHFRLAELDQRA"
FT   gene            complement(37800..38159)
FT                   /locus_tag="Arad_7035"
FT   CDS_pept        complement(37800..38159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7035"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7035"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28621"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLC2"
FT                   /protein_id="ACM28621.1"
FT                   /translation="MLYAYCKPEAFMTDSIQVQLRKGALDLCVLAVLSRGESYGYEIAS
FT                   TLVAAVGMGEGTIYPLMRRMQNDGLVATRIVESSNGPPRKYYRLTPLGRTIFEAHRRDW
FT                   RSFAGAVDKLLEDLP"
FT   gene            38306..39277
FT                   /locus_tag="Arad_7036"
FT   CDS_pept        38306..39277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7036"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7036"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28622"
FT                   /db_xref="GOA:B9JLC3"
FT                   /db_xref="InterPro:IPR005065"
FT                   /db_xref="InterPro:IPR016986"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLC3"
FT                   /protein_id="ACM28622.1"
FT                   /translation="MTMIRLRFFLAALFCLAAPLAHAAGFQLIEIPADGPLPALKGGIW
FT                   YPCAQPAGDVTIGPFTMSVTKDCPIMGETLPLVVVSHGRIGSALGHRDTAETLADAGFV
FT                   VVAISHPGDNSLDQSRTRDFSVFVERPADIRRVIDFVLGPWPNAGKIDARRIGMFGFSR
FT                   GGYTGLVAIGANPHFGKRLRLCDGNSSVLCDQVHKGELPELAHDPRIKAAVIADPLSVF
FT                   FTPDSFENVKIPVQLWGSERGGDGVTPESVVAISNQLPTKPEFHAVPNSQHFDFLPPCP
FT                   AELAKSAPEICADRSGFDRTEFHRKFNAEVLAFFRKHLVDVQ"
FT   gene            complement(39331..41052)
FT                   /gene="ftsI"
FT                   /locus_tag="Arad_7037"
FT   CDS_pept        complement(39331..41052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsI"
FT                   /locus_tag="Arad_7037"
FT                   /product="cell division penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7037"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28623"
FT                   /db_xref="GOA:B9JLC4"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLC4"
FT                   /protein_id="ACM28623.1"
FT                   /translation="MSILHTFSIKSGRLVELTFSSGARRRNIVASGRKNRQAKSRILTL
FT                   AGVLTMAYLAICGKLVYFDSQPAVDTANIPSGPVIAWRPDIVDRNGELLATDIRTVSMF
FT                   AEPFHIVDVDEAVEKLSTLFPDLDKKTLYQKLSDKRSHFAWLRRQLTPKQQNEVLGLGI
FT                   PAIGFRPEVKRFYPGGRTAAHILGYVDIDNHGVAGIEKYLDGQGLSDLTSAGMTSRDSL
FT                   QPVHLSIDLRVQNIVHDVVSDAIGQYQAQSAGAVILDIHTGEVLAMASAPDFDPNDPQA
FT                   DIKGWLNRMSDGTDEMGSVFKTFSIAMAIDTGTVKLTDTFDASAPLHYGGFTIHDDRDV
FT                   PRRWLTVPEIFRYSSNIGTAKIMDKVGMDVQKTYLTRFGLLSRMQTELPEVKAPSQPKV
FT                   WKKINSITIAFGHGVATTPMQTAVAGAALIDGGELIEPTFLPRTREEAEKTEKMVVKKS
FT                   TSDVIRYLFKLNGEQGTGKTADVPGFHVGGKTGTANKVINGVYSHKLSFNSFLAAFPME
FT                   NPRYVVLSFIDQPLTGLHNLNLAAETAAPMVHDIVSRAAPLLGVEPNFGQNLLTAY"
FT   gene            41356..42324
FT                   /locus_tag="Arad_7038"
FT   CDS_pept        41356..42324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7038"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7038"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28624"
FT                   /db_xref="GOA:B9JLC5"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLC5"
FT                   /protein_id="ACM28624.1"
FT                   /translation="MSDRELHASQVQSALVGSAAAQSAVVASWSRSMRLYGLDPEDGAS
FT                   PDVLTEAEFRQVRERLGSLVQTAQASLDRLYSAVGGAGCCVLLADKDGVPVDRRGSVAD
FT                   DAVFCKMGLWTGAVWSEERAGTNGIGTALAEQRALTIHRDQHFFSRNTALSCTVAPIFD
FT                   HRGRLMAAIDVSSARSDLTEDFVKLIALAVGEAARHVEAENFRLAFPKARIVLAQSGAD
FT                   PLQERAANALLAVDDDDLVIGASRSARHLLGLTDEALSRPLPAADLLGQRKTARQDYAT
FT                   AERSVIQRALARTSGNISAAAMIMGISRATLHRKLKKLGLY"
FT   gene            42544..44061
FT                   /locus_tag="Arad_7039"
FT   CDS_pept        42544..44061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7039"
FT                   /product="aldehyde dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7039"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28625"
FT                   /db_xref="GOA:B9JLC6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLC6"
FT                   /protein_id="ACM28625.1"
FT                   /translation="MNKVEFHRTVRPNFKKRYGNFIGGKFVEPKSGRYFENTSPVNGQV
FT                   LCEIARSDAQDIEAALDAAHAAKDTWGRTSVAERSLLLNRIAQVVEDNLALLAQAETWD
FT                   NGKPIRETMAADLPLAVDHLRYFAGVIRAQEGSISEVDHDTVAYHFHEPLGVVGQIIPW
FT                   NFPLLMAIWKLAPALAAGNCVVIKPAEQTPASILVFAELIADILPPGVLNIVNGFGLEA
FT                   GKPLASSPRIAKIAFTGETTTGRLIMQYASQNLIPITLELGGKSPNIFFKDVAEEDDDF
FT                   LDKAIEGFVMFALNQGEVCTCPSRALIHESIYDRFMEKALKRVEAIVQGDPLDPATMIG
FT                   AQASSEQLEKILSYLDIGKQEGAEVLIGGERNVLQGDLAAGYYVKPTVFKGHNRMRIFQ
FT                   EEIFGPVVSVTTFKDNDEALSIANDTLYGLGAGIWSRDVNTCYRFGRAIQAGRVWTNCY
FT                   HAYPAHAAFGGYKQSGIGRENHLKMLEHYQQTKNMLVSYSPKKLGFF"
FT   gene            44144..44485
FT                   /locus_tag="Arad_7040"
FT   CDS_pept        44144..44485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7040"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28626"
FT                   /db_xref="InterPro:IPR008497"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLC7"
FT                   /protein_id="ACM28626.1"
FT                   /translation="MNDQVSATPAALDLIKTLQSEYGPILFHQSGGCCDGSSPMCYPQN
FT                   DFIVGDHDVQLGEIGGAPVYISGPQYEAWKHTELIIDVVPGRGGMFSLDNGREVRFLTR
FT                   SRICAVPGS"
FT   gene            complement(44601..46535)
FT                   /gene="mcpAch"
FT                   /locus_tag="Arad_7041"
FT   CDS_pept        complement(44601..46535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcpAch"
FT                   /locus_tag="Arad_7041"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7041"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28627"
FT                   /db_xref="GOA:B9JLC8"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLC8"
FT                   /protein_id="ACM28627.1"
FT                   /translation="MSFLQNAKIRTKVLSIIIPICLIGIAGVLVVSSQYKDTVESYSNF
FT                   ISKDETAAVEMSRASQRVVALSYSAYQILVYSSKDPAMATFTKEYGDNRRILLERLANA
FT                   KRLMPTEATAIDALIVQANNIIALTDQAVKAGLADDNDIATQLLKQADPLIDAEVVAVR
FT                   NWLDAFNKNIAAKSNRLGEQTDHTITYTLIALGIIFAAAILVALLISARGITTPIERLR
FT                   ARMASLARGETEEAVSGIERQDEVGHMAAAVSVFRDNAIERIRLEQEADAGRNLSEKER
FT                   LEREAQKTKDAADTQFAVDGLAAGLAELSNGNVTYRIDKPFVAHLDQLRANFNSSMAKL
FT                   QDTLRAVGDNAQAIEAGANEIRSASDDLSKRTEQQAASIEETAAALEEITTTVKDSTRR
FT                   AEEAGSLVGRARIGAQKSGDVMREAVAAMEAISKSSSEISNIIGVIDDIAFQTNLLALN
FT                   AGVEAARAGDAGKGFAVVAQEVRELAQRSAKAAKEIKALISTSGQQVHSGVDLVTKTGD
FT                   SLQQIVKEVEEIDHNVRAIVEAAREQATGLQEINTAVNTIDQGTQQNAAMVEQSTAASH
FT                   SLAKEVASLNNLLGQFTLQGDRSYQRPAAATQQSAPAASPARSLRAKLAGAFGGAGSAA
FT                   ATAGAWEEF"
FT   gene            46983..48260
FT                   /locus_tag="Arad_7042"
FT   CDS_pept        46983..48260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7042"
FT                   /product="sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7042"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28628"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLC9"
FT                   /protein_id="ACM28628.1"
FT                   /translation="MSVATTRRSVLMGALGLAGAMTSFGAAYAETTRLRLAWWGGNERT
FT                   RRTQEVLRLYQQRVNGVELAGEVSNSEYFTKLATQVVGRSAPDVFQLEPNSFADFVKRD
FT                   CVLALDGLMPNPIDAAGISRAMLDLCAVDGKVWGIPQALNSFAMMYDKDAFATAGVAPP
FT                   DAQTSWDDYADRMVELTKALNRRRYWGSCDASGYSYAFQVWLRQRGRDLFTADQALGFG
FT                   KDDVAEWFAYWDKLRQRGGCVPADVAALSPDSTINLMPLIQGKAATSFAFSNQIVGMQA
FT                   TTPVQLAMTMFPNGGAGAKPGQFYRPASSWSIYAQSPNPEAAARFVNFFVSDPEAAKIL
FT                   GVERGVPMSPALRASILPTLRPVERATVEYIDAIADKVGPYPPPPPKGSQQFGQLMKRA
FT                   ADAVAFNSASISDSAATLMKDAHSIL"
FT   gene            48290..49990
FT                   /locus_tag="Arad_7043"
FT   CDS_pept        48290..49990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7043"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7043"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28629"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLD0"
FT                   /protein_id="ACM28629.1"
FT                   /translation="MQAAANTLEAREHLTAEFDAHPWLFEHHATAGQRSEQEAFIAELA
FT                   QRLPLRIGEACFLSPRAHIFPDSLMLGDRCIVAAGVRIHGQLIAGDHCSFNLNASVIGH
FT                   VRMGSWVRVAAGAVLAGFDHIADDPEKPIALQGVSFKGIEIGDDVWIGANAVVTDGIRI
FT                   GNHCIIAAGAVVTRDVPDYALVGGNPARLIRDRRRPRSSSPPDPLVAEIKVFSDRIGKE
FT                   WSGILAAHAAPTPDRASWYLDPRNNGNAPFRADCDAIQIAAMFGAVPDPFAKEEWTDRL
FT                   AALQDPATGLCFNADTVQAVRDNPPADPGGDNLYNILCVGYALECLGAAFRHPIAWASR
FT                   LDPGTLQRALDGLPWVGRGWSSGAWVDALGTAYYLNTRSFDDPGELATLMGWLTTRADP
FT                   VTGLWGGPVGDDWLQPVNGFYRLTRGTYAQFGIPLPYPERTIDAVLAHLRRNGRFERAR
FT                   FDACNVLDVVHPLMLCARQTDYRAEEVAEVMRHFLSAALRHYTPGQGFAFARSEAPGLQ
FT                   GTEMWLSIVGLILTYLGLSDAASFQLVGVHRWGPALPVGNIRWPTPAVR"
FT   gene            complement(50037..51110)
FT                   /gene="nerA"
FT                   /locus_tag="Arad_7044"
FT   CDS_pept        complement(50037..51110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nerA"
FT                   /locus_tag="Arad_7044"
FT                   /product="glycerol trinitrate reductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7044"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28630"
FT                   /db_xref="GOA:B9JLD1"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLD1"
FT                   /protein_id="ACM28630.1"
FT                   /translation="MSNLFTPVRIGRYELPNRFVMAPMTRSRANDDDGVLSDIVATYYS
FT                   QRADAGLIISEGVYPAATGKGYVRTPGIETDAQVAAWKRVTDAVHARGARIFMQIMHCG
FT                   RISHPSLLAGNAQPVAPSAIKPAGQTWTATGQQDFVTPHALSLAEISDVIAGYRAATRR
FT                   ALEAGFDGVELHGASGYLPEQFLSSGSNKREDQYGGSIENRARFILDVLKAMVEEAGSD
FT                   RVGIKISPEMNYNDVSDATPQETYTYLVRQLNTFNLAYLHVALFGTTVDYHSALKPLFN
FT                   GAYLMGSGLDQAKAEAALDKGQADATVFGSTFLANPDLPARFLKGAALNAPDRDTFFSA
FT                   GEKGYIDYPALDTAGAA"
FT   gene            51464..52831
FT                   /gene="ach1"
FT                   /locus_tag="Arad_7046"
FT   CDS_pept        51464..52831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ach1"
FT                   /locus_tag="Arad_7046"
FT                   /product="Acetyl-CoA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7046"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28631"
FT                   /db_xref="GOA:B9JLD2"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLD2"
FT                   /protein_id="ACM28631.1"
FT                   /translation="MTMIHQALYRERLTSAERAVAMIPSGAKVAMPLAAGQPPAILAAF
FT                   AERARAGAVKNVRLHYLLCTGVAGTSVFDFELRDVIVPMSYFHGGVERALDKRRSAEAL
FT                   PAVDLVPCHFSQVPRSMIEHVGVDTLIATVSPMDADGNFSLGASTDYALTVSRKPGIRV
FT                   ILEVNPNMPYVRGDCMIPVSSVTALVENDAGLPILPAAPRNEVDDAIGAIIAGLVEDGD
FT                   CLQMGIGALPDAVCSGLSRHRHLGIHTEMMTPGLARLVKAGVVDNSRKQTHVGRSIFTF
FT                   ALGDQALYDFLNNNPDVEAYPVDYVNNPFVIAQNDRVVSVNATLQIDLNGACNSEFVNG
FT                   RQFSASGGQVDFVRGAYASRGGRSIIACHSTAAKGTLPRIVPALTGPVTTSRNDTHIVV
FT                   TEYGWANLKGKSVAERARALIGLAHPDFREDLDRAAHGAGLYADAALDARAVNTDR"
FT   gene            complement(53159..54244)
FT                   /locus_tag="Arad_7047"
FT   CDS_pept        complement(53159..54244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7047"
FT                   /product="insertion sequence transposase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7047"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28632"
FT                   /db_xref="GOA:B9JLD3"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLD3"
FT                   /protein_id="ACM28632.1"
FT                   /translation="MCQNELFRSQSKGPPMDKIIRIGMDTSKHVFQLHGVNAADKPVLR
FT                   KKMRRKEMIDFFTTCPPTLVAIEACGGSHHWARLLTSFGHEVEMIAPQLAKPYVKRNKN
FT                   DAADAEGLCEAMSRPTMRFVPVKTVDEQAALMLISVRTRLIANRTQLANAIRGYANEFG
FT                   ISAAKGLAHIPMLLERVQVEKTVPELAQELFMSQAEEYAQLEKKIAAVEAKVKAWQRND
FT                   ERSRRLNTIPGIGPIGSALLIMKTPAPELFQSGRQFAAWIGLTPKDHSTGGKLRLGGIT
FT                   RAGDEALRAVLVAGATAVIHHARRSGKASQWLAELLRRKPPKLAAVALANKMARIAWKL
FT                   MISGQTYRSLGKHTAHNQEQL"
FT   gene            complement(54473..56167)
FT                   /locus_tag="Arad_7048"
FT   CDS_pept        complement(54473..56167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7048"
FT                   /product="FAD-dependent L-sorbose dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7048"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28633"
FT                   /db_xref="GOA:B9JLD4"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLD4"
FT                   /protein_id="ACM28633.1"
FT                   /translation="MIADHLILGGGSAGCVLAARLSEDPKRMVVLVEAGRNIAAGDIPD
FT                   DVRSRYPGRAYLDTSNIWSSLTALMGSSRSNSVPRSSRRYEQAKILGGGSAINALMANR
FT                   GAPSDYAEWEGLGATGWGWESCLPYFRRIEADRDFGGPLHGANGPLSIRRITDEKISPF
FT                   VDRVMKTLETRGHPIRPDQNGPWENGTFRGAVAVSDAGERLPTSIAYLTPDVRQRPNLT
FT                   IITDSTATRILFEGTRAIGATLTGTRSQTIKAHEVIVASGAIHSPALLLRSGIGPGADL
FT                   AALGIPVISSRAGIGRNLMEHPSIAVAAYLPPRMRVRDRTEHHEQSIWRFSSGLPDTPQ
FT                   GDMHAAILSRSGWHSVGLRMGSLFFWVNKSYSRGVLKLGSADPLAEPEVDFRMLTDERD
FT                   LERLKLALCMGAQVLLDPHMNGYRGTVFPSSYSPRVAKVAVPGAWNAIQRGALSAMLDL
FT                   AGPLRAALIHSAVTLRTTMEDLLNDDAMLTEFVRRHVGGTWHPSGTCRMGSPDDPMAVT
FT                   SATGRVYGVEGLRVCDASLMPSIPCANTNIPTIMIAERIADFIRGGQ"
FT   gene            complement(56164..56961)
FT                   /locus_tag="Arad_7049"
FT   CDS_pept        complement(56164..56961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7049"
FT                   /product="polyamine ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7049"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28634"
FT                   /db_xref="GOA:B9JLD5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLD5"
FT                   /protein_id="ACM28634.1"
FT                   /translation="MRMPKILLYAVVVLILAWLIIPILIIVPMSFSGARFLSFPPPSWS
FT                   LRWYEAYLSSAAWMQATRVSLIVSVSSAILATIFGTAAAYALDMTSSRLVRSLQMLLLL
FT                   PLIVPIVITAVGVFLVYAQIGLLATMTGLILANVMLGLPYVITSVLVGLRKFDHTQEMV
FT                   SRSLGMNRLRTFFVVTLPQIRPSVISGMLFAFISAMDETVVSLFISGGQYQTLTKRMFT
FT                   ALRDEIDPTIASISSLLTAISFILVMLVAINARNTDRRQGKAA"
FT   gene            complement(56965..57837)
FT                   /locus_tag="Arad_7050"
FT   CDS_pept        complement(56965..57837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7050"
FT                   /product="polyamine ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7050"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28635"
FT                   /db_xref="GOA:B9JLD6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLD6"
FT                   /protein_id="ACM28635.1"
FT                   /translation="MTVSTSNPSERHDRREQRLMLMLLAPALLVVVSLLIVPLLWLAWQ
FT                   SIWQDGGFTLVNYERFLTDSVYWMTFLQTFRIAFVVTLATLLLGYPVAYVAAGLPQRWS
FT                   VLILAMVLLPFWTSVLVRAYAWLILLQRTGIVNSALKSAGLIDSPLLLVNNEFGTVLAT
FT                   IHILLPFMVLPLYATMKKIPPELTMAGASLGGSPAHVFARVFLPLSLPGVIAGMVLVFV
FT                   LTLGFYITPELLGGGRTYMVSMLVSRNIEVYNEWGAASSISVVLMACVFLIFRLASLII
FT                   PFERIMGTR"
FT   gene            complement(57863..58903)
FT                   /locus_tag="Arad_7051"
FT   CDS_pept        complement(57863..58903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7051"
FT                   /product="polyamine ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7051"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28636"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLD7"
FT                   /protein_id="ACM28636.1"
FT                   /translation="MILKFSTLVLSASAIALSAGLASAEQITFVSQGGAYQDAQTKAIL
FT                   DPVAKLLGITINQDSAPDAWPVIKTQTSTGKPIWDVVDTPTQDCVRGGQQGMIETLDFS
FT                   KIPNAEKMPAEYKSPYSVAYEFYSSVLAYNKDKFGTNPPKSWADFWDVKKFPGTRALRN
FT                   HPLATLEAALLADGVPADKLYPLDVDRAFKKLEEIKPYVTVWWTSGAQSAQLLADGEVD
FT                   MEMAWNGRVTAVAKEGAPISYTFNQGFLQYTSLCILKGAPNLDTAVKFVNAAMTPEIQA
FT                   NFPTYIDYGPGNPEAYKTGKISPERAAEMPSSPENAAKQVLVSDKWWSSPAGEEAQKRW
FT                   ASFIQK"
FT   gene            complement(58968..60275)
FT                   /gene="ordL"
FT                   /locus_tag="Arad_7052"
FT   CDS_pept        complement(58968..60275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ordL"
FT                   /locus_tag="Arad_7052"
FT                   /product="oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7052"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28637"
FT                   /db_xref="GOA:B9JLD8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLD8"
FT                   /protein_id="ACM28637.1"
FT                   /translation="MAAAHPPFPDINSLWQEAAVDRPVFGTLSGDHRYDVAIIGGGYTG
FT                   LSTARYLARRGLSSVVLEANRIGWGASGRNGGVVSGKFRLAFSEIAGRFGIETARRMHD
FT                   LGIEAIEHVGELVEDYGIASAGYSPTGSLRCAHNAVSLEALKTEVDWLQQALGDSACSI
FT                   LSPGDMERETGSRDFAGGMLNTHGGVIHPLNFVFGIAAGLKAAGIDIFENAPVTGLRRE
FT                   SSGVRLETPRGTITARQAVIATNSYSDLTHATAAVRKAIIPFRSAMIATEPLSGKAGGA
FT                   LLANGRSYTETRRMMRWFRKAGDRLLYGGRGAFGKTDSESAFTALHKAMVRQFPELSDA
FT                   AVTHRWSGLVAMTMDSIPHVGRLDERVVYAVGYNGTGVALASNMGKHVAAIVAGESPDL
FT                   GLLTSERLKPVPFYPIREPAVRLVAGWYQFLDAIGR"
FT   gene            complement(60285..61016)
FT                   /gene="dehII"
FT                   /locus_tag="Arad_7054"
FT   CDS_pept        complement(60285..61016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dehII"
FT                   /locus_tag="Arad_7054"
FT                   /product="haloacid dehalogenase, type II"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7054"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28638"
FT                   /db_xref="GOA:B9JLD9"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLD9"
FT                   /protein_id="ACM28638.1"
FT                   /translation="MKLTEFKVMTFDVVGTLIDFETGVLNAVRALGGEKADAASDDEIF
FT                   EPYKRGRDKFYGRSSFAMKDVYLSLATECGFVKDAATAEAFQLAVLRWPAFSDSVEALA
FT                   RLRKNFRLVAMTNADRTAFSAYSDTLGNPFHDSVTCDETGCAKPNPQFFAFNKGRQSAS
FT                   GFKQSEILHVAQSQHHDIGVAKELGYTTCWIERRQGQKGFGGTPEPKVLTKPDFHFSSL
FT                   KQLADAVDAELAAGVQTASAA"
FT   gene            complement(61058..62149)
FT                   /locus_tag="Arad_7055"
FT   CDS_pept        complement(61058..62149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7055"
FT                   /product="polyamine ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7055"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28639"
FT                   /db_xref="GOA:B9JLE0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLE0"
FT                   /protein_id="ACM28639.1"
FT                   /translation="MIDLKSAERLGVSIRAANKSYGEFRALDNVSLEVAAGEFVSILGP
FT                   SGSGKTTFLGILGGFVQPTSGSIWLGERDITFEPPHKRNIGIVFQNYALFPHMSVAENI
FT                   TFPLRARRLPKSDWPSKLREALDMVELTGYGERRVHELSGGQRQRVALARAMIFEPGLI
FT                   LMDEPLSALDKQLRETMQIELKRLHKRLGATIIYVTHDQREALTMSDRVAIMNKGRFVQ
FT                   VDTPEQLHDHPADSFVARFIGEATLLPVKREGDDSVRLGDTVLRTSHRVPENRHLHLAV
FT                   HSEKLVVADGSEPSASNRLTGTVTDTLYQGESIRVFLTLSSGGDLSLRLPSNHAGRAQL
FT                   KKPGDPITVALHPEDTIIVPEAS"
FT   gene            62384..63346
FT                   /locus_tag="Arad_7056"
FT   CDS_pept        62384..63346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7056"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7056"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28640"
FT                   /db_xref="GOA:B9JLE1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLE1"
FT                   /protein_id="ACM28640.1"
FT                   /translation="MNKLRRSLPSMNGLFTFEAAARCGNFSKAADELNVTPAAVSRMIA
FT                   RLEEHLDTALFSRQPGGVGLTESGRILFDAIARGFSAIENALREIEDRRIGIQTVSLSV
FT                   STGFTTHWMMPRMAEFKKQFPTVDLRFQLVMGALAGPVNDVDLGMRFVNGSDERHEAVF
FT                   VMPEILVPICSPAYRESHGPDGNDMKRSPDTTINLSDAQPNWSSLFSPANEGDAVNSMI
FT                   FSDYAIVVQAALLGQGVALGWLNVVAHWLRTEALVPAREHLMTTGRQCHLVRLRDKPAR
FT                   AIVTQVRDWMIAELNSDIVAVDALYPTLRLDPGSWSKAG"
FT   gene            63760..64524
FT                   /locus_tag="Arad_7058"
FT   CDS_pept        63760..64524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7058"
FT                   /product="amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7058"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28641"
FT                   /db_xref="GOA:B9JLE2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLE2"
FT                   /protein_id="ACM28641.1"
FT                   /translation="MKDASGKALIGLHLLSKRYGTHTVLDKIDLEVGSGEVLAIIGPSG
FT                   SGKSTLLRCINYLEPPSGGTITIGPTTINAAQPVSRTELSSLRRRVGMVFQSFNLFPHM
FT                   SVLRNVSLAQERVLGRSRAEADERSMQLLSRVGLTDKAAQFPGRCSGGQQQRIAIARAL
FT                   ALDPEVMLFDEPTSALDPELGLEVLAVMRELATSGMTMIVVTHEMGFAENVSDTVMIMA
FT                   DGQIVEKGPSAEVMRNPQHERTRRFLRAVHDR"
FT   gene            64521..65165
FT                   /locus_tag="Arad_7060"
FT   CDS_pept        64521..65165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7060"
FT                   /product="amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7060"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28642"
FT                   /db_xref="GOA:B9JLE3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLE3"
FT                   /protein_id="ACM28642.1"
FT                   /translation="MSAADLLMFVRGLAWTTALTMGSFAIGAILAIPLLAARRSRFFPV
FT                   RFLASVAIQIVRAIPPILWLFIIFFGLGISLFPISPFVAALAGLGLIAAANMAEIYRGA
FT                   LSSIHHGQWEACAALDLGRWSTMRDVVAPQAFRVALPSGASYLIGLMKETAVASTIGVT
FT                   ELAYQGNQLSQLTFRGLEIFAFVGLFYIFLSLPVAWLSRLADAHLRSRVAR"
FT   gene            65165..65827
FT                   /locus_tag="Arad_7061"
FT   CDS_pept        65165..65827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7061"
FT                   /product="amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7061"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28643"
FT                   /db_xref="GOA:B9JLE4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLE4"
FT                   /protein_id="ACM28643.1"
FT                   /translation="MFPSYDEIVSWMPELLGGLSISLQVTVLSLLLGIPFGLLLALGVL
FT                   ARSKALRAVSLILVEVGRGAPALVLLQFIYFGLPSVGLTIESFAAAVIALAWNTGAYTS
FT                   EIIRASLQSIAHGQREAAEALGLNRTDELRFVLLPQGLRVALPALLGFSILIFQGTSLC
FT                   FTIALPELVSRAYEIGSTTFRYFPALLCAGALYACISIPAALLVSHVEKRASLYAQH"
FT   gene            65852..66691
FT                   /locus_tag="Arad_7062"
FT   CDS_pept        65852..66691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7062"
FT                   /product="amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7062"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28644"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLE5"
FT                   /protein_id="ACM28644.1"
FT                   /translation="MPAFKSKAYLLLSGIAGMLLSAQITHAADCTPQHKFTTIEPGTLT
FT                   VAVTTYAPHSYLDDSGGMKGIDGDIAAEFAKRECLKVKAVAVDPAAAIQYVLSGQADIT
FT                   TGDWYRTAERAKVMSLSAPLYTDQMAIYSKQDFKKVSDLEGKKVGTVQGYLWVSDLKTL
FT                   LGASLKLYPNSVNMQQDLFAGRIDVAVDGYSTGVVAAQKGALKDVKVAVATADPRVKAT
FT                   KEAAQAGFPYSLKAKEFGEALDSNIEAMHKDGTIVKILKSYGLDGTAGETGAPRLVQ"
FT   gene            66759..67493
FT                   /locus_tag="Arad_7064"
FT   CDS_pept        66759..67493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7064"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7064"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28645"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLE6"
FT                   /protein_id="ACM28645.1"
FT                   /translation="MTVYTVTRKTQSWYGEQIGILILDAAYPCVPGNVGNASTYTYPVR
FT                   FQEVRGASIDRLLNQRDPALKEAFVEAALELQDRGVKAITGACGFMAYFQEEVATALDI
FT                   PVFLSSLMQVPFMHALCGGSVGIITANASRLTPRHFKACNIPDGIPLAIAGMEDQTEFR
FT                   QAILEEKGTLDSAEIEREVTQVARRLVEEHPDVRSILLECSDLPPYAHAVQAATGRPIF
FT                   DFITMINYVRQSIAHRPYVGSM"
FT   gene            67523..68668
FT                   /locus_tag="Arad_7065"
FT   CDS_pept        67523..68668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7065"
FT                   /product="oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7065"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28646"
FT                   /db_xref="InterPro:IPR005399"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLE7"
FT                   /protein_id="ACM28646.1"
FT                   /translation="MSVDEYYLLGRSGLRVSRLALGTMTFGNGGIRGIGGNWGADEATA
FT                   RAIFNRYIAAGGNFIDTANSYAGGLSEKLVGALVAETGLRDDVVIATKFSNNVSPGNPN
FT                   AGGNGRKAMLQAVDASLKRLKTDYIDLYLLHTWDRMTPAEEVMRTFDDLVRAGKIRYAG
FT                   FSDVPGWYAARAQTWAEAHALTQPICLQLPYSLVERSIEHEFMPLAETLGLGITAWSPL
FT                   AMGLLSGKYRPGSTEQGRLSQDASGGGLGLFTERNTGILTVLERIAGELGRSMAQVALN
FT                   WCVNRPGVAAAIIGASRLSQLDDNLAALDFTIPPEFRSELDSATAIEAPYPYALFADDY
FT                   QAAILNAGAYVGDKPPSYRREILLPKITDYTFGQPKAKDPD"
FT   gene            complement(68709..69653)
FT                   /locus_tag="Arad_7066"
FT   CDS_pept        complement(68709..69653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7066"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7066"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28647"
FT                   /db_xref="GOA:B9JLT3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLT3"
FT                   /protein_id="ACM28647.1"
FT                   /translation="MHRLRSLVPSANYLFVFEAAARRRSFTAAAEELNVSQPAVSKTIK
FT                   LLEEATGLKLFRREHTRLELTAEGQRLYRETQQAFDHLHMVLTSLRTKHSNDTVRVSFS
FT                   TSFVQLWLLPRLKDFKVKHPDIALRIEESSRDDQDLNEEDIDISARLGAGKWPGIHAWH
FT                   FVTEEVIPVCNADYLREHGPINVPADLLNHRLLHFEERHRVRLGWRDWLLHHSVPVARL
FT                   AQDFVFTDALSSIEAAVLGQGIALGWKHLVHDHVQAGRLVYPLDAVHRSGQSIYLVMPA
FT                   QRPAKHGAMLFRDWLLEQDADAPIFETTDIPAA"
FT   gene            69746..72187
FT                   /locus_tag="Arad_7067"
FT   CDS_pept        69746..72187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7067"
FT                   /product="glycine cleavage system T protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7067"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28648"
FT                   /db_xref="GOA:B9JLT4"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR032503"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLT4"
FT                   /protein_id="ACM28648.1"
FT                   /translation="MQTHARAVVIGGGCVGAAILYGLAKRGWTDVALLERTQLTAGSTW
FT                   HAAGLIPSYARSINIGRMIAKTIEIYEGLEAETGQHVGWHKCGQLRIANTRDRLDEYKS
FT                   YMSVATVQGIRAELVTPQEARRLWPLLENNHDMLAALYHPDDGHIAPADVTQAMAKGAR
FT                   DRGAKIYLNTEVRGFERMPGGEWKILTNNGEIICEHVISATGNYARQTGAMLGLEIPAI
FT                   PIVHQYWITDAVPEVIERKRQGLPEMPILRDEAFEGYLREEGDGLMFGPYERTEHLKLF
FT                   AENGVPEWFGADLLEEDFDSVSWNWERAMELVPALGRVGIKANVRGPFQMTADELPLVG
FT                   PAWGLENVWIAEGVPGGILWGGAIGYYLSERIVEGANSLDTSELDPRRFGDYANKEWTR
FT                   HKVRESWGTHAEQHYPGQDMPAARPQKTAPSYDILTKRGAVWGVLNGWEMPNWFAPEGV
FT                   EARDQNSWRWTEKGKYVGEEVHAVRNIVGLVEMTPMTKFEISGPGAEAWLDGILANRLP
FT                   KVGRVNLSHHLTRNGGVQAEYIVSRLEDGMFYLISTPRAERWNFDDLSKLLPKDGTVQL
FT                   RNATNERGCFTIVGPKAREVLQGLTEMDISNEAFPWFGVKSGTVGLATDVRLLRVNYEG
FT                   ELGWELYHPLCYQRHLLEALLAAGAPHGLRLIGLQALESLRLEKSYRAMYRDMNPELTA
FT                   WESGLDRFIRLDKGEFIGREALLRQKEQGVKQRSVTISIDTDGASSLIHEGVYRNGKLV
FT                   GRITSGGYAYTLGCDVAFALLPAELGTPGTELEVPILGEMRKARVIPESPYDPDALRGR
FT                   M"
FT   gene            complement(72423..72944)
FT                   /locus_tag="Arad_7069"
FT   CDS_pept        complement(72423..72944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7069"
FT                   /product="4-hydroxyphenylacetate 3-monooxygenase small
FT                   chain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7069"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28649"
FT                   /db_xref="GOA:B9JLT5"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019917"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9JLT5"
FT                   /protein_id="ACM28649.1"
FT                   /translation="MQAPSLTVTAPASPSPDERKQEYRDAMARLGAAVNIVTTDGPGGL
FT                   AGFAATAVCSVTDSPPTLLVCLNRTSSAYPAVNANRVLCVNTLERGHEDLSRLFGGKTP
FT                   VHERFEGASWSSLETGAPVLDDALISLDCRVKAISDGGTHDILICDVVAIRENDGGQAL
FT                   IYFDRRYHAI"
FT   gene            complement(72955..73743)
FT                   /locus_tag="Arad_7070"
FT   CDS_pept        complement(72955..73743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7070"
FT                   /product="hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7070"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28650"
FT                   /db_xref="GOA:B9JLT6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR019913"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9JLT6"
FT                   /protein_id="ACM28650.1"
FT                   /translation="MHFEVHGLDRPDAKTIILSSGLGGSGSYWAPQIEALATDFRIVTY
FT                   DHRGTGRTGGDVPDTGGISAMADDVLEIAARLQLDRFDFMGHALGGLIGLDIALRRPEL
FT                   IGKLILINAWSKADPHSGRCFDIRIELLERSGVEAFVKAQPLFLYPAVWMSENAERMAA
FT                   DERHGVAHFQGKANVLKRIAALRAFDIDDRLSEIRTPTLVVGTRDDLLVPYTRSVRLAE
FT                   GLSAAELALSDFGAHAVNVVEPEEFNNKVLRFLRARSEVR"
FT   gene            complement(73749..74138)
FT                   /locus_tag="Arad_7071"
FT   CDS_pept        complement(73749..74138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7071"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7071"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28651"
FT                   /db_xref="GOA:B9JLT7"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019898"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9JLT7"
FT                   /protein_id="ACM28651.1"
FT                   /translation="MPKSIIVPAGTHKPIAPFSPGTLADGIVYVSGTLPFDKNNDVVHV
FT                   GDAGAQTRHVLETIKSVIETAGGTMEDVTMNHIFVTDWANYQAVNAVYAEYFPGDKPAR
FT                   YCILCGLVKPDALVEIATVAHIGKK"
FT   gene            complement(74163..74903)
FT                   /locus_tag="Arad_7072"
FT   CDS_pept        complement(74163..74903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7072"
FT                   /product="isochorismatase hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7072"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28652"
FT                   /db_xref="GOA:B9JLT8"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR019916"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9JLT8"
FT                   /protein_id="ACM28652.1"
FT                   /translation="MSAVTAAGYQAPQERSQSVTLPARPEPITLKPSETAVVVVDMQNA
FT                   YSTEGGYVDLAGFDIAGAKGTIANIKKTLDAARAAGVQVIYFQNGWDKDYVEAGGPGSP
FT                   NYHKSNALKTMRQRPELQGQLLAKGTWDYAIVDELQPQPGDILVPKTRYSGFFNTNMDS
FT                   VLRARGIRNLVFVGIATNVCVESSLRDAFHLEYFGVMLEDATHHLGPDFIQQATVYNVE
FT                   KFFGWVATVNDFCATVSQAAPTEA"
FT   gene            complement(74900..75991)
FT                   /locus_tag="Arad_7073"
FT   CDS_pept        complement(74900..75991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7073"
FT                   /product="monooxygenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7073"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28653"
FT                   /db_xref="GOA:B9JLT9"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019914"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9JLT9"
FT                   /protein_id="ACM28653.1"
FT                   /translation="MEIGVFIPIGNNGWLLSENAPQYKPSFELNKEITLKAEKYGFDFV
FT                   LSMIKLRGFGGKTEFWDHNLESFTLMSGLAAVTTRIKLFATAATLVMPPAIVARMASTI
FT                   DSISNGRFGLNLVTGWQRPEYSQMGMWPGDEYFAKRYDYLGEYATVLRDLWETGKSDLK
FT                   GEFFQMDDCRLSPRPQADMKVICAGSSTAGMEFSAQYADYNFCFGVGVNTPKAFAPAAE
FT                   RLQVATAKTGRDVSSFVLFMVIADETDEAARAKWESYKDGADQEAIAWLGVQGAADTKS
FT                   GSDTNIRQMADSVSAVNINMGTLVGSYETIAKLLDEVPTVPGTGGVLLTFDDFVKGVED
FT                   FGTKIQPLMKCREHIKPMLEAAE"
FT   gene            complement(76345..78168)
FT                   /gene="exsA"
FT                   /locus_tag="Arad_7074"
FT   CDS_pept        complement(76345..78168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exsA"
FT                   /locus_tag="Arad_7074"
FT                   /product="saccharide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7074"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28654"
FT                   /db_xref="GOA:B9JLU0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLU0"
FT                   /protein_id="ACM28654.1"
FT                   /translation="MAFGFKSRRGGAFRSVFRFCWAHWKQQPGRASFMLFTAMLSTFAD
FT                   VLTPLFSGRLVDAVVSGKAGDAATWNNAFNAFCWLMALSIGAVILRHATFTAIIGFTLK
FT                   SMSEIAANSFFHIQRFSSDWHANSFAGSTVRKVTRGMWALDLLNDTVFVALFPSLVMLI
FT                   GSTILMTWYWPMMGLLVGAGSVLFIAFTATMALRYVAPMASMANSWDTRLGGALADAVT
FT                   CNAVVKAFGAEDREDKRLATVMRKWRDRTARTWTRGTLNGTSQNALLSLLRGCVLGLAL
FT                   WLWANGKANAGDITFVLTAFFILQGYLREIGMHIRNLQRSVNDMEELVTIHAQPLGVED
FT                   VPRAPALHVKAGLITFDHVTFHYGNHHAPLYKDFSVTIKPGERVGLVGHSGSGKTTFIK
FT                   LIQRLHDVNHGTVSIDGQDISKVAQTSLRRQIAIVQQEPILFHRSLAENIAYARPTATQ
FT                   AEIRRAAQLASAHDFIEALPKGYATLVGERGIKLSGGERQRIAIARAFLADAPILILDE
FT                   ATSSLDSESEMLIQQAMERLMEGRTTLVVAHRLSTVRALDRLLVFEHGHIAEEGTHASL
FT                   IRRKGGIYRGLFERQALELTKGIASEGLIGE"
FT   gene            78669..80969
FT                   /locus_tag="Arad_7075"
FT   CDS_pept        78669..80969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7075"
FT                   /product="sensory box/GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7075"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28655"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR012226"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLU1"
FT                   /protein_id="ACM28655.1"
FT                   /translation="MFRGISVAKGVIADGKLPISFSEVEPASNAVMSPRMSDDSHHEAD
FT                   LGERQSWLENMINQIPDYIYAKDLEGRFLFANQAIVANNGLSHLKDLVGRTDFDFLPHH
FT                   IAQIATDVERSVAETGQPHFGGEELAFRGGGERWLMITRVPLRDASGTIVGVVGVSRDV
FT                   TAQKSAERRMRAQSGLLEMIARGMPLPNFLEELALMTAGFAKGVHAAFLTITPDPAELR
FT                   LAAAPTLNEDYRKRANATFIRTVPTDLDAAAAALKLAFDQAGISELDHQCRCLAISDAD
FT                   GQIEGILALYSSEGSRFQPDFSEFVSIAVHMAGIAISRHRAEARIGFLADHDPLTGMAN
FT                   RALLDRKLTFAMQTADSTRSEVALAFLDLDNFKLVNDSLGHSVGDQLLKIVASRISELT
FT                   SDQGSLARIGGDEFVIILEQMDLESCLDRLSAIREAVTRPIVLNDIELRVTCSIGVASY
FT                   PSHGSTAGELLASADMAMYRAKELGRDGIALFTSAMTAIVRKKLSRTDELRQALLRDEF
FT                   VLHYQPQVDVRTGRIVAAEALIRWNHSSEGLVYPGDFIALAEETSLIVPIGEWVLKTAC
FT                   RQAKAWQDQGREPIRISVNVSARQFQEKRLIETVATALSESGLDPIWLELEITESLIMK
FT                   DLAGSIARMQELETLGVKLAVDDFGTGYSSLSALKRFPLSRLKIDRSFIADIPHDADDM
FT                   AITAAIISLAQKLGLEVIAEGVETEEQARFLVESGCNEIQGYLFSRPVEEAQFNRMLEN
FT                   NSGMHPLLRTQAS"
FT   gene            complement(81031..81759)
FT                   /locus_tag="Arad_7076"
FT   CDS_pept        complement(81031..81759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7076"
FT                   /product="ribitol 2-dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7076"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28656"
FT                   /db_xref="GOA:B9JLU2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLU2"
FT                   /protein_id="ACM28656.1"
FT                   /translation="MTNKLEGKVVAITGAASGIGLACSKACLESGARVVLIDRAEDRLN
FT                   ALCQELGGNAIPLVIDLADTSSIATMMPQILSKAGQLDVFHANAGSYIGGDLIEGDPDA
FT                   FDRMLNLNINAVFRCVHAVLPHMVERKAGDIIVTSSVAGHVPVVWEPVYTASKHAVQAF
FT                   VHTVRRQVSKHGIRVGAIAPGPVVTALLKDWPPENLEKAMAAGNLIEPSEVAEAVLFML
FT                   TRPRNVTIRDLVILPQNFDI"
FT   gene            complement(81794..82558)
FT                   /locus_tag="Arad_7078"
FT   CDS_pept        complement(81794..82558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7078"
FT                   /product="oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7078"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28657"
FT                   /db_xref="GOA:B9JLU3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLU3"
FT                   /protein_id="ACM28657.1"
FT                   /translation="MTLKQFRLDDKVALITGGNRGIGLAIAQLFGEAGAKSVLTARRDN
FT                   PEADALLNGAGYDYDFVSADATDPAAPDMLIRHTIAKYGRIDILVNNAGVAVHGDTPDF
FT                   NDQMLDTIMSTNLIQAFRFCRAAMTPMREQGGGVILNVGSISGFTTNIPQHQVAYNASK
FT                   AAVHMMTKSLASEVAAENIRVNAVAPGYIDTDMTRGGFAIPEWDSVWRQMTPMGRYGQP
FT                   EEIANCVLFLCSPAASYVTGSVLVVDGGYLTR"
FT   gene            complement(82676..83878)
FT                   /locus_tag="Arad_7079"
FT   CDS_pept        complement(82676..83878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7079"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7079"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28658"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLU4"
FT                   /protein_id="ACM28658.1"
FT                   /translation="MTEPAVATSSPRGIRQRNELAALRALYQFGPLSRAELARRLGLNR
FT                   SSSGHIIAGLTLDGLVREVSDGDQARGGHAHAGRPGIMIELVPGAVYFLGIEIGVEHIS
FT                   AVEIDLGGNIVSTTVEPFDGASAGVAATVERAIEMVLGAIPSSRLERCEGIGVAVPAQM
FT                   DKHGFVRLAPLLRWENVQLAELVRESLPVSVPVVAENDGNAFAIGASYGRNDKHSGVTL
FT                   FLVMESGVGGGIIANGSLFRGANGLAGEIGHLRISSASEPSRSLEEVLGLEHIMTEYRK
FT                   VPAVAAPTFGHFLADVRDRVPGAVSIAEEWARALAFGLIQACRVIDADRIILGGSVAAL
FT                   YPLMAARVAHHIQLAQEASFPLPSIGVNEEETVGPAFGAACILHQRFLSLESQRFAEEA
FT                   G"
FT   gene            complement(84001..84885)
FT                   /locus_tag="Arad_7080"
FT   CDS_pept        complement(84001..84885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7080"
FT                   /product="epimerase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7080"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28659"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLU5"
FT                   /protein_id="ACM28659.1"
FT                   /translation="MGRLGIHSFVWTGGSTQRMLEDAMEKSAACGYGLIEFAYLRPEKF
FT                   NLDQLAKRARSLDLQIAVTMGLPLNADVSSDDTETVKAGERMLADAVRAVRDIGGTKLG
FT                   GILYSAHTKYSRMPTENGRRNSVQAIAKTADIARAAGVDLVLEIVNRFETNLLNTTAQG
FT                   LAFIEATGSDHVLLHLDTFHMNIEEANPAAAIRLAGEKIGYFHIGESNRGYLGDGCINF
FT                   DLVFDALLDIGYGRDITFESFSSAVVDEGLSLACAIWRDTWTENMPLAEHAKAFIDLKM
FT                   QEAIRRRATNGRP"
FT   gene            85388..86344
FT                   /locus_tag="Arad_7081"
FT   CDS_pept        85388..86344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7081"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7081"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28660"
FT                   /db_xref="GOA:B9JLU6"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLU6"
FT                   /protein_id="ACM28660.1"
FT                   /translation="MKADLRIVPDFEMVICAPAESFRWNMHDYPYFGAKWHYHPEYELH
FT                   LTRKSSGVMMVGDYIGEFEPGCLVLTGPNVPHNWVSDIEPGIPIQNRDMLIQFSAEWAD
FT                   RVTGFCPELASIRPLYEDAVYGVEFLGATAMAGQRLLAQIGAAHGAERIVLFLQLMTTL
FT                   AQNPGDRRRLSRLAPTSAHVELPRELDVAMRYVLEHYSDDIDLASVSRLCGLEPQAFSR
FT                   FFKRQSGHTFARYVILARVYAACSLLTQTYRPITDICFEVGFNSIANFNRQFIKVCGRT
FT                   PSDYRRNAHKIGTKARADPFREIRAFSAGIGAVGEKV"
FT   gene            86580..88013
FT                   /locus_tag="Arad_7082"
FT   CDS_pept        86580..88013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7082"
FT                   /product="sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7082"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28661"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLU7"
FT                   /protein_id="ACM28661.1"
FT                   /translation="MIGKNGIGLAALAISLMATVMPAKADFWSDAGAKYKGVVLHGVTE
FT                   STPPSNYIKDVLAPEFEKKTGIKVAIETTSWDQMYDKAIKDMEAKTGIYDMVYIEQDII
FT                   YAYLARNFLVDITKSLKDNASLKAPEFDETHFTTFANYFKNADGDLFGVPMEAFIKIYL
FT                   YRTDLFNDPKIKEAFKKETGKDLVPAKTHEDYTEIAEFFTKYGKDNGLELWGTTAQAHT
FT                   GHPASWYEFFESVAPTFGVFNWGIDASKNYAATVENGGTMNGPEAKKALKYWLHLRDIA
FT                   PPESAASTWTEVGTTFAAGRVAQGLVYGENAAWIASDAEKSKVVGNVGVALPPTEPAVL
FT                   DEVKGGKGYIGYYDGGAFGLPVTSKNKEAALLFLQFIGQDSVQADWAVAAPRITNTATY
FT                   DDPKIIAMDKKLNGYYSMLKDDGKLFAGAPPYPFHAQVREATAPIFYRILLGEVSPDDG
FT                   LDQMAAAAETELKNLGYRK"
FT   gene            88112..88993
FT                   /locus_tag="Arad_7083"
FT   CDS_pept        88112..88993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7083"
FT                   /product="sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7083"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28662"
FT                   /db_xref="GOA:B9JLU8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLU8"
FT                   /protein_id="ACM28662.1"
FT                   /translation="MRSNTVGWLMLAPTIAILGIFGIAPFIYVLYLAFHHWNPFGADPS
FT                   MAYNGANNFRRLVFDQEFLGSIAVTAKFAFFAVLSEIALGYALAQLFMREFPGRGFFRT
FT                   IHTLPLIVAPIVVGSVWRLMTTPSIGIIPYLLKHWFGYDLNIGRDASAAFALTVIMDIW
FT                   HWTPLVTLTLLAALLALPKEPFEQAQIDGANRWQIFWHVTLPMIRPAILATVFIRLMDA
FT                   LRTVDEVWMLTSGGPGAATRYVGLHIWKIVFPKTDYGYGAAISVIVLYLTLVMCWLLYV
FT                   ALVARREKKSTF"
FT   gene            88993..89829
FT                   /locus_tag="Arad_7084"
FT   CDS_pept        88993..89829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7084"
FT                   /product="sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7084"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28663"
FT                   /db_xref="GOA:B9JLU9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLU9"
FT                   /protein_id="ACM28663.1"
FT                   /translation="MRQQRPILYLLLWLLLSLLTLFPIYWLFVISVKPAVDLFTTPSLI
FT                   LDTVYWKNYVNVINNETLRGYMINSLIISTSNALLVTVLAFLACYALSRFDLAGKENIF
FT                   FWTITNRMAPAAVFLLPFYLLFTQVFTFGDWKLYDTKIGMILLYCTFNLPFAIWTLRPT
FT                   IDGIPKELDEAATVDGASTWQVIHEVVFPLARPGLAVTFILTWVFAWNEFLLAATLTSF
FT                   NARTITTGLSEYVTTTGTEWGTMAAIAVITLIPALIIFSMVQRHIVAGLTFGAVKE"
FT   gene            89833..90075
FT                   /locus_tag="Arad_7085"
FT   CDS_pept        89833..90075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7085"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7085"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28664"
FT                   /db_xref="GOA:B9JLV0"
FT                   /db_xref="InterPro:IPR018678"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLV0"
FT                   /protein_id="ACM28664.1"
FT                   /translation="MRHQIDPDETEDAPAIVVAGKQERVGFLPIVTNWFDRVFVGIYLF
FT                   VALELFWMRFLEQSIPLTVCHVLAVALGVLIVWRG"
FT   gene            90115..91158
FT                   /locus_tag="Arad_7087"
FT   CDS_pept        90115..91158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7087"
FT                   /product="xylitol dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7087"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28665"
FT                   /db_xref="GOA:B9JLV1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLV1"
FT                   /protein_id="ACM28665.1"
FT                   /translation="MKALVLEEKMKLSLRDFPIERKETLGPRDVRIKLHTVGICGSDVH
FT                   YYTHGGTGIFQVKAPMILGHEASGTIVEAGADVTSLKVGDRVCMEPGIPDPNSRATRMG
FT                   MYNVDPAVRFWATPPIHGVLRPTVVHPADFTFKLPDNVSFAEAAMVEPLAVGVHAATKA
FT                   QVKPGDIALVIGAGPIGLVTALSALAAGCAHVFVSDIDDAKLEIAAKLGAVIPINPQRQ
FT                   DLVNEILTATDGWGVEILFECSGHSRGAEGVFDPLAPGGRVVFIGSQVHPIHYDVGKAM
FT                   VREARVEHVFRYAHVFPRCVAMLSSGAIDVKPLITRTFDFEDSVGAFETAASAPRGEVK
FT                   MQIILPQ"
FT   gene            91168..92229
FT                   /locus_tag="Arad_7088"
FT   CDS_pept        91168..92229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7088"
FT                   /product="sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7088"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28666"
FT                   /db_xref="GOA:B9JLV2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLV2"
FT                   /protein_id="ACM28666.1"
FT                   /translation="MAQVAVKDVIKKYGSLQVIHGVNIDIADGEFVVLVGPSGCGKSTL
FT                   LRMIAGLETISGGEVSIGARVVNNVLPKDRDIAMVFQNYALYPHKNVADNMGFPLKLKG
FT                   APKNEIEAKVRKAAEILDLGKLLDRYPKQLSGGQRQRVAMGRAIVRDPQVFLFDEPLSN
FT                   LDAKLRVTMRVEIKELHQRLKTTTIYVTHDQIEAMTMADKIVVMRDGLVEQIGAPLDLY
FT                   DHPANVFVAGFIGSPAMNFVRGKLATMNGETVFVSDKGAVLPVPASTTAHDEPVIYGIR
FT                   PEHIEHGGEGLPATISVLEPTGSETQIFAHIGGDPINAVVKDRIALRPGETIPLLINRE
FT                   RVHLFERKSGRRV"
FT   gene            92256..93029
FT                   /locus_tag="Arad_7089"
FT   CDS_pept        92256..93029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7089"
FT                   /product="oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7089"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28667"
FT                   /db_xref="GOA:B9JLV3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLV3"
FT                   /protein_id="ACM28667.1"
FT                   /translation="MFFEKFRMDGQVAVVTGGGRGIGLACAEALAEAGARIVIIDREEV
FT                   IAQSGKQALAAKGYDADVLILDVTDSVAVDKAAEAVFAKFGRIDVLVANAGIARSGTPA
FT                   EDTPDELWLNVNDVNYNGVFWCNRAFGRPMLKAGRGSIVNIGSMSGYIVNRPQNQTYYN
FT                   ASKAAVHHLTASLAAEWAGRGVRVNAVAPTYIESEMTKVLNLDPDVVDTWLRDTPMGRM
FT                   GQPHEIASVVHFLACDASSLMTGTTVKADAGFTIW"
FT   gene            complement(93154..94026)
FT                   /gene="dat"
FT                   /locus_tag="Arad_7091"
FT   CDS_pept        complement(93154..94026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dat"
FT                   /locus_tag="Arad_7091"
FT                   /product="D-alanine aminotransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7091"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28668"
FT                   /db_xref="GOA:B9JLV4"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLV4"
FT                   /protein_id="ACM28668.1"
FT                   /translation="MNMTSPERTVYVNGQYCPETEAKVSIFDRGYLFADAIYEVTCVLG
FT                   GKLVDFDGHMARLQRSLNELDMAMPMSVDELLAIHRKLVAANNVDEGLIYMQISRGSAD
FT                   RDFNFPPKGTPPVVVMFTQSRPVIESPLAKRGLKIISLPDIRWGRRDIKTVQLLYPSMA
FT                   KNAAYQAGADDAWLVQDGYVTEASSANAYIVRSDGKIVTRKLSFDILHGITRAAVLRLA
FT                   AESGYTLEERSFTIEEALAAKEAFITSATSFVTAVLEIDGTTIGEGVIGPVSKRLREIY
FT                   IEKAVAAAK"
FT   gene            complement(94084..94950)
FT                   /locus_tag="Arad_7092"
FT   CDS_pept        complement(94084..94950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7092"
FT                   /product="D-2-hydroxyacid dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7092"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28669"
FT                   /db_xref="GOA:B9JLV5"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLV5"
FT                   /protein_id="ACM28669.1"
FT                   /translation="MPEEKIVSFRHLNEEERAAVDIAIVANPDPMDLARLPGLTWIHSL
FT                   WAGVERLVSEIGDSTLPVVRLVDPQLSRTMAEAVLAWTYYLFRDMPAYARFQRERSWQQ
FT                   LPYRRPEQVTVGLLGLGALGEAAAHRLIDAGFKVIGWSRSAKDIGGIETHSGDDGLNAV
FT                   LRRSDILVCLLPQTSETRALLNAERLALLPANASLINFARGPIVVSEDLLQALDTGRLS
FT                   HAVLDVFDVEPLPADAPFWDHPRITVLPHISAPTDRETAAALVADNIRTFRRTATLPSI
FT                   VDFARGY"
FT   gene            complement(95042..95455)
FT                   /locus_tag="Arad_7094"
FT   CDS_pept        complement(95042..95455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7094"
FT                   /product="dioxygenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7094"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28670"
FT                   /db_xref="GOA:B9JLV6"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLV6"
FT                   /protein_id="ACM28670.1"
FT                   /translation="MRSLFHLAYHVTDLDEARRFYGGVLGCEEGRSTDTWVDFDFFGHQ
FT                   ISLHLGKPFETTRTGKVGDHMVMMPHLGVVLALDDWFTLAKRLEDAGTAFDIPPVVRFE
FT                   GLPGEQRTMFFFDPSGNPVEVKGFKDFESVFAH"
FT   gene            complement(95495..96721)
FT                   /locus_tag="Arad_7095"
FT   CDS_pept        complement(95495..96721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7095"
FT                   /product="CTP synthase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7095"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28671"
FT                   /db_xref="GOA:B9JLV7"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLV7"
FT                   /protein_id="ACM28671.1"
FT                   /translation="MGLILVLHDTSRPALYGAVAAAIAAARQCGFMHVAARFDTRLHAD
FT                   AAQHVIASGGLGPSGLCWFERLSGKQVRPVATPESILDAARMQNVVVPIHPAFLADQDM
FT                   PTTLSSAAQALGIKVKAITVHEGSDCFFDAATQELLALRDRFGRIGLRAPPFWEGDGLT
FT                   IGLVGAESDHRDVYPAALASLADAADSLSIPIDVRFIDPVHINQFEDPAIFDGLSGILL
FT                   PGGADMKNVAGQTAAAALSLESGLPTVGLCLGMQTMATAVAWRALGRDTANLAEADPDA
FT                   RIKTFVPMAGTQGPDETLLPLHRTGDQAIDIVSGTQLSAIIRSERQIRCNHRFRLNPAL
FT                   LPDLEAAGLRVAASSSAGAIVDAIEVPGHAFFIGMQGHPELSSRADMPHPLLVAFLEAA
FT                   AKRCPSTMS"
FT   gene            complement(96743..97912)
FT                   /locus_tag="Arad_7096"
FT   CDS_pept        complement(96743..97912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7096"
FT                   /product="peptidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7096"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28672"
FT                   /db_xref="GOA:B9JLV8"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLV8"
FT                   /protein_id="ACM28672.1"
FT                   /translation="MTTAGTIVQGQESAFPKEEYEIRVARARQNLVEAGIDALVITGPE
FT                   NIFYLTGQQTPGYYTFQALLLPAEGDPVFVIRQLEYFNFIANTFIADAEVYQDGDEPVS
FT                   FLMALIEKRGLRGKRVAIDKRGWFLPIFVYESLAERLGVVHDGAGVIEKLRAVKSPLEI
FT                   EKLERAASYVDAGMRAGLAAVKVGATDNDLVAAMMSAAISAGSEYMGMEPLVSVGARTG
FT                   VPHGTWRRGRIEDGDPAFLEMAACHDRYHAALMRSAWIGQAPNEATEMMKVCQEALQVS
FT                   LDTIRPGVPCEVPHMACQRIIDAAGYTDNFRKRLGYSVGISFAPDWGEGAILSLNAGVK
FT                   TELRPGMTFHLPPALRIYGRFTVGVSETIVVTDTGYRALGTVKRDLLEV"
FT   gene            complement(97909..99006)
FT                   /locus_tag="Arad_7097"
FT   CDS_pept        complement(97909..99006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7097"
FT                   /product="muconate cycloisomerase I protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7097"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28673"
FT                   /db_xref="GOA:B9JLV9"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLV9"
FT                   /protein_id="ACM28673.1"
FT                   /translation="MQASLHRAMLSYGGNLMLHTASSGPITGLDTLYLCLRDGDVVATG
FT                   EVRINIAYLNGLQADTVLAEALSLFDRIDWSLEAADLLADETIWAEASAPVRMLLDIAL
FT                   HDLLARRQGVPLAQWLGAATAMPISHPTNQTLFISTPEQFLAQAENYVRRGFCDLKVRI
FT                   GAGAFEDDLWRLSQLRSRFGEAIKLAVDANGAWGRDDAEGKLARLAEFDLAYVEQPIPA
FT                   GDFDLMLELARKSPMPLMLDESVSGLQDVEAIIKASGRLWAHLKLVKLGGIAPTLKAAV
FT                   ALRNGNIPFMLGQMNEGTVATAAALHLACATGPTFAELYGADGLADDPASGLFYERGQV
FT                   TGTQAPGLGLTVDLSKTSLLKEFAR"
FT   gene            complement(99010..100182)
FT                   /gene="argE"
FT                   /locus_tag="Arad_7098"
FT   CDS_pept        complement(99010..100182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argE"
FT                   /locus_tag="Arad_7098"
FT                   /product="acetylornithine deacetylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7098"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28674"
FT                   /db_xref="GOA:B9JLW0"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLW0"
FT                   /protein_id="ACM28674.1"
FT                   /translation="MRKADMSHTPDIARMKRELAELIAIRTENPPGREADAAVYVRDML
FT                   LSAGFAVDITEYKPGRFNVEARLDNGPGPVFAFNTHMDTVPAGDGWSSDPFTLREADGK
FT                   LYGRGACDCKGPLIAMVEAMRMLASDRSTWSGTLLGVFVGDEEIASEGAKFYAAGKPKI
FT                   DFAVVGEPTSNTTFAAHKGSLRPVVRVHGQAAHSGTPHLGENAIYRAGQLLSLIEAHHN
FT                   EVVRGRTHPLVGEASLTVTRISGGHADNVVPYACDLLLDRRMVPGENEEVVKQEFADLL
FT                   ALAQARFGVRAEIIDYKATTGGATETAIDSAIVQASMAACRSHGIANPGPFGFQGGCDL
FT                   VHFRQIGAQGTVIGPGDLSVAHKPDEFVPVDEFVTASLIYRDVAQSMLRA"
FT   gene            complement(100183..100947)
FT                   /gene="aapP"
FT                   /locus_tag="Arad_7100"
FT   CDS_pept        complement(100183..100947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aapP"
FT                   /locus_tag="Arad_7100"
FT                   /product="general L-amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7100"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28675"
FT                   /db_xref="GOA:B9JLW1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLW1"
FT                   /protein_id="ACM28675.1"
FT                   /translation="MRKDDMAAPDNKPLLEIIGIDKSFGPARILKTCSLNVFRKQTVVV
FT                   IGPSGSGKSTLLRCVNLLEPADGGNIFFDGNDITRDLRNASKIRRDIGMVFQNFELFQH
FT                   LSAAENIMLAPMKVSGISKLDAHDIAMQLLEKVRIPEKADFFPDELSGGQQQRVAIARA
FT                   LAMKPKLMLYDEPTSALDPEMIREVLDVMADLSADGMTSVVVTHEMGFARRAADQIVFM
FT                   ENGEVIENAPSEQFFGGTVNDRARLFLGQILH"
FT   gene            complement(100944..101660)
FT                   /locus_tag="Arad_7101"
FT   CDS_pept        complement(100944..101660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7101"
FT                   /product="amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7101"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28676"
FT                   /db_xref="GOA:B9JLW2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLW2"
FT                   /protein_id="ACM28676.1"
FT                   /translation="MSLELVFDYLLSPAFFHGAVLTLLITIVSLFFGIIVGLVIALLQE
FT                   TELRAVKAATLVYLWLFRGTPVLFQIIFIYNVLPGFGIRLSAILSAVLALSLNEGAYMA
FT                   EILRSGLHAVKKGQRTAGLALGMTRASVMRFVVMPQAARIVLPAVGNQMIGMLKTSALV
FT                   SVVAVEELLLVANQTASANFRYFEALSAAGIYYLALTTIFMVFQSILERSLDPKRGRRG
FT                   SIRKPLSLIAPKSEIQ"
FT   gene            complement(101709..102518)
FT                   /locus_tag="Arad_7102"
FT   CDS_pept        complement(101709..102518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7102"
FT                   /product="amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7102"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28677"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLW3"
FT                   /protein_id="ACM28677.1"
FT                   /translation="MLRSFMTAFALPLVLAQSVIAADLPKSGLVENGSITYGVAATFAP
FT                   FEFQKDGVLSGFDIDLIAALAAKLSAKPVPMNMEFKGLIPALLSSRIDIINSAMYINDK
FT                   RSEQVDFIPYMKIGNQVIVQAGNPAKITGRDDTLCGKTIAVTLGGIQENQARADDTRCK
FT                   AKGLSGVTVLTLPTAQDSALSLRQGRADAEYDSTPGAVVLQAAVPGVYEVVGGEFESNT
FT                   SIGIATRKGDTALQASIKAALAEIVADGTYKSLIEKWKLPASVSIFN"
FT   gene            102820..103725
FT                   /gene="matR"
FT                   /locus_tag="Arad_7104"
FT   CDS_pept        102820..103725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="matR"
FT                   /locus_tag="Arad_7104"
FT                   /product="transcriptional regulator (activator) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7104"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28678"
FT                   /db_xref="GOA:B9JLW4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLW4"
FT                   /protein_id="ACM28678.1"
FT                   /translation="MESLMASAPRQGRYRLANQILDLARDARFEPGHHLREQQLGDLIG
FT                   VSRTPVRAALLLLVEHGVVEARKNQGFFLKALPEELRRVELEVPTTADQDLYLRIVEDR
FT                   LSGALPETFTQSEIARRFDVDRILLQRTLTHLVNDGLLARNSGRGWTFLPTLDTQVALR
FT                   NSYDFRTTIEPAGLLLNTFRHDPAALERSRLQHLYLEAHPDITSINPRQLFETDAQFHE
FT                   MIAEFSGNIFFLQSIQQQNRLRRLLEFGGYTNRRRVKDWCREHVSILDAIASGQRAHAA
FT                   QLMTQHLRAALSFAPQYGAS"
FT   gene            complement(103776..105422)
FT                   /locus_tag="Arad_7105"
FT   CDS_pept        complement(103776..105422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7105"
FT                   /product="polyamine ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7105"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28679"
FT                   /db_xref="GOA:B9JLW5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLW5"
FT                   /protein_id="ACM28679.1"
FT                   /translation="MPHEPSSKIPEALCPDRPGCSAPRHLPGIALYQHRGHEPAQSGER
FT                   DALCARLHPLKLSQALCRQLLSGADRKHADDRFHHHLCLPYPRLPRRLAAREDPNAFSW
FT                   AGLWPRAVTASRRHRHPQLRLDDPARQQWHDKPHPDRLRPDRSPPCPDVQLSWDRDCPG
FT                   ARLLAIHDPSAHERTAGYRPVDRSGRPLAGGRTHHCLQTNCPATSHARHTGRLHTGLCP
FT                   VAQRLRHAVPDRRPACEDDGGQRGRRAYRHVSMALRLGHGTDAVSDRGDHGAAVCKAHP
FT                   HEMEGQLMSRHLLTGYCLIIYAFLLLPILVVVGASFNAGAFLTFPPQGLSFRWYVVFFH
FT                   NEVFLSAIKTSLWVAAVSTVISSIIGTMAAIFYVQHAGRWKESIRLAMLLPLLLPEVLT
FT                   AISLLFFVYSIGMGTRTIAAMIIGHCLITLPFVFINVSAAMESYDASWSLAAKSLGAGP
FT                   LTRFRRIMLPLIKPGVIGGCLFAFIISFDTFTISFMLKNVGTATLPIQLYDYLRTNFTP
FT                   EAAAVSTVSIVLTLFVVVLSEKVLGLRIHRF"
FT   gene            complement(105412..106476)
FT                   /locus_tag="Arad_7107"
FT   CDS_pept        complement(105412..106476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7107"
FT                   /product="ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7107"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28680"
FT                   /db_xref="GOA:B9JLW6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLW6"
FT                   /protein_id="ACM28680.1"
FT                   /translation="MTEVSIEALTKHYGASLAVNGISVRIAKGEFISLLGPSGCGKTTT
FT                   LKMIAGFEDATSGAIRFDGQDVVHVPAEKRDIGMVFQNYALFPHMTVAQNLAFGLEMRR
FT                   RPKREIAERTARVLDMVQLSGYADRYPRQLSGGQQQRVALARALVIEPRILLLDEPLAN
FT                   LDAKLREEMRVFIRDLQKRVGITTVYVTHDQAEAMTMSDRVAVMFGGQIAQYGAPADIY
FT                   DRPASLEVAQFVGQVNILSGRLLSTEANDISVIDTALGTIRIGNMPKSPDGAVTLVLRP
FT                   EAVELFPESAGQAGTPATITASYYSGSLIDYRLALDSGDTINVQTFPRSRFSPGDRVTV
FT                   KVDGDRFWALGAAA"
FT   gene            complement(106591..107646)
FT                   /locus_tag="Arad_7109"
FT   CDS_pept        complement(106591..107646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7109"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7109"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28681"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLW7"
FT                   /protein_id="ACM28681.1"
FT                   /translation="MTRGTEMMNMNRRQLLAGMGGLAAASMISLPARAQGKTLVVPTLG
FT                   GAWEQFWRSTLAPAFTAKSGAAVTLDAGNGRVWSANLRAAGAENPPYSILMTNEAFASS
FT                   LRKEGFFEKLDLTKLSNYNDLYSLAKKTDGWGAVAMVSPIGIAYRTDMVKTPPKGWKDL
FT                   WENPEFKGRIGLYNFANTAGKMELMLASKIFGKDQYDIDAGFKALEKLGPVIQADFNLS
FT                   TGLAAGEFVVAPFDFGEVARLRSQGLPIDVVVPEEGMLMFDQTLNILAHAPEKELAYQY
FT                   ADFLLSPEGQIPLMKQFFVSPTNSKVVVPADLQKDVPISGETMDKILTWDWNFMNQKQA
FT                   EFSETWAKVMR"
FT   gene            complement(107699..108664)
FT                   /locus_tag="Arad_7110"
FT   CDS_pept        complement(107699..108664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7110"
FT                   /product="oxidoreductase, 2OG-Fe(II) oxygenase family"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7110"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28682"
FT                   /db_xref="GOA:B9JLW8"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR026992"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLW8"
FT                   /protein_id="ACM28682.1"
FT                   /translation="MQTAPSSRQDMDSIPVINIAPFIRQATGSDAVVKAIEAACRETGF
FT                   FLITGHGVSKEATTQLYNLARDFFDEPQDWKKKQGRGTSLKGGVAFSPIADEALSATLG
FT                   IKTPGDYKESLNFGPRLPGDAWPTVPQGLQAAFNAYFGEMETLSGHLRRAFCQAIGLAP
FT                   DYFEPAFTDHLSALRVINYPEQQESPLPGQLRAGVHTDYGFMTILRSEASPGGLQVRRR
FT                   DGEWLDAPNVEGAYVVNIADAFMRWTNDEWLSTPHRVANPPGNFKGTTRRQSIPFFVNP
FT                   SKETLIECLPPFAAKAPAKYTPITYGDYIALKTSQAFSKS"
FT   gene            complement(108740..109561)
FT                   /gene="fadB1"
FT                   /locus_tag="Arad_7111"
FT   CDS_pept        complement(108740..109561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadB1"
FT                   /locus_tag="Arad_7111"
FT                   /product="enoyl-CoA hydratase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7111"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28683"
FT                   /db_xref="GOA:B9JLW9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLW9"
FT                   /protein_id="ACM28683.1"
FT                   /translation="MSMTESFETILYDKDEQDKFATITINRPDKLNAMNKTTVREIDRA
FT                   VALAVADKDVNALVITGAGRAFSAGYDLQGADYDVSIEDWHADMSENAQALLNIWKAPI
FT                   PVIASVNGYALAGALELVMSCDLAIAADNAKFGEPEVRHNSGPPALFMPWLLATRDVRW
FT                   LMYTGDLVDAEEALRMHLINKIVPADQLKQKTENLARKLARMPVPAIKFAKSSINNQQV
FT                   AAGLMTSFDYNVHAIAALHVSKDGQEWMRNLQKMSLKEYLEFRDAPFKGLD"
FT   gene            complement(109558..113076)
FT                   /locus_tag="Arad_7113"
FT   CDS_pept        complement(109558..113076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7113"
FT                   /product="indolepyruvate ferredoxin oxidoreductase chain
FT                   alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7113"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28684"
FT                   /db_xref="GOA:B9JLX0"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLX0"
FT                   /protein_id="ACM28684.1"
FT                   /translation="MSTLPVAAHPEDRPKASAATTPSLDDRYTLDRGSILVSGTQALVR
FT                   LPMIQRQRDLARGLNTAGYVSGYRGSPLAGFDREMARAKKYLDDHHVRFQPGLNEDMAA
FT                   TAVWGTQQTAMFPGARYDGVFAMWYGKGPGVDRSMDVIRHANAVGTNPNGGVLLLVGDD
FT                   HGAVSSTLPHQSEHNLISAMVPLLSPAGVGEYIDYGLLGWALSRYSGAWVGFKCQTEIV
FT                   ECTATVELDPDQSAIVYPDGNGDLSLRWPDGPHAMERRLENKMEAIHAFARQNSIDRTV
FT                   WGSIAGKARLGIVSTGKSWLDLMGALASLGIDERRAGELGIRLYKIGMVWPIEPEGLQR
FT                   FASGVETLLVVEEKRAVIEDQIKAQLFNMASDRRPRIYGKFGVDGRPLLSAAGEINAVA
FT                   VARAIVSLIGEHHTDLLARSHAIEAIFAASAAETPALKRDPYFCSGCPHSISTRLPEGS
FT                   RASTGIGCHMMVIGLEERNTSTFTQMGGEGGAWIGLSQFTDEKHIFVNMGDGTYFHSGL
FT                   LAIRAAIAAKVNATYKILYNDAVAMTGGQKHDGEVSVPGIVGQMLAEGAARVAVVAERP
FT                   EVWQGNLPSGVTINHRDELDAVQRELREVAGVTVLVYDQVCAAEKRRRRKRGALAVSDK
FT                   RAFINELVCEGCGDCSAVSNCISIEPQETEFGRKRRINQSSCNTDLSCIKGFCPSFVTV
FT                   EGGTIRKPDAKAGKASFDDLPLPAIRPITDRPYNMLLAGIGGTGVITVSAIVSMAAHMD
FT                   GLAVQTLDQTGLAQKNGAVISHLRVARTREQITSVRIGPGESDLVLGFDIVVSAAQNAL
FT                   STFAFGRTRAVLDDHFAPTASFVQNTAIDFRQEATLKALRRAAGDDAISLIAATKLGAA
FT                   LMGDAIAANMFLLGHAWQRGLVPISLEAVDKAIELNGTGIAMNRAAFGWGRRSVVDPEA
FT                   VKQAAAVDLDEAPAKQTLDDLVAKRIEFLTHYQNTAYANKYRKLVTTARNAEARAKLGE
FT                   DFSGAVARNAFKLMAYKDEYEVARLHNDRSFKDKIAAQFEGDFEIKHHLAPPLFSRRID
FT                   KRTGNPAKIAISRKLISPAFSVLEKLRFLRGTPLDPFGYTHERRTERKLVADYTALIND
FT                   LSANLSPENQQRAIALAQLPDQIRGFGPVKSASIERFEKNKAALLMQASSTASQPADTS
FT                   VKRKSI"
FT   gene            complement(113077..114534)
FT                   /locus_tag="Arad_7114"
FT   CDS_pept        complement(113077..114534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7114"
FT                   /product="FAD-dependent oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7114"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28685"
FT                   /db_xref="GOA:B9JLX1"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLX1"
FT                   /protein_id="ACM28685.1"
FT                   /translation="MGGSIDRALAAHPLSAPSLRLWELLARLNDRLDKNAVVVGPDVGD
FT                   AYCADATDERGVRPSILFRPRDTASVSAILSACDALRQPIVVQGGRTGLAGAARPMAGE
FT                   VALSLERMSAIEPVNEDAGTVIAHAGATLQAVQETATSHGFMFGVDIGARGTSTIGGNI
FT                   ATNAGGIRVLRYGMYRAQVLGLEAVMADGSVLTGLKGLSKDNSGFDLNQIFIGSEGTLG
FT                   VVTRACLRLHPKPQSLANAFCALPSLGAAIALLRRLRQRLGPSLSAFEVIFPAVYAGVL
FT                   NRTGAPPPVPAGAGMYALIEMQGQDEAGDEDRFAAALMECYEEGIVSDVAASRSLRDYH
FT                   AIWALREAASEFIFSMDHVAGFDVSLPISAMQRFLDRATAEIATVDPAASIYIFGHLGD
FT                   GNLHFLVRTHHYDRVADATYSCVASEGGSISAEHGIGLEKKKWLALVRSPTEMAAMRRL
FT                   KAAFDPNNILNPGRVFDMEPTTPRERA"
FT   gene            114667..115422
FT                   /locus_tag="Arad_7115"
FT   CDS_pept        114667..115422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7115"
FT                   /product="L-asparagine operon transcriptional regulator
FT                   (repressor) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7115"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28686"
FT                   /db_xref="GOA:B9JLX2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLX2"
FT                   /protein_id="ACM28686.1"
FT                   /translation="MNLRYDEVVRSGIAKQVAENIKSAILDGRLKIDERLPTEEDLARS
FT                   FGISRPTVREALKRLAAQNLIHSRRGPLGGNFVMRPDPEGLSKAITGAATLLVGIGAFD
FT                   IDEIITARLETETICCRLACENRSEEGLQAMAAEIALQRDQDISDEDFCASDVRFHRAL
FT                   VDSTGNGPLKLMMYIVIESFIPITNMIVFRVRERRQVVAFHQRIHEALSNRDVGEATAA
FT                   LTNLLAYVRDSYSAALDARSRRAGEQAQS"
FT   gene            115471..116463
FT                   /locus_tag="Arad_7116"
FT   CDS_pept        115471..116463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7116"
FT                   /product="zinc-dependent alcohol dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7116"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28687"
FT                   /db_xref="GOA:B9JLX3"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014188"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLX3"
FT                   /protein_id="ACM28687.1"
FT                   /translation="MSDSFTAMVIDTVDGKQQAGFRQLNLADLPDHDVLVEVAFSTVNY
FT                   KDGLALSGKGRIARRTPMVGGIDLAGVVVESRSDKWVAGDKVVLNGWGLSETEWGGYSR
FT                   YQRVKAEWLIALPPEFSLEQAMAIGTAGYTAALCVNALEDWGTIGVDDREVLVTGAAGG
FT                   VGSVAVSLLANKGYKVTASTGRPETYDYLASLGASGFVERAALSEKGGPLQKERWAGAI
FT                   DSVGSTTLANVLSQTVYGGAVAACGLAGGADLPATVLPHILRNVALLGIDSVMAPMVKR
FT                   ERAWRTLSQHLNPVRLETLTRIEPMSALPKIGEDIVAGRIRGRVVVAIT"
FT   gene            116979..118727
FT                   /gene="prsD"
FT                   /locus_tag="Arad_7117"
FT   CDS_pept        116979..118727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prsD"
FT                   /locus_tag="Arad_7117"
FT                   /product="protease/lipase ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7117"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28688"
FT                   /db_xref="GOA:B9JLX4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010128"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLX4"
FT                   /protein_id="ACM28688.1"
FT                   /translation="MALPSKKLPRTFLMAVLSSLRKAFLSIAIASAVLSVLALTGSFFM
FT                   LQVYDRVIPGHSLPTLVGIAIIAATLFVFQGILELLRSMLLARVGVALDERMNGKVFAS
FT                   LVLQPQLMQAPGDGMQSVRDLDKVRSFLSSTGPIALFDLPWIPLYLGLCFLFHFWIGLT
FT                   ATCGAIVLVVLAVLAEIMSQRPAVEAAKHSAARLAFAESARRNWEAVVAMGFVGRMTER
FT                   WTDINDAYLANQLAAGNVTGMLTTTSRILRLMLQSAVLAVGAVLVIRQEATGGIMIASS
FT                   ILVSRALAPVELAIGQWRAFVAARQSWSRLVRLLEIMPAGHQSISLPAPRSKLTVDNLS
FT                   LASPGSRELILRNISFDISAGTVLGVIGPSASGKSSLARAVTGLWPAAIGSIRLDHAAL
FT                   SQWDLSDLGRYVGYLPQDVSLFDGSIADNIARFEKRPSSQSVVAAAKSAGVYDMIVKLP
FT                   QGFDTVIGEGGSRLSAGQRQRIALARALYGEPFLVVLDEPNSNLDAEGEAALTQALLNV
FT                   GARGGIAIVIAHRPSALIAADMVMVIAGGRLQAFGPKDAVLGNPARQPIKQSAVRLMVA
FT                   GEDAGS"
FT   gene            118724..120034
FT                   /gene="prsE"
FT                   /locus_tag="Arad_7118"
FT   CDS_pept        118724..120034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prsE"
FT                   /locus_tag="Arad_7118"
FT                   /product="protein secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7118"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28689"
FT                   /db_xref="GOA:B9JLX5"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLX5"
FT                   /protein_id="ACM28689.1"
FT                   /translation="MSGLKLSPSERSIPRLSAVMLGTIVLLVGVMGGLAATTEISGAVI
FT                   APGTLVVDSYVKPVQHLKGGIVGDIQVKNGDRVDAGQLLIHLDDTQTSANLAIIRKRLD
FT                   ELFARTARLDAERDGAPAIAFPAELLSRAGEDEIARTIAGERRLFDDRLASRQSRKSQL
FT                   GERIQQLSQEADGLVAQENGKRIEIDLIAKELASLQRLFEKGIVPAAKVYALQRESASL
FT                   TGELGNLVSSIAQTKGKMTETELQITQVDDDHSAEVSEQLRQAQSDTGLFLERLIAAED
FT                   DLKRIDIRAPQAGIIDHLSVHAAGAVISPGETVMQIVPDQDALVAELKLSPQDIDQVIV
FT                   GQPVTLRLSAFNQRDTPELNADITKISAELTTDQHSGASYYVLRAHVSKAEWSRLGKLT
FT                   AVPGMPVEGFLQTGARTVLAYLTKPMADQMARALREE"
FT   gene            120190..121479
FT                   /locus_tag="Arad_7120"
FT   CDS_pept        120190..121479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7120"
FT                   /product="Hemolysin-type calcium-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7120"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28690"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLX6"
FT                   /protein_id="ACM28690.1"
FT                   /translation="MVKRVPITAGNLTGHQIGADDILVASDLTSILYGDAGGSLLDHAT
FT                   GGNDNLTIHGSGNFYGDAVKDIADHAIGGDDILFAQITGPSGSTTNLYGDVGGSISDSA
FT                   KGGNDVLSAAPSATNITVAMYGDAGKNISGHAAGGDDTFKLSAFQNTFAIYGDAGGDLK
FT                   DHAVGGNDTATDGSSEGFVTFYGDAGRNISGHAHGGNDVLNTGLEDSVTFYGDAGGNLG
FT                   DHAMGGNDTMNVASVGAVLAYGDAKSMSGSAHGGNDSLIVRAQQTANDMIVGDAQAMSG
FT                   NAHGGDDVLNVDAVRHREGSITLIGDAQTMSGHSRGGNDTLISGNGNDDMWGDAQVMVG
FT                   HAKGGNDTFVFKFNNGQDKIGDFGQGACCAGSNWGTDHIDVSALGIQDFSQLTISAFDP
FT                   TTHDSRISFDTGDVVVHSQHLLTEHDFLFA"
FT   gene            121550..122845
FT                   /gene="exsH"
FT                   /locus_tag="Arad_7121"
FT   CDS_pept        121550..122845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exsH"
FT                   /locus_tag="Arad_7121"
FT                   /product="endo-1,3-1,4-beta-glycanase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7121"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28691"
FT                   /db_xref="GOA:B9JLX7"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR031768"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLX7"
FT                   /protein_id="ACM28691.1"
FT                   /translation="MAGISDPAAISTGFAFCWRWMFAVHAILEARAGSFALEVDMSAID
FT                   LTKYKLTFDDEFNTRSISQTGNGTTWADIRPQWRYDANSDIGFGHSSFVDPSSGYDPFK
FT                   VSNGVLTITAVPDRTASGIPGSWESGLITTQGHFSQTYGYFEMRADFSNLAGAWEAFWL
FT                   LPDHVIADPNKAGHWQELDVVENYGSFEKGVYSGIHTTDAAPNVNWQQNLQVYSGLAQP
FT                   TGFHTYGLDWNADTIGFYVDGQLMGTKATPSDMHGPMYLLANLATQNDPHNNADITKAP
FT                   ISEQIDYIRVYSHLPATTPPVTVTPPAGGTPTASATIGAGADKLVLLISEDAYLGDAQY
FT                   RVTVDGKQIGGVQTAHSHHGSGQSDHLLVQGDWDKGSHDVSVTFLNDAWAGTTTTDRNL
FT                   YLDGATYDGADVAGAEHALMGVSAFHFHVFDI"
FT   gene            123149..124351
FT                   /locus_tag="Arad_7122"
FT   CDS_pept        123149..124351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7122"
FT                   /product="sugar transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7122"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28692"
FT                   /db_xref="GOA:B9JLX8"
FT                   /db_xref="InterPro:IPR004750"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLX8"
FT                   /protein_id="ACM28692.1"
FT                   /translation="MTRLLPEVFRDPTIRVSMLAIFAFGFAGAATTPYQSVVGIRELGL
FT                   SNGLYSVLIFSAAAVNVIVSILLGNLADRLGQYRTMMLTVAIFGILGYGAVYFIPAQAT
FT                   FVVSALLFLPVYGSLNSLLFANVRVATKGMERNDVATVNSGVRAMISLSWVLVPGIIGA
FT                   LLINSGTMLPAYLFAGLACAVCFGLIAAFLPRQNGTDKAATRHISYLAALGEVVSPPVL
FT                   ARVIAVALITSTVHVSDTILPLIVTGAAHGTVADIGALVGIVALLEVIFIIVWGRVQRI
FT                   MSHVTALAIGTVIYVVYLLLLAQASAPWHVYALTLVSGIGAAALISIPITYLQDLIAER
FT                   PGLGSALISVNIFLSAGMSALLFAIGTEMSSYSGTAVISAAAGLVGLALLLFFDGSRRR
FT                   R"
FT   gene            complement(124444..125133)
FT                   /locus_tag="Arad_7123"
FT   CDS_pept        complement(124444..125133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7123"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7123"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28693"
FT                   /db_xref="GOA:B9JLX9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLX9"
FT                   /protein_id="ACM28693.1"
FT                   /translation="MNDDSLLSAINGEASLSERAYDELSRLILTRKLPGGSLVVEGRLA
FT                   QQLDVSRTPMREAILRLAAEGLLIKQGSRSYAVRRVQPVEFFQALKVRELLEGEAVELA
FT                   IGRIKPETIEALRSDILRLGALEAQAAEHWDTDDRLHMLFPEALGNGVLVRMIQQLRVI
FT                   TRLFELTSPSGRVAADAAEHVAILDAFAKGDGRRARAAMVTHLRNVASEILDIVSGRDT
FT                   TPARRRP"
FT   gene            complement(125130..126071)
FT                   /gene="dapAch1"
FT                   /locus_tag="Arad_7124"
FT   CDS_pept        complement(125130..126071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapAch1"
FT                   /locus_tag="Arad_7124"
FT                   /product="dihydrodipicolinate synthase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7124"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28694"
FT                   /db_xref="GOA:B9JLY0"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLY0"
FT                   /protein_id="ACM28694.1"
FT                   /translation="MIPAIDHPFRGIYVATLTPFRDDGTIDEDALADHFRSVTAEPGIV
FT                   GVLCNGHAGENILLTREERRRVTEIAVETIGRTHIVICGILCEATAEAVCHAEDAANAG
FT                   ADSILVFPPFSWALSQDAEMAVTHHRTIAEAVDTPMMLYQAGVASALAYRPDVLSRLVQ
FT                   LPTVVGIKEGSWESNAYDRNRRLVKNTAPHVEIMASGDEHLLSCFAIGSEGSLVSLAVI
FT                   MPGEIVALDRAVQGGDLERARALSERIQPLANAIYGTHPVGWATARLKACMVLLGHWRN
FT                   GSPRAPITDLPSSEILRLRHALANAGLLGSDA"
FT   gene            complement(126068..127204)
FT                   /gene="ooxB"
FT                   /locus_tag="Arad_7125"
FT   CDS_pept        complement(126068..127204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ooxB"
FT                   /locus_tag="Arad_7125"
FT                   /product="D-Octopine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7125"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28695"
FT                   /db_xref="GOA:B9JLY1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLY1"
FT                   /protein_id="ACM28695.1"
FT                   /translation="MMSKNPSQTFDIAVVGAGAMGATAALHLARSGMRVALIDRGEICR
FT                   EASGVNAGTLTLHMTRAALIPYAMKGRELWLDAPNWLGMDVGARSAPGLSLAFTAAERE
FT                   MLEKRAQARAAMGAPIRLITPAEALRIEPGLNPSLIAAAYCELDGHVTAYMTGRAYRKA
FT                   LVSANVTILENASVNRIEPDGGHYTILHEDGARTTAKRLVLAGGVWLETMLAWLGFRVP
FT                   IKCLINQLVVTERMRPVMQTVVGIANGLLSLKQFENGSVLIGGGWQGIGDPIRGGVETI
FT                   PDNLIGNVQLARHAIPALGDTRILRIWLGLESETADAMPIIGPLPGLDEAYVIGCAHSG
FT                   YTSAPYMGRLLADRILGREPEMPLFDPARLIKNPEETA"
FT   gene            complement(127201..128982)
FT                   /gene="ooxA"
FT                   /locus_tag="Arad_7127"
FT   CDS_pept        complement(127201..128982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ooxA"
FT                   /locus_tag="Arad_7127"
FT                   /product="D-Octopine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7127"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28696"
FT                   /db_xref="GOA:B9JLY2"
FT                   /db_xref="InterPro:IPR017224"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041117"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLY2"
FT                   /protein_id="ACM28696.1"
FT                   /translation="MYLSYTVRRRKKHRDRRKSTLRIETTQSARAGCEAGDACALHLRW
FT                   QSRRRLCGRIGGCRTSGRRLSNPAGKPKRACAARCVLLDGSLPGMHGGGERRSQAGLSH
FT                   GMCGWPHCAKRNDRMSDTCDVLVIGAGPAGTEAALSAAACGLRVVLVDEAPAAGGQVYR
FT                   APPSTFAGLPATPESRTGDALRRRLAESTVDAHFGHTVWSVSPDLRVDALAKDGPVSWS
FT                   ARKIIVATGAQERVVPFPGWTLPGIIGLAGATILLKSQRMLPGRRTLVAGQGPLLLAVA
FT                   AGILKAGGTVAGVVDLASRGEWLAKSPAFLTRPDLAARGAGWLTRLHGAGVPFFYRHAI
FT                   RRAVKQDENEIEVTIGPVDRSGCSIAGNERTFIVDAVAVGNGLVASTDVTRLLRADHAF
FT                   DEARGGWIPRIDADFRTSIAGLYTVGDGTGIAGAAAAALNGRLAGLVAARDLGALSGEA
FT                   YEEKSAPLRRSAKRALGFGGAMAGLMALRPGQIKSIAEDAVVCRCEDVTRRDIDLAFAD
FT                   GARSANQLKAWTRCGMGPCQGRICGDIASALLAQATGQHPRSGMFTGRTPFRPLPLAQL
FT                   LEPVDYSELKLPPPAPL"
FT   gene            129063..129872
FT                   /locus_tag="Arad_7128"
FT   CDS_pept        129063..129872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7128"
FT                   /product="amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7128"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28697"
FT                   /db_xref="GOA:B9JLY3"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLY3"
FT                   /protein_id="ACM28697.1"
FT                   /translation="MNSLKTVCMLAGAACLALTAVAAEAHSLDEILSAKKIVVGINPNL
FT                   PPLGRFNDKNEIEGFDVDVAKKLGEMLGVEVSLVQVSSADRVPFLATGKADIVLGALTR
FT                   TADRAKVIDFSLPIQTEAISALVAKDKPYQTMDDLNSADVHLVEVRGTTPVDFVKDRLP
FT                   KAQVTLFDNYPDAVRAFEQGRGDAIVDVVDYLGAYTKNYSAETRVITDKSASIDYDCIG
FT                   LAQGNTALKSWVNVALYQLQTNGFMKQTYKQWFGIDMVYPVPVTPYF"
FT   gene            129909..130583
FT                   /gene="occQe"
FT                   /locus_tag="Arad_7129"
FT   CDS_pept        129909..130583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="occQe"
FT                   /locus_tag="Arad_7129"
FT                   /product="octopine ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7129"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28698"
FT                   /db_xref="GOA:B9JLY4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLY4"
FT                   /protein_id="ACM28698.1"
FT                   /translation="MHYALHYSQITSYLPYLIGGALLSLELSVLAFAGGMVIGFALAIA
FT                   RNEGGPILSRLVRAYVVFFTNTPQLVQIYVIFFGLPDLGVVFSPFAAVLIGMTLNAGAY
FT                   LTEILRAGLASVHQEELDAAETLGMSRLQSLRYVIVPHVFRVAMPPLSNQYILMTLGTS
FT                   MAAVFGVEELTGRAFNVNSTTFRSIEIFTTIAGLYVVITFMATILLAVVGRYVFRARVR
FT                   VL"
FT   gene            130583..131293
FT                   /locus_tag="Arad_7130"
FT   CDS_pept        130583..131293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7130"
FT                   /product="amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7130"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28699"
FT                   /db_xref="GOA:B9JLY5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLY5"
FT                   /protein_id="ACM28699.1"
FT                   /translation="MLKDILAQLPQVFTSYNIAMLAEAALTTLFLSAVGCLVGVVFGTI
FT                   LSLARLSRTRLLLPVKIVAFVYVEVFRRVPFLVTLLVFFFGAQVLGFDISPLVVTLIST
FT                   SVISTAFVAEIIRAGLAAVRPSQLEAAEVMNFSPWQTLCLVRWPQAWPLILPPVFGYFV
FT                   LFIKDTALASQIGVLELTQAGKILNTKGFSALLVFATILILYFLISYPLARLGAYLESN
FT                   LGASRHSRSHGQLR"
FT   gene            131250..132011
FT                   /locus_tag="Arad_7131"
FT   CDS_pept        131250..132011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7131"
FT                   /product="amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7131"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28700"
FT                   /db_xref="GOA:B9JLY6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLY6"
FT                   /protein_id="ACM28700.1"
FT                   /translation="MAHLDIRGLTASYANHTVLDGIDLTVKRGEIVSLIGPSGSGKSTL
FT                   LRVITGLLKPERGEIILDDERIDYADRRSLKAAREKLAIVFQQYNLFGNMTVLGNVMVA
FT                   PAKIRKRNRSEVEADARRLLEKVGLGDKLAAYPDELSGGQQQRVALARALCLKPEILLL
FT                   DEVTSALDPERVSEVLDTIKLLASENITLLIVSHEMNFVREVSDRVVFMANGKIQEIGS
FT                   PEQIFDAPQVQRTREFTSRIARVSQADSIAT"
FT   gene            complement(132193..133032)
FT                   /locus_tag="Arad_7133"
FT   CDS_pept        complement(132193..133032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7133"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7133"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28701"
FT                   /db_xref="GOA:B9JLY7"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLY7"
FT                   /protein_id="ACM28701.1"
FT                   /translation="MPKETSFLFRVRQALPELHPAERRLGDFVCDFPGELASYSAQELA
FT                   ALAHVSKATVSRFVQRLGYANYEEARRHARAQKQTGSRLFLSTSTDASTTQSIKAHIAQ
FT                   AIANIDATFLAINDTQIDAVADAMLNARKVWVVGFRSNHPFASYLQWQLTQVIENIVAI
FT                   PGPGQTLGEHLVSVQEQDVVVLFGLRRRIARMDLLIEQILRSKARFLYITDEGAPVLTS
FT                   AEWHFLCQTLAPGPLFNHASVMALCHLLITRCVEKAEVSGRRRLRNIEALNDSLEEL"
FT   gene            complement(133131..133835)
FT                   /locus_tag="Arad_7134"
FT   CDS_pept        complement(133131..133835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7134"
FT                   /product="hydantoin racemase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7134"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28702"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLY8"
FT                   /protein_id="ACM28702.1"
FT                   /translation="MLVQHAQDTTKHIVLINPNTSAATTAMMTDIARSVLPADVTIEGV
FT                   TATSGVPMILDDNQLAAAAAGVVKMGLVAARFCDGIIVSAFGDPGIQQLRDLTKVPVVG
FT                   ICEASMLEASAHGRRFGIATVTPNLVNGFARKADGLGLGQLFTGTRLTNGDPQKLAADP
FT                   ERLQAELAFAVEQAFELDGAEAVIIGGGPLGQAAVELGRRFSRPVIAPITAAVASLLLQ
FT                   IKATSPASNPSS"
FT   gene            complement(133887..134855)
FT                   /gene="appD"
FT                   /locus_tag="Arad_7135"
FT   CDS_pept        complement(133887..134855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="appD"
FT                   /locus_tag="Arad_7135"
FT                   /product="oligopeptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7135"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28703"
FT                   /db_xref="GOA:B9JLY9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLY9"
FT                   /protein_id="ACM28703.1"
FT                   /translation="MTDAQPMIDIRNLSVTFNRGRKPVKAVNGVSLSVRPGEVVALLGE
FT                   SGSGKSVTMRSLLRLHPPGTIIEGSMTVAGRNVTALSKKELGDLRGPIVSMVFQEPRLA
FT                   LDPVYTLGQQIEETIRRHENVSRQEASARALALFQKVRIPSPERRLKNYPHEMSGGMLQ
FT                   RSMIAMALSCNPKVLLADEPTTALDATVQIQILLLIRELQAEYGLSVIFVTHDIGVAAE
FT                   VADRIAVMYAGRIVEEGTASDIINQPKHPYTRGLLGARVELAHGRDRLVTIPGSPPDLA
FT                   NMPPGCAFAPRCSQVSDACRSRVPDLVGQGGTGQVACLQYA"
FT   gene            complement(134848..135894)
FT                   /locus_tag="Arad_7137"
FT   CDS_pept        complement(134848..135894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7137"
FT                   /product="oligopeptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7137"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28704"
FT                   /db_xref="GOA:B9JLZ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLZ0"
FT                   /protein_id="ACM28704.1"
FT                   /translation="MPTQDPRDRGGPAQPLVSVRSLLKHFPVKGGGLFQPKKVVRAVDG
FT                   IDFDILKGETLGVVGESGCGKSTTARLLMQLIKRDQGEVLFDGETVGGTLSLSDYRRQV
FT                   QMVFQDSYASLNPRLTMEESISFGPRVHGVTAEKAMARAHDLLHRVGLEPKRFAGRYPH
FT                   ELSGGQRQRVNIARALALEPRLVILDEAVSALDKSVEAQVLNLLLDLKRDFGLTYLFIS
FT                   HDLNVVRFMCDRVMVMYLGKIAEIGSRDAIFDRTRHPYSSALLASMPKINPSDRTSEPP
FT                   LAGDPPNPIDPPPGCRFHTRCIFAEDICSREMPPLAMVSGDHAAACLMSMPASSHSRAP
FT                   VMMETRND"
FT   gene            complement(135909..136799)
FT                   /gene="dppCch3"
FT                   /locus_tag="Arad_7138"
FT   CDS_pept        complement(135909..136799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppCch3"
FT                   /locus_tag="Arad_7138"
FT                   /product="dipeptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7138"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28705"
FT                   /db_xref="GOA:B9JLZ1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLZ1"
FT                   /protein_id="ACM28705.1"
FT                   /translation="MVAVTADVVADAPRTIRSPGFWHGVVRRLCRDPVALVALLVIIVL
FT                   IAAAILAPYLAPYDPTKTSVIRRLKPIGTPGYILGTDELGRDMLSRLIYGARLSLLMGV
FT                   IPVPIAFVIGSAIGIIAGYAGGIVNTLIMRTVDVFYAFPSVLLAVALSGALGSGLTNAL
FT                   VSLTVVFIPQIARVAESVTTQVRNLDYVDAARASGAKARTIISVHILGNVLGPIFVFAT
FT                   SLISVSMILASGLSFLGLGVRPPAAEWGLMLNTLRTAIYVNPYVAALPGVMIFITSICF
FT                   NLFSDGLRAAMDVKS"
FT   gene            complement(136804..137757)
FT                   /locus_tag="Arad_7140"
FT   CDS_pept        complement(136804..137757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7140"
FT                   /product="peptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7140"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28706"
FT                   /db_xref="GOA:B9JLZ2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLZ2"
FT                   /protein_id="ACM28706.1"
FT                   /translation="MLAYGLKRLLHVIPVAIGVSMVCFMLIHIAPGDPLAAILPSDASA
FT                   ELQAQMRSFYGLDRPLPVQYALWSWRALHGDLGVSIASGRPVLGEIASASLNSIILAVA
FT                   ATLIGFTLGAGLGFLAGVFRGKWIDRIASAVSMLGVSVPHYWLGMVLVIVFSVRLGWLP
FT                   AMGGGPGGSDGRAVNWEYLRYLILPAITMSVIPMGIIARTIRSLVADILAQDFTQALAA
FT                   KGLTTRQILRHVVRNAAPTAISVMGLQLGYLLGGSILIETVFSWPGTGFLLNGAIFSRD
FT                   LPVLQGTILVLAMFFVLVNLVVDVLQSAIDPRIQRS"
FT   gene            complement(137841..139352)
FT                   /locus_tag="Arad_7141"
FT   CDS_pept        complement(137841..139352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7141"
FT                   /product="dipeptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7141"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28707"
FT                   /db_xref="GOA:B9JLZ3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLZ3"
FT                   /protein_id="ACM28707.1"
FT                   /translation="MTASDIPLTTGQTDQGGEGQRFMGYTVYDSLIEWDLTSAVKPSAL
FT                   VPGLAVSWAVDANDKTKWVFKLRDGVKFHDGSAFTADAVVWNLDKLLKADAPQFDKRQS
FT                   AQGKSRIPAVASYKVIDPLTVEITTKTPDATLPYQLSWILMSSPANWEAQGKNWDVVAQ
FT                   KPSGTGPWKLESGFTPRERAELTPNKNYWDPARVPKLDKLILIPLPEPNTRVAALRSGQ
FT                   VDWIEAPAPDSVASLKEAGFTIVTNSYPHNWTWHFSRVEGSPWNDIRVRKAANLAVDRD
FT                   GLNELLGGLSIPAQGFMPPGHQWFGNPTFKLSYNVEEAKKLMAEAGYGPDKRIKTKVII
FT                   SSSGSGQMLPLAMNEYIQQTLAEIGIDIEYEVADWNTVINIWRAGAKDPSAKGATAINY
FT                   SYFIQDPFTGLIRHLQCNLAPPAGTNWGYYCDPEMDALIDKVRNTFDPAEQDKVLQQVH
FT                   EKYVNEALFLMVTHDVNPRAMSAKVKGFVQAQNWFQDFSQITLDP"
FT   gene            139718..140539
FT                   /locus_tag="Arad_7142"
FT   CDS_pept        139718..140539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7142"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7142"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28708"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017627"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLZ4"
FT                   /protein_id="ACM28708.1"
FT                   /translation="MTDRNYYSKLGGLPPQTELLSSKAVFTTAYAVIPRSVMTDIVTSV
FT                   LPHWSGTRAWILSRPLSGFSETFSQYVMEVLPGGGSDRPEPDNRAEAAIFVVEGEMAIE
FT                   FAGSEHALRAGSFAFIPAGAAWKLSNPGTAPVRFHWVRKVFQAVEGLEAPPAIFTHEDQ
FT                   HAISSMPDTNGSWGTTRFIDPSDVRYDMHLNIVTFEPGGTIPFMETHVMEHGLYVLEGK
FT                   AVYRLNKDWVEVEAGDFMWLRAFCPQACYAGGPGRFRYLLYKDVNRHPGLW"
FT   gene            complement(140832..141719)
FT                   /locus_tag="Arad_7144"
FT   CDS_pept        complement(140832..141719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7144"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7144"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28709"
FT                   /db_xref="GOA:B9JLZ5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLZ5"
FT                   /protein_id="ACM28709.1"
FT                   /translation="MELLNDMAMFVEVVKARSFRRAAETIGMPNSTLSRRISSLEKAIG
FT                   LRLLHRTTRRIELTEAGQLYFERCKRIVDEARLAHEQLGEILTPPSGVLRASLPVDFAL
FT                   IYLAPLIAEFARRYPDIDFEFDLTPRRVDLVVEPFDVAIRMGGSPDSNLMSWELACLPR
FT                   YLYASPRYLELFGEPNEPADLIRHESLQFPAQSGVWTLNHGHETVEVAAGGRFRLNGVS
FT                   MIRRLATLDLGIAMLAEEIVADELAEGRLRRVLPQWQGAPTPVYAITETRLLPARTQRF
FT                   IEFLRERLGSCENG"
FT   gene            141989..144352
FT                   /gene="gcd"
FT                   /locus_tag="Arad_7145"
FT   CDS_pept        141989..144352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcd"
FT                   /locus_tag="Arad_7145"
FT                   /product="glucose dehydrogenase (pyrroloquinoline-quinone)
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7145"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28710"
FT                   /db_xref="GOA:B9JLZ6"
FT                   /db_xref="InterPro:IPR001479"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017511"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLZ6"
FT                   /protein_id="ACM28710.1"
FT                   /translation="MQSFLRFPAVLITAVICMLIGLSLAVGGAWLAALGGSWFYFGAGA
FT                   GLLVTGGLLFARHRAALWTYAAVLIATLVWAVYEVGFDWWPLAARGDILFPLGVWLLTP
FT                   WIVRGLRGSDAVSYRRATAPLWLGVLAGAIVLIVGLSSNYHDIDGAIADSSSGVSQSAD
FT                   GQPDGDWQSYGRTQFGQRYSPLKQITPSNAKNLKVAWTFRTGDQQGPNDSSETTFEVTP
FT                   IKVRDTLYLCSQHQRLFALDAKTGRQRWSFDPKIVSNSTFQHLTCRGVSYHEAAAATPA
FT                   PPECPRRIFLPVNDGRMIAVDADTGKLCDSFANHGTLDLQEGMGIKTAGFYEPTSPPVV
FT                   SDRILVVAGAVIDNYSTEEPSGVIRGFDVTTGKLVWAWDSGAADENALASPTHSYTNGS
FT                   PNSWITASFDPKLNLVYIPMGVRSPDIWGGDRDPLVERYSSALVALDINTGKRVWSYQT
FT                   VHHDLWDMDLSSQPTLVDLPTKNGITPAVIQPTKTGNLFVLDRRTGQPIVPAPERPVPQ
FT                   GAAPGDHVSATQPFSELTFRPEKNLTGADMWGATIFDQLACRIEFQSLRYEGTFTPPSL
FT                   QGTLVFPGNLGMFEWGGIAVDPVRQIAIANPIAIPFVSKLIPRGPDNPAAPNDAHPSGT
FT                   ELGVQPMYGTPFGVVLHPFLSPVGLPCKQPPWGYMAAIDLKTMKIAWMHRNGTIRDEAP
FT                   IPVPIKMGVPSLGGPLTTAGGVAFLTSTMDYYIRAYDVLSGQVVWEDRLPAGGQSTPMS
FT                   YDVDNVQYVVTAAGGHGSFGTKTGDYVIAYKLTD"
FT   gene            complement(144754..145104)
FT                   /locus_tag="Arad_7147"
FT   CDS_pept        complement(144754..145104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7147"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7147"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28711"
FT                   /db_xref="GOA:B9JLZ7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLZ7"
FT                   /protein_id="ACM28711.1"
FT                   /translation="MGFLNDKALLVEAVKAKSFRGAAEVTSVPNSTLSRRISALEKAIG
FT                   LRLLHRTTRRIELTEAGLIYGCGWTQLHGESGKWLKCGLAAGRKLLLSVAWSTATPHSP
FT                   ESLPDHDRRRRI"
FT   gene            145207..146514
FT                   /locus_tag="Arad_7148"
FT   CDS_pept        145207..146514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7148"
FT                   /product="efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7148"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28712"
FT                   /db_xref="GOA:B9JLZ8"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLZ8"
FT                   /protein_id="ACM28712.1"
FT                   /translation="MSDGLMDRTALEAQVSLTPRGEPVAPVTNVFLAKYAIAYCGLFVA
FT                   LLTPVAMTLAIRIGALDATGKGASLGSILGLGALFALIANPLFGQLSDRTQSPLGRRKP
FT                   WIVAGVIIGSLAQVAIAYVSSLVVIGIAWCVAQTAYNAALAALVAVVPDQVPEQQRGKI
FT                   SALMGMSIYIALLIGSAVLTFVGTVGVGMFIIPAVIGLFTTLLFAVGLTDVRKSKAAAQ
FT                   TENRPLLAELAGMFWVNPVKFPDFGWAWASRFLVFLGMSVLMTYQVYYLTDVLGFAADA
FT                   ISRIMFLSTLITAGCVLVSSLVAGWLSDRFQRRKIFVFIAATVYAFGILLIVFSTGLFG
FT                   FLFGVSVSSLGFGVYLAVDQALVVDVLPNRETDAGKNMGVLNIANAVPQSIAPAIAPIF
FT                   LAMGSATGQNYALLYAIAALCAFLGALAIAPVRGVR"
FT   gene            146619..149072
FT                   /gene="bglSf"
FT                   /locus_tag="Arad_7149"
FT   CDS_pept        146619..149072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglSf"
FT                   /locus_tag="Arad_7149"
FT                   /product="beta-glucosidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7149"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28713"
FT                   /db_xref="GOA:B9JLZ9"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011658"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="InterPro:IPR037524"
FT                   /db_xref="UniProtKB/TrEMBL:B9JLZ9"
FT                   /protein_id="ACM28713.1"
FT                   /translation="MLDDLLDRMTLEEQVSLLSGADFWTTAAIERLGVAKIKVTDGPNG
FT                   ARGSGSLVGGIKSACFPAAISLGASWNTDLVREMGKALAEEAKSKGARVVLAPTVNIQR
FT                   SGLNGRNFECYSEDPHLTSEIAVGYIDGLQGEGVAATIKHLVGNESEVERYTMSSDIDE
FT                   RALREIYLPPFEAAVKRAKVMAMMSSYNRLNGTPTSEHKWLLTKVLREQWGFEGIVMSD
FT                   WFGSHTTVETVNAGLDLEMPGPYRDRGEKLIQAVQEGKVDPQTVRVSARRVLVLLERLG
FT                   AFTDPSMHEERAEDRPEHRALIRKLGNEGAVLLKNDGVLPVDFTALKRVAVIGPNAAEA
FT                   RVMGGGSAQINAHYRISPLEGLREAFGSEKFAHSVGAQNNRLIRVFPGPFSVELFKNRD
FT                   WKGPAVAQPETASGEVWWFGDMPEGIDRDDFSARISGSYTPEESGEHILSLTTAGLGKL
FT                   FVDGELIVNSDDGWTNGDNFTGLGNSEVRKPLVLKAGRTYAITVEFRSLVTPQEGISFS
FT                   ALRFGVEKPLGDDALEAAVRLAADSDVAIVFAGRQSEWDVEGLDLPDLGLPGRQDELIK
FT                   RVAAANPRTIVVLQTGGPVVMPWLDDVSAVLQMWYPGQELGNCVADILSGAACPGGRLP
FT                   QTFPHALTDNSAITEDRRTYPGKDGHVGYSEGIYVGYRHHDTRNISPLFPFGFGLAYTS
FT                   FEWSEPYLSSHDMMDDGITVDVDVTNVGARAGADVVQLYVRALESDVDRPDKELRAFGK
FT                   IHLEPGRSGKVSLTISSRDLSYYDVDAGAFVAQAGRYELVLAASATDAKHKVVVRLADD
FT                   YEERP"
FT   gene            complement(149480..149725)
FT                   /locus_tag="Arad_7150"
FT   CDS_pept        complement(149480..149725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7150"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28714"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM00"
FT                   /protein_id="ACM28714.1"
FT                   /translation="MRNVDSRLTLVARQMLWNKTASKLVITGLNFLKERIEGNAPNCVS
FT                   EQINRHLPHWFCGKHFTGFATYMVMPEIWAEDEQTG"
FT   gene            149995..151965
FT                   /gene="mcpGc"
FT                   /locus_tag="Arad_7152"
FT   CDS_pept        149995..151965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcpGc"
FT                   /locus_tag="Arad_7152"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7152"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28715"
FT                   /db_xref="GOA:B9JM01"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM01"
FT                   /protein_id="ACM28715.1"
FT                   /translation="MRLPVLSIEDCIMKRPNIKTSLILIFAILTITVGAFAFYAIDRLE
FT                   TTNESLRDLAVNTLPGVKVAQNIALSMGEVRIAFRNHILASEPGAKATAQEKVTEMAQK
FT                   FKKKFAEYEPLISSEDERVIWKKLGMAADSWLAGGEKLLSLSRENRNAEAAAVLNGDMV
FT                   PAATALQNAVNDLVVLNESGATAAYEQSQSAFHTSLTITFIVVGLLGLFVLCSIYFVII
FT                   SIARPIQRITGAMTILAEGNTQQSIPYAGRADEIGEMAAAVDVFRANAQERQRLEVEAQ
FT                   ANRTLSEQERIEREQLRAKEAAEIKFAVDTLAGGLGQLANGNLMHRIDAAFAPQLDSVR
FT                   GDFNIAVERLEDALRIVGQNAQIITAGSSQIKAAADNLSKRTEQQAASVEETAAALEQI
FT                   TTTVADSSRRADEAGQLVKVTRDNAEKSGMVVRRAIAAMGEIETSSNEISNIIGVIDDI
FT                   AFQTNLLALNAGVEAARAGEAGKGFAVVAQEVRELAQRSASAAKEIKSLINASGEQVKN
FT                   GVTLVGETGQALEQMGHQVQDINLNVSAIIDASREQATGLKEINQAVNAIDQSTQQNAA
FT                   MVEESNAASHSLAKEAEALFNLLSRFKISERGHTTRAAIELAQKNHVPAPSPARKLAGT
FT                   LTRAFGGQAATAAAAQSWAEF"
FT   gene            complement(152103..152276)
FT                   /locus_tag="Arad_7153"
FT   CDS_pept        complement(152103..152276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7153"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28716"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM02"
FT                   /protein_id="ACM28716.1"
FT                   /translation="MPVGGFIDKLRLAPQSSVTVSASRSVKLFSLLFASDLVRATLGSV
FT                   FAAGLNWSAPEK"
FT   gene            complement(152382..153500)
FT                   /gene="nah"
FT                   /locus_tag="Arad_7154"
FT   CDS_pept        complement(152382..153500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nah"
FT                   /locus_tag="Arad_7154"
FT                   /product="salicylate hydroxylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7154"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28717"
FT                   /db_xref="GOA:B9JM03"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM03"
FT                   /protein_id="ACM28717.1"
FT                   /translation="MSGTNPQITIIGGSLAGLTVALACAARGVAVHVIERSARRVHGGD
FT                   SLTVDLDALAATVGHSPRAHPILPVVPAYRPLTTWSALYSWLYDRAAVAPGITLEQGKT
FT                   VASVTDLGDRVQLFFTDGTERIVDAVIGADGYHSLVRRAIAPDAPLARYAGYVVWRGIV
FT                   EEQDLSRSVHWPTDGGLWIEFVGGYRLVAATLPGRDGSVKVGRRQITFAWFDVHQDELL
FT                   RRTNCLTPEGYIVGTLARGTIEESVRDDLIARIPALWPETWAEAVALGVRSNAALSGAP
FT                   IAEYKPERLARGSLAIAGDAAHAVSPMTGRGYATGVEDAAVLAQLLADRAANEPIAETL
FT                   ARYESVRLPYVRSLVTHSRRISADFLRYASTA"
FT   gene            complement(153576..154100)
FT                   /locus_tag="Arad_7155"
FT   CDS_pept        complement(153576..154100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7155"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7155"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28718"
FT                   /db_xref="GOA:B9JM04"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM04"
FT                   /protein_id="ACM28718.1"
FT                   /translation="MIEVSRARRRCTAQGADRAMSDELDDYEDCTRAFNAFMGASAAIL
FT                   ARVTQALDEHFSLSINEYNALACLDAGGQESRPLMAICEAVRLSQPAISRLADRLEHRG
FT                   LIERQSGLEDRRNVCIQLTTDGRALLHRAMPVHAAAAHETLFKRLTLHEREVFRKILMK
FT                   LDATNDDDGKS"
FT   gene            complement(154192..154356)
FT                   /locus_tag="Arad_7156"
FT   CDS_pept        complement(154192..154356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7156"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28719"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM05"
FT                   /protein_id="ACM28719.1"
FT                   /translation="MVELSSKELAQKVVCHGFFKKCFRQLADLIVATHGHVQIVHSDLK
FT                   FSDRCKRCL"
FT   gene            154429..154674
FT                   /locus_tag="Arad_7157"
FT   CDS_pept        154429..154674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7157"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28720"
FT                   /db_xref="GOA:B9JM06"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM06"
FT                   /protein_id="ACM28720.1"
FT                   /translation="MRFLLAKHVGMSISEKQRARWVQLMLTSAREVGIPEYAVATFGQY
FT                   LEGTSRSTMAFSNVSPVAALAQLGYVEAPKPLVDEH"
FT   gene            complement(155039..156109)
FT                   /locus_tag="Arad_7158"
FT   CDS_pept        complement(155039..156109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7158"
FT                   /product="iron alcohol dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7158"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28721"
FT                   /db_xref="GOA:B9JM07"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM07"
FT                   /protein_id="ACM28721.1"
FT                   /translation="MDNFVYNGLPSRVIFGEGTLGAVRDEAVLLGISKALVLSTPQQIA
FT                   MAERVSDRLGEQTAGIFSNATMHTPVPVTEEALTVLTARDCNGIVSIGGGSTTGLGKAL
FT                   SLRTGLPHLCIPTTYAGSEMTPILGETDNGRKVTIRDMKVLPAAVVYDVELTLGLPVTM
FT                   SSVSGMNAIAHAVEALYAQDRNPIISLMAADAIEKLANALPAICDNPSDCSARRDALYG
FT                   AWLCGVCLGSVGMALHHKLCHTLGGMLNLPHAETHTVILPFALAFNAPAAPDADAAVAK
FT                   ALGTEKGFIGLQQLARRLGSPTSLRELGVPFTTLEAVAEEAMARPYWNPRVLTYDTILD
FT                   LLRAAWNGSDLTARGL"
FT   gene            complement(156109..156993)
FT                   /locus_tag="Arad_7159"
FT   CDS_pept        complement(156109..156993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7159"
FT                   /product="dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7159"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28722"
FT                   /db_xref="GOA:B9JM08"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR007535"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="InterPro:IPR039390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM08"
FT                   /protein_id="ACM28722.1"
FT                   /translation="MGTESYPLFTEALSDEVVNARMGEDTDPRLRQVMAAAVRHLHAFV
FT                   KEVEPTHEEWMKAIEFLTKTGHMCTEWRQEFILLSDILGVSMLVDAINHRRPDGGTENT
FT                   ILGPFYVPQAPQYERGVDICLDGKGIPISVKGSVLDTQGHTIDGAKIDVWQTNDDGFYD
FT                   VQQHGIQPDWNLRGVFTSDAAGTYRFRSVKPRDYPIPDDGPVGQLLHALGRHPNRAAHI
FT                   HFIVSAPGYETIITHIFSPDCKYLRQDTVFGVKESLIAEFLPMSGPGAGEEADMSGDWF
FT                   SVNWDFVLMKKAS"
FT   gene            complement(156996..157976)
FT                   /locus_tag="Arad_7160"
FT   CDS_pept        complement(156996..157976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7160"
FT                   /product="metal dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7160"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28723"
FT                   /db_xref="GOA:B9JM09"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM09"
FT                   /protein_id="ACM28723.1"
FT                   /translation="MQGKIALEEHFAIPDTLQDSAGFVPGDYWKELSARLLDIHEQRLM
FT                   QMDAYGIEKMILSLNAPAVQAIPDKAKALEISRRANDFLAEQCARNPDRFLGFAALPLQ
FT                   DPDAATAELQRCVKTLGFVGALVNGFSQEGDGVTPLYYDLPQYRGFWAEVEKLAVPFYL
FT                   HPRNPLPQDSRIYAGHPWLMGPTWAFAQETAVHALRLVGSGLFDDHPALRIILGHMGEG
FT                   LPYMMWRIDNRNAWVKVAPNYPAKRRIADYFNENFYITTSGNFRTQSLVDAMLEIGADR
FT                   ILFSTDWPFENIDHASDWFDTATISEADRLKIGRTNAATLFNLES"
FT   gene            complement(158027..159259)
FT                   /locus_tag="Arad_7161"
FT   CDS_pept        complement(158027..159259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7161"
FT                   /product="FMNH2-dependent monooxygenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7161"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28724"
FT                   /db_xref="GOA:B9JM10"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM10"
FT                   /protein_id="ACM28724.1"
FT                   /translation="MSTKTASFLASRWAENARLSDRVAPILEEIRNNARDTEKAGRVPT
FT                   RNIELLREAGYFDIVKPARFGGRQGSFTELVDANIEVSAACASTGWVAGLLSAHQWLVA
FT                   MFDERVQQEVWESNPNALICGSYAPVRMAERVDGGFHLSGDWAFASGCENADWALCAAV
FT                   IPARNEGDRSGPAFLLVPSGDYTIAETWDVVGLAGTGSKSLILKDAFVPEHRILSFSDA
FT                   TSGKTPGGSGYKGVGLFNIPLLMGIPFCLGSTAIGAAKGALTSYLDQMGNRVTRGAVAG
FT                   GNNRVAEFPTIQLRVAEASALVDAAREIVLRDVARAQELAQASEDGKGEITEENRLLAR
FT                   RSQAFAVTLALRAVEALNASTGGLGLQMSNPVQRAWRDANAVGRHISMNWDTVGTMIGQ
FT                   HLLGLAPKGQY"
FT   gene            complement(159270..159803)
FT                   /locus_tag="Arad_7162"
FT   CDS_pept        complement(159270..159803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7162"
FT                   /product="4-hydroxyphenylacetate-3-monooxygenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7162"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28725"
FT                   /db_xref="GOA:B9JM11"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM11"
FT                   /protein_id="ACM28725.1"
FT                   /translation="MSATAVLDIKPAPISDAFRATMRRFPATVTVISACRNGVDHGMTA
FT                   TAVTSLSMDPPSLIICLNNRTFLHDMLLEVREFAVNVLTNSQVALSEGFSGKVPPERRF
FT                   EASDWIRHERGMMVLGSAHASVVCHRTGAVPYGTHTIFIGQVVDTQLSDGTIPLMYENS
FT                   NYCAPQHALLSPQN"
FT   gene            160019..160471
FT                   /locus_tag="Arad_7163"
FT   CDS_pept        160019..160471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7163"
FT                   /product="Transcriptional regulator protein, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7163"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28726"
FT                   /db_xref="GOA:B9JM12"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM12"
FT                   /protein_id="ACM28726.1"
FT                   /translation="MYKLTDSVPYLLNRAGVRIAEVFAQRIAEDNISVPMYRVLAMLRE
FT                   RRESTLGDLADVVSVEISTLSRLVGNLAKRKLVSRTRPEDNGRIVIVRLTEQGEALTER
FT                   LMPLAVELESTAVQGLSEEEVRALKSALRRMHANLSAISSKGKPAD"
FT   gene            160674..161957
FT                   /locus_tag="Arad_7164"
FT   CDS_pept        160674..161957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7164"
FT                   /product="transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7164"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28727"
FT                   /db_xref="GOA:B9JM13"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM13"
FT                   /protein_id="ACM28727.1"
FT                   /translation="MAIQDLGVAKARVRSANSIIVLCGLLILFDGYDLIVYGAVVPALL
FT                   NEPGWGLTPVTAGRAASLTLFGMLLGALVAGTLADKIGRRHVIIGSLVSFSVMMIGSGL
FT                   APNFATFEATRFLAGLGLGALFPTVTALIIEFSPPKRKAMAYSVALLGYLIGGVISGLL
FT                   GMALLKAYGWRPLMIIGGAPILLLPFFLRLIPESPEWLATKNRQAEANFIANQFGLPNP
FT                   LPKPANSYRTGIPALFSDGRLLPTLSAWGIHFCSLLLTFGMVNWLPTIMNRMGYDIGSA
FT                   LFFAVTLNIGAGVGLLIGARIADRGNVKMVVAGMFFLGACAIWLLTQMEQGLQVYGLVA
FT                   LAGTGTIGTQILANVLVGSLYPVEIRGTGLGFSLGIGRIGGMAGPAIGGAVLGSGLAPQ
FT                   WNFYIFAGVGAVGCVLALTTLLYSNGER"
FT   gene            complement(162273..163058)
FT                   /gene="casR"
FT                   /locus_tag="Arad_7166"
FT   CDS_pept        complement(162273..163058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="casR"
FT                   /locus_tag="Arad_7166"
FT                   /product="calsymin transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7166"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28728"
FT                   /db_xref="GOA:B9JM14"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM14"
FT                   /protein_id="ACM28728.1"
FT                   /translation="MALAQFGPVAMALKGVRGHRWVVSPKQRTVRRCDKAACPKECLME
FT                   RSAMTIKPRAKRKSWSEDDPRFERMAEKRALILESAKAVFLSEGYAAASMERISAHAGV
FT                   SKMTLYRHFKDKESLFIETINQQCGAIYQFSQHKPAASRDEAVIELKRYGAAFIDVVIA
FT                   PDILGLYQTLLGEMMRFPDLGRMFFDIVIARSIEAIERILSGIMPPNEVAWRAPAFMHL
FT                   VMGDSYQRLSLGKLSYDECRRRCVSEIDKAARLIICELS"
FT   gene            163244..163402
FT                   /locus_tag="Arad_7167"
FT   CDS_pept        163244..163402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7167"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28729"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM15"
FT                   /protein_id="ACM28729.1"
FT                   /translation="MSGGGRDVAEIARRWIFEAVITIHIESSASSPPDTRRIALLKHPM
FT                   AIQPRSN"
FT   gene            complement(163527..165278)
FT                   /locus_tag="Arad_7168"
FT   CDS_pept        complement(163527..165278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7168"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7168"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28730"
FT                   /db_xref="GOA:B9JM16"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR005674"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013736"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM16"
FT                   /protein_id="ACM28730.1"
FT                   /translation="MYSTKWTTSPREHDVIIERNVRIPMSDGVYLDGDIFRPASGDSYP
FT                   AILGVHAYDNAMQSTPTMPRAMQGKNAQAEAGDPQFYARRGYVHAIVNARGTGRSEGLY
FT                   SHYGPRDVEDIRDTIAWLAEQSWCDGNVGMFGVSYFSVAAKQVAATNPPALKAVWGQYG
FT                   YTDFYRDKFYHGGILAHTFLTSWAKHLAGVRIDPWSRRNLGEEEYSRRLTALRANRDIM
FT                   AVPELAAAVREPDAGPNPIILDVLLNPEDGPYWQERAPNLEAIKVPIMLGACWGMYGLH
FT                   LPGEFRAWERITAPKKMIVGPPIYLDRPVYQYAEASLRWFDHWLKGNDTGIMDEPPVQL
FT                   YLMGSGGKWLDSDTWPLPQTKWQSFFLHRDGLLSEHEFWPNEGATSFEDNTFNARGAID
FT                   FTTPPLVEETEIVGPAKLTVYVSSSDDEVLLFASLWDVDADGGQRILTRGWLRGTLADI
FT                   DGDLSKPWQVHYRHKERTVVEPNVPQRYEINLIGTANVFKAGHRIRLRISASDEETPES
FT                   FLHLLAQGHLLRQRPSWISIHHDADHPSALDLPIISGNRIGTYISGGKSERTAGAGSSE
FT                   KRGWDRW"
FT   gene            complement(165290..165715)
FT                   /locus_tag="Arad_7169"
FT   CDS_pept        complement(165290..165715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7169"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7169"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28731"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM17"
FT                   /protein_id="ACM28731.1"
FT                   /translation="MSKTSIVREAFAISLETATRLVSAAIASEERQSIPMSVVVVDAAG
FT                   QLVHASRMDGATLLSYEVAQRKAWTAAMTGFDTDGVRHFIESDAGSLRSMPHLPGFSVV
FT                   SGGLPIIVDKRCVGAIGVSGGPAPIDLAVAKVALESL"
FT   gene            complement(165777..166388)
FT                   /locus_tag="Arad_7170"
FT   CDS_pept        complement(165777..166388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7170"
FT                   /product="NADPH-dependent FMN reductase flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7170"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28732"
FT                   /db_xref="GOA:B9JM18"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM18"
FT                   /protein_id="ACM28732.1"
FT                   /translation="MTSSSNHDPRPFIVGLGGTTKAESSTEKAVRIALRAAEEAGARTK
FT                   MFDGHFLARLPHYAPESQSRTMDEQNFVSAVRKADGVIVGSPGYHGGISGLVKNALDLL
FT                   EDTASDDRVYLEGLPVGLIVTAYGWQATGSTLAQLRGIVHALRGWPTPLGATIKSSGGV
FT                   FTPDGQCTDQQAAAQLAMVGRQVVEFATWRAAAQARQSVA"
FT   gene            complement(166399..167523)
FT                   /locus_tag="Arad_7171"
FT   CDS_pept        complement(166399..167523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7171"
FT                   /product="luciferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7171"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28733"
FT                   /db_xref="GOA:B9JM19"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM19"
FT                   /protein_id="ACM28733.1"
FT                   /translation="MVKSWLFDIFNYPYEPTAEGFDPQLCQEVYNWHLESWELAEKVGF
FT                   EGIMFSEHHYTAYNLSPSPNLLIAATAQRTKRVKLGVMINILPMHNPRRVAEECAMLDY
FT                   LTHGRLEIGVGRGVDQKEFKREGIPMEEVRPRFEEGMDFMMKALENKVFTHKGRYLNFE
FT                   EETTLWPQPLSRPIRRPWISGLSPETISWAGTNGYRLATAFQATSAIKDAFASYYEAAD
FT                   AAGKPSGPENTMVLRQVFCAETDEEARAIAEPALNHIFALYREAVIFKDLDHVPDSFEF
FT                   YSSFFKPFTGSGPISWEVLDELGIFVVGSPSTVREKLIKQARELHTENILMWGSFGTLT
FT                   AEQTMNSYRLLGREVIPALSELSVAREPEIAAAQ"
FT   gene            167747..167908
FT                   /pseudo
FT                   /locus_tag="Arad_7176"
FT                   /note="catechol 1,2-dioxygenase fragment; Incomplete gene
FT                   (pseudogene)"
FT   gene            complement(168751..169230)
FT                   /gene="cheW5"
FT                   /locus_tag="Arad_7177"
FT   CDS_pept        complement(168751..169230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheW5"
FT                   /locus_tag="Arad_7177"
FT                   /product="chemotaxis signal transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7177"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28734"
FT                   /db_xref="GOA:B9JM20"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM20"
FT                   /protein_id="ACM28734.1"
FT                   /translation="MPDLQHSGEPRSSRAPEIIAFHLGDQQFCIKTTVIREIRGWAAAT
FT                   PLPQAPPHVLGVMNLRGSVIPVINLAARLGVCSAVDTSRSAIVVAEVGANIVGLVVDRV
FT                   SDILSISNELIQPVPDLGAAFDPAFSYGLIPLEQGMVCFLNLDHMFANLGLADAA"
FT   gene            complement(169230..169571)
FT                   /pseudo
FT                   /locus_tag="Arad_7178"
FT                   /note="Conserved Hypothetical Protein; Incomplete gene
FT                   (pseudogene)"
FT   gene            169597..170340
FT                   /locus_tag="Arad_7179"
FT   CDS_pept        169597..170340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7179"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7179"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28735"
FT                   /db_xref="GOA:B9JM21"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM21"
FT                   /protein_id="ACM28735.1"
FT                   /translation="MDFFASGFSMNDFKWRHFCGDEILWAVRWYCKYGISYRDLETMLC
FT                   ERGVNVDHTTICRWVQHYAPEMEKRLRWYWKRPSMWRSWRVDETYVKVKGKWVYLYRAV
FT                   DKYGDTIDFYLSQTRNAKAAKRFLGKALAGLNDWEKPLTINTDKAPAYGVAIAELKVDG
FT                   KCPAETVHRQVKYLNNVVEADHGKLKRLIKPTLGFKSMKTAYATLKGFEVMNALRKGQA
FT                   ALWQYEGGVMGEVRLINRQFGVYPV"
FT   gene            complement(170523..170924)
FT                   /locus_tag="Arad_7180"
FT   CDS_pept        complement(170523..170924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7180"
FT                   /product="two-component response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7180"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28736"
FT                   /db_xref="GOA:B9JM22"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM22"
FT                   /protein_id="ACM28736.1"
FT                   /translation="MKGCGAQRGSRLSQSKLIAIVDDDRSVRDATENLVRSYGLNARTF
FT                   ASAESYLAAARDCSVDCLITDVQMDGIGGMELFQILREFGITTPVIFITAFPDEHISKR
FT                   VIAAGAVAFLGKPFESQTLIDCIERALTH"
FT   gene            complement(170972..171613)
FT                   /locus_tag="Arad_7181"
FT   CDS_pept        complement(170972..171613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7181"
FT                   /product="two-component response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7181"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28737"
FT                   /db_xref="GOA:B9JM23"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM23"
FT                   /protein_id="ACM28737.1"
FT                   /translation="MTETLPSMVFVIDDDASLRDALSSLFRSVGIQVELYGSPSEFLAR
FT                   EPVTVGESCLVLDIRLPGVSGLDFQNQLSKLGNTIPIIFMTGHGDVPMSVRAMKAGALD
FT                   FLIKPFRDQDMLDAVSNALALDRERRATKETMSVWKARYETLTAREREVIAMVTSGLMN
FT                   KQIAGMLGVSEITVKLHRGHLMEKMGVRTLAELVKIYELLRPGLKDNASA"
FT   gene            complement(171613..173157)
FT                   /locus_tag="Arad_7182"
FT   CDS_pept        complement(171613..173157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7182"
FT                   /product="serine/threonine kinase protein of two-component
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7182"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28738"
FT                   /db_xref="GOA:B9JM24"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM24"
FT                   /protein_id="ACM28738.1"
FT                   /translation="MPVQLLRSRNGMSRLMQVAAILIAVAIFLLDTLTNYDIAIAVLYV
FT                   SVVLLSLNFTGRTGLLLTGAACIGLTVLSYLISHGIDFTSEPLGRCCVSLAAIAITTFL
FT                   ALRVKATITVLGESEQRYRTIFLATGVAILEMDFTDLKVAIDRLKMDGFPSIDVVAKSE
FT                   PDFVQRAMKLMRLTNANNTTLTMFNAKSIEAFKSELPALIGSQMESSIWSLLDAIWKGR
FT                   QTHESEVTMNDMDGGRHTVLYNVAMPADRPALDLVLISIMDVTARREAENGLHAAQAEL
FT                   AHVTRVATLGELTASIAHEVNQPLAAVVTNGEAGLRWLKRVEPNLDEVAASMQRMIADA
FT                   RRAGEVIRHLRALSSKTDSQTVPVDLNEVIEETIELVQREIASQRIRLRLDLANDLPAV
FT                   LGDPVQLQQVTINLVLNAIQAMSAQGRGRRELSVMSSGDHETVRVKVCDTGPGFASGEA
FT                   ANLFNAFYTTKSNGMGMGLSICRSIVSAHGGRVSAISDPVNGTSFEFTIPVQEGTA"
FT   gene            173541..174764
FT                   /locus_tag="Arad_7183"
FT   CDS_pept        173541..174764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7183"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7183"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28739"
FT                   /db_xref="GOA:B9JM25"
FT                   /db_xref="InterPro:IPR006045"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017774"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM25"
FT                   /protein_id="ACM28739.1"
FT                   /translation="MATFNRRDALVTLAAGGLVAAASPAAFAQELPQPRRGSVGGDDPG
FT                   PRNIGRDRQNPDILNQPVTDAGTLPNLRFSFADAPTKEYPAGWTRQITVRELGISKSIA
FT                   GVDMRLNAGGVREMHWHKEAEWAFMLYGNARVTAVDSDGKNFVGDVGPGDLWYFPSGTP
FT                   HSIQGLGPDGCEFLLVFDDGGFDEDSTFLMSDWFKHIPKNILAKNFGVDAKSFDKLPSP
FT                   GERYIFNLPVPGSLSSDKIAGAVSVPVSLTHQMSAQDPIKSSGGTVRITDSKNFPASKT
FT                   IAAALVEIQPGGIRELHWHPNTDEWQYYIEGSGRMGVFAANGHARTFDFTAGDVGYVPF
FT                   AMGHYIENTGDKPLKFLEMFKSDHYADISLNQWLALTPPELVSGHLNFDKATMAALKQA
FT                   KQPVVSGT"
FT   gene            complement(175730..176257)
FT                   /locus_tag="Arad_7185"
FT   CDS_pept        complement(175730..176257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7185"
FT                   /product="Helix-turn-helix, AraC type:ThiJ/PfpI"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7185"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28740"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM26"
FT                   /protein_id="ACM28740.1"
FT                   /translation="MSNAFETSALKGDDYIRWLDGLWLERLLGACDPKPELTIGILLWP
FT                   TFPMMSLTGILESLRHAANFGDNSRPVHRRWSIMAERGYKASASCGLRVPADLPYINPT
FT                   DFDDAVVKRGATPASSRRTGAPPRLSKGSSRRWRSPDRRLYLCPHTRTRRLARRLQGRC
FT                   PPVPPRGFPKGR"
FT   gene            complement(176556..177590)
FT                   /locus_tag="Arad_7186"
FT   CDS_pept        complement(176556..177590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7186"
FT                   /product="transcriptional regulator protein, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7186"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28741"
FT                   /db_xref="GOA:B9JM27"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM27"
FT                   /protein_id="ACM28741.1"
FT                   /translation="MQETARSNHVSRLQGATFDHMVETFTESFGPFEAWPVTRGRTFDW
FT                   KADLWSNGTLSLIIGEYHSEWRAKAVPETQEWLSILLPLTGAIDVARGRNVIEGVPGQM
FT                   LLVNNREAERFSVRGEPHRSQVLRLNWTAMAQKVADILEIPLSGALDLSPVVDLSTSSG
FT                   QVIGGLGQVIILGIRDAGPLCHSPIAISNLTETLADMIVRSIPHRLSHHLDKKIHMIAP
FT                   RHVHSAIEFMRANIDRPFTMQKVAEVAGVSIRSLEEGFRTFKGTTPAAFLRTMRLRAVR
FT                   EDLLDHSNRRSVQDICLKWGFFHFGRFSTVYRMTYGENPSDTRKRISRGFASFTPTLTN
FT                   RLPS"
FT   gene            complement(177778..178740)
FT                   /locus_tag="Arad_7187"
FT   CDS_pept        complement(177778..178740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7187"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7187"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28742"
FT                   /db_xref="GOA:B9JM28"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM28"
FT                   /protein_id="ACM28742.1"
FT                   /translation="MNEECPTPPFSWGTTSRRAFDQVGSRYRRHSLHREGALQVARIWH
FT                   KPGAARYNPNQNLAHANQSKRQDERADPGKAECAASPHSSMEGRSGLRCSYSQKNSGSF
FT                   GLEFLVENKRANWSRLWLGVGFAMARPQEFDTADVLNKAMQLFWNKGFESVSLTELLKA
FT                   TGLSKSSLYGTFGNKRELFLAAYDVYRVARAHELEITLNKGLARNALETFFCKIIADAR
FT                   AVEFTSGCMSTNQAVEMAPYDPQVRGRVEADFQLIEDAFASTIERGRADGSIKSSRSSR
FT                   EIASLLVVAFPGFQVMVRAGAGEARLETALNVLLSNLDT"
FT   gene            complement(179680..180117)
FT                   /locus_tag="Arad_7188"
FT   CDS_pept        complement(179680..180117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7188"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7188"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28743"
FT                   /db_xref="GOA:B9JM29"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM29"
FT                   /protein_id="ACM28743.1"
FT                   /translation="MIDRLQKLRQSRSGASAVEFALVMPAFLLMLFGIVEFGRLFWTSH
FT                   ALHETAIATARCMGIPQLECEDGGAYSTSKVITFAETKAAGWFVNLDPASIALDHNASC
FT                   YGLAGFSQVNLTYQFTTALPGLLTSLAGGTGLVAQACYTNQ"
FT   gene            complement(180710..182659)
FT                   /locus_tag="Arad_7191"
FT   CDS_pept        complement(180710..182659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7191"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7191"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28744"
FT                   /db_xref="GOA:B9JM30"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM30"
FT                   /protein_id="ACM28744.1"
FT                   /translation="MNRSIRVLLHYLRLFCDDRKGGIAIMTVFCLPVVIGFAALSIEYG
FT                   YGLLVRDQNQRTADLASYAGALAYSNANSEDQMTDAALRVAKLNGVDAANVVVSLTASP
FT                   KDSRVQAVHVDVTTTNTLFLAPILGVDSKLNIATEAYSSLGAAESGCIIALDKSASGVT
FT                   LSGGVQANASSCYVASNSNLVAPCGTKITAKSASYYEGSSQPCPWSTNIVRADGSPAPV
FT                   TKQYTSDPLEGNAGVDKLSGRFDTIREATWPSKVSTGNGTDIEFGGSSSPSVTAAAIDA
FT                   VGCSYDPANYNQYWTTKWDITCSGSKISMGSLLVHGNVQVNFNTAGSKSTIYSFSGRIQ
FT                   NDFGTKLVFGDGTFNVAKGVYGADLTFGAGTFHFGMGDQNCGDARYSLCSSGKLTIGGP
FT                   SSFILDAGFYTGDGATLKLGAGASNSYTIGKSSGSNGIGVGGGSVTSMADASSGAGSFR
FT                   VNGGINGGGGGSCITIPASAQHDISGNVNLAGGARLGAGIYTVDGYFSVNTGGASCGDS
FT                   VAVSGKDVTIIISGVASPSDWECNGKSFCLTGGNAITLTAPQSGTYANLAVIGPQSSSN
FT                   TTGAEITSGGTGKISGAFYFPNGKIDFGGGGSLGNVPGGCLQLIGASISLSGGSQTMSE
FT                   CVLSTGSGKVALIQ"
FT   gene            complement(183323..183571)
FT                   /locus_tag="Arad_7192"
FT   CDS_pept        complement(183323..183571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7192"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28745"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM31"
FT                   /protein_id="ACM28745.1"
FT                   /translation="MTLLGAVGPSYLIVRGNEPLDLGIFAQLDMELIESMRQFAFNKIP
FT                   AWPSISSCMKPSRRSIFWFPDYMIAFAQLAPDRMRKY"
FT   gene            complement(183699..183938)
FT                   /locus_tag="Arad_7193"
FT   CDS_pept        complement(183699..183938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7193"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28746"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM32"
FT                   /protein_id="ACM28746.1"
FT                   /translation="MKPEITWPLIRLDPSIMMIDLFRDPGPPIRYDIVDGPIALQIGRM
FT                   AMLASALLKSPAFVIFLENTLPLGKISSTALLIK"
FT   gene            184587..186494
FT                   /locus_tag="Arad_7194"
FT   CDS_pept        184587..186494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7194"
FT                   /product="sensory box/GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7194"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28747"
FT                   /db_xref="GOA:B9JM33"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM33"
FT                   /protein_id="ACM28747.1"
FT                   /translation="MSIPLDNPELLKAQYQAFSYQLPLMYVILLTNTWVLAATHISVAP
FT                   AWLVVYIPALLTLACAVRIVSWSRSMRITPTPELAAHALTRTNRLAGIMAICFTAWALL
FT                   LFPYGDAYAKSHVAFYTAITVIGVIFCLMHLRPAAFTVAAIVNGAFFIFFILSGNVVFI
FT                   AIAINTALVSGTMLVILLVYYRDFTRMVEAKVRTEALSNENSRLANLDSLTDLPNRRAF
FT                   FSHLTRAVCEAQAEGLRLAAGIIDLDGFKPVNDLYGHGAGDKLLYEVGQRLARLCSGNV
FT                   YLARLGGDEFALIVSGLSDDTELMALGDNLCLTLRTPFLLTEAAVQISGSIGFAVYPEM
FT                   AANVEDLFERADYALYHGKRTNRGNAVLFSSDHDAEIRRDARIEQALQMANLREELSVM
FT                   FQPIVDVRSHETIGFEALARWTSPIIGKVSPAQFIPVAERAGFINRVTRPLLEKALAAA
FT                   ADWPMGIRLSFNLSAQDLTSPEGLLHLIAIIHASGFDPRRLDLEITETAFTADFGQIQS
FT                   AITTLKALGCGISLDDFGTGYSSLSRLHSLPLTKIKIDRSFVTDLHEKPASYKIVKSLL
FT                   ALGRDMGLDCVIEGVETREEMDALKELGGLIVQGYFYSPPIQETDIRDFLKLPATEAMG
FT                   "
FT   gene            186745..187518
FT                   /locus_tag="Arad_7196"
FT   CDS_pept        186745..187518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7196"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7196"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28748"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM34"
FT                   /protein_id="ACM28748.1"
FT                   /translation="MILANEETGTTGHEALRVEDGTVVTLMPQTAGGSRSGSIALVTLA
FT                   RGGVLSSVATARCELALVALAGAARLEVDGKPHVIGPFQCFYIGQAAVTIRASEHFRLL
FT                   VIAGDLSAADGKAPVAPRMIDIVTAPDHPFHMPEQGFYHLSARWLVDGGIGSDKLVIGQ
FT                   STFASHDGAHELHRHAHGEEFFFVLEGQGVHLTEDGEYPMAGGDLVFVPCEEWHGFRNT
FT                   ASTPVRALFGFLGVNSLDGAGYELHARTIGMAGGR"
FT   gene            complement(187551..188366)
FT                   /gene="iclR"
FT                   /locus_tag="Arad_7197"
FT   CDS_pept        complement(187551..188366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iclR"
FT                   /locus_tag="Arad_7197"
FT                   /product="transcriptional repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7197"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28749"
FT                   /db_xref="GOA:B9JM35"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM35"
FT                   /protein_id="ACM28749.1"
FT                   /translation="MDNSQDVPQMHDGSGGIQSLNAALRLLQAMTTVKGPLTLSEIAKQ
FT                   CDMPLSKAHRYLASFVQAGLVEQAGRSGKYNLGRGAVLLGLAALERHDFVNRAADDLPD
FT                   LCAETGLTALLAVWGNNGATAVRWERGSQPTVTSIGLGTTLPLLNSATGRCFMVWGPQV
FT                   PIRPVLEAELLRARKSSGVLPDMTPSPSGVEELRRMIRQAGYASVDGRFIPGLVAIAAP
FT                   ILDWQGEAQAVVTLIGTDPATARTGSDAVTKLLAFVQHQSIFLRENRQK"
FT   gene            complement(188359..188772)
FT                   /locus_tag="Arad_7198"
FT   CDS_pept        complement(188359..188772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7198"
FT                   /product="4-hydroxylbenzoyl-CoA Thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7198"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28750"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM36"
FT                   /protein_id="ACM28750.1"
FT                   /translation="MIEIHGSLEQCVSFGDCDPTGIVFYPHFYAWFDRTFHALLARFGG
FT                   HSTLCGQLGAKGVGLIEASARFHRPLQDGDRIRIDLVVKEWGEKTVSLGYEVWKGDVLC
FT                   ATGAEVRGLFKETDTGMIAASIAPLKRALEADG"
FT   gene            188861..191593
FT                   /gene="matB"
FT                   /locus_tag="Arad_7199"
FT   CDS_pept        188861..191593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="matB"
FT                   /locus_tag="Arad_7199"
FT                   /product="long-chain-fatty-acid-CoA ligase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7199"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28751"
FT                   /db_xref="GOA:B9JM37"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR011957"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM37"
FT                   /protein_id="ACM28751.1"
FT                   /translation="MQGLGKVEILGGGPAGLYTAILLRRMLPNVVVRVTEQNPQGATFG
FT                   FGVVFSDQALEFLKAEDPEIHDLVEPQMERWRNMTLNHPEGQVTLDGVGFTAIGRLNLI
FT                   EILRKKVQELGVEVRFAHPITSLDKLEGDLIIGADGLNSLVRRSDETVFETTVEHFSAH
FT                   FAWFGTNKVFDTLTQTFIRTDKGPLNAHHYRFSPTTSTFIVECEPETFEAWGFDAMSEA
FT                   ESARVCSEIFKDVLDGQPLITNRSMWRNFPRLWCDRWFAGNHVILGDAAHTAHFSIGSG
FT                   TRLAFDDAIALVKALASHGELSDALSAYDAVRRPIARKLVNAANTSASWYETFGEKMAM
FT                   APVDFAFDYLMRSGRMDINRARQLAPGFIARYETEKAAKQGVVTDPVGDGLPGELEIGF
FT                   NRAAHPNCSSILWDNLARNPDKSAIIGPTGSMTYAELIADAARWGNAFRAAGLERGDRI
FT                   PFFLDDTPTYPAAFFGAVRAGFVPVLLNTMTPIDTLNYYLKDTGARLALSEAALLSRFT
FT                   GEALVGTALETVVVANGAIRGERQVRAEDFLADQPATLDCSDTGPDDMAFWMYSSGTTG
FT                   KPKGIVHLHHDMAYTQASFGDNVLKLRSDDIVFSVPKIFFAYGFGNSLTFPFSIGATVL
FT                   LMPGRPDPVSILAFIEAYRPTVFFGLPTLYTALCRADAVQHRDLSSIRQSMSAAEILSE
FT                   DVYHAWKALVGYGPTEGLGSTEVLHIYLSNALDDHRLGSAGKCVPGYEVKLVTPEGNPI
FT                   QPGEEGIMLVRGNSSAPCYWNRPDKTRETMLGDWMWTGDRFVERDGHYYFQGRADDLVK
FT                   VSGQWVWPLEIERCLNEHPAVHECCLLAQEMEDRRMSLHAVVHLKAGQAGDGTMTKVLQ
FT                   DYVKTTLLPFKYPRAVTYVAELPKTGTGKIDRQAVKSMV"
FT   gene            191645..192346
FT                   /locus_tag="Arad_7200"
FT   CDS_pept        191645..192346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7200"
FT                   /product="fumarylpyruvate hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7200"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28752"
FT                   /db_xref="GOA:B9JM38"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM38"
FT                   /protein_id="ACM28752.1"
FT                   /translation="MAFVFSPAPTPSVAIAVSEDRLPVRRIFCVGRNYAAHAREMGKDP
FT                   DRDPPFFFTKPADAVVDSDETVAYPPLTENFHYEAELVAVIGRAGRNITEADSLSHVWG
FT                   YAIGNDLTRRDLQLAARDQGRPWDWGKAFDRSAVIGPVHPVSKVGHPEKGAIQLSVNGV
FT                   VKQDADLTELIWSVPEIISILSHSVALQPGDLIMTGTPAGVGPLVPGDICTVHIDGLGS
FT                   ISTPIAERFAS"
FT   gene            192343..192990
FT                   /gene="maiA"
FT                   /locus_tag="Arad_7201"
FT   CDS_pept        192343..192990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maiA"
FT                   /locus_tag="Arad_7201"
FT                   /product="maleylacetoacetate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7201"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28753"
FT                   /db_xref="GOA:B9JM39"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR005955"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034330"
FT                   /db_xref="InterPro:IPR034333"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM39"
FT                   /protein_id="ACM28753.1"
FT                   /translation="MTMKLHNFFRSSTSTRLRAALNLKGLSYEYIPYVLRRGDTRRPEY
FT                   LAMNPAGLVPVLERDDGKVLTQSLAIIEWLDETHPEPALLPADAEGRVRVRGLSYMIAC
FT                   EVHPLNNLRVLGQLTEQFGADEAAQKVWFTHWVELTFDALEVQLANDPATGRFCHGDTP
FT                   CMADLCLYAQVWNNRRFEIDLDRWPTIARIFAALDTIPAFSNAAPPRQPDAA"
FT   gene            193051..194118
FT                   /locus_tag="Arad_7203"
FT   CDS_pept        193051..194118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7203"
FT                   /product="gentisate 1,2-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7203"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28754"
FT                   /db_xref="GOA:B9JM40"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM40"
FT                   /protein_id="ACM28754.1"
FT                   /translation="MQPEDTPALRELYAGFERQHIRPLWTQIGNLMPKHPHPQAVPHIW
FT                   KWADLLPLAQKSGELVPVGRGGERRALGLANPGLGGNTYISPTMWCAIQYLGPRETAPE
FT                   HRHSQNAFRFVVEGDGVWTVVNGDPVRMSRGDLLLTPGWSFHGHHNDTDHAMAWIDGLD
FT                   IPFSYQNDVGFFEFGSERVTDYATPRFSRSERLWCNPGLRPLSGLQDTANSPIGAYRWE
FT                   FTDRALTEQLLLEEEGQPATVEQGHAAIRYVNPTTGGDVMSTIRCEFHRLRAGTETATR
FT                   REVGSSVFQVFEGRGVVVIDGATHRLDIGDIFVIPSWVRWSLQAETQFDLFRFSDAPIM
FT                   ERLNFARTLVEGEAP"
FT   gene            194115..194702
FT                   /locus_tag="Arad_7204"
FT   CDS_pept        194115..194702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7204"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7204"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28755"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM41"
FT                   /protein_id="ACM28755.1"
FT                   /translation="MTNLDAGRAELRERQGEGARYDAPAAPSWDLALARRGTAYFARLL
FT                   NDLNDAELDAPCADAVASRRAIIAAVGLQARHMAEAIAWCREKGGTAFPDALELNMDNV
FT                   ALTATLPARALRNLFTHAEVHLNVEWRDMTDVHWDQSVFGKDGLLLGLRALPMLRARSL
FT                   WRAAFDLRSGARRADLPLGIDIAALSGAFTLP"
FT   gene            complement(195232..195690)
FT                   /locus_tag="Arad_7206"
FT   CDS_pept        complement(195232..195690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7206"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7206"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28756"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM42"
FT                   /protein_id="ACM28756.1"
FT                   /translation="MIAKSAHIPADGGEQISFMGMDLVWKLNKERSSTLMTFIQIAPPG
FT                   GGVPLHIHHNEDESIFLIEGSLMFQVGSEKFEVDKGGTVYMPKGETHGFRITGDKPAHI
FT                   LFTLGLSPQSRYEDMFNGLVGLSPDDFDRIQEVCGRNAVEFLTPPQMP"
FT   gene            complement(195759..196643)
FT                   /locus_tag="Arad_7207"
FT   CDS_pept        complement(195759..196643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7207"
FT                   /product="Glyoxalase/Bleomycin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7207"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28757"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM43"
FT                   /protein_id="ACM28757.1"
FT                   /translation="MIKVNRIVYAAFETPDLDGQVDHYTKTMGLTLMDRDSSAAYLSSS
FT                   GDRHTVVLRKGAEARCDALGFQLPQGTDLGEYAKQIAGHGIQAQRQSDCQPGIKDSLVF
FT                   VDSKGTKVETFVEAPIAGIGFQPSGISPNKLGHVAFNAVDVQAAVKFYCEVLGFKVSDW
FT                   MGDFFAFLRCGPDHHTINLVSGAKNKMHHIAFELRDWTHIRDACDWLATDRIPVIWGPV
FT                   RHGIGHNISTYHRNADGQIIELFCELDRVNESLEVYEPRRVHQEFPQKGKVWTDKPMAA
FT                   NMWGSMPPEGFLD"
FT   gene            complement(196661..197536)
FT                   /locus_tag="Arad_7208"
FT   CDS_pept        complement(196661..197536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7208"
FT                   /product="2-hydroxyhepta-2,4-diene-1,7-dioate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7208"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28758"
FT                   /db_xref="GOA:B9JM44"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM44"
FT                   /protein_id="ACM28758.1"
FT                   /translation="MNEYKLGTGIIDNRPIPLVLVGNKVFTLPEVLGESAPTSLEAVFA
FT                   DWSNMDPVLSARAASLTGGRDPESIQFLTPVANPRKIVCIGINYRDHLTEMKVTEPPTF
FT                   PYGFLRPQTSLAAHQEEIQLPSGAKMIDWEAELGIVIGRLYGPGDMADPLDAVAGYTVL
FT                   NDISARDWIETRPFVGVDWVMQKSWNQFQPTGPWITPARYVADPQNLPICLTLNGEIKQ
FT                   NSNTGQMIFGVRDIIRHLSNMMTLEPGDIIATGTPAGVGFGRRPPEFTKPGDRIAITIE
FT                   GLGTLENTFV"
FT   gene            complement(197533..198489)
FT                   /locus_tag="Arad_7209"
FT   CDS_pept        complement(197533..198489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7209"
FT                   /product="6-Phosphogluconate dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7209"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28759"
FT                   /db_xref="GOA:B9JM45"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM45"
FT                   /protein_id="ACM28759.1"
FT                   /translation="MERPWTVQCFDLSGGIVADKIGLIGLGKIGFPIAENLIRGGLVPA
FT                   GYRRGDTSSFASIGGTVADSPRSLAEMSDIIICCLPNEAALADVISGARGIATGDCTGR
FT                   VIVELSTLSTAVKAQQAARIAARGGVMLDGAVSGLPSMVAAREATFLLSGEEDVFLRVR
FT                   PVLELLTTRLFYLGAFGAALKAKLCANMLVAANLAATAEMLAFAARIGLDQLRLIDALK
FT                   TSAGTSTQFLARANRMAQGDWHIVMGSTRMLTKDIRLIEEAARAADCPIPLLTGSARFY
FT                   DAAIAEGYGDLDVASLYAVFAKAAGLRVPDEKKDDPK"
FT   gene            198572..198775
FT                   /locus_tag="Arad_7210"
FT   CDS_pept        198572..198775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7210"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28760"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM46"
FT                   /protein_id="ACM28760.1"
FT                   /translation="MPGGPKLSGASNLLRFNIGGFDPPGSRGQLFIHFLENARFFQNKI
FT                   EKQKNRLERARSMHPFLMIIAL"
FT   gene            199056..199799
FT                   /locus_tag="Arad_7211"
FT   CDS_pept        199056..199799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7211"
FT                   /product="short chain dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7211"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28761"
FT                   /db_xref="GOA:B9JM47"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM47"
FT                   /protein_id="ACM28761.1"
FT                   /translation="MRGLKGKTAIVTGGANGIGRAFSLRLAQEGANVVIADIADGSVTA
FT                   GAVEKEGVKTLAIRCDMSSGDSIAAMGAEVDKTFGGADILVHNAGIYPATLFEEMSFEE
FT                   WKRVLTINLDSVFHLTKAVLPKMKDKGWGRIISVSSTTFHSGIAYNSHYTASKAGLIGF
FT                   SRGLATEIGVYGITVNCIAPGLVKTETTAAGPHAQWFDALAQQQAIKRTETPEDLVGPM
FT                   AFLASDDAAFITGQTLLVDGGWRFV"
FT   gene            199878..200846
FT                   /locus_tag="Arad_7212"
FT   CDS_pept        199878..200846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7212"
FT                   /product="sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7212"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28762"
FT                   /db_xref="GOA:B9JM48"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM48"
FT                   /protein_id="ACM28762.1"
FT                   /translation="MVRTMVRRVFAVDEIGLILGLVILILLVGLPNPALFSLGSIKSIL
FT                   RDGAFVAIMAFGMVYLIAMIEIDLSVGAIYAVCAMLAALMIKAGYDPWLGALAALAFGI
FT                   FLGAMNAWLTILLDVPLIIITLGTQSVFLGFNLIISGAHPVFGLPKDHLFFVIFGGEFL
FT                   GLPAPTWVMLFIGIVMHIVLYRSRFGATVRAIGSNRSAAEFIGIRLNRVRIIAMAIMGF
FT                   LCALSGVLTMAYFKAVDPGLGIQKEMQVIAAVVIGGTSLAGGSGTLVGALLGVLIISII
FT                   QSGIVFFGVDPNYGRFITGVVIVLAIALDRILKRRRMVGAH"
FT   gene            200882..201979
FT                   /locus_tag="Arad_7213"
FT   CDS_pept        200882..201979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7213"
FT                   /product="conserved hypothesis ribose ABC transporter,
FT                   periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7213"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28763"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM49"
FT                   /protein_id="ACM28763.1"
FT                   /translation="MKNRNRWTMHASAIGLGLALSLSAASAFAEDPISISYVGAFTANE
FT                   WHTEIVAGAKAAVADLPFKVNLRVVGPSDFDPVQQATIFTREAQTQPNGMIVTNVASAL
FT                   FVQPAQDAQAQGITVTWTNAAPTPDFAGSLFVSADPKAQGMAGAKIVAKVLEARTGKPA
FT                   AQIEGKFVVGLCVPGLATLENRIAGFRKGMAKVLPKVSILPTIETKPDRSGNFVDWNQA
FT                   VQANRDALGFIDACEAGQQNIAKIIEDDKLQATSVAFDAPAEVRDAVARGVIPASVPSN
FT                   HYLQAYFSTYLTAMALHDKKPMPKGWVVLPPTIIDAANVGKLVEGWKEPVKGLRAYFDA
FT                   DIKQVLADVAAGKTAATADYDKAPD"
FT   gene            202038..203624
FT                   /gene="rbsAch2"
FT                   /locus_tag="Arad_7214"
FT   CDS_pept        202038..203624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsAch2"
FT                   /locus_tag="Arad_7214"
FT                   /product="ribose ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7214"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28764"
FT                   /db_xref="GOA:B9JM50"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM50"
FT                   /protein_id="ACM28764.1"
FT                   /translation="MVGGGETMQKIVFEARGVSKSFGPVQVLDDVSLSLKQGEVLGLIG
FT                   ANGAGKSTLMKILAGSLRPSEGEILLDGKPCLMNSMQEAWAVGIGFVSQELNLFPALTI
FT                   LENLALVPGQTGSMHDAALQSASAATLMELGLTLPLDIKVQELSLADRQLVEIARALLR
FT                   NPRVLILDEPTSALHPAETERLHDVIRKLREGGVAIIYISHFLEHLLDIADDFAVLRDG
FT                   RRINFQTRKERPTVPELVEAMLGSRPAAATVAPLRKERGAGLVALEIADATTRSGLSVD
FT                   QLRAESGEVVGIAGHVGAGPEDLFQLLFGRLPLKSGKISLPSGQVMRPDTPAAVQAGVA
FT                   YFPADRKRLGLTLRQSIRDNISAVRSLSLGRDGLLPSARHQSNRAEERGKTIGIKMSSI
FT                   DQVVGELSGGNQQKVVFARWLEARPSLLLLDDPMRGVDVNAKRQIAGIIHDLLNEPRVI
FT                   LFHSTDPADYVAIAHRVIIFVDGTTFCELSGEQLTEHNLVAAMNGIRVDGGDDHHQPHR
FT                   SNLASRGGGFQ"
FT   gene            203833..204306
FT                   /locus_tag="Arad_7216"
FT   CDS_pept        203833..204306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7216"
FT                   /product="lactoylglutathione lyase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7216"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28765"
FT                   /db_xref="GOA:B9JM51"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM51"
FT                   /protein_id="ACM28765.1"
FT                   /translation="MIGRFFQMGIVVPDMDAALRAMTAKIGTGRFMTLPPNLKESWYRG
FT                   RMETMSYALAFGYMGDIQVELMQPISGNSTYSEYLAKFPEGGVHHLGFEVDDFDAAAAM
FT                   MDERGYRAVQKGSFGDTRFNYYEHDGDTGVITEILFVDPAVKDMFARIREQNF"
FT   gene            204443..205120
FT                   /locus_tag="Arad_7217"
FT   CDS_pept        204443..205120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7217"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7217"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28766"
FT                   /db_xref="GOA:B9JM52"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM52"
FT                   /protein_id="ACM28766.1"
FT                   /translation="MQDADTARGKQTIAEDVYHRIRGDIISGKLSPGMTLRSDWMREQY
FT                   SVGISPLREALTRLSSERLIVAESQKGFRVAPIDASEVIDVLETRIMVETKALRRSIEL
FT                   GSVEWEGRILSAYHIMSRNKIPLVGATGTEQWVASHRNFHMVLLSASGSAWLLHLARLL
FT                   FDQSERYRAVRAARAEGGNLARDIDLEHKRILDATLARDADMACNALIEHYTRTTNAVL
FT                   KVL"
FT   gene            complement(205166..207112)
FT                   /locus_tag="Arad_7218"
FT   CDS_pept        complement(205166..207112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7218"
FT                   /product="oxygenase (tetracycline 6-hydroxylase) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7218"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28767"
FT                   /db_xref="GOA:B9JM53"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR012941"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR038220"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM53"
FT                   /protein_id="ACM28767.1"
FT                   /translation="MQFHLNGFRTGDPAISEPLGQHIIADTVSLPDEVDVLIVGCGPAG
FT                   LTLAAQLAAFPAIKTLIVDQKPGPLELGQADGIACRTMEMFQAFGFAERVMKEGYWVNE
FT                   TAFWKPDEVLRERIVRQGRVQDVEDGLSEFPHLILNQARVHNFFLDVMRQSAAPLEPAY
FT                   SRRLLDLQTDAGQGTSGHPVTARLERIDPAHEGQIETVKARYLIGCDGARSTVRKSIGR
FT                   SLRGDSANHAWGVMDVLAVTDFPDIRLKALIQSAGEGSIVLIPREGGYLVRIYVELDKL
FT                   NENERVANRKLTVEDLIGAVGRILHPYRFEVKEVAWWSVYEIGQRLCDKFDDVPETEVG
FT                   TRLPHIFIAGDACHTHSPKAGQGMNVSMQDSFNLGWKLAAVLQGRCAPELLHSYSDERQ
FT                   SIAKELIEFDREWAKMLSAPLKSSPEGDGVNPAEIQQYFVRHGRYTAGTATRYAPSRLT
FT                   GKPTHAHLARGLEIGTRFLSAPVIRLADAKRMHLGHAALADGRWRLYAFAGTEDTAVSG
FT                   SHLHALCQFLAQSPASPVRKYTPSGSDIDSVIDLRAIFQQSHHELALEDMPALLLPAKG
FT                   RLDLRDYEKMFCADVRSGDDIFDMRGIDRARGCVIVVRPDQYVAHILPLNAHSELSAFF
FT                   DGFMIQPSSIGPA"
FT   gene            complement(207270..208247)
FT                   /locus_tag="Arad_7219"
FT   CDS_pept        complement(207270..208247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7219"
FT                   /product="aliphatic sulphonate ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7219"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28768"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM54"
FT                   /protein_id="ACM28768.1"
FT                   /translation="MKRRDILRLIGAAVPAIALGSSRALASEDSFKLAIGQRGNWENSV
FT                   CELGQNAGFFKKHGITLDLLYTEGGGQTQQAVISGSADIGIGVGTYGVMGAFAKGAPLR
FT                   IIGSSMTGAHDLYWYAKADGPIKTIKEAVDKTVAYSTNGSSTNLVVLGLQKTLGIQFKP
FT                   TATGSPASTFTQVMSGQIDVGWSSPPFGVADVDAGRIRIVARGSDVPQFANQSVRVMIA
FT                   NAASFERRTDAYGRFMKAYREALDWLYADPAALDAYGAWAGVTPALAKRVRDEFYPKKN
FT                   LAPDKVNGLDELMVDAVAYRYLSAALQPDQVKKLVVADAGALAP"
FT   gene            complement(208244..209194)
FT                   /locus_tag="Arad_7221"
FT   CDS_pept        complement(208244..209194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7221"
FT                   /product="conserved hypothesis ABC transporter, periplasmic
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7221"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28769"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM55"
FT                   /protein_id="ACM28769.1"
FT                   /translation="MLELKQALFALLALAFTGAAQAEELKLAIGQRGAWDTAIAELGNR
FT                   AGIFKKHDIDLRILYTQGGAETQQAVLSRSVDIGIAAGTLGALSVAAKGAPLRIIGGEA
FT                   TGVSELYWYVPMASPIKTVNDMAGHTVGYSTSGSSSHTPLLLLAKEHKIDIQPVATGGL
FT                   ATTLTQVMSGQIDVGWAVAPFGLDQLDKTIRIVARGSDVAATRQLTTRVLITHAEVLAQ
FT                   KKLTIEKFLAAYRETLDWMYADPAAIKIFAEFAGISESATKRTRAEFFTKAALDPGTIT
FT                   GLPAIMADGVQFKFLQAPLTREQLAQIIQIERKAP"
FT   gene            complement(209205..209993)
FT                   /gene="tauC"
FT                   /locus_tag="Arad_7222"
FT   CDS_pept        complement(209205..209993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauC"
FT                   /locus_tag="Arad_7222"
FT                   /product="taurine uptake ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7222"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28770"
FT                   /db_xref="GOA:B9JM56"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM56"
FT                   /protein_id="ACM28770.1"
FT                   /translation="MAATTRIIDTQGRLDLSVSTIRVIGALVLLGIWQGLALSGFFFRD
FT                   VVPPLQKIAYGLIALFANGAFYANLAVTGGELALALVIGSLAGVLAGLLLGGSQVMSDA
FT                   YESWLSYLGPTPKIILFPVMIMLFGVDAGSKVAMGAVSCFFPIAISVASGIHGVDPTLR
FT                   RVGRSFQANAWQVFLKIELPAMTATLVNGFRLGFGVAMIGVLLAETKLSNQGIGFMIIN
FT                   AYTRFDMPQMYALLIVTIAFAAVVNAFAVRMARRFGARAI"
FT   gene            complement(209972..210646)
FT                   /locus_tag="Arad_7223"
FT   CDS_pept        complement(209972..210646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7223"
FT                   /product="aliphatic sulphonate ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7223"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28771"
FT                   /db_xref="GOA:B9JM57"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM57"
FT                   /protein_id="ACM28771.1"
FT                   /translation="MAEVINPYIVPLPTDIAASLWRVVVEEGIPGRFAVTVGETLAAGL
FT                   LILLVGMPIGLLLYRFGRLRLAFEPWLAAMAAAPLVLAYPLFLVLFGRSSLTIIVIGFA
FT                   AGVAPVALKTIEGFASTRRVLIDVGRSFRLTPAQEFRKILLPAALPQIFVGLRLGLIFC
FT                   LINVVGVEFLINLGGLGQLINDLAERYDLPGTYAAICFVVLVSILFFAILDRGEKWLQR
FT                   RG"
FT   gene            complement(210739..211590)
FT                   /locus_tag="Arad_7224"
FT   CDS_pept        complement(210739..211590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7224"
FT                   /product="amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7224"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28772"
FT                   /db_xref="GOA:B9JM58"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM58"
FT                   /protein_id="ACM28772.1"
FT                   /translation="MIAEKDIIARAQLDAAPPVPPPLTVENVTKRFGEGPGALTAVDSV
FT                   SFTVASGEFVSVIGPSGCGKSTLFHVIGGLTDATLGSVRVEDETINGPHPAIGIVFQEE
FT                   STFPWRNVIDNVAFPLELRGVGREERYAAASRYIDMVGLHGFEKQLPSELSGGMRQRVS
FT                   IARTLSAKPRILLMDEPFAALDEQTRLLLGDKVLQIQQQLQQTTLLITHSITEAVQLSD
FT                   RILIMSYRPGRVKRIVKVDLPRPRTSDVVGSREFGALVADIWADLREEASRGLAESERG
FT                   SG"
FT   gene            complement(211587..213377)
FT                   /gene="ilvG"
FT                   /locus_tag="Arad_7225"
FT   CDS_pept        complement(211587..213377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvG"
FT                   /locus_tag="Arad_7225"
FT                   /product="acetolactate synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7225"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28773"
FT                   /db_xref="GOA:B9JM59"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM59"
FT                   /protein_id="ACM28773.1"
FT                   /translation="MNDFNTDIVDLSGIEQPQALPPKRDALFGSDAVAEVLRSLDIPYI
FT                   ALNPGASYRGLHDSLVNHLGNVRPQMLLCLHEEHAVAIAQGWAKVTGKPMLVGVHSNVG
FT                   LFHATMAIFNAWCDRMPVIVLGATGPVDAAKRRPWIEWIHTAQDQGAIVRPYVKWDAQP
FT                   ASPAAAREALLRGAWLAKTAPQGPVYINLDAGLQEEPLAEPLPEIDPKRFMPTVAATVS
FT                   ENQISELLDLLKQAKSPVFLMGRVSRSQEGWDERVTLAEAFNASVVTDLKLGAAFPTDH
FT                   PLHVGNPGIFPLPEAMVVFAKADVIVSLDWVDLAGTLHMACKDAPPGKIVQISLDHALH
FT                   NGWSADHQGLPPVDLFLAAEPDQVVTSLVSKLPKVDTPRLPAVALPDARKTTGSITVPD
FT                   MAVVLRQVVGTRPVSLLHLPLSWDGASWPFRHPLDFLGSDGGGGIGGGPGIAVGAALAL
FT                   RGSGRLPIAICGDGDFLMGATALWSATHYRIPALFVIANNQSFFNDEVHQERMARMRDR
FT                   PVENKWIGMRMTDPEIDLAAIARAQGATGIGPVKSMDQLEAVFKEAIAVVDAGGVAVID
FT                   VHVATGYTPAMASALTRAKP"
FT   gene            complement(213374..214876)
FT                   /gene="betB"
FT                   /locus_tag="Arad_7226"
FT   CDS_pept        complement(213374..214876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betB"
FT                   /locus_tag="Arad_7226"
FT                   /product="betaine aldehyde dehydrogenase (BADH) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7226"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28774"
FT                   /db_xref="GOA:B9JM60"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM60"
FT                   /protein_id="ACM28774.1"
FT                   /translation="MNERVEAQSDRVELILPTRTDLYYGGRWQEALGKRRVYVNSPATG
FT                   KLLGSVADADAGDVDAAVTAARKGFDEWRKVAPLERGKILKAMAEVLRRNGRELAMLDA
FT                   ADGGNPFTEMQGDVMIAAAQMEFFAGLVTEMKGNSIPMGPNAVNFSVREPRGVVARIIP
FT                   FNHPFMFCAGKSAAPLAAGNAVIIKPPEQAPLSALRLAELIGGMLPAGVFNVIPGGREV
FT                   GAALTSHPQVDMVALIGSVPTGRAVMKAAADTIKPVLLELGGKNALIAFADADPEEVAT
FT                   AVVNGMNFTWCGQSCGSTSRAFLHEDIHDAVVAKVAERATRFKPGIPTDPATTMGAIAS
FT                   KAQYERVLRYIETAKTEGARVVCGGKRPSAPELADGYFVEPTIFADVTMDMTIAREEIF
FT                   GPVLSVLRWSDERAMIEQVNRPEYGLTCSIWTNDLTKAHRTALEVQAGYIWVNETSKHF
FT                   LGAPFGGFKQSGIGREECLEELIAFTQEKNIHINLRRGSTPQ"
FT   gene            complement(214939..215727)
FT                   /locus_tag="Arad_7227"
FT   CDS_pept        complement(214939..215727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7227"
FT                   /product="Class II aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7227"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28775"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM61"
FT                   /protein_id="ACM28775.1"
FT                   /translation="MCTSGQHSHSDPIAVDIDDTADTSVAPSRELIEELVAANQILFDQ
FT                   GVVDAFGHISVRHDKRPDHFFLARNMAPSRVTTEDIIEFTLDGEAVNANGRKVYLERFI
FT                   HSEIYRARPDVVSVVHSHSHSIVPLSVVKGVRLKAIFHMAGFVGQGAPVFEIREAGGDA
FT                   TDLLISNNTLGKALAKHFDGHDIVLMRGHGSTVVGISIKQAVYRAVYAELNARYQLQAM
FT                   QLGEVTFLTEGESQACVQNVEGQVQRPWDMWLEQARARRN"
FT   gene            216314..216781
FT                   /locus_tag="Arad_7228"
FT   CDS_pept        216314..216781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7228"
FT                   /product="transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7228"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28776"
FT                   /db_xref="GOA:B9JM62"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM62"
FT                   /protein_id="ACM28776.1"
FT                   /translation="MSMQHVYQMPGHLIRRAQQIAVSIFLEESASVDITPVQYAALVAV
FT                   RDNPGIDATRLSALIAFDRSTLGNVLERMESKGLILRIGDKDDKRIKLLRLSPKGEEVL
FT                   DEAEPLVSRAQERILAPLAPEDREIFLRMLSQLVELNNDASRAPLKVDRQR"
FT   gene            217068..218039
FT                   /gene="ocdch1"
FT                   /locus_tag="Arad_7229"
FT   CDS_pept        217068..218039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ocdch1"
FT                   /locus_tag="Arad_7229"
FT                   /product="ornithine cyclodeaminase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7229"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28777"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM63"
FT                   /protein_id="ACM28777.1"
FT                   /translation="MTDTQLRILDARTTGALLPFSELVAALRRAFAEGCVVPVRHHHTI
FT                   ANDAEPDATLLLMPAWHETQRPERYLGIKIVTVFPGNTARGIPGLTSSYILYDGRGGAQ
FT                   LALLDGNTITGRRTVAASALAADYLARKDAHRLLVIGAGRVASLIPDAYRAVRQIEQVD
FT                   IWDIDPQSAARLAQTLTQQGLKASVVSDLEAAVGSADIVSAATLSTVPLIKGEWLRPGT
FT                   HVDLIGGFTPTMREADDEAVRRSSVYIDTHEALHEAGDLVQPIKAGAFSAELVRATLDE
FT                   LCRRDTPARSSDTEITLYKAVGTALADLAAATMVYEGSLSAK"
FT   gene            218049..218459
FT                   /locus_tag="Arad_7230"
FT   CDS_pept        218049..218459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7230"
FT                   /product="translation initiation inhibitor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7230"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28778"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM64"
FT                   /protein_id="ACM28778.1"
FT                   /translation="MYGGMRMQREIIEVPIISEAIRRLGAPTSAVVRMGDLVTTCGMPP
FT                   IDTVSGEIVKGDIATQTRAVLDALSVALEHAGSSLSKVIKTTVYVTDPDLMAEVNAVYR
FT                   AYFRDGFPARTSAAIKPWAQPFDIEIECIATR"
FT   gene            complement(218481..219122)
FT                   /locus_tag="Arad_7233"
FT   CDS_pept        complement(218481..219122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7233"
FT                   /product="demethylmenaquinone methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7233"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28780"
FT                   /db_xref="GOA:B9JM65"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM65"
FT                   /protein_id="ACM28780.1"
FT                   /translation="MNDTDMTAEVLQLLKDVETATIGHIRSSGFLAPQIQCLTDGVRIV
FT                   GPTHTASLPGDDGAALAQAVSTARPGDILVIERLDDDRHACWGAVMTAAAQAAGIVGVV
FT                   IDGYVTDLGAIRASGLPVWCRGRSPLTTKIHGGGSVGGAINCGGVAITAGDIVLADENG
FT                   VYAATITEALAAGREALVIQSREPGIIARIEAGETLAAIYGNPVPPDESN"
FT   gene            complement(219191..220453)
FT                   /locus_tag="Arad_7232"
FT   CDS_pept        complement(219191..220453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7232"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7232"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28779"
FT                   /db_xref="GOA:B9JM66"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM66"
FT                   /protein_id="ACM28779.1"
FT                   /translation="MRKIAVASVIGTTVEWYDLFVFATASALVFNKVFFPSFDALVGTL
FT                   LAFGTFASAYLARILGAALFGHFGDRLGRKSMLLFSLVMMGVATFAIGLLPNYDSIGIW
FT                   APILLLFLRVMQGLALGGEWGGAVLMAVEHAPKDKRGLYGSWVQIGVPAGTLIANLVFL
FT                   AIASSMSSEDLLAWGWRVPFLASILLVAVGAYVRLNTAETPSFAKVKKEDATAKMPFLE
FT                   LFKKSWKTVVLGGIATMSTGSSFNLIVAFGLTYGTQALKISRNEMLVIVLIACAVCIVL
FT                   LPLFGWLSDRIGRRPVILGGIIAEAVVAFPMFWLMDTQTFIGALAGYLLMMTAFAANYG
FT                   PIATFLAELFGTKVRYSGLSISYMLSGVLGSALTPIITTWLLSATGSGASVAWYMIGSA
FT                   LLSAVALLLLSETIKRDLAKA"
FT   gene            220740..220916
FT                   /locus_tag="Arad_7234"
FT   CDS_pept        220740..220916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7234"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28781"
FT                   /db_xref="UniProtKB/TrEMBL:B9JM67"
FT                   /protein_id="ACM28781.1"
FT                   /translation="MILFPSSGFIANSPSHEVGPREHGMRFFIPFFSNHAGEETMRQIE
FT                   NADATYRVRRWEY"
FT   gene            221240..222487
FT                   /gene="amaB"
FT                   /locus_tag="Arad_7235"
FT   CDS_pept        221240..222487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amaB"
FT                   /locus_tag="Arad_7235"
FT                   /product="N-carbamoyl-beta-alanine amidohydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7235"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28782"
FT                   /db_xref="GOA:B9JMK1"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMK1"
FT                   /protein_id="ACM28782.1"
FT                   /translation="MSRQTNLRPNIDRLWSSLMRSAEIGKTPKGGLKRLALSEEDAVMR
FT                   RQFIDWCEEAGCTVRVDPLGNIFAERAGTDPDAKSVLVGSHLDTQVRGGRFDGILGVLA
FT                   GLEVVRTLNEHNLATRRPVTIVNWTNEEGARFEPPMIGSAVFTGQKALEFAYSRLDRDG
FT                   ISLGDALEKVAFKGGDHVSVDQFDSLFELHIEQGPRLDDAKLQVGVVTGAFGVRGFVVE
FT                   VFGETGHVGPTPMPARRNALVGAAHVTLAIDAIGWSHHETGSKSTTMRIRAEPNLLGAL
FT                   PDYVEMTCDMRHPDEAVVIEMLEAFKAQIPQLEERSRCRIVIKEAWSYGGMRYDPDCVG
FT                   LVRDAAQRLGYTTMDLLTEAGHDAMHVAEFLPTAMIFTPCEGGLSHNEAENVTIADIEP
FT                   GVNVLLQAVVERANQI"
FT   gene            complement(222497..223450)
FT                   /locus_tag="Arad_7236"
FT   CDS_pept        complement(222497..223450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7236"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7236"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28783"
FT                   /db_xref="GOA:B9JMK2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMK2"
FT                   /protein_id="ACM28783.1"
FT                   /translation="MASRYPRINNLNWNLLRTFLVIVEERNITKAADRLLLRQPSVTAA
FT                   LQKLEETLGRQLIQRDSRRFVLTSHGEMLRQECMEIFRRVERIGEKLSADEDDLTGQIR
FT                   IMIVTHVMMPGLDQALRQMRRRHPSVSVRIDVAHSQDIVRAVAQKQLPFGFCLLPKPLA
FT                   PLNCRFLMREEFGIYCGATHPLFGRSDVDLAQLREEAFIAFACSQEGGALEPMIALRDG
FT                   AGLGTWTVGSSPNLEEVRRLIAAGLGIGILPKDAAQHAVEAEELWLLPPLCDSLGADVY
FT                   LVTNPEMELGAAETAFLDIFNTALFDAQHQPPEALA"
FT   gene            224304..225464
FT                   /locus_tag="Arad_7238"
FT   CDS_pept        224304..225464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7238"
FT                   /product="permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7238"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28784"
FT                   /db_xref="GOA:B9JMK3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMK3"
FT                   /protein_id="ACM28784.1"
FT                   /translation="MRLPLASLALGAFAIGVTEFAPMGLLPNIAADLQVSIPSAGLLIS
FT                   GYAVGVMVGAPLVTLLLSAQKPKTSLIALMILFVVGNLLSAIAPSYGTLLAARVLTSLS
FT                   HGAFFGLGAMVAAKLVPPGKGASAVATMFMGLTVANIGGVPAATWLGVALGWRLALGAT
FT                   AILGAVAAIGLLLALPDGERGQPPSIVRDLKILARPTVIMALATTAFSAASMFTLYTYI
FT                   APVLGALTHASSGFVTAMLVMIGVGFTIGNMLSGRLADRALQPTLVGFLLALVVVNLAF
FT                   PLFATTQVGVTIALLIWGAVTFGAATPAQMRVMQEAHEASGLASSVNIGAFNLGNAIGA
FT                   AIGGAVLNAGLGYAWIAPVGGVMGLIAVLAALSNDRRPVLRDEGAS"
FT   gene            complement(225667..226551)
FT                   /gene="oxyR"
FT                   /locus_tag="Arad_7240"
FT   CDS_pept        complement(225667..226551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oxyR"
FT                   /locus_tag="Arad_7240"
FT                   /product="hydrogen peroxide sensing transcriptional
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7240"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28785"
FT                   /db_xref="GOA:B9JMK4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMK4"
FT                   /protein_id="ACM28785.1"
FT                   /translation="MELRHVRYFIAVAEELHFGRAALRLNLVQPALSAQIKALETILGV
FT                   ILLSRTRRRVELTPAGEGFLKDCYETLAHLENAVTSVVDMANGRRGEVRIGYGANATIA
FT                   GLLVPTIQRFRSDAPDVEIKLTEMSTRSVLESIMRGEIDIGYASLSLDALPEGIVGRYV
FT                   GEWPWMLAVSSTHPLAGRKHLRLADLANEAFVVYGDSGEHFDPADVQRIHESIESSFLR
FT                   RSGNLINLATYVAAGLGVALMPKPITELSLPGICYLSVDDLVTPMTMSLLWSRTTTSTA
FT                   VKNYIAAAVGEAT"
FT   gene            226696..227847
FT                   /locus_tag="Arad_7241"
FT   CDS_pept        226696..227847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7241"
FT                   /product="multidrug resistance efflux pump protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7241"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28786"
FT                   /db_xref="GOA:B9JMK5"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMK5"
FT                   /protein_id="ACM28786.1"
FT                   /translation="MQKQGTSADLVDTKTQRPIAGEIGGVPSPRRRDWSSLGRLFVPLL
FT                   VIVVVGTLVAVATENWDRWTAQASVQSTDNAYIRAELTRLSARVSGNLKSAPVQDFEHV
FT                   KAGQLLMEIDPSDYEVKVAQAKASLDSAVAQLQNLANQERLQHAAIDQANAQFQAASVT
FT                   AELARQEAVRQTALLQSGSGTKQKQEQADAEKQQTAAAAQASQASVVSARAQLDVVSGQ
FT                   RAQLQASVDAAKSNLDAAQLNLSYTKVVAPFDGIVSERQVHVGDYISVASNLLTVVPLP
FT                   NVYVTANFKETQLARMSVGQRVIIKVDTFPGQVFRGHVESLSPASGSQFALLPADNATG
FT                   NFTKVTQRIPVRIAFDEDASVLEKLRPGMSSVVAVQVDNVTGG"
FT   gene            227851..229473
FT                   /locus_tag="Arad_7242"
FT   CDS_pept        227851..229473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7242"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7242"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28787"
FT                   /db_xref="GOA:B9JMK6"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMK6"
FT                   /protein_id="ACM28787.1"
FT                   /translation="MTAKVPPLVARALGAQTHHPIFAVCAVLLGPFMVGFHSRLFSTGL
FT                   ADLRGAFDLSFDEGAWLNTISTAPQMLAAPAVAWLAATFGVRRVMVPPALLYAIVSAVI
FT                   PTVTDFRELAVLHFIHGLLLGIFVPATLMIIFRNLPLKWWTSAIAIYAFRAAFTTNAGT
FT                   GLLDFYIQNLGWKAVYWQDVLLAPIMAILVLLGSPREEVNRGLLAQADWGGMLLLGCGM
FT                   SLIFVGLDQGNRLDWLESGFVQSCLAGGAVLLLAFFINESLVKQPWASASVLYSRNLIL
FT                   ILTIALFYLISSLSNAALIPNFLSTVALLRPQQTGDMLIVWACIPLLIMTPICVWALNR
FT                   IDGRIVLLIGLTCFALSGWLGTRVTADWTADNFRLLAVLQGCGHILTFLPIIVLAVANS
FT                   NPAKSTSFAAYIQVIRLLGTEMALTLMTTFLRKQEQIHSFLLTMDVPTGAALTTDRILL
FT                   LTRKFAAFGQGLASSRALSTFNQALQKQSNVLSYIDAFWITFFAAIVAMLLLAFMRPAP
FT                   AGPFTPQGRQNALKATREQSKAV"
FT   gene            229710..230534
FT                   /locus_tag="Arad_7243"
FT   CDS_pept        229710..230534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7243"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7243"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28788"
FT                   /db_xref="GOA:B9JMK7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMK7"
FT                   /protein_id="ACM28788.1"
FT                   /translation="MFVRVAQLGSFTATAKASGISTAMVSKHIQDLENRLAARLLERTT
FT                   RSVKLTPRGQLFYSHCKNLIEQVVEAEQSVTRPPEPSGVLRIGAPKAFGSIVLMPEILR
FT                   LLSLFPELKVALILRDNIRDPRDENLDIAISAKAPRDDDIEMLTMRPQRRIVCASPSFI
FT                   DQGNDVSFESDGVSTDQHAERVPNFTGRSGAHQLLERLDLEDEEACLQAALLGAGAFEL
FT                   HEFLASQYLQDGRLLALSREPRIRTTNLLLLYEKGRILLARDRAFIDFAVAI"
FT   gene            complement(230531..230905)
FT                   /locus_tag="Arad_7244"
FT   CDS_pept        complement(230531..230905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7244"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28789"
FT                   /db_xref="GOA:B9JMK8"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMK8"
FT                   /protein_id="ACM28789.1"
FT                   /translation="MVTRWLPTALIGICSGFFLIGRILNILEPASIAAEFRRWGYPSWF
FT                   HDFVGTLEISAAILLLMPSTRIFGITMASMAMLGALVTVMLFAEWSHTIPPLIALGFLA
FT                   GLAFVTRSDLLHVGSVRPRP"
FT   gene            complement(230967..231443)
FT                   /locus_tag="Arad_7246"
FT   CDS_pept        complement(230967..231443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7246"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7246"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28790"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMK9"
FT                   /protein_id="ACM28790.1"
FT                   /translation="MSARIVKPGEGQATGVAGDIYTIKTSGQQTGGAYTVMEAIIPPQA
FT                   GPPPHRHTHEEECFYILEGEMELFADGQRDVAGPGTWITLPKGSLHYFRNIGQTPARML
FT                   ILAVPAGLDDFFIEVSQAEGTFSEKSPPVVTPEQIEKMVATAPKYGLEFAKPDE"
FT   gene            complement(231488..232339)
FT                   /locus_tag="Arad_7247"
FT   CDS_pept        complement(231488..232339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7247"
FT                   /product="alpha/beta hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7247"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28791"
FT                   /db_xref="GOA:B9JML0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9JML0"
FT                   /protein_id="ACM28791.1"
FT                   /translation="MTQQTDLTHHTAVVDGVRLHYVRAGSGDPLVLLHGWPQSWLEWRH
FT                   IIPTLASRFTVIAPDMRGFGDSDKPTSGYDKRTVAQDIRKLVQQLGFSEINLVGHDIGM
FT                   MVAYEYAASHPAEVRRLAVLEAGLPGLGLEALFDAALFPQFWHFGFFMAPGVAETLVAG
FT                   HEKMFLRHFIRHLAYDTYAVTEDDINEYADRMGAPGALRASFEHYRAFPIDARNNQENA
FT                   RTKLTMPVLAIGGDHCMGDQVGHIMRPLADKVETAVIEHSGHWIPEEQPKQLADLLTGF
FT                   FS"
FT   gene            232760..233530
FT                   /locus_tag="Arad_7250"
FT   CDS_pept        232760..233530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7250"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28792"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B9JML1"
FT                   /protein_id="ACM28792.1"
FT                   /translation="MSVVATLRRTYHGRHFRACGLRDGDVKGLIDPFIGFDNAWVSAGM
FT                   LLPHPQASFEAASYLFLDSETGMRHGSSPDDFAIIRPGGLLWSMVGTGESCEEVPLETD
FT                   KTVHAFHVLMRSPHERASAPPFTSSLEPQDVPVVRLPGARIRVLLGRYGVARSPLKAST
FT                   DVTLLDISLAEGSELIVPVPAGECAFAMPIFGAVDVDGNRFDHGDLKIPIFPARADPQR
FT                   ITLRAIQRPAKVALFGGRPLHQSYPKNQEKHHVL"
FT   gene            233520..234107
FT                   /locus_tag="Arad_7251"
FT   CDS_pept        233520..234107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7251"
FT                   /product="Isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7251"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28793"
FT                   /db_xref="GOA:B9JML2"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:B9JML2"
FT                   /protein_id="ACM28793.1"
FT                   /translation="MSYEKFSADNTAMLLIDHQVGTMSWAKSLPFDELKRNALMLAKTA
FT                   KILGIPTVLTSSMEAYAQGPLLAELETILPKEFAGRIQRLGIVNAMDDENFAAAVKATG
FT                   RKKLIIAGVTNDVCTVYPALSLVRDGFEVQVVADAGASPTRLADDIALRRMEHNGVTLT
FT                   STNQLIAELAGSWATPEGGQLVQVLMEALQPE"
FT   gene            234324..234491
FT                   /locus_tag="Arad_7252"
FT   CDS_pept        234324..234491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7252"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28794"
FT                   /db_xref="UniProtKB/TrEMBL:B9JML3"
FT                   /protein_id="ACM28794.1"
FT                   /translation="MFSPTAAPNPLRLQALFRQEQRRIHNTPTGASRPANLVATILYGA
FT                   EREAGGTLLR"
FT   gene            complement(234633..235370)
FT                   /locus_tag="Arad_7253"
FT   CDS_pept        complement(234633..235370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7253"
FT                   /product="accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7253"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28795"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR041602"
FT                   /db_xref="UniProtKB/TrEMBL:B9JML4"
FT                   /protein_id="ACM28795.1"
FT                   /translation="MIQILRANASRSFTQGPFTLRRIRPGSIMGPDADPAFGPLSVIDH
FT                   ANLDVGTVVGLHEHKNDEILSYLWRGSMVHIDSARGRVPISAKKLMLMNAGRSFWHEES
FT                   TPYVAVEMLQIFVRPYEADLPGKVQFFDRTGGLVPGGWQLIAGPEGTDAPLLLRQHVKV
FT                   YDALVSKGDELRVPTAPGMDPWLYVMDGALTIDGEQLETGDAAATSGEDLPMIRVERDE
FT                   TTLLAFLVDRGATASTAGTISGQ"
FT   gene            complement(235468..236187)
FT                   /locus_tag="Arad_7254"
FT   CDS_pept        complement(235468..236187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7254"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7254"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28796"
FT                   /db_xref="GOA:B9JML5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JML5"
FT                   /protein_id="ACM28796.1"
FT                   /translation="MQDSGMNTKTMSDVAYQRVRDDIISGALKPGEKLKVADLVERYDI
FT                   GASPLREALARLSAAYLVSFEGQRGFTVAPVSAQELKELSDLRQMIEALALSRSIEAGD
FT                   EAWESRIVAAYYRLQKADHRVSESPDASSLSEWEERNRDFHEALTSACDSAWLLRLQKL
FT                   LYAQHERYRRLAVINRRPSREIDKEHKALLDACLSRDTDVAAKVMGEHIGKTVLSLSPL
FT                   LEQGTQQESPRSRRKVG"
FT   gene            complement(236329..237345)
FT                   /locus_tag="Arad_7255"
FT   CDS_pept        complement(236329..237345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7255"
FT                   /product="4-hydroxy-2-oxovalerate aldolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7255"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28797"
FT                   /db_xref="GOA:B9JML6"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR012425"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017629"
FT                   /db_xref="InterPro:IPR035685"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9JML6"
FT                   /protein_id="ACM28797.1"
FT                   /translation="MPSIYVQDVTLRDGMHAIRHQYGLDAITSIARALDRAKVAAIEIG
FT                   HGDGLSGSSFNYGIGRHQDVEWIAAVADVLEHAKCTTLLLPGIGTVHDLKAAAALGVAS
FT                   VRVATHCTEADVAKQHIEAARALDLDVAGFLMMAHMNSPEGLAKQAQMMEAYGAHCVYV
FT                   TDSAGALTMDGVRERVRALRQALKPETQVGIHVHHNLSLGVANAVVGVEEGAYRVDASL
FT                   AGMGAGAGNTPIEVFAAVADRLGWQHGCNLFALMDAADDLVRPLQDRPVRVDRETLSIG
FT                   YAGVYSSFLRHAENASKTYGVDVRDILVELGRRRMVGGQEDMIVDVALDLLASQQRA"
FT   gene            complement(237345..238286)
FT                   /locus_tag="Arad_7256"
FT   CDS_pept        complement(237345..238286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7256"
FT                   /product="Acetaldehyde dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7256"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28798"
FT                   /db_xref="GOA:B9JML7"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR003361"
FT                   /db_xref="InterPro:IPR015426"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9JML7"
FT                   /protein_id="ACM28798.1"
FT                   /translation="MERTMTPIKAAIIGSGNIGTDLMIKILRTGSGIEMGALVGVDPAS
FT                   DGLERARRLGVFTTHEGLDGLRRSPIYKDIGIVFDATSAKAHERHAEQLRQDGKRAIDL
FT                   TPAAVGPYIVPVVNLEENLNAVNVNMVTCGGQATIPIVAAVARVAPVPYAEIVASIASR
FT                   SAGPGTRANIDEFTETTARAIEVVGGARRGKAIIVLNPAEPPLIMRDTVYCLALTQDQD
FT                   AVRRSIHDMIDRVRGYVPGYRLKQEVQFEPLRDARAVGGEEDGPALKVSVFLEVEGAGH
FT                   YLPSYAGNLDIMTSAALAVAERFARTLIEENA"
FT   gene            complement(238294..238731)
FT                   /locus_tag="Arad_7257"
FT   CDS_pept        complement(238294..238731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7257"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7257"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28799"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:B9JML8"
FT                   /protein_id="ACM28799.1"
FT                   /translation="MSSLLSKPALSLVLAEMAADRALAAATGRRLAVTVAVVDDGGHLL
FT                   VLKRMEQVGPAGPVTATAKARTAALFRRTTAQLAEAVAAGASGLLSISEALPLAGGIPI
FT                   VVDDVVIGAVGVGGATPDEDAAVAEEACCALAAFLRPSADR"
FT   gene            complement(238734..239894)
FT                   /gene="stcD"
FT                   /locus_tag="Arad_7258"
FT   CDS_pept        complement(238734..239894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stcD"
FT                   /locus_tag="Arad_7258"
FT                   /product="2,4-dienoyl-CoA reductase (NADPH) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7258"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28800"
FT                   /db_xref="GOA:B9JML9"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B9JML9"
FT                   /protein_id="ACM28800.1"
FT                   /translation="MTVSIDRMMSPLNIGGKTMRNRIVHAPMSVGYADSAGIPLQTMVE
FT                   HYGRRAQGGVGMVITENVAISTAGRQMPHQPMLSDRRRVPAFAAVAAEIKRHGALAVMQ
FT                   IVHAGRYAGPWDVYESARRLAPSAVSFPLLPGRVVTPDEITAGEIKQCIDEFVETALSA
FT                   EQAGFDGVELHAAQGFLISSFLSPRLNRRTDQWGGSFENRIRLLMEVLRRVRAVVAPSF
FT                   IVGVHLISDELAPGGWAVSEAIRLSPLLEDAGADFIMPVVSTFETLKAPENAGLMNTPF
FT                   FQHSATAAIKKAVGIPVFTNGRIDTPEAIDTVLAAGEADAVGLARPLFADPDWVAKVIA
FT                   GRVADIRVCGCPTSLCLRTQLTGSVCECWPDPAKQAGFLGYERSAA"
FT   gene            complement(239922..240809)
FT                   /locus_tag="Arad_7260"
FT   CDS_pept        complement(239922..240809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7260"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7260"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28801"
FT                   /db_xref="GOA:B9JMM0"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMM0"
FT                   /protein_id="ACM28801.1"
FT                   /translation="MIGVKKIGHATFETPDLERQIAYYTEVLGLTLTDREKDRAYLAST
FT                   LDHHSVVLTRGDEARCSKLSFQVAPGTDLKDYARQLAGHDVSAELRSDPEPGIRSLLSF
FT                   SDPKGTTIEAYAERDFAQQNYAERGVAPLKLGHLAFNVDDVQQIVNWYVKVLGFRESDW
FT                   MGDFFAFLRCGPDHHTVNFVRGARVKMHHIAFELRDWSHIQSASDILGRSGHPLIWGPG
FT                   RHGMGHNIYTYHRDPDGQIVELFTELDQINDEELGYFEPRPWHEDRPQRPKVWKPGVYA
FT                   ANLWGVAPPSDFLD"
FT   gene            complement(240836..241729)
FT                   /locus_tag="Arad_7261"
FT   CDS_pept        complement(240836..241729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7261"
FT                   /product="2-hydroxyhepta-2,4-diene-1,7-dioate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7261"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28802"
FT                   /db_xref="GOA:B9JMM1"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMM1"
FT                   /protein_id="ACM28802.1"
FT                   /translation="MSMLKLGSGRIDGSKMLLLALNGRIYRAADLLAGERWHDLTLDEL
FT                   LEHWEEFFPELQKALVHLPDPQVRPVEEAAIDWLPPIERPGKVVCIGTNYRDHLAEMRV
FT                   AELPAFPYAFMRPAGSLNGHGKAVPVPDWPQMIDWEAELGFVVGRRARNVPQETALDII
FT                   AGYTVINDISARDWIESRPFVGVDWVMQKGWDGFQPTGPWLTPASLVPDPQNLAIRCLV
FT                   NGVVKQDSNTNQMIFGVREIIAHLTKIMTLEPGDVIATGTPAGVGFGRQPREALRTGDI
FT                   VRVEIEGLGAIENHMK"
FT   gene            241873..242103
FT                   /locus_tag="Arad_7262"
FT   CDS_pept        241873..242103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7262"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28803"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMM2"
FT                   /protein_id="ACM28803.1"
FT                   /translation="MTDGRGGSGLAHFDEEEKMNTIATPAHRPGTRERAPDALPYECII
FT                   QQIERMPIIHWHVRAAIVFKTSERALEEIAP"
FT   gene            242189..243685
FT                   /gene="betB"
FT                   /locus_tag="Arad_7263"
FT   CDS_pept        242189..243685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betB"
FT                   /locus_tag="Arad_7263"
FT                   /product="betaine aldehyde dehydrogenase (BADH) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7263"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28804"
FT                   /db_xref="GOA:B9JMM3"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR017628"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMM3"
FT                   /protein_id="ACM28804.1"
FT                   /translation="MTTSAQVLDVTRHKRVQNFIDGAAVTGGDHNTFENINPATGEVVS
FT                   LIEEATADDVDRAVSAASRALSGPWGKLTHHERAKLLHRVADGIEARFQAFLDAEVADT
FT                   GKPVGMASHLDIPRGAANFRAFADILHHHAGEFFTMATPDGGEAINYTIRAPKGVIAVV
FT                   CPWNLPFLLMTWKVAPALACGNTVVVKPSEETPSTAALLGEVMREAGVPDGVYNVVHGF
FT                   GPDSAGEWLTRHPGVDAITFTGETRTGSAIMKAAADGVRPVSFELGGKNAGLIFADCDL
FT                   DKAVEQTARATFLNAGQICLQTERVYVERPIFDRFVAGLAQAAQNLVAGDPHDPKTTFG
FT                   PLISLGHRDKVLSYYEAARRDGATIVTGGTALDMPGSLNGGAWVAPTIWTDLPHTSSVI
FT                   REEIFGPCVHVEPFDTEEEAVMRANDTEYGLAAMVWTRDLSRAHRVAKRLEAGIVWVNS
FT                   WFLRDLRTAFGGSKHSGIGREGGLHSLEFYTELKNVCIRL"
FT   gene            243701..244507
FT                   /locus_tag="Arad_7264"
FT   CDS_pept        243701..244507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7264"
FT                   /product="hydratase/decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7264"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28805"
FT                   /db_xref="GOA:B9JMM4"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMM4"
FT                   /protein_id="ACM28805.1"
FT                   /translation="MLAENASIQRIADALHLAETETSPIEPIRPILAAGDIEAAYAVQD
FT                   INTERALVSGRRLVGRKIGLTAKSVQRQLGVDQPDFGMLFADMEVENGGELPHARLIAP
FT                   KVEAEVAFVIGRNLAIPQPTVADVIRAVEFVLPALEIVDSRIANWDIRIVDTVADNASS
FT                   GRFVLGSVPRLLAGLDLRLAGMVLEHNGEPASTGAGAACLGHPLVALQWLARKMFDVGR
FT                   PLQEGDIVLSGALGPMVPATPDSVFEARVSGLGTVAVTFTSSDRRA"
FT   gene            244509..245276
FT                   /locus_tag="Arad_7266"
FT   CDS_pept        244509..245276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7266"
FT                   /product="4-oxalocrotonate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7266"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28806"
FT                   /db_xref="GOA:B9JMM5"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMM5"
FT                   /protein_id="ACM28806.1"
FT                   /translation="MSVAEHAERVDTAAREARAIAQFPEGSFDTETAYAIQASSVANRL
FT                   ERGERLVGVKMGFTSRAKMAQMGIDQMIWGRLTSGMLVEEGGDVDLARYVHPRVEPEVA
FT                   FLIGKPLTGHVTPAEAQAALSGVAPALEIIDSRYADFRFSLPDVIADNSSSSGFVVGPW
FT                   SPPDTDVSTLGMVMSFNGQAVAIGSSAAILGHPIRSLVAAAAMAGEAGITLEPGFIVLA
FT                   GGATAAEPLRPGVRVSLAVERLGSVSFRVRGAK"
FT   gene            245500..246354
FT                   /locus_tag="Arad_7267"
FT   CDS_pept        245500..246354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7267"
FT                   /product="oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7267"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28807"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMM6"
FT                   /protein_id="ACM28807.1"
FT                   /translation="MIAIEQLRYVRLGTRDLAGAADFAQRILGLQLVERTSEAAYFRSD
FT                   YRDHTLVYHHGDPAEQAIGFEVRDTETLEQALAVLKDRGLEAEEGTAEGCLLRKVKAYG
FT                   SFRDASGNLIELVVRPLHSGWRYHAPRDAGVTGLAEVALRGVADGTGERLWTELFSGRV
FT                   SDRVGDTAYIRFDDAHHRLAVYPTDTPGILAIEFGVENVDLIMQNSYYLQANQVRIMHG
FT                   PGRRPTSNQVFVTFQGPDGVYFSYVAEGDRIEDEDRHRPRQFPRQPLSFCAWGSHSEVP
FT                   EFN"
FT   gene            246445..247299
FT                   /locus_tag="Arad_7268"
FT   CDS_pept        246445..247299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7268"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7268"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28808"
FT                   /db_xref="GOA:B9JMM7"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMM7"
FT                   /protein_id="ACM28808.1"
FT                   /translation="MINLQDVAYVRLGTRDLEGATTFATKFLGLEVAERTAKSVYFKSD
FT                   EREHTLCYTEGDPAEQAAAFEVRDRSDLDEAGTILERLGHEVRRGTSEEAELRKASDFI
FT                   AFRDPTGNPIELVWRPAYSGKRYHGTRDAGITSFSHIGLCTTDPARDELFWTQVCNARV
FT                   SDRIGDAPLLRIDEVHHSIALFPTNRSGIQHINHQVETGDDIMRSFHFLRDRQVNMVFG
FT                   PGKHPTSSAKFLYFEGPDGMVFEYSSGVRSIADELLYRERQFPFEAKGFCQWGAKPEIR
FT                   EFK"
FT   gene            247296..248024
FT                   /locus_tag="Arad_7270"
FT   CDS_pept        247296..248024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7270"
FT                   /product="decarboxylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7270"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28809"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMM8"
FT                   /protein_id="ACM28809.1"
FT                   /translation="MTVDPAIAAAWIRVAGRALARSGLVHAYGHCSVRLDTGTIMVSPA
FT                   KPLGLVAAGEECSIVALEGPLPDHILGEVRIHREIYRRRVDVNGVVRSMPPNVMSLGTL
FT                   ARTARARHGFGSYFYPAPPLWNDPQLLRSDEQAAALAEQLGSAPGIAMRGNGFVAVGQS
FT                   LAQAVVLTWYAEDAARVELDCLKALPEEHHRLLTREEALQRASWSGRILERMWDYLSAG
FT                   DPELTTLDAPASKTHPGVTS"
FT   gene            248045..249322
FT                   /locus_tag="Arad_7271"
FT   CDS_pept        248045..249322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7271"
FT                   /product="tartrate transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7271"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28810"
FT                   /db_xref="GOA:B9JMM9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMM9"
FT                   /protein_id="ACM28810.1"
FT                   /translation="MAKVSRRLLPFLFLLFLVNFLDRVNVGFAALQMNQQLGFSPQVFG
FT                   FGAGIFFLGYTVLEVPSNIVLRRVGARLWLSRISLSWGLVAMATALVQGPLSFYVLRFL
FT                   LGVAEAGFVPGLLYYLSLWYPPEQRAQAIARVWLATAAAIVLGSPLSAALMTLDGVLGL
FT                   PGWKWIFLIEGAPAVLLGILGFRVLTNSPETAAWLEPEERTALAASLTAGQGQAASHKV
FT                   SGLVAGLRSPMVWSLSLVFFCMGIGFFGVTIWLPQIVKQLSGLSNIEVSLVTTIPFAFA
FT                   AAGMVLNARHSDRTGERRWHLVIPLLVGAIGLGGSALVPEPLSAFALLCLAAAGLWSAI
FT                   GVFWALPANLLTGAAAAAGLALINAIGGISGFVAPYGIGLLRGITPSFSAALLCMSASL
FT                   MAAAVLAALLGRQQSALLSNSEQKVA"
FT   gene            complement(249457..250341)
FT                   /locus_tag="Arad_7273"
FT   CDS_pept        complement(249457..250341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7273"
FT                   /product="Xylose isomerase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7273"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28811"
FT                   /db_xref="GOA:B9JMN0"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMN0"
FT                   /protein_id="ACM28811.1"
FT                   /translation="MTAFPETIMWEGTVRSLSLREQIRATKTAGFDKLSTTPLKYIQSL
FT                   LEGFSSEDMLQLAADSGIGISHLDPLCRWCRQWKPENIIGGGMPLAFFSFSVDDFLRIA
FT                   STLKVESLTAMTVAPHGSMSVDEMTGDFAALCDRAADYGIRCDLEFIPLDWAIPDLATA
FT                   WTIVRNADRKNSGLTFDFWHFVRSGLPFELLRTIPGDKISCVQLADGLAHVPAHRSKFQ
FT                   DCLEDRVPPGAGEFPISAILQTLKDIGGLRRVGPEVFSCEFDAMSADDIAVRCRETLVQ
FT                   ALDSVGIRRTIPQ"
FT   gene            complement(250436..251296)
FT                   /locus_tag="Arad_7274"
FT   CDS_pept        complement(250436..251296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7274"
FT                   /product="3-oxoadipate enol-lactone
FT                   hydrolase/4-carboxymuconolactone decarboxylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7274"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28812"
FT                   /db_xref="GOA:B9JMN1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMN1"
FT                   /protein_id="ACM28812.1"
FT                   /translation="MSTSFEHHTVRVKDIRMHYVRAGKGEPLVLLHGWPQNWASWKRII
FT                   PVLSDHFTVIAPDMRGFGATSKAEAGYDTNNVADDIRELVGSLGFERIFLAGHDWGAAV
FT                   AYSYAAQFQQQVRKLAIFEMVLPGFGIMEEAMTPQPNGNFLWHMGFQSVPDIPFTLISG
FT                   REDLYLRWFFQTYAYDPSAITSTETEEYVQAMTNVGALRAGLQYYQSYFTSAAQNAQHK
FT                   QHKLTIPVSAWAGEACLGPLTKQCLDMAATDVTGGVIERCGHWIGEERPDFVASQLVEF
FT                   FGSGG"
FT   gene            complement(251457..252227)
FT                   /locus_tag="Arad_7275"
FT   CDS_pept        complement(251457..252227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7275"
FT                   /product="oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7275"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28813"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMN2"
FT                   /protein_id="ACM28813.1"
FT                   /translation="MVDLTKRLAGKTCIVTGSGGSIGRATCLRFASEGANIVGCDIAPV
FT                   GAEETVRLVQEAGGTMISVHPADLTKKEECERLVKTAVERFGGIDVLFNNGAMAYFAWI
FT                   EEMDDDTWYKTINQELDLVFLLTRAAWPELTKRKGAIINTASLSAWAGIELLPGLAHSA
FT                   AKGGVLSMTRHLAMEGRKHGIRANSVSPGTIETNQTRFILENPEWCRVQLGRAMMNRMG
FT                   QPEEIASVVAFLASDDASYVTGADIAVDGGVRAW"
FT   gene            complement(252229..252660)
FT                   /locus_tag="Arad_7277"
FT   CDS_pept        complement(252229..252660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7277"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7277"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28814"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMN3"
FT                   /protein_id="ACM28814.1"
FT                   /translation="MRPGDSSAATEALNPVAAVAARHDDWVADFFRDADSFQIEKLAGW
FT                   FSNDVEIRFGNAPPVIGKSTAEELFRNFWSTIRGMRHRREELVQLDDMAVQVGVITYIH
FT                   HDGSETALPVASHLRRVAPGKIDRLWIYIDMAPMYEKGA"
FT   gene            complement(252657..253112)
FT                   /locus_tag="Arad_7278"
FT   CDS_pept        complement(252657..253112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7278"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7278"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28815"
FT                   /db_xref="InterPro:IPR015075"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMN4"
FT                   /protein_id="ACM28815.1"
FT                   /translation="MYTLSYAVEVNPQGASPILNAEQAWRGLEMKAENALPFVPGMSRC
FT                   EVVERKGNTLLREVTFAGDNFKEFITLHAPVQVQFERVGTGGFIQNTISESDKGLLLTF
FT                   TFSLPYPGTEPGSPEERAKGESMRQAYVNAVNATLQKVRELVKEGKL"
FT   gene            complement(253131..253895)
FT                   /locus_tag="Arad_7279"
FT   CDS_pept        complement(253131..253895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7279"
FT                   /product="oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7279"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28816"
FT                   /db_xref="GOA:B9JMN5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMN5"
FT                   /protein_id="ACM28816.1"
FT                   /translation="MGILDGKSIIVTGAGGGIGRATCSVLAAAGARLIVSDVAQESGEE
FT                   TARIAREAGGEAVFVAADLASEDAIAALVAKAIAIYGRLDGAFNNAGVEQRNKPLADLS
FT                   LAEWQRAIDIDLTAVFLCVKHQVKAMLETGGGSIVNTASSLGQIGMAGASEYCAAKHGV
FT                   IGLTRAAGADYGFHGIRVNAVLPGVTRTPMIARLSEDPNFTAMFERLRTRHSMGRFGEP
FT                   SEIGESVKWLLSDDASFMNGAAVAVDGGYLSI"
FT   gene            254484..255353
FT                   /locus_tag="Arad_7280"
FT   CDS_pept        254484..255353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7280"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7280"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28817"
FT                   /db_xref="GOA:B9JMN6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMN6"
FT                   /protein_id="ACM28817.1"
FT                   /translation="MEFLNDMALFVEVVKAKSFRGAAEVTSVPNSTLSRRISALEKAIG
FT                   LRLLHRTTRRIELTEAGLIYFERCKRIVDEARLAHEQLGEILAQPSGLLRVSLPVDFAN
FT                   TYLAPLIAEFADLYPGINFEFDLTPRRVDLVSEPFDVAIRMGEPEPSHMIARPLARLSP
FT                   HLFASPRYLELNGEPKKPSDLLNHQCLCMLKTKVWTLSNGTDTDEATIGGRFRLNSIGM
FT                   IRRLASLDMGIAMLPDEIVSDELASNRLRRVLPGWCGAPTPVYAITETRLLPAKTQRFI
FT                   EFLKERLK"
FT   gene            complement(255416..256147)
FT                   /gene="phbB"
FT                   /locus_tag="Arad_7281"
FT   CDS_pept        complement(255416..256147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phbB"
FT                   /locus_tag="Arad_7281"
FT                   /product="acetoacetyl-CoA reductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7281"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28818"
FT                   /db_xref="GOA:B9JMN7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMN7"
FT                   /protein_id="ACM28818.1"
FT                   /translation="MSKGTAVVTGAANGIGQAYARRLAADGFDIAVADVGDASETKAMV
FT                   EAAGRKFFSAKVDVTSPISTAEFATEVAKTLPPVTALVNNAGIYPWKSFAETDYDLWRK
FT                   VISVNLDGPFLMCKAFVPGMVERGFGRIVNVASTTYWLNTTQMSSYVASKGGVIGFTRA
FT                   LAGEVGASGITVNVIAPGLTNTKSMRGENEEIFDYLPKVQAIPRVIEPSDIVGVVSFLC
FT                   SQDSAFVTGQTIVADGGNVRN"
FT   gene            complement(256368..257075)
FT                   /locus_tag="Arad_7284"
FT   CDS_pept        complement(256368..257075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7284"
FT                   /product="pirin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7284"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28819"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR041602"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMN8"
FT                   /protein_id="ACM28819.1"
FT                   /translation="MVRAQGPFQLRRIRPGISLRQRDDAGFGGLGIVDHARLQPGLVVR
FT                   MHEHRNDEIISYLRSGNMEHTDSAGQSEVISPGRLMVMNAGSGFSHEEEVVGKDQIEML
FT                   QIFVRPETADMEPGVQFVSLDETARTDQWRLLTGPVGSAAPSFVRQAIYLYDTHLSAGK
FT                   SISLPSMPGFDRWLYVFRGSVLVGHQEAETHTALTISADEAAPDVTATTETDLVLFLID
FT                   RRAAFSREGTISG"
FT   gene            complement(257170..257760)
FT                   /locus_tag="Arad_7285"
FT   CDS_pept        complement(257170..257760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7285"
FT                   /product="isochorismatase hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7285"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28820"
FT                   /db_xref="GOA:B9JMN9"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMN9"
FT                   /protein_id="ACM28820.1"
FT                   /translation="MTTKFTAENSALLLIDHQVGTMKLIKNIDVEQAKRMSLALAKAAS
FT                   ILGIPTVLTSSQEDRLQGPLLPELQEILPEAFEKRVKREGIVNAWTDSNFKAAVEATGR
FT                   KNLIMAGVTTDVCLVFPAIDAVAEGYEVQAVMDASGSPYELSEDMSRRRMQDGGVILTA
FT                   TNTMIAELAQNWGTPNGQKLIQLLFTEVLPPIS"
FT   gene            257873..258778
FT                   /locus_tag="Arad_7286"
FT   CDS_pept        257873..258778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7286"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7286"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28821"
FT                   /db_xref="GOA:B9JMP0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMP0"
FT                   /protein_id="ACM28821.1"
FT                   /translation="MKTFDDFDGLALFIRIAQAGGLASAERATGIPKATLSRRLSVLEE
FT                   SLNVRLVRRTKKGVVLTEQGQQLFDRSQTAFMLAEQAVAEVQDERVALSGTVRLSLPPD
FT                   MATAVLAPTLIDFKTRYPDVTIEMTLADRRVSLIEEGYDLVVRMGPVADSELMFKRIAT
FT                   LPRTLVASPAFLSGHPDLSAPGDVEMLPALAIRRDRIEWDLQNAQGVRETVRPRIGFAA
FT                   NRQTILVEAACAGLGIANLPKFMIKDAITAGALVPVLPDWEPSPVEMTALWQKDRITAR
FT                   LIKAIVSDFEEALRAKLAEI"
FT   gene            complement(258826..259728)
FT                   /locus_tag="Arad_7287"
FT   CDS_pept        complement(258826..259728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7287"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7287"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28822"
FT                   /db_xref="GOA:B9JMP1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMP1"
FT                   /protein_id="ACM28822.1"
FT                   /translation="MDRLTSLSVFGKVVEHGGFSAAARRLNMSVTMVATHVQSLEERLG
FT                   VRLLNRTTRKVSLTETGKFYYDRSSQILAELEEADRAAGALTTTPRGTLKIYSSAAIVR
FT                   FLLPVIDEYLQLYPSVSMDVDIGERTIDMIEDGHDLVIRTVPSPDSSLMVRKLTSWRHV
FT                   LVCSPSYLEEHAEPKTPAELAAHNCLQYSYYPYGDEWHFEADNGEPASVRVQGNARSNS
FT                   AETLRHLAVNGRAVWLAPSFIVSEDLAEGRLIRMMPEFRGVEFTINAIYPNRSHLPTKV
FT                   RLFIDLLVERFAEHRKWMT"
FT   gene            259875..261038
FT                   /locus_tag="Arad_7288"
FT   CDS_pept        259875..261038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7288"
FT                   /product="multidrug resistance efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7288"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28823"
FT                   /db_xref="GOA:B9JMP2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMP2"
FT                   /protein_id="ACM28823.1"
FT                   /translation="MVELPRKEAFESAKAETAKVADVPAPTTAEAVAAKAPKTKGSAVK
FT                   RGVLVVALLAGAAYAANFGYHYWTVGRFMESTDDAYVKADYTTIAPKVTGYIKEVLVND
FT                   NDTAKAGQVLARIDDRDFQAALSQAKADFNAADAAITNIDAQIRLQQSVIDQAKASLDA
FT                   SRASLVYAQSDAARNARLIANGAGTQSRAEQTQSLNDQAVAAVERDQAAFVAAQNKVPV
FT                   LQTERDQAVAQRDHADAAVHQAELNLSYTDIVAAVDGTVGARSIRVGQFVTAGTQLMAV
FT                   VPLHAVYVVANFKETQLTNVRPRQPVEIKIDSFPDVAIKGHVDSISPASGLEFSLLPPD
FT                   NATGNFTKIVQRIPVKILIDDEGLVGLLRSGMSVEPEIDTRDVALQK"
FT   gene            261144..262763
FT                   /locus_tag="Arad_7289"
FT   CDS_pept        261144..262763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7289"
FT                   /product="multidrug resistance efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7289"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28824"
FT                   /db_xref="GOA:B9JMP3"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMP3"
FT                   /protein_id="ACM28824.1"
FT                   /translation="MATLQVVANNSQPLSPTAVSAPAKPAMSPLRMWCAVIGSTLGAFM
FT                   AVLNIQIVNASLADIQGAIGAGTDDGGWISTSYLIAEIVVIPLSGWLARVFSVRTYLLV
FT                   NAILFIIFSIACAFAANLQQMIVIRAIQGFSGGVLIPMAFTIIITLLPKAKQPIGLALF
FT                   ALSATFAPAIGPTIGGYLTENFGWEYIFYVNLVPGSLMVGMLWLSLERAPMNLSLLSKG
FT                   DWPGILTMSVGLAALQTVLEEGNKDDWFGSDFIVRLSVIAVVSLTLFLIIELKTAHPLL
FT                   NLRLLVRRNFGFGIVANILLGIALYGSAFILPIYLSRIQGYNSEQIGMVLAWTGIPQLL
FT                   LIPLVPQMMKRFDVRLLIIVGFALFAASNFMNVHMTGDYATDQLFWPNVVRAIGQALVF
FT                   TPLSAIATAGIEQENAGSASALFNMMRNLGGAVGIASLQTFLSKREQFHSNIMTNSVSM
FT                   FEEATRERIAKLTAYFMSHGVSDQATATHKAVVAVASGLRKQANIMAFSDTFFLLGAAL
FT                   LVALVATLFFKKPGQLSGGGAH"
FT   gene            262799..263998
FT                   /locus_tag="Arad_7290"
FT   CDS_pept        262799..263998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7290"
FT                   /product="adenylate cyclase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7290"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28825"
FT                   /db_xref="GOA:B9JMP4"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMP4"
FT                   /protein_id="ACM28825.1"
FT                   /translation="MNTLLKDPVSVGQRTIRRRSVDPNSMLSVLEWLSGDECHAIDEAG
FT                   LIAGLGRRLQGMGLPIDRLTLHLMTLHPEFPGRTVAWAPGEPVEIHDHEHSTGHSFAGS
FT                   PLRKLLGSREPMIVGMDERNWPWQEMDVHAGRGLAQLLVAPLCNVDGPVSAVIFGTRHP
FT                   GGFTLPDICVIERILPALRNTCELRVMRQAELSLLDTYTGPMTVQRILAGRIRQGEVET
FT                   MEAALLLCSLRDFTELSNRLSGDRALELLNAYFEIVVSAITHRGGKLLRSMGDAVLAFF
FT                   PSSDAEAASSSAFAAADAILEELRHFEFDGADIEASIALHYGGVSYGNVGSGGRQDLAF
FT                   IGSDVNLLTQIQSACVVLGTSVLMSDSFRRRIGAEEIRTAGFHQLKGLEDPIELFTAEP
FT                   "
FT   gene            complement(264039..265037)
FT                   /locus_tag="Arad_7291"
FT   CDS_pept        complement(264039..265037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7291"
FT                   /product="permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7291"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28826"
FT                   /db_xref="GOA:B9JMP5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMP5"
FT                   /protein_id="ACM28826.1"
FT                   /translation="MSVSDAVAPEHSWHRYGHLAVVYLVWGSTYLAVKICVSGPSALSP
FT                   LQLQTWRMWMAGILLIGLSFFSGNLPSKIRIRDLPTCCVTGALMWVSGNGLATLASRHA
FT                   TSGFIVMAMGMIPVWTTLITSIMNRALPSRTMILGLFTGMIGLSFVIVPPALSSEVSSV
FT                   AQGYAVSTALILCAAGLTWSLGSVLQQPLIGRLAPTTAAGIQMLSAALILTTIGKLQAA
FT                   PLLPQFGLATNQIAAFLFLVVFGSAICLVSYIKVIKSFNPTIASTFAYVNPLVGVALGW
FT                   ALLGELPETAASLGMALILFGVFLVVARPSKRSAAYEGQSKLSRFSEENGK"
FT   gene            complement(265045..265725)
FT                   /locus_tag="Arad_7293"
FT   CDS_pept        complement(265045..265725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7293"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7293"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28827"
FT                   /db_xref="GOA:B9JMP6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMP6"
FT                   /protein_id="ACM28827.1"
FT                   /translation="MLEAKAIKTGPRIYEEIRRMAMEYRFKPNERINEVELAARLNVSR
FT                   SPIREALQRLVTEGLITFQPNRGFFCRGFDVDEVVNLSDVRCLLEERAVVLAIKRASDE
FT                   ELRALVDWWRATAARADALSSADLTSKDEEFHMRIAKMSGNPELARMIEGINTRIHFVR
FT                   QIEVEKHRRLSTTYTEHTDIAQAMAARDADRAARIMRDHISISVADAVSSVKEGLARIF
FT                   MRVD"
FT   gene            complement(265836..266189)
FT                   /locus_tag="Arad_7295"
FT   CDS_pept        complement(265836..266189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7295"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7295"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28828"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035709"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMP7"
FT                   /protein_id="ACM28828.1"
FT                   /translation="MTAIQRIGTAQRMSQAVAYGNMVFLAGQVALRAPGASVSEQTRDI
FT                   LAKADELLAEAGTDKTKLLSASIWLSDIATFGEMNEIWDAWVAPGGAPARACVESKLAA
FT                   PQFTVEISVIAAI"
FT   gene            complement(266201..267490)
FT                   /gene="dadA"
FT                   /locus_tag="Arad_7296"
FT   CDS_pept        complement(266201..267490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dadA"
FT                   /locus_tag="Arad_7296"
FT                   /product="D-amino-acid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7296"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28829"
FT                   /db_xref="GOA:B9JMP8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMP8"
FT                   /protein_id="ACM28829.1"
FT                   /translation="MRALILGGGVAGISAAYQLQQDGYDVTVLERAERVAEGASFGNAG
FT                   MIAPGHSFVWSSPKAPMTLLKSLYLKDQALRFKLSADPHLWVWSWKFLMQCTAEKARRN
FT                   TLLKHRLAVHSQAVLQSVVAKEGIEYDRTSNGILYFHRSQSALDQGVRNMELLASDGQD
FT                   IRVIDGDEIERREPALASSRGKIAGGILCPSDETGDSAKFTRALAGLVQTRGGKILTGT
FT                   TITAIEKAGDAITRVLTDRGDYKADIYVLCLGSESPILARSIGLDLPIYPIKGYSLTIP
FT                   ITDPDLAPKLPVLDEHNLVGITPMGDRIRVTATAEFAGYDRSHKPSDFAFMKKVTQELF
FT                   PKGIAYDRAEMWAGLRPMTPDNLPVLGRRIFKNLWLNTGHGHIGWTMSHGSAAIIADLV
FT                   AGRPAPIPLDGIIEAEHRAPLQLSEISYQL"
FT   gene            267767..268858
FT                   /gene="braC1"
FT                   /locus_tag="Arad_7297"
FT   CDS_pept        267767..268858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="braC1"
FT                   /locus_tag="Arad_7297"
FT                   /product="amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7297"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28830"
FT                   /db_xref="GOA:B9JMP9"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMP9"
FT                   /protein_id="ACM28830.1"
FT                   /translation="MKKLLSFVVVLAALAGPAAAQDIVIGAILPLSGASATQGEDQRRG
FT                   MELAVDKINAAGGVMGQPLKIVTEDSAGNAVTALTAAKKLVTVDNVPVVLGEFSSGITI
FT                   PVADYLLQQGRTHINIGSSSIKIRDLGKGSFSVIGLDNVSGAFGADDVIKSGAKKVAII
FT                   APNNAYGQGIVDAFSTKFKALGGTVTSSILYTEGQTTYRPELQQLEKSKPDVYVYSAYG
FT                   KESATINRESFELGLNETPWYALYLTMCTADSDPQYVEGQIGMDLNYIGTGGADYQKSY
FT                   KATFKSDFTSTYNGFAYDGVMMVAAAIDKAKSTEPAKINVALAEIGKNYQGVTGPITFD
FT                   DHNQRSAQPYLKLKIAAGKPVTN"
FT   gene            268942..269835
FT                   /gene="braD"
FT                   /locus_tag="Arad_7298"
FT   CDS_pept        268942..269835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="braD"
FT                   /locus_tag="Arad_7298"
FT                   /product="amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7298"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28831"
FT                   /db_xref="GOA:B9JMQ0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMQ0"
FT                   /protein_id="ACM28831.1"
FT                   /translation="MVQFVVDVLLRASDLVLIAVGMSAIYSLMKFPNIAVAQYAASGAF
FT                   IALVLQRSGIPIVVAAIIAVLCVGVAAVALNELLFNRMLKISSSTAMIGSLAVSMLVSA
FT                   VFLLAIGPNPTRFSLPITRPFRVLGARMTENQLASLSITTGAILCFALLLFRTDLGRCM
FT                   RATATNGLLAEATGIDTRRTRNAVVLISGMLAALGGICLTLKGEINIQTGLDLLLPVFS
FT                   AAILGGLGNPLGAAAGAVVIALAETLITGINFGTAFGRDLLFMPAAYATAGSFVLLVVT
FT                   LIWRPRGLFVSEVKRV"
FT   gene            269828..270721
FT                   /locus_tag="Arad_7299"
FT   CDS_pept        269828..270721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7299"
FT                   /product="branched-chain amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7299"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28832"
FT                   /db_xref="GOA:B9JMQ1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMQ1"
FT                   /protein_id="ACM28832.1"
FT                   /translation="MFDFLIHVTILACLYSLVALSLNLQSGFGGLMNFGQVALFGCGTY
FT                   GAGIAYKYDLGFASGIVIAAAFAVFVGWAFAAIGRNLQEDYWGMATLALAEVIRIIVNN
FT                   EGWFTGGAQGISPVSPLFPSLAGRMQQVAILCSCAALLTVAYILCRWLTDGRYGLGLKM
FT                   SREEPQLALSLGYNVAALRRECMILSGLVAASAGFVFAHYISFVAPEQLVSSETFLIWA
FT                   MVIIGGIGNHRGAIVGACLLQFIFSFIPFFKDLVGLPTEFVAAARLVMIGGGLIAFMLW
FT                   RQSGLVPERIGGPKLA"
FT   gene            270714..271472
FT                   /locus_tag="Arad_7301"
FT   CDS_pept        270714..271472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7301"
FT                   /product="branched-chain amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7301"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28833"
FT                   /db_xref="GOA:B9JMQ2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMQ2"
FT                   /protein_id="ACM28833.1"
FT                   /translation="MPENLLHIADVSKSFGENQVLKGIDIKVTAGEVVGLLGPNGCGKS
FT                   TLLNVISGFSRASAGSVIFAGEEITSTAVDRIARKGLVRTFQLPSMPRRMTVADVLQAG
FT                   KADGSGFRSLFKRSCFDARDVERLLGELALDHVRDLPAGSLSGGQKKLLSIALALRTNP
FT                   RLICLDEPTAGVHPSLRQHMVQLLRRVNAQGVTLLIIEHDMHFIRELCGRCVVLDRGKV
FT                   IADCAPADLTLNSSVVEAYLGGARDKRAYA"
FT   gene            271469..272191
FT                   /gene="braG"
FT                   /locus_tag="Arad_7302"
FT   CDS_pept        271469..272191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="braG"
FT                   /locus_tag="Arad_7302"
FT                   /product="amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7302"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28834"
FT                   /db_xref="GOA:B9JMQ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMQ3"
FT                   /protein_id="ACM28834.1"
FT                   /translation="MIEVDNIRAGYGDGPDILNGISLRADPQRIVTILGPNGCGKSTLL
FT                   KCVAGFVRPRAGQVKMSGEIVTHLPTHDKIRHHRVGFVPQTDNVFATLSVSENILLGAR
FT                   QMQKADRSHRFDELMVQYPSLAAKKNKRASALSGGERQLLSLARALIANPSILLLDEPS
FT                   AGLSPRMMHEVFEAIRTIRTRDGICILMVEQNAFEALHISDTAYVLSLGNVALHGNAAD
FT                   LLADPAMRSLYLGGDAPH"
FT   gene            272236..273030
FT                   /locus_tag="Arad_7303"
FT   CDS_pept        272236..273030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7303"
FT                   /product="arylmalonate decarboxylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7303"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28835"
FT                   /db_xref="InterPro:IPR026286"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMQ4"
FT                   /protein_id="ACM28835.1"
FT                   /translation="MSANAAEISDALVLNKERIGFTTNDGIGTHANLGLLVLRTDQTIE
FT                   DEFRFALPPRDVALYGARLYSDVQITPENLIKMSDEIPGTVGLLPDVEFDVIGFACTSG
FT                   ALVIGEGRIAERVHEVLPGVQVTDPVTAARAAFKALGASRIALLTPYLPAINHSLRTSL
FT                   MARGMEIPVMGSFNEADDNIVARITPESIERAILDIGASDECDAVFVSCTSLRVARIVE
FT                   AVEKTLGKPVTSSNHALAWHMLRLAGMESSLEGKGELFRRRR"
FT   gene            complement(273138..273833)
FT                   /locus_tag="Arad_7304"
FT   CDS_pept        complement(273138..273833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7304"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7304"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28836"
FT                   /db_xref="GOA:B9JMQ5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMQ5"
FT                   /protein_id="ACM28836.1"
FT                   /translation="MLAAMTIMESAEFAAEQIRKAIIAGALKPGDRLVEQQLTDMINVS
FT                   RHPVREALRLLAREGFVELRRNRGAVVSALDAASVVEVYDIRMALGKIALTYLLSEEGR
FT                   LQPDDLKRIEKLANNAVKFADLKDQSDTVSNDLEFQQAIIDATGLQRTIRYFSELTGDV
FT                   RRFNNLLGIVYTDRRGDAEKYVVSLYEAIRDRNLPLAESVWDAKFRKAMERYLSLITNS
FT                   PSDGASKQA"
FT   gene            complement(273954..274379)
FT                   /locus_tag="Arad_7305"
FT   CDS_pept        complement(273954..274379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7305"
FT                   /product="translation initiation inhibitor-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7305"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28837"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMQ6"
FT                   /protein_id="ACM28837.1"
FT                   /translation="MVSEIVKVKSGSILEDKEGYSRIVALDNWIFMSLTAGRDYKTRAM
FT                   PDTAVEQAKQAMKNVEGALASVGASLADVVRRRIFIPRQEDVADVMAFMGETFKGIDPA
FT                   SCVSCGPLGGPEYLFEIEITAYRGAGTLPQKHLVISL"
FT   gene            complement(274510..275271)
FT                   /locus_tag="Arad_7307"
FT   CDS_pept        complement(274510..275271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7307"
FT                   /product="oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7307"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28838"
FT                   /db_xref="GOA:B9JMQ7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMQ7"
FT                   /protein_id="ACM28838.1"
FT                   /translation="MISFDLKGRTALVTGGASGIGFETARMLSRGGARVAINYLPDDPR
FT                   GEEALAALRKEGYDPVAAPGDVGDADKAEAMVEKAISDLGHLDLLVNNAGTPGVKLPVP
FT                   IQDLESITEELWANLLNVNLMSVFRCSKAAASALKESKGAIVNTASIAGFGSVASTIAY
FT                   SGSKAAVINLTKNLARSLAPDVRVNAVAPGSVDSSWAIEWSKERHDGTIAATPLKKLCT
FT                   PDEVAELIVYLGFAGRMITGHTVVIDGGISI"
FT   gene            complement(275317..276078)
FT                   /locus_tag="Arad_7308"
FT   CDS_pept        complement(275317..276078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7308"
FT                   /product="amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7308"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28839"
FT                   /db_xref="GOA:B9JMQ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMQ8"
FT                   /protein_id="ACM28839.1"
FT                   /translation="MIEIKNVRKIFGPLTVLKGINLTVEKGELLCLIGASGSGKSTLLQ
FT                   CINGLEPIQGGEIIVDGISVHDPKTNINTLRRKLGIVFQQYNAFPHLTALENVALAPRV
FT                   VAKRSRSEARKLAQKHLEHVGLGDKANALPSRLSGGQQQRLAIARALAMEPSYMLFDEV
FT                   TSALDPELVGEVLETMRLLKSEGMTMVVVTHDIGFARESADRVAFLHQGEVCELGTAAQ
FT                   VIDNPSQEQTQRFLRRENRISTDCGRKISAA"
FT   gene            complement(276075..276731)
FT                   /locus_tag="Arad_7310"
FT   CDS_pept        complement(276075..276731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7310"
FT                   /product="amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7310"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28840"
FT                   /db_xref="GOA:B9JMQ9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMQ9"
FT                   /protein_id="ACM28840.1"
FT                   /translation="MQFQFANQGLHWSDAYFLLLGAINTIKIAVAAGLLGTVLGIVLGW
FT                   LRSISLVIRLLTTPIIDILRSVPMVIQLILANSILSLMGFSASPFWFGTIALGAWMAAV
FT                   TAEVARDALRSVPFQYRRGARSLGMNYFQELFHISAPLGFRAGLPSWIGLVLSLIKDSS
FT                   LAGVIGYLEFTRSAQMLMTRTHETWLMLLGTGLFYFLICYPVSKYSRQLERRVLV"
FT   gene            complement(276731..277396)
FT                   /locus_tag="Arad_7311"
FT   CDS_pept        complement(276731..277396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7311"
FT                   /product="amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7311"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28841"
FT                   /db_xref="GOA:B9JMR0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMR0"
FT                   /protein_id="ACM28841.1"
FT                   /translation="MLGYQFYWSIVWDALPQLLAGAWVTVQITILSFVIGTLIAMPMAV
FT                   ARQRETGLGYRLATAWVELSRNTPVLFQVFMIYFGLGALGINISSYISVLAAISFNNAG
FT                   YLAEIFRGGIAAIPRQQFSAARSLGMTSFQSFMHVVFPQVFQVIFLAFVTQGIWGMLNT
FT                   SLGMLVGLRELAGAAQYAQSVSFRTFEFFIVTAGFYYVIAKALQLSAHLVFKLMYGRT"
FT   gene            complement(277453..278280)
FT                   /locus_tag="Arad_7312"
FT   CDS_pept        complement(277453..278280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7312"
FT                   /product="amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7312"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28842"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMR1"
FT                   /protein_id="ACM28842.1"
FT                   /translation="MKNTILKTAMIATAFSLTLSAHSYAQSALDTIVQSKKLRCGIMLD
FT                   SPPAGFRNTNNEPEGFDVVYCKDMAAALGAEPEIVETPSPDRIPALVSNRIDVLIASTT
FT                   PTPKRALTVAFTQPYMNNTMGVVTRKDTGIKAYADLSSKKLGGVVGSTPEQLLNKELAN
FT                   GWKDKGATYTGYSTDAEAYLALQQGKVDAILVSFGVFNALAQSGQFPEFVIAGEAPLSD
FT                   MVSIAVRRDDQQMLNWAKMFVWQQGVSGRFAEVYKQYFGNGPVPSLHADGVDF"
FT   gene            complement(278374..279465)
FT                   /locus_tag="Arad_7314"
FT   CDS_pept        complement(278374..279465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7314"
FT                   /product="luciferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7314"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28843"
FT                   /db_xref="GOA:B9JMR2"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMR2"
FT                   /protein_id="ACM28843.1"
FT                   /translation="MQLGLFNLMTLRDHPDGALGVMRDTRKMVETAEELDFDIAWFAEH
FT                   HFANYSSSPSPLMMCSYAAGWTKKIKLGPGVIVLPLYNPLRVAQEIAVADTQSGGRLVI
FT                   GMGTGYQQYEFDRYSVVLDDKVDIFLEYWDIIEQALVNGTVEYNGKFISVPKTSFAIKT
FT                   EQKPLPSIFVTSSHPKLLSRFKKWGATPFIAASTLGSPALYKMGDGLNKAWESIGDDPA
FT                   TKPLAIMQYVNITDSRAEALEAGERARYVGRMAHFLRQPELPLDQAGFIRNEPYPGEFT
FT                   LEQYADNMVVGDPHTVAEKIVDNIKRLNPSNYTCNFSFGCMPLERAQKSIYRFKKEVLP
FT                   LVEQAVGPIANIGAQEIAQRKAG"
FT   gene            complement(279493..280008)
FT                   /locus_tag="Arad_7315"
FT   CDS_pept        complement(279493..280008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7315"
FT                   /product="4-hydroxyphenylacetate-3-monooxygenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7315"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28844"
FT                   /db_xref="GOA:B9JMR3"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMR3"
FT                   /protein_id="ACM28844.1"
FT                   /translation="MALMSDQHEENFRQSMRRLAATVCVISCRHEGVRFGITVTSVTSL
FT                   CFKPLSILACINNGTSIIHPLLAEGRYCINVLQKSQVEISKRFSGGVPPSERFLVGGWA
FT                   EDAQGIPYLPDAQANLFCEVDQTVAYSTHQIVIGRAIASGFAERVDPLIYQNGGYVACA
FT                   PLLLNDAA"
FT   gene            280198..280953
FT                   /locus_tag="Arad_7317"
FT   CDS_pept        280198..280953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7317"
FT                   /product="oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7317"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28845"
FT                   /db_xref="GOA:B9JMR4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMR4"
FT                   /protein_id="ACM28845.1"
FT                   /translation="MSLDLVGRTIIVSGAAGGVGRSVVGKLAAMGARVCATDLTPSVLE
FT                   LAANCAGKVVSIVGDVTKSDHVNAIYEFAESKLGPVDGLVSNAGFIISKSVHETSEDEW
FT                   DSVMNANAKSFFLMAKRALPSMMERRAGTIVATGSISSVVGLPSQAAYCASKGALLQLV
FT                   RQMAVDYASAGIRINAVGPGSINTPFLTKYLQGLEDPAAGEADIKSAHPLGRWAEPEEI
FT                   ADAIVYLSGSASSFVTGQILMVDGGYTAR"
FT   gene            complement(280974..283328)
FT                   /gene="nodW"
FT                   /locus_tag="Arad_7318"
FT   CDS_pept        complement(280974..283328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nodW"
FT                   /locus_tag="Arad_7318"
FT                   /product="two-component nodulation response regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7318"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28846"
FT                   /db_xref="GOA:B9JMR5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMR5"
FT                   /protein_id="ACM28846.1"
FT                   /translation="MSLFLPRPHLCSRIAGETAGVIFLRAPAGAGKTVLLRMVAEMLGK
FT                   HVCTLQQPRLDDVEDGWLFWDVPVSTRSARLSAQVLDAAQSVVIACRPDQRISGLARQI
FT                   LYRRSATFGATDLTLTEDELRALPSEQASLMRDGYAGWPAFLPLASASNERLCIDYLRE
FT                   TFLSHLSPGQTTTLSIWLEAPLPTPTGDWTEMLSPFLTADPERHPDLLRLLTIAVHERL
FT                   ATFETQGAVTEIASAYERAGRSLAAMALLIDHGREAHAAQILERAHGRDLIYRSSLNRF
FT                   QDIVLRFSQEMIATNETVLFAVTRTLLKQGELQRVRHLLSRHLGSDYMDPLKVLARGSR
FT                   FSFAARTFRLNLMITEDLTPSDAMISRLGEFMADYPMGDHGKWAAYYNALLEFEIRRRN
FT                   FREAEAAAARALIYLRQPSGQPLLEFFIHLHQIVLRLMSGDALFARQAAREARSKLEQV
FT                   PHEAEAEFRMLRLAEACVAYEAGRPRDLLDFVQTEFEQFAVAEIWPSLMQFALHYASQV
FT                   LADHFPMAIRPGFLDGLWIHLSEGLQFHAMMEIRTAIAYQNVNRWGDAAATLSAVRMRI
FT                   GRNWVESATEELTRLSRRDEISYAMAWLRDAVRLSTPRAYLSRQIDALIANPQVTNREK
FT                   VALQLWRSYAAHQRRDNAAARAHILSALESATRLGCNGVLSEERIFLAPLLKNRRIRSF
FT                   IETSSDVRTALSIFSASVNSPQARALQGGLSQREAQMLQLIAGGLSNKRIAQTLNISEV
FT                   TVKFHLGNLFRKLGCNRRAEALRAATALGWL"
FT   gene            283466..284494
FT                   /gene="dppBf"
FT                   /locus_tag="Arad_7319"
FT   CDS_pept        283466..284494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppBf"
FT                   /locus_tag="Arad_7319"
FT                   /product="dipeptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7319"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28847"
FT                   /db_xref="GOA:B9JMR6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMR6"
FT                   /protein_id="ACM28847.1"
FT                   /translation="MQQHPLVAILTRIGTFVLVMIALSIMIFLLARVVPGDPARMALGP
FT                   AATQEQVDTLRLQMGLDQPMVLQYLDYVRNALHGDLGMSLVSQRPVTTDLAQTVPATVE
FT                   LVLVSVIFMFVVAIPLGVITAHYRDRAWDHIGRVLSLTGVTIPSFLFAISLQLLAARYL
FT                   PGWPIIGRIDHALNWQGGPTGFLLLDGLLAGRFDVMLNALQHLVLPAFALSMAGIGQIT
FT                   RITRSSMIENQRKDHVLTLQSFGVPERVIIFRYLLKLSSIAPLTIMGLEFASLIGNAFV
FT                   IEMVFAWGGFASYGLTAILQKDLNAITAVVLVAGLFFIVANLIVDVLISIIDPRLRRKE
FT                   AR"
FT   gene            284491..285375
FT                   /gene="dppCch3"
FT                   /locus_tag="Arad_7320"
FT   CDS_pept        284491..285375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppCch3"
FT                   /locus_tag="Arad_7320"
FT                   /product="dipeptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7320"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28848"
FT                   /db_xref="GOA:B9JMR7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMR7"
FT                   /protein_id="ACM28848.1"
FT                   /translation="MMADMNMLDASDRGLSDGYMMWYRFSRNPAAVIGTLMLISVVILA
FT                   VFAPWLTPYPKHVGAVVDFRARHMPPDLTHWFGTDKAGRDIFSRTVFGLRVSLLLVIGV
FT                   LGISVPVGTVLGLIAGYFGSWVEKIITGLTNVMLAMPPLVMALAVSNLLEPTLMNAMIA
FT                   ITLLWWTWHARLIYSVSKSVASEDFIEAARLAGAGPMHILFREILPNCVAVISVKTTLD
FT                   AAFVILFGATLSFLGFGVKPPTPDLGSMVADGRQFMPDYWWEVLCPGAAVFYVTLGFNL
FT                   LGDGLRDMFDVES"
FT   gene            285380..287026
FT                   /locus_tag="Arad_7321"
FT   CDS_pept        285380..287026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7321"
FT                   /product="peptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7321"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28849"
FT                   /db_xref="GOA:B9JMR8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMR8"
FT                   /protein_id="ACM28849.1"
FT                   /translation="MAEPLLKVEALNVSFTTYGRTRRVLRDVGFTVAAGERVALIGETG
FT                   SGKSVTAKAIIGTLPKNATIGSGTIAVAGRNVLTMPRTEREALKGTAFSLIMQDPLSSF
FT                   NPVFKIGTHLDDVMRFADKRDGVVSSRADRRRRIAAVLRRVQLADVERVMNAYPSELSG
FT                   GMRQRVLIGLALLHQPTLLIADEPGTALDVTTQDEILNLINQLVVEENMALLMITHNLG
FT                   VVRKVADRVVVMHHGDIIEAGPCTEILHRPKQPYTKALLEAVPPLYGRRVTDLPQSDRA
FT                   PIVKVEALNKVYGRRPGFHAVRDVNLTLRKGEIFGLAGESGSGKTSVARIIMGLSRPTS
FT                   GSVTIDAPAPGHGKRLTQIVYQNPGTSLNPKRTVKQTLALPLKSIGMDGPTREARMSEL
FT                   MDLVRLPQSYLAKYPHELSGGQKQRVAIARALAAEPKILILDEPTAALDVSVQKTVIEL
FT                   LLQLRRDLGLTYLMISHDLSLMRNFCSRIAIMLRGEIVEEGPTPEVFAEPNHPYTRALI
FT                   AAIPVVTDEEERLKPVVTQEERMRFLVKTID"
FT   gene            287044..288600
FT                   /locus_tag="Arad_7322"
FT   CDS_pept        287044..288600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7322"
FT                   /product="N-methylhydantoinase
FT                   (ATP-hydrolyzing)/5-oxoprolinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7322"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28850"
FT                   /db_xref="GOA:B9JMR9"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMR9"
FT                   /protein_id="ACM28850.1"
FT                   /translation="MYRVGIDVGGTNTDAVVLNGKTVLAGVKASTTEDVTSGVIEALEK
FT                   VIEASGIDRARIAAVMIGTTHFTNAVIERRHMDEVAAIRLSLPSGAGLPPMVDWPDDLR
FT                   EIIGNHGYQVKGGYEFDGRELSPLDEDAIVRIAGDIRAKGLKAAAVTCVFSGINDAMEL
FT                   RAKEILQQHCPGLPVVMSKDIGRHGLIARESATIMNASLLSLADRTVAAFGKALTAAGI
FT                   PCPFYITQNDGTLMAADVVRSFPVLTFASGPTNSMRGAAFLTGIKDAVVVDVGGTTSDV
FT                   GSLSHGFPRQASTTVDIGGVRTNFRMPDVFSIGLGGGSLVARGDAGLTVGPKSVGYRVR
FT                   KEALCFGGTTLTATDIAVASGKADVGDRALVENLDKVLVDAAVAKINAMLEACVERSRI
FT                   SSTPVPVIAVGGGSILMPDRIGELEVIRPENFAVANAVGAAIAQISGETDRVFSLIDGR
FT                   TRESALAEAEAEAREKAIAAGALAETLEVIEREDMPLAYLPGNATRIHVKVVGEMGGDH
FT                   A"
FT   gene            288593..289726
FT                   /locus_tag="Arad_7324"
FT   CDS_pept        288593..289726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7324"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7324"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28851"
FT                   /db_xref="InterPro:IPR010318"
FT                   /db_xref="InterPro:IPR027479"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMS0"
FT                   /protein_id="ACM28851.1"
FT                   /translation="MPETRKLKYDEAVLRTLTPEDLDALEIGAGILGTGGGGNPYQGKL
FT                   LALEAMKAGYGMKVLATDSIEPDALCMSIGGIGAPVVGVERIREGREGLRCLRAMEELI
FT                   RTPIDAIVCEEIGGSNAMNPLVTAALGGLPVLDCDGMGRAFPEMQMTTFSIYGHSSTPS
FT                   VMCDLHGNAVIFSHAVSEVWHERMARACVVAQGGGAMLATAPMQAHYVHQYGIPKSYTK
FT                   AIALGEAVIRARKAQEDPIAAVCALEGGRRIFNGKITDLKRHLRGGFAVGDMELAGFDD
FT                   CVGQTANVAIQNEFLIFRRDGEVEVCVPDLIVLLDVDTGYPITTEMLRYGQRVAVVAIP
FT                   CHELLRSARALDVVGPAAFGYRDITYLPLPTPAGTAA"
FT   gene            289774..291369
FT                   /gene="dppAch2"
FT                   /locus_tag="Arad_7326"
FT   CDS_pept        289774..291369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppAch2"
FT                   /locus_tag="Arad_7326"
FT                   /product="dipeptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7326"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28852"
FT                   /db_xref="GOA:B9JMS1"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMS1"
FT                   /protein_id="ACM28852.1"
FT                   /translation="MKMGSNSLRLAALFLGTAMALPLTSVAASAADKVSIAVNTMQIFS
FT                   SLDPAKVTDYTGYMAIVNMYDGLTTVSPSGDIVPHLAKSWDIAPDGLTYTFHLRDDAKF
FT                   QDGTPLKASDFVWSIRRLLGINKGPSNLVVGLVKPENITAPDDTTVVIKLDRQFSPFMA
FT                   VTPLMMALNEKLIEANTKPEDKWGEAYVGEHSAGSGPYKLVSYNRSADMVIARNPDYFL
FT                   GWTKGTPIDEVRFIQTSDDATVKALAEKGDLGLSSHGMGNDTYETIGKMPNYKLIQTGT
FT                   AGGFVIKLNSKVYPTDDVHVRRAIAYATDYKTIQEAIYPGFDMTGPLSTAFKDAHSDDI
FT                   QPGVFDLEKAKEELAKSKYAGQKITLVNSYVASLAFEADVALLMQANLEQIGITLDIKP
FT                   EPWNRIVELSSKPETTPASTQVNISPNYPSPDAIFYNQYHSKASGTWMSMEWLQNPEVD
FT                   ALIDKARATTDVKEQNAAYKELQAKLVDLQPDVWAVSPNRRYAANKCLQGYEFIPMQSW
FT                   DLNFSNFHWDCKAN"
FT   gene            291438..292514
FT                   /locus_tag="Arad_7327"
FT   CDS_pept        291438..292514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7327"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7327"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28853"
FT                   /db_xref="InterPro:IPR010318"
FT                   /db_xref="InterPro:IPR024071"
FT                   /db_xref="InterPro:IPR027479"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMS2"
FT                   /protein_id="ACM28853.1"
FT                   /translation="MLQEFSEDDIEPLATGAWILGTGGGGNPYISTLNLRRLYAEGRRV
FT                   QVMDPMALDDDDMVAVVSKMGAPLVGQERLGDPVHLARAVEVMEDYLGKPFRAIMSVEI
FT                   GGSNALSSFLAAAMLGRPVVNADAMGRAYPEAQMTSFAIGNLPMFPLSLVDVRENEVIV
FT                   TRAASWKWMERISRKICTEVGSTAATCKAPRTGREVKEWGIHYTITKATELGRAVIEAR
FT                   ARHDDPVKAVLDHEGGKQLFRGKVIDVARETTGGFLRGRTVIEGIDADKGARMELAFQN
FT                   EWAVAFRDGEPVAMTPDLLCLLDTISGGAIGTESVRYGQRVTVVALPAPKLLTTPAGIA
FT                   AVGPRAFGYDIDFRSVFA"
FT   gene            292511..294049
FT                   /locus_tag="Arad_7329"
FT   CDS_pept        292511..294049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7329"
FT                   /product="hydantoinase A"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7329"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28854"
FT                   /db_xref="GOA:B9JMS3"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMS3"
FT                   /protein_id="ACM28854.1"
FT                   /translation="MKRIGIDVGGTNTDAVLIDGENIIASIKVPTTQDVMSGVKAALSH
FT                   VAGYAGGSGRPIDAVMIGTTHFTNAVVERARLERVAAIRIALPTGASLPPMCDWPEDLR
FT                   TVVDPLVFMVHGGHEYDGSLLVPMIPDEIREAAMKIRDAGITSIAISATFSPLTTECEV
FT                   RAAEIVRSVIPDARITLSHTLGRIGLLERENVALLNAALQSLGKTTVQAFSDALREAGL
FT                   AAPFYLTQNDGTVALADVAAANPVHSFASGPTNSMRGAAFLTGLMDAMVVDVGGTTSDI
FT                   GCLVGGFPREANNIVHIGGVRTLFRMPDLLPIALGGGTIIDPETGKIGPRSVGYRILTE
FT                   ARVFGGNTLTTSDIAVAAGLIEMGDRDRVKDLDPTFVRTSLGRIRDMVTDSFDQMKTSA
FT                   EDVPLIAVGGGAFLIPDKIAGASDVLRVENAGVANALGAAMAQVSGEVDQVFSGLSRDE
FT                   ALAKAEEGARDAAVASGASRASLKTLEVEDIPIAYLPGGARRVRVRVIGDIAFN"
FT   gene            294046..294273
FT                   /locus_tag="Arad_7330"
FT   CDS_pept        294046..294273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7330"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28855"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMS4"
FT                   /protein_id="ACM28855.1"
FT                   /translation="MKQIAWPGRSAFFICYVVGHEIASRLAYLKQDLASAADGVVNGDL
FT                   APYHIGAKLVAIDAAGEVVATHETIYEVTL"
FT   gene            294285..295337
FT                   /locus_tag="Arad_7331"
FT   CDS_pept        294285..295337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7331"
FT                   /product="membrane dipeptidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7331"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28856"
FT                   /db_xref="GOA:B9JMS5"
FT                   /db_xref="InterPro:IPR008257"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMS5"
FT                   /protein_id="ACM28856.1"
FT                   /translation="MSEDPIHIPVFDGHNDILSRLMSEGRVGAETRFLNGQEGVHIDLP
FT                   RARQGGLVGGLCAVYVPGTGRVPDANGDLPQVDRQSALDHTIAQAALLRRIEAQSEGAF
FT                   TVCTSVAEIHTAIEYGSFAAVFHIEGIEAVGPDLDLLHVLHAAGLRTLGPVWSRPNIFA
FT                   HGVPFRFGHGPDIGPGLTEAGRDLIRLCNRLKIMIDLSHMNDAGFWDVAEISDAPLVAS
FT                   HSNAFAICPHSRNATDRQLDAIRETGGLIGLNFGVKFLHPEGKADSGTDISVMVRHIDY
FT                   LVERVGIDHVALGSDFDGTLISNKIGDVTGLPRLLSALQAAGYDNEVLTKIAHSNWLSL
FT                   LERTWGDETA"
FT   gene            complement(295462..295830)
FT                   /locus_tag="Arad_7332"
FT   CDS_pept        complement(295462..295830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7332"
FT                   /product="two-component response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7332"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28857"
FT                   /db_xref="GOA:B9JMS6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMS6"
FT                   /protein_id="ACM28857.1"
FT                   /translation="MTNAHITVLVVEDEPLMRMDISDALEDGGFLVLEAANADEAIVIL
FT                   VEHTEIQALFTDIDMPGSMDGLMLAIAVRDRWPPIKIIVTSGHQSIREENLPVDGRFFS
FT                   KPYDPEKIVSTIREMVAA"
FT   gene            296082..297584
FT                   /gene="cheRf"
FT                   /locus_tag="Arad_7333"
FT   CDS_pept        296082..297584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheRf"
FT                   /locus_tag="Arad_7333"
FT                   /product="chemotaxis methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7333"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28858"
FT                   /db_xref="GOA:B9JMS7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMS7"
FT                   /protein_id="ACM28858.1"
FT                   /translation="MTDGPQPPNVNGTILRELIAGLSDGIVLLDPEGGISWANSAALQM
FT                   HRVSAIEELGGDVEGYRKAFALRYRNNHPLEEGQYPIERLLDGETVDEVTVEISPACDP
FT                   DLVWVHTVRSLIIADAGDRPNVLALVIRDETPLFEAEERFERAFNANPAPGLICRLEDL
FT                   RFIRVNPGFVEMTNYTREEVIGKTVDQIGLFANCDTGEDATAKLMEGKMIRQREALLPL
FT                   PGGGDCLVIVAGEPIAVGEEPCMLFTFADLDARRKAQNALRQSEERFSKSFRLSPAAAA
FT                   ISRLDDFVFTEVNDAFVQLSGYSLEEIVGKTASELRLWDNITARRAVEKKLADTIAVRD
FT                   EAMLMKQKDGGTADCLVSAERVEIGDQQCVIWSLQDITERKRSEAELVEAIESVMADTS
FT                   WFSRSVVDRLATLRQVSSGKAPSAQLLDLSDREKEILALICRGQSDAEMSETLHLSKNT
FT                   IRNHVASLYIKIGVNRRAAAVIWARERGFTGASASSKGLKSK"
FT   gene            297787..297966
FT                   /locus_tag="Arad_7334"
FT   CDS_pept        297787..297966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7334"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7334"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28859"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMS8"
FT                   /protein_id="ACM28859.1"
FT                   /translation="MDKNRIKGAAKEAAGSIKETAGKLTGNDRLKAEGAAEKTEGKIQS
FT                   EVGKAKDAVKDILR"
FT   gene            298018..298311
FT                   /locus_tag="Arad_7335"
FT   CDS_pept        298018..298311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7335"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7335"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28860"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMS9"
FT                   /protein_id="ACM28860.1"
FT                   /translation="MLFLAKLSSLTTGSDRCATCAAIRCLIAYADGLEGSRIDVTATEG
FT                   TIVLSGVATSDQARETAIAIAGEYAGNRVVNNIATQADIAGLPACHICRDGR"
FT   gene            298533..299990
FT                   /gene="cheRf"
FT                   /gene_synonym="exsG"
FT                   /locus_tag="Arad_7336"
FT   CDS_pept        298533..299990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheRf"
FT                   /gene_synonym="exsG"
FT                   /locus_tag="Arad_7336"
FT                   /product="chemotaxis methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7336"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28861"
FT                   /db_xref="GOA:B9JMT0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR011102"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMT0"
FT                   /protein_id="ACM28861.1"
FT                   /translation="MSHLSTNENETVAEYVGMSAGSGSQPNLIHHPLALQDILEALPEA
FT                   VYTTDALGRITFYNKAATEMWGVSPKLGESEFCGSWKLYWPDGTLLPHDECPMAIALKE
FT                   RRAVRGLEAIAERPDGTRTAFLAFPTPIFDAAGNLSGAVNMLVDLTDRASVEEAAQRFA
FT                   AIVESSDDAILAKDLNGKIVSWNRGAERLYGYTAQEAIGQPVLMLIPLDRQNEEPELLA
FT                   RIRRGERIDHYETIRRRKDGSLVEISLSVSPIKNREGRVIGVSKIARDITERRRAEEQQ
FT                   HLLIREMDHRVKNLFSLASSVVSLSARAATTPGELASAVSARLNALARAHALTVPRTSG
FT                   AASRNEQATTLHALIQTIVAPYDITTDSRQSRAIVTGPDIAISGSAVTSFALLLHEFAT
FT                   NAAKYGALSTSDGRVDIACAEDGEHFILTWTESGGPQVDRQTDGDGFGSILAKATVRSQ
FT                   LGGEISREWNREGLSIRLMVKADRLVV"
FT   gene            complement(300496..302589)
FT                   /locus_tag="Arad_7339"
FT   CDS_pept        complement(300496..302589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7339"
FT                   /product="Catalase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7339"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28862"
FT                   /db_xref="GOA:B9JMT1"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024712"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR041399"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMT1"
FT                   /protein_id="ACM28862.1"
FT                   /translation="MATETNFETSRGKGGETHQHVPAKGPHGGVDHLTTDQGTPVSDNQ
FT                   NSLKSGVRGPTLLEDFVLREKIFHFDHERIPERIVHARGSGAHGFFELYEPLSDITKAD
FT                   LFQRKGEKTPVFVRFSTVAGGAGSVDTPRDVRGFAVKFYTKQGNWDLVGNNIPVFFIQD
FT                   AIKFPDLVHAVKMEADRAYPQAGSAHDTFWDWASLMPEATHMLMWAMSDRAIPRSLRMM
FT                   QGFGIHTFRLVNEAGKSTFVKFHWRPKLGMQSLVWDEALKLQAADNDYHRRDLFETIAA
FT                   GHFPEWELGLQLFDDKFAESLPYDVLDPTKLIPEEILPLKIVGRMVLDRNPDNFFAETE
FT                   QVAFCPANIVPGVDFTNDPLLQGRLFSYLDTQKSRLGTANFHQLPINAPKCPVMNFQRD
FT                   GQMQMNVPKGRANYEPNSLSENGEPGGPRECPVTGFQTFAHQAGEGEQGDKLRARGELF
FT                   ADHYSQARLFWKSQTPSEQAHIASAFAFELSKVQLEQVPPRVVGNLMNVDADLAKRVAA
FT                   GLGIALPNRNPPARKPIDLDPSPALSIHKNMKETLEGRTVGILIADGSDAKAISDLVKS
FT                   LTKAGATPFIVAPKVGETKLSDSSTLKADGQLLGSPSQLFDAVAIILSNEGAAKLVKEG
FT                   AAVQWAMDAFGHLKAIGHNIPAKPLLDKAGIQPGTGVVELASFVGAAAKRYWDREPLVR
FT                   TLA"
FT   gene            302880..303482
FT                   /locus_tag="Arad_7341"
FT   CDS_pept        302880..303482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7341"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7341"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28863"
FT                   /db_xref="GOA:B9JMT2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMT2"
FT                   /protein_id="ACM28863.1"
FT                   /translation="MLDTATEERDEMDLGKRVRALRANIDMTIKEVSLRSGMSASAISK
FT                   IENNQLSPTYENIIKLARGLGVDISELFSDPSKQMPRGRRSFTRKGQGKIINTKQYIYE
FT                   MLCTDLIGKKMMPLKATLKAHEIRDFGKLIAHVGEEIVVVLSGRVELRTEFYEPLVLEE
FT                   GDCAYFDSTMGHACLAAGDGDAELFWVCSSNEVLGLS"
FT   gene            303618..304490
FT                   /locus_tag="Arad_7342"
FT   CDS_pept        303618..304490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7342"
FT                   /product="amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7342"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28864"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMT3"
FT                   /protein_id="ACM28864.1"
FT                   /translation="MTEDVTGRRAFLTAAALGGGAAVLVGGATAAVAQTASAPGTLQAI
FT                   RDRGELRIAVAPGEPWFYKDQRSGEWYGLGWGVGVALAKELGIKATPVETTWGTAIAGL
FT                   QAGQFDVMFTMDATPQRALAADFPVQPMFYYAQGVLLKDGVTVTTWEEMNKPEFKIGVV
FT                   LGTSPDRDITVRLPKATIERFPSADETGAAFVAGRMDAISLFHPALVMLQSKVKRGSIV
FT                   LPEPIRQSPSSAGVPNQADKSWRDWLGLSMDYLYQTGQTQKIFDEYLTYRGIDASKVPA
FT                   IMRERWTKA"
FT   gene            304583..305254
FT                   /locus_tag="Arad_7343"
FT   CDS_pept        304583..305254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7343"
FT                   /product="amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7343"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28865"
FT                   /db_xref="GOA:B9JMT4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMT4"
FT                   /protein_id="ACM28865.1"
FT                   /translation="MNYTWDFTPIRMNAGLLLEGLGNTLLLSAASIVAGLCFGIVLVLM
FT                   RLSSNKPISIVGTAIIEFYRNTPPLVHFFWYFYGLPILIGVSLDPFVAAWIALSIQSGA
FT                   FFAEVFRGGIISIERGQWEAARALGMRGGRIMRRIILPQALRRMIPPLMERSFELVKTT
FT                   SLAATLAYGDLVYQAMVVTSQTYRPLETYTTVAVLFFSVLFVASLGMRAVEARLARYHK
FT                   R"
FT   gene            305258..305926
FT                   /locus_tag="Arad_7345"
FT   CDS_pept        305258..305926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7345"
FT                   /product="amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7345"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28866"
FT                   /db_xref="GOA:B9JMT5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMT5"
FT                   /protein_id="ACM28866.1"
FT                   /translation="MDYQFQFGEVLANSDLLLRGIRLTLTLWALAFSGALVAGLFLGLA
FT                   RASTVKWINWLATGYIEVFRNTPVLVQLIWFYYAFPVLTGWQMSSFTAAALGLFLNTSA
FT                   YCAEIWRAGLQSVASGQWEAASALGMTTRRTLARIILPQAARRMIPAFTNRGVELAKMT
FT                   SIASVITVQELMYEAKMLSTQSFLPLETFSVVAVIYFLVIYPGTLAAYGLERRLNSRGT
FT                   "
FT   gene            305928..306710
FT                   /locus_tag="Arad_7346"
FT   CDS_pept        305928..306710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7346"
FT                   /product="amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7346"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28867"
FT                   /db_xref="GOA:B9JMT6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMT6"
FT                   /protein_id="ACM28867.1"
FT                   /translation="MALNEETVLSVEGLRKSFGPNEVLKGMDLKVKPGERIAILGSSGS
FT                   GKSTFLRCINFMETPSVGRISLDGVPVGKQGKAGQIVASEKELCALRTRVGMIFQQFNL
FT                   FPHMTALENVMEGLISVHGRSRADARAKARDYLARVGLAEKADQYPARLSGGQQQRVAI
FT                   ARALAMEPEILLFDEPTSSLDPELVGEVLDVILDLSKEGRTMLLVTHELGFAYHFATRV
FT                   LFLHDGLIHEEGTPDEVLKNPQQERTKAFLARFSSFHF"
FT   gene            306721..307641
FT                   /locus_tag="Arad_7347"
FT   CDS_pept        306721..307641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7347"
FT                   /product="Aminotransferase class IV"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7347"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28868"
FT                   /db_xref="GOA:B9JMT7"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMT7"
FT                   /protein_id="ACM28868.1"
FT                   /translation="MTEDKGAQTPVEDPRNQDLWIWLNGRLVKRVDAVVSIFDAGFGLG
FT                   DGVWEGIRLAKGKLVFVEEHLKRLYEGARTIAIDIGLTPSEMRAALEEVCAANGIEDGG
FT                   HLRLMVTRGEKRTVHQDPRNALGKATIAITAEFKKPDPEIKKQGIKLFTSTFRSSGPDS
FT                   FDLRLNSHSRLNFIQPLLQAIAAGAHEALMLDPAGFVASCNSTNFFIVRDGEVLTSSGR
FT                   FCFKGITRAKVIRLCAEQGIACRETDFTLAEVYNAEEAFVTGTFGGVTPVRSVDGRSLG
FT                   ESLPGTLTSRLSAIYDQTFLGEAPK"
FT   gene            307638..309035
FT                   /locus_tag="Arad_7348"
FT   CDS_pept        307638..309035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7348"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7348"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28869"
FT                   /db_xref="GOA:B9JMT8"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMT8"
FT                   /protein_id="ACM28869.1"
FT                   /translation="MTLTSRIAAFAETLRYDDIPQAVRHKASLHIIDSIGCGIAGAASD
FT                   LSRRVLSFLASEAKEGVCPILGTPLAFGPATSAFGNSAAMNALDFDDGLEVDGKGMGHP
FT                   GATIVAAAISAPFLTAVSGRDFLTAVVAGYEINNRLIQAIQPSIERFREVYGVCQHQTV
FT                   GAAIAYGKQKGIGRNALENAIGFAGTLANVPSLKKYNWESRPLVSFKDFNAPAAETGVR
FT                   AVELDACGLVGAKAVLDGTSGLWRMLGSDRFDAEMLVGRLGNDWSLSRNTIKAFPTCRW
FT                   MQTTLSAFQELKREHGLRAEDIQTVTVHTAAALIRDFMDRAPTTMVDAQFSFPYALAAM
FT                   ALDIAPAARWYEPETMTHADLKAFSGRVEAEIDDEADRLLDSIRRPTGRVSIRTQDGRH
FT                   LASPLVQFAPGSPLNPVSDEFILEKFEANVAPVIGTEASQKLLEGLLGLDRIGDMAALL
FT                   RLGVTAS"
FT   gene            complement(309085..310026)
FT                   /locus_tag="Arad_7349"
FT   CDS_pept        complement(309085..310026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7349"
FT                   /product="sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7349"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28870"
FT                   /db_xref="GOA:B9JMT9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMT9"
FT                   /protein_id="ACM28870.1"
FT                   /translation="MSALFDIIASAGLWAAVLRIATPLIFGTLGALLCERAGVLNLGIE
FT                   GIMTFGAMIGWLSVYHGADLWTGLLIAAIAGGVFGLLHSALTVTLGLSQHVSGLGVTLF
FT                   ASSFSYYVFRLVVPVAGTPPTIVPFQPISIPGLSTLPFIGPAFFTQTVPTYLAILVALF
FT                   MAYVVFRTPIGLAIRMTGENPHAAEAQGVNPMKVRYGAVIAGSALMGMGGAFLTLSAFN
FT                   SFFPTMVQGRGWICIALVVFSSWRPGRALFGALLFAFFDAFQLRLQTAVQGVPYQIFLM
FT                   TPYILSIVALAVMSRRAHVPQALMQPYRRGER"
FT   gene            complement(310023..311072)
FT                   /locus_tag="Arad_7350"
FT   CDS_pept        complement(310023..311072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7350"
FT                   /product="sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7350"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28871"
FT                   /db_xref="GOA:B9JMU0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMU0"
FT                   /protein_id="ACM28871.1"
FT                   /translation="MRFERREHRPLYLMILTPLLAVVAALALAGILIAIAGAPVLEAYR
FT                   RILIGAFGSRLSATETLTRATPLMLTGLAAAVAFRARLWNIGAEGQFYLGAIAVAAFGS
FT                   NMLAGLPAPILIPLLLVIGAVAGMVLILIPLWLRLRFSVDEVVTSLILNFIAVLFVSML
FT                   IDGALKDPTAFGWPQSQAVVDHAMLPKLIARSRLHIGFLIAIALAFVVYFVQSHTVFGM
FT                   RSRAAGLNPSGAAFAGVRLGGTLVKVACLSGGLAGLAGAVEVMGVKGYVTTDLSPGFGY
FT                   AGIVVAMLANLNPLGVVLAAIFTATMFVGADGMSRSLGIPTYIADVTVALSLLTMLIAV
FT                   FFTQYRIRR"
FT   gene            complement(311062..312588)
FT                   /locus_tag="Arad_7351"
FT   CDS_pept        complement(311062..312588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7351"
FT                   /product="sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7351"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28872"
FT                   /db_xref="GOA:B9JMU1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMU1"
FT                   /protein_id="ACM28872.1"
FT                   /translation="MTGPVLEIDSVSKRFGDIVANDDISLTLAKGEIVALLGENGAGKT
FT                   TLMSILFGHYVPDTGRILIDGTELPHGKPRAAISAGVGMVHQHFSLAPNLTVLENVMTG
FT                   TEKLWSWRSHTGTARGKLLALSERFGLKVDPDARLGDLSVGEQQRVEILKALYNDARIL
FT                   ILDEPTAVLTNIEAERLFAILKEMARQGLSLIFISHKLDEVMTAADRIVVLRGGRKVAE
FT                   REALRTDKAELAELMVGHRVTRPVREPGTPGEIALEARDVTVSIGGVERLKKVSFSLRA
FT                   GEILGIIGVSGNGQTALAQILSGTLARTSGELLFFGKPMGNPDVAEIVGAGIGRIPEDR
FT                   NKEGAIGEMAIWENAVLERLSSFSKNGLVDRKAGIAFAQEIIAEFDVRDGAPTSRTRLL
FT                   SGGNMQKLILGRNLHQRPKILIAAQPARGLDEGAVAAVHARILEARRKGTAVLLISEDL
FT                   DEVIALADRIQAIVGGRLSPPVEAEEADARMLGLMMAGEWSKTPETIHAV"
FT   gene            complement(312585..314009)
FT                   /locus_tag="Arad_7352"
FT   CDS_pept        complement(312585..314009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7352"
FT                   /product="amidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7352"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28873"
FT                   /db_xref="GOA:B9JMU2"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMU2"
FT                   /protein_id="ACM28873.1"
FT                   /translation="MPSPLSADATDLAGAVKAGKLTCVDAMQAALSASEQQASLGTIAH
FT                   LDTGMGLASAKALDQERSQHPDRFAARPFAGVPTLAKDLGGPFAGLPVTAGSRLFKREG
FT                   GEADSDLAKRFREAGFCLFGLTTSPEFGFSLASEPAIGPICRNPLYPARTAGGSSGGAA
FT                   AAVAAGIVALAHATDAGGSIRVPAACCGLVGLKPTRGAMPAGPSFGNHLGGIASEFAVT
FT                   RSVRDASRLLEALTGKTKGPFADIERIAAQAGSLRIGLLADTGTRHPTMPERQQVVEAA
FT                   ARLLETQGHQIIPLAWGDVEQPVLASGRAFGDIISVNIAALVDSLDLDMRAAETLTQAF
FT                   ILRGRAMTATALWDALNGAVQASRSLWTLFDKVDILLTPMLASPPPLVGSFPTDHSDTD
FT                   LHLDRMTAFAPLASLANISGFPALTLSFGTDADGLPLPVQIMAPMGKDALLLSLAARLE
FT                   ADGRWQHRYPIAGLAA"
FT   gene            complement(314022..315008)
FT                   /locus_tag="Arad_7353"
FT   CDS_pept        complement(314022..315008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7353"
FT                   /product="lipoprotein periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7353"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28874"
FT                   /db_xref="GOA:B9JMU3"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMU3"
FT                   /protein_id="ACM28874.1"
FT                   /translation="MTHDIMLSRRAVIASGIALGVSALAPAARAAAPLKVAGIHASPVE
FT                   NAWNSCLHKALQDAAKEGVIEYVFSEGVSGTDYPRAMREYAEQGNKLIIGEAYAVEKEA
FT                   RQVAADYPDTAFVLGSSGEAAGGNFGVFGTWNHDGAYLAGMLAGKMTKSNVVGSVGAIP
FT                   IPEVNMLINAFAAGVKAVNPECKHLVSFIGTFFDPPKAREAGLAQIDAGADILFGERIG
FT                   TADAAKERKIKSIGSLIDYTPRYPDTVFANAMWYFRPILNAAIAAVAAGKPVGRNYTAY
FT                   GLMKDGGSDIVYVKGVAPADAEAAMEKVRADIKAGTFEVPKVIEQPK"
FT   gene            complement(315148..317229)
FT                   /locus_tag="Arad_7354"
FT   CDS_pept        complement(315148..317229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7354"
FT                   /product="tail-specific protease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7354"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28875"
FT                   /db_xref="GOA:B9JMU4"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR020992"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR040573"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMU4"
FT                   /protein_id="ACM28875.1"
FT                   /translation="MRIRYGFLCIFLAIAPSAYALEAGSPPVLTPLPQQGQAAHLSAQF
FT                   LTRFHYKPVPLDDALSVKVMNRFIKSLDPDRVIFLQTDIDTFMASSTKIDDAINQEDLN
FT                   IPFSIFNVYEQRVVDRMSYARSLLSQKFDFSVQEDYPLIRDKEPWPKSEAESNELWRKR
FT                   VKSDWLRLKLAGKTDAAIRDTLDKRYKNSLDRAYKYKSDDVFQSFMDAYTTSVDPHTDY
FT                   FGATASAEFDISMKLSLVGIGAVLQERDDYTTIRELVPGGPAQLSGKLAVGDRITGVGQ
FT                   DESGPIKEVVGTRLDEIVQMIRGAKGSVVRLDILPADAGPDGKHRLISLVRDKISLEKQ
FT                   AAQKTILSVKDGDATRKIGVITLPAFYEDFEARRKGDKDYRSASRDVAKLLTELKQDKV
FT                   DGVLIDLRNNGGGSLSEAIDLTGLFVGKGPVVQQRDADGKVDVESDDLSTPAWTGPVGV
FT                   LINRGSASASEIFAAAIQDYGRGVIVGEPSFGKGTVQTVVNLDQVARNSKPKFGELKLT
FT                   VAQFFRVNGGTTQLRGVTPDISLPGLSDPKTFGEASYDNALPWTEVKPANYKADGTIKA
FT                   LLPQLQSRHDARVQNDPDFRRFVEDIAVLKAQREKRVISLNETERRNEMAAQANRLKSR
FT                   EKIDDGVDTGGDDGLQANERSLSADIALEKARKNAKDVLLNEAASILADEADLQAGTR"
FT   gene            complement(317569..318288)
FT                   /locus_tag="Arad_7355"
FT   CDS_pept        complement(317569..318288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7355"
FT                   /product="oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7355"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28876"
FT                   /db_xref="GOA:B9JMU5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMU5"
FT                   /protein_id="ACM28876.1"
FT                   /translation="MLLTGASRGIGHATVKLFLEKGWRVLTVSRQPFSEECRWPSARES
FT                   HIQADLADLTQIDQLVADVRDRLNGAALHALVNNAGISPKGPNGARLGVIDSDAQTWTT
FT                   VLNVNLVSIALLARALLPELEAAQGSIVNVTSIAGSRVHPFAGVAYAASKAGLAALTRE
FT                   IAHEFGPHGVRANAIAPGEIATSILSPGTDLLVETNVPMKRLGTPREVAETIHFLCSDT
FT                   SAYINGAEIHINGGQHV"
FT   gene            complement(318460..320148)
FT                   /gene="ggt"
FT                   /locus_tag="Arad_7356"
FT   CDS_pept        complement(318460..320148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ggt"
FT                   /locus_tag="Arad_7356"
FT                   /product="gamma-glutamyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7356"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28877"
FT                   /db_xref="GOA:B9JMU6"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMU6"
FT                   /protein_id="ACM28877.1"
FT                   /translation="MTPARLPFTCEKSPASGAGGMVVTNHPLGSAAGFEMLSAGGNAVD
FT                   AAVAALLALTVVEPMMVGIAGGGLSHLRLADGQHVVIDALSSAAATMHPEIYEPVSDER
FT                   ARYMDAKGRRNIIGASSVAVPGNLAGWCDMQARYGKLPFADVVEPAIRLASRGFAVTHY
FT                   LSGAITEAAGELSQDAEIARILMPDGRAPAPGERLVMSDYAESLRLIQREGAAALHGGA
FT                   LGAALAARMQTGGDDAGWVTEADLRAYRPIERKPIIGSYRGFEIAGPPPPASSGVHVTQ
FT                   MLNMLEAYDVAGMGFGSPASLHLLAEVIRIAFADRREHSGDPAFVDVPVERLTSKAYAA
FT                   ECRAQIGHSASLPATYAPGYESHDTTHITVADRDGNIVSATHTINGLFGARLAVPGAGI
FT                   IPNNYMSNFDPHPGHALSVVPGKRVPTSMAPMILMKDGAPVFALGLPGGLRIFPSAMQA
FT                   IVNLIDHKMSLQEAVEAPRIWTQGQEVEIEQAYAPQQTKLEKLGHDVRVMPHIGGGMNA
FT                   IAFGDTMTGAACWRADGTVAALGGGLARPGVRFWPDKAPAKPVQG"
FT   gene            complement(320227..320895)
FT                   /locus_tag="Arad_7357"
FT   CDS_pept        complement(320227..320895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7357"
FT                   /product="demethylmenaquinone methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7357"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28878"
FT                   /db_xref="GOA:B9JMU7"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMU7"
FT                   /protein_id="ACM28878.1"
FT                   /translation="MSYKINPMPAQIAKEDLALLAQVETATLGHWRHFGFLNRQIQPLI
FT                   PGRRVVGTAVTIAIPGPDSTLLHHLLSLIRPGDFVIVDRLHDDRYACWGGGVTVGAKAA
FT                   GAVGAVVDGPCTDLEEIVQSDFPMWCRGISPITTRIYDLGGAINVPVSVGNTVVMPGDA
FT                   VLADESGVIVLSPDEVASEAQKAIDTQIRGKAREASVRETGVKLGDLSGATAKVLAKLL
FT                   "
FT   gene            complement(320923..321714)
FT                   /gene="potC"
FT                   /locus_tag="Arad_7358"
FT   CDS_pept        complement(320923..321714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potC"
FT                   /locus_tag="Arad_7358"
FT                   /product="spermidine/putrescine ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7358"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28879"
FT                   /db_xref="GOA:B9JMU8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMU8"
FT                   /protein_id="ACM28879.1"
FT                   /translation="MTKFLSWFSRTYVTLVFCIVFMPMAIILVISFSADSYLSFPPSGW
FT                   SLKWYGAVLGNASFMQGFRNSALIAMIVAALSLALGLPAAYALVRLDFPGRNLIRSLVI
FT                   APLVLPAMMLGLGILMVFTPAGLVATYPGLVLAHLVMTLPFSIRILQTALSNLGTDVDE
FT                   AAMTLGARPLQVFMQITLPRLTPGVIASSAIALILSFDEIVLSLFIVGPRLQTLPVALY
FT                   RYVDERTDPMVAVLAVLMITLSLAIVLVVERSIGFAKAFDR"
FT   gene            complement(321716..322585)
FT                   /gene="potH"
FT                   /locus_tag="Arad_7359"
FT   CDS_pept        complement(321716..322585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potH"
FT                   /locus_tag="Arad_7359"
FT                   /product="spermidine/putrescine ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7359"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28880"
FT                   /db_xref="GOA:B9JMU9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMU9"
FT                   /protein_id="ACM28880.1"
FT                   /translation="MNRFTVPGSSTRFTPWLLLSPVLIVLIISFIAPILWLFRMSLNIS
FT                   DYGAITKAVSLQTYIGILQDSYYLDLLGRTLRVSITCSVVALLLAYPMALSLSRMTSRW
FT                   RTPLTVLAASPLLISAVVRSFGWLVTLGDDGPVNHLLRISGLTTEPLHMVNNYSGVIIG
FT                   LSESIMPYMFLTIAAGLGKLDRRLDDAAMSLGAPPQTVFWQVTLPLSLPAILAGLTIGF
FT                   VLCVSSFITPSLLGGGRVFLLATEVYDLALVSLDWPTAAALSFLMLAFFVLAMGLTGLL
FT                   LRLLTRRA"
FT   gene            complement(322582..323673)
FT                   /gene="afuC1"
FT                   /locus_tag="Arad_7360"
FT   CDS_pept        complement(322582..323673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="afuC1"
FT                   /locus_tag="Arad_7360"
FT                   /product="iron(III) ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7360"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28881"
FT                   /db_xref="GOA:B9JMV0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMV0"
FT                   /protein_id="ACM28881.1"
FT                   /translation="MKLAASPAHIQIDKLTFDYGGERPAVDSLSFDIAKGEFIGLLGPS
FT                   GCGKSTTLRMFAGLLAPTSGQIIIGGENIVSRPPWERNLGLVFQSYALFPHMTVAQNVA
FT                   FGLRLRKVGKEETAARVTEALRAVRLEGFGTRRPAELSGGQQQRVAIARAIVIEPEILL
FT                   LDEPLSNLDARLRDEMRFEIRDIQTRTGITTLFVTHDQQEALTMCDRIAVMNGGRLEQI
FT                   GTPVEVYDKAATPFVAGFIGRANSVSATLSHMASRPQLSHKGQLLPAPRAEDLPKDAAD
FT                   GAKFSAMIRPHAIQLGKSNSGLTARVIRSVFVGSIIEVGLELAGGQTLVAELRPGSDEA
FT                   QLAQPGAEVALSWRSTDMRIFAA"
FT   gene            complement(323691..324740)
FT                   /gene="potD"
FT                   /locus_tag="Arad_7362"
FT   CDS_pept        complement(323691..324740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potD"
FT                   /locus_tag="Arad_7362"
FT                   /product="spermidine/putrescine ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7362"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28882"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMV1"
FT                   /protein_id="ACM28882.1"
FT                   /translation="MSIRLVPAIIFTALLSTTAHAQSSDVSGEITLTAYSGIFQDKYNE
FT                   AVIKPFLAKYPNVKVNYFPSPASSAMLGNLRSQAGDPQMDVVIFDVSTSLIGDKEGLLA
FT                   PLSKTDVPSLADLVPQAIVKEGYGPAVTFDNLVVIYNIEAFPTAPTSLQVLWDKTYAGK
FT                   MAVTSMPSILGSGLMVMTSAMLGEDYTKSVKQSAAKLAEMAPGVQTFDPKPDAYTLVIN
FT                   GTDVLGTGWNARGQYYADESKGKLGVMLPKEGTILQINTINLVQGSKNPVAAKAFIDYA
FT                   LSPEAQAAFTEVMFYAPVNAKAKVSEAATARTVAGKLDKTLPLDWGWAATKSDEWNQIW
FT                   KRQIISAGK"
FT   gene            complement(325101..326033)
FT                   /locus_tag="Arad_7363"
FT   CDS_pept        complement(325101..326033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7363"
FT                   /product="D-2-hydroxyacid dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7363"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28883"
FT                   /db_xref="GOA:B9JMV2"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMV2"
FT                   /protein_id="ACM28883.1"
FT                   /translation="MNIAVSLPAEDKTEWWCQMLRDLMPDWNIYPINKVPDPDAVTYSV
FT                   VWRPATGAMKPFKNLKAIVSLGAGIDHVLADEQLPLHVPIIRTVGTDLTQRMKEYVAMH
FT                   VLRHHRELPAIQANQAHQVWEQIVVPPATQRRVGVMGLGNLGAIAADLLKQIGFEVSGW
FT                   SRSQKDLPGIKCFSGAEGFGAFLEGTEILVCLLPLTESTRGILNADTFNRLKRGASIIN
FT                   AARGPHLVDSDLLEGLNSGQISSATLDVFHVEPLPKSHPFWTNPKITVTPHVASLIDAP
FT                   TGSKIVAKNIRTFHETGTVADLADAKRGY"
FT   gene            326175..327092
FT                   /locus_tag="Arad_7364"
FT   CDS_pept        326175..327092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7364"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7364"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28884"
FT                   /db_xref="GOA:B9JMV3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMV3"
FT                   /protein_id="ACM28884.1"
FT                   /translation="MNFKQLEAFYWLTRLKSYQRVADHIGLTQPAVSARISGLEDSFGI
FT                   PLIDRSQADFTLTEQGYEVAEYAETFLNLSETLTSRLKSKQKRRYTIGVVSMVTQTWAI
FT                   TLRHKIANLPDPPLVDFYSGANLDLRPMVKSGALDMAFVTGEAGLPQMADSFSVLYHVG
FT                   WVARPDVVGEITRPLTPDELRELPLVLYPHTSPLFGPVADLIEETKRRPNSRHTGNSLA
FT                   TICEMVRAGYGASAMPLVSLEPEIVTGMLVEIPTTVQLAPLDIRCVHQNRARKAQTEEI
FT                   FQLARQAAEEWAAAHPRYVSFRAT"
FT   gene            complement(327191..328003)
FT                   /locus_tag="Arad_7365"
FT   CDS_pept        complement(327191..328003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7365"
FT                   /product="creatininase (creatinine amidohydrolase) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7365"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28885"
FT                   /db_xref="GOA:B9JMV4"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMV4"
FT                   /protein_id="ACM28885.1"
FT                   /translation="MLTNKIKIAELTSEEARQFLNDDAVILLPMGSLEDQGTHAPMGDY
FT                   LAAEAVALDIARAARAEGVPTFIAPVIPFGGADYFGSSHGGVALSQSTLVAVLDDMFAC
FT                   LARHGLTKVLVINGHGGNVGAINDVSLKWRQTNGMFVASMYLWQISYELLKEILGPEAA
FT                   AKSSGHGGDPLTSVGLHYYPELLRMDLAKAPPKGQKAMGVDVAGFAALKYAGARLQAPI
FT                   EAMESAPNGVWGGDPVYCSAETGAALTARLVQIGAGFIRDHVSKRFAA"
FT   gene            complement(328014..328982)
FT                   /gene="appF"
FT                   /locus_tag="Arad_7366"
FT   CDS_pept        complement(328014..328982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="appF"
FT                   /locus_tag="Arad_7366"
FT                   /product="oligopeptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7366"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28886"
FT                   /db_xref="GOA:B9JMV5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMV5"
FT                   /protein_id="ACM28886.1"
FT                   /translation="MNPAPLLDVQNLKKSYPLGRGGLFSKQTLKILHDVSFSVAPGEVL
FT                   GLVGESGSGKSTIGRAILRLIESKSDVMRFNGQDLNTVSPARLRDLRKEMQIIFQDPYA
FT                   SLDPRKTIRAVLSEALDAHGLHKGPARVPRLIELVNLVGLDPSFLDRRPHEFSGGQRQR
FT                   IGIARALAVEPSFIVCDEAVSALDVSIQAQVLNLLADLRAKTGVSLLFISHDLSVVRYI
FT                   SDRIMVLYLGRVMEVGPADQVHFTPKHPYTAALVSAEPSLHRESRRIRLTGEIPSPLSL
FT                   PSGCVFRSRCPYVQPACAETVPTLQSVGDQHQSACLRHDIL"
FT   gene            complement(328979..330904)
FT                   /gene="appD"
FT                   /locus_tag="Arad_7367"
FT   CDS_pept        complement(328979..330904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="appD"
FT                   /locus_tag="Arad_7367"
FT                   /product="oligopeptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7367"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28887"
FT                   /db_xref="GOA:B9JMV6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMV6"
FT                   /protein_id="ACM28887.1"
FT                   /translation="MMSIPRFPKRMIVPSILLAALIIIPFAAPLITAEDPIKIGVRYRL
FT                   AAPDLTHWLGRDEFGRDRLARVLYGGQVSLTVAFVATTIACIVGTLFGLIGAYFRGPSE
FT                   FVTTRLSDIVLCFPPILLALLVVTLFGPGAGTLVAVLSVLYFPTFARIAFSEALRVTSL
FT                   DFVEASRALGTPSYRIVLGTILPNIAGPVSVQYSLTAAAAITIESGLSFLGLGVVPPAP
FT                   SWGQMIRGARQFMNQDPLGIMIPCAALVLTIYAINFFCDRLRDTLDPKGAASSCMDEVS
FT                   VPLALADSPAIRDPDVVAVISNLRLETSRFETPVAVIEDVSLTLRANQCTALVGESGSG
FT                   KSLSSLALMGLLPGAIRQASGTLQLRRKTGDVVNLGFVDARTLEEIRGNDIAMIFQEPM
FT                   TSLNPIHKISDQMVEAILAHRPMSKADARKHAIELLKRVGMTDAERRIDSYPDQMSGGM
FT                   RQRVMIGMALTCEPRLLIADEPTTALDVTIQAEIIELLHSLRQDQGSGLSLLFISHNLG
FT                   IVADIADRVAVMYSGQIVEEGPADQILYDPHHPYTHALIESMPSSHEGLHSTGGDRLPA
FT                   ISGTPPLPSARPSGCAFRDRCPIAISACAEIRPALYPSADSERAVRCLRAPEAPVGLQN
FT                   PQTEAA"
FT   gene            complement(330901..331854)
FT                   /locus_tag="Arad_7368"
FT   CDS_pept        complement(330901..331854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7368"
FT                   /product="peptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7368"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28888"
FT                   /db_xref="GOA:B9JMV7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMV7"
FT                   /protein_id="ACM28888.1"
FT                   /translation="MLAFISRRIAAAAAMLLVIGTIIFSLLIIVPGDPAELLLSTGGGS
FT                   ATPEAIANLRSNMGLDKPVMVQYATFIYNTARLDFGTSIVDNGSISSAIALRLPRTLEI
FT                   IVVGAILALMLAIPAGTAAGLRAGGKFDIATSAVNALLTSVPGFVVGTLFIYFFAQLLG
FT                   WLPAGGYVAFPSDPLQHLQMLVLPSLTVGLHLATIVFRMTRASVLEMRGHDWVRTAVAK
FT                   GLRRKRVVRRHILYNALGPIITVVGLQLGILLGSTVLVEFVYNWPGLSGLLVSAVEQRD
FT                   YPTVRAIILTVAAIFIGINMVIDILSSLLDPRIRLQ"
FT   gene            complement(331865..333364)
FT                   /locus_tag="Arad_7369"
FT   CDS_pept        complement(331865..333364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7369"
FT                   /product="peptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7369"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28889"
FT                   /db_xref="GOA:B9JMV8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMV8"
FT                   /protein_id="ACM28889.1"
FT                   /translation="MVSLGAGIVALTLPQGTHAQTPGTVLKFGLSTFPPTIKPFDNTGG
FT                   AANTVKLMLFRGLMGYDAAGKLVTELAESVTWSNPTTAVFKLRQNAVFHDGSPVTATDV
FT                   IYSLNEITKEGSTAYLKSDLKIIAAVNALDDKTVQVTLKAPSAIFLDLMASYCCPVISK
FT                   KSTESAMIGAGPFTMKASEKGVYIELSRFKGFYMADQPEVDGIRFIAYADENLRYAALE
FT                   AGDVDLIEYLPWTQFDAVEASKTLKMKTTLGPFMFLLFNVTDGPFANAKVRRAVGYAIE
FT                   RQDVVDAAFAGRGVPLYGLPNPQGSPFDLADPAHEWKYDVEKAKALLAEAGYPNGFECR
FT                   LLATATYGMHQDTASVVQAYLAAIGINATLDLPDWGTRVTAGKEGKYNIAVHGTSGNYN
FT                   DPDALWSLLYSGNPSYLQSFGFKSARIDGLLEQGRNEVDQAKRKTIYQQLVVAYYEEVP
FT                   QVPLNWRIQAYAMKQSVEGFEQLPGFLSGSSGYALDETKLA"
FT   gene            complement(333822..334061)
FT                   /locus_tag="Arad_7371"
FT   CDS_pept        complement(333822..334061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7371"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28890"
FT                   /db_xref="GOA:B9JMV9"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMV9"
FT                   /protein_id="ACM28890.1"
FT                   /translation="METICEMAPSNLGLTNVPMRSRLKPTHWSKARAKPLRLTHVDIDQ
FT                   ILSAQYRFIVFSPSAVLLIQFCFFAPLARRVLPA"
FT   gene            complement(334090..334716)
FT                   /locus_tag="Arad_7372"
FT   CDS_pept        complement(334090..334716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7372"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28891"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMW0"
FT                   /protein_id="ACM28891.1"
FT                   /translation="MAVLHHAFRCAITPALKREVSDLLAAWEIGDREKLSAMAVARYAA
FT                   LAGREDIHAAFYLGPEGAAQSWLQPQFISPGLAALVVFAGNFAPLPTLSASNDTNHHRL
FT                   ETHLPALGWSPEEIDSLIHGQPIETMLHDYAGSANRMEPGGFRHTGGWTPPGTAQKLSV
FT                   KLDRLALEPPKASWSLLNESKALDDARAMLAPLRDNDWLVTAITH"
FT   gene            complement(334794..335345)
FT                   /locus_tag="Arad_7373"
FT   CDS_pept        complement(334794..335345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7373"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28892"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMW1"
FT                   /protein_id="ACM28892.1"
FT                   /translation="MQITKLRSRILAATFVALVALGTASAANAYSVYRSVNANPGTGVV
FT                   DWTLASFGVSGTPPTLSFFHNPNDDAARTATPAAQCFVKVYLGELIGPLVGTQVPVGNA
FT                   GIPTPVSPNPLDHPRPFPWNITFDSIQPGHWSIARAQIVDDTTNAAASRVAAAGFRILA
FT                   TRAGSGVTVINGTLGNCTAQ"
FT   gene            complement(335702..336370)
FT                   /locus_tag="Arad_7374"
FT   CDS_pept        complement(335702..336370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7374"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7374"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28893"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMW2"
FT                   /protein_id="ACM28893.1"
FT                   /translation="MSTLLTINVKNYQKQTQNFYFFQEPAIYSGGGPVYSNSLYSLSLG
FT                   NYDDTGAILTFQVNMQYYAGIQQTHSLPQVGAASGFASASRPIDLTPKAKGSSPNNWTE
FT                   ASVAPLGLSRPKHLEGVQAGSFRIETPIADSPPYYNIGSAVSVNGGIVLSNFVHANPSN
FT                   YTDCQPVLKYYVQTGLYTPGNVMNFTQSSKTAAGCDFTGGYTICDVELESNGKWSVELE
FT                   "
FT   gene            complement(336552..336902)
FT                   /locus_tag="Arad_7375"
FT   CDS_pept        complement(336552..336902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7375"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7375"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28894"
FT                   /db_xref="GOA:B9JMW3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMW3"
FT                   /protein_id="ACM28894.1"
FT                   /translation="MAHDPARGRRIRQAISQRKIRKVHALAAELNVSVAAVSRWQNGGH
FT                   TSLESVSALARVLDVSLDWLLLGRGTIDWHRDSTISATELQWVLALRSRPATIRSRLLD
FT                   LLEAIPPEQSLR"
FT   gene            complement(337235..338137)
FT                   /locus_tag="Arad_7376"
FT   CDS_pept        complement(337235..338137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7376"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7376"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28895"
FT                   /db_xref="GOA:B9JMW4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017685"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMW4"
FT                   /protein_id="ACM28895.1"
FT                   /translation="MLDYSALRAVSTVVQTGSFEKAAGLLNVTPSAVSQRVKQLEERLG
FT                   IVLIVRGNPCIATEKGEWLCRHMENVGMLEIELFGHLPSLVDPTEPEPRVTLHIATNAD
FT                   SLGTWFLTAMSNFANRSPYLLNIAIDDEDHTAEWLRRGQVVAAVTSLEKPVSGCRRMSL
FT                   GALRYHATASPDFIARHFPQGVTAQAIGKAPALTFNQKDRLQSRWMRQVFGEDLSPPAH
FT                   WLPSTQGFVAASLSGMGWGMNPAALVREHLASGRLVELIPETPLDVLLYWQMNRLAADR
FT                   LVDLTREVTTVAKHHLLGL"
FT   gene            338236..338844
FT                   /locus_tag="Arad_7377"
FT   CDS_pept        338236..338844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7377"
FT                   /product="amino acid efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7377"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28896"
FT                   /db_xref="GOA:B9JMW5"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMW5"
FT                   /protein_id="ACM28896.1"
FT                   /translation="MNFPVFGTGLMMGLSLIVAIGAQNAFVLRQGLRNEHIFAVCFACA
FT                   LSDAVLITLGVSSFRQIAALLPWLDPVMRYGGAAFLIWYGAKSLYSAFRSSGALGVQDA
FT                   GASNFRATLLTCLALTWLNPHVYLDTVMLLGTISTRFPGYEVSFAAGAVTGSFLFFFSL
FT                   GYGAIWLRPIFSRPASWRILETVITLTMWMIALNLLRQT"
FT   gene            complement(338922..339836)
FT                   /locus_tag="Arad_7378"
FT   CDS_pept        complement(338922..339836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7378"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7378"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28897"
FT                   /db_xref="GOA:B9JMW6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMW6"
FT                   /protein_id="ACM28897.1"
FT                   /translation="MDTLTSLRVFCTVAELKSFTAAADRLGLSPAMASKHVMHLESRLG
FT                   TRLLNRTSRHVSITETGMLYFNQARQMLDGLDEVEAAVSNVTVMPRGILKFSAPVWIAN
FT                   TLIARTIAEYHQRYPDVRFDMDLSGRIVNLVDEGFDLALRATTPERLDPSLIARPLMEV
FT                   GFHLVGAPAYLSRTGRPVALTDLNGHSLLLYSGINASGSLTFKGPQGPETVNFRPVMQS
FT                   ENEIMLHLAALEGMGLVFLPVWMTQTDIAEGRLELVLPDAVKFSATLHAVYPSRKYLSA
FT                   KVRTFIDFLASRKNLCSSAGESN"
FT   gene            339972..340823
FT                   /locus_tag="Arad_7379"
FT   CDS_pept        339972..340823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7379"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7379"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28898"
FT                   /db_xref="GOA:B9JMW7"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR014436"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMW7"
FT                   /protein_id="ACM28898.1"
FT                   /translation="MTTELRLPTYFVSHGGGPWPYITDDFRRNFDRLEQSLIEMRTELD
FT                   NAPKAILVVSGHWEEPGFTISSGARPGMVYDYHGFPEYLYQIKYDAPGSPALAKRVLDL
FT                   LQARGFDAGLDPARGFDHGTFSIMKPLYPDENIPVVQLSLDASYDPALHLEAGRALAPL
FT                   RDEGVLIIGSGLSYHNLREMRGSSGHEPSRQFDAWLQQTLVHSLPHERAERLLEWEKAP
FT                   FARAAHPQEDHLIPLMVAVGAARDEPGAVTYHQTDFAGGLTASSFRFGNAPGAPLSKGG
FT                   TQ"
FT   gene            340820..341194
FT                   /locus_tag="Arad_7380"
FT   CDS_pept        340820..341194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7380"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28899"
FT                   /db_xref="GOA:B9JMW8"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMW8"
FT                   /protein_id="ACM28899.1"
FT                   /translation="MSDTTSRPIVYFKNNCPFCLKVKLFLLEAGMMDDVEIREFEPGSK
FT                   QEKEIRAELDTRLEKVSFPSAQLEPGRYIAESDDIIAFLAARSGREPASMPVLNNYVEG
FT                   ALKPMLKLWKENLELKAAAA"
FT   gene            341225..341647
FT                   /locus_tag="Arad_7381"
FT   CDS_pept        341225..341647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7381"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7381"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28900"
FT                   /db_xref="GOA:B9JMW9"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMW9"
FT                   /protein_id="ACM28900.1"
FT                   /translation="MPNTAKWTPHILAILRIVTALLFLEHATMKFFQFPAAIPGVPYPL
FT                   PAIMLVAGAIEIVTGLLMTVGYYARIAAFVAAGEMAAAYWMAHAPQSFWPALNMGEPAI
FT                   MFCFIFLYLAFAGAGSWALDNVWRPSTKEVSLAKGA"
FT   gene            341745..342359
FT                   /gene="acpD"
FT                   /locus_tag="Arad_7382"
FT   CDS_pept        341745..342359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpD"
FT                   /locus_tag="Arad_7382"
FT                   /product="(acyl-carrier-protein) phosphodiesterase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7382"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28901"
FT                   /db_xref="GOA:B9JMX0"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMX0"
FT                   /protein_id="ACM28901.1"
FT                   /translation="MKLLHIDSSVLGDNSVSRILSAEIVARQKALHPSIDVIYRDLALD
FT                   VASHLSGGHIAARHGAPIEEQGLRGDIAKGDEYLTELLGADIIVIGAPMYNFSVSSQLK
FT                   VWIDRIVVAGRTFTYNDTGEVRALVSPSKKIFIASTRGSAYAPGSPYAAFEHHESYLKG
FT                   VFAFLGLHDVTIVRAEGLAFGPEARDAAISQARGEISSISA"
FT   gene            342564..344207
FT                   /locus_tag="Arad_7383"
FT   CDS_pept        342564..344207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7383"
FT                   /product="Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7383"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28902"
FT                   /db_xref="GOA:B9JMX1"
FT                   /db_xref="InterPro:IPR004705"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMX1"
FT                   /protein_id="ACM28902.1"
FT                   /translation="MQGITIALALLAMVVVSGTVTRILPIAVPLPLIQIGLGMLVAVVT
FT                   GRAVELDPSIFFLLFLPPLLFLDGWRIPKEGLLHDKGIILELALGLVLFTVLGVGIFIH
FT                   WMIPSVPLPVAFALAAILSPTDPIAVSAISARVPIPKRLMHILEGESLLNDASGLVCMR
FT                   FAVAAAVTGAFSVGEAVTTFLWLALGGIAIGVGLTWAVTRTRDLVSRKLGEDTGSHILI
FT                   SLLIPFCAYLAAEHFHCSGILAAVAAGITMSFVERRGRALAITRVRTQTVWDTVQFAMN
FT                   GMVFVLLGQQFPNIASSAAKVVRETGHGHPIWLVIYVAAITAALVIMRLSWVWISLRFT
FT                   LFRAARRGETIRTPSWRLVVATSLAGVRGAITLAGILTLPLALDDGSAFPARELAIFLA
FT                   AGVIITSLVLASVFLPFLLKNLDLPPEPTHRQEEDAARIAAAEAAIKAIQAAQHRMGEG
FT                   RSDADFYSEVGARLMEFYRERIDGRSKTGDEAEQVQRMEDIERALRLSGLRAERDAIFG
FT                   MARARKLPEATAKTLVREIDLLEARLVSST"
FT   gene            complement(344245..344823)
FT                   /locus_tag="Arad_7384"
FT   CDS_pept        complement(344245..344823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7384"
FT                   /product="flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7384"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28903"
FT                   /db_xref="GOA:B9JMX2"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMX2"
FT                   /protein_id="ACM28903.1"
FT                   /translation="MQLSRRTMLTSMAAMAIVPSWSFAAEPPRILLAYYSYTGNTRSVA
FT                   EKLRAHVGAQLFEIRMADPYPSDIRKAAERSRYELETGTLPALLGDPPDVSDYDLILVG
FT                   GPVWWNTVATPIMSFLERTDFRGRSVGLFATYALTPSHYESNFAAQAHNAFFLPGLMIN
FT                   EFDLANGRAGDAIDSWGIRTGSTGRANTL"
FT   gene            345652..346875
FT                   /locus_tag="Arad_7387"
FT   CDS_pept        345652..346875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7387"
FT                   /product="protein secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7387"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28904"
FT                   /db_xref="GOA:B9JMX3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMX3"
FT                   /protein_id="ACM28904.1"
FT                   /translation="MEFHMRMLFVRLAAASITTLSLTACERGEASAPQTPPPPAVGFIT
FT                   VSPEALPMTTELPGRVTATRVAEVRPRVSGIVTEQVFQQGATVSQGDVLYRIDPAPFKA
FT                   QVDSAEATLRRAQATHLDARQTAERQEQLRKSNVTSRQDYDSAVARLAQADADVAVAEA
FT                   GLVSAKLNLQYSDVTAPISGRIGRAMITEGALVSANGSENLATIQQLNPIYADFTQPAA
FT                   DLIRLRKAFANGSLTAGSNEARVGLRLDDGTEYPHPGRLLFSEAAVDATTGQVTLRGEF
FT                   PNPDGELLPGMYVRVEVAQGTRNAGLAVPQQAVQRDAAGNASLLVIANENKLEQRSVAV
FT                   GRAVGQRWIIDQGIQAGDRVVVDGFQRARAGATVAPQPWSDSTVAAAKPTAETAERAAV
FT                   QANLPLQR"
FT   gene            346885..350040
FT                   /locus_tag="Arad_7388"
FT   CDS_pept        346885..350040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7388"
FT                   /product="multidrug efflux transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7388"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28905"
FT                   /db_xref="GOA:B9JMX4"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMX4"
FT                   /protein_id="ACM28905.1"
FT                   /translation="MANFFIDRPIFAWVVAIFITLAGILTLPLMPIARYPQVAPPQITV
FT                   STNYPGATPEDIYQSVTRPIEEELNGVPGLLYFESVSEASGRIALNVTFETGTNVGEAQ
FT                   VEVQNRIARVEPRLPSAVTQQGIRVDRAGTSFLMMVVLRSEDGRTDAVGLGDYLSRNVI
FT                   GELRRVPGVGNAQLFATQRSMRVWMDPDRMLGLNLTAADITNAITAQNAQVTAGRVGAS
FT                   PNLPGQQTSAIVNVQGQLRSPQEFDEIILRANPDGSTVRLRDVARVEVGGENYNFASRL
FT                   NGQPSANVGIQLTPTGNALATAEQVRATMEDLSRYFPPGLSYEVSYDTTPFVEVSIEKV
FT                   VHTLLEAIVLVFIVMFLFLQNIRYTIIPTLVVPVALLGACAVMYAAGFSINVLTMFAMV
FT                   LAIGILVDDAIVVVENVERIMAEEKLSPKEATKKAMSQITGAIIGITLVLTAVFIPMAF
FT                   FPGAVGVIYQQFSLTMVVSILFSGLLALTFTPALCASFLKPVSHGHERKTFFFRGFNRG
FT                   FDSLTRRYSVGVGATVRRAGRFMLIYVALLGGLGWAYLQLPNSFLPNEDQGYLIAELQA
FT                   PAEASTDRTREAIRQMEGILMEESAIRNVVAVSGFSYSGSGQNAGLAFITLKDWSERGP
FT                   SDSAAAIAARVNAKFAAIRDASVRALSPPPIQGLGTSNGFAYRLQDRSGAGQAALAAAS
FT                   AQLLNAARASPVLAGVRVEGLPDAAQINLMIDREKANAFGVGFSDINATLSANFGSSYI
FT                   NDYPNAGRMQRVTVQADAVQRMQTQDLLRLNVRNSHGSMVPLSAFASIDWVRGPSQVVG
FT                   YNGYPSIRIGGQAAAGYSSGDAIAEMRRLSQQLPAGFGFEWTGQSFQEIQSGSQAPFLI
FT                   GLSILFVFLLLAALYESWSIPLSVMLVVPLGVLGSVLAVMLRGLPNDIYFLVGLIAIIG
FT                   LSAKNAILIVEFAKDLVAEGRSVREAAIEAARMRFRPILMTSLAFTLGVVPLAIATGAS
FT                   AASQNAIGTGVLGGMISATLLAIFFVPVFFAFVVGFLRKPEKSPHPREPELTNAVGSGI
FT                   HET"
FT   gene            350185..350910
FT                   /locus_tag="Arad_7389"
FT   CDS_pept        350185..350910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7389"
FT                   /product="two-component response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7389"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28906"
FT                   /db_xref="GOA:B9JMX5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMX5"
FT                   /protein_id="ACM28906.1"
FT                   /translation="MQKAAHIAVVDDHADIRNLVGQYLEQQGYRVSVADSGVALRRILE
FT                   RSAVDLVVLDVMMPGEDGLSVCRHLRATMDVPIIFLTAMTEDTDRIIGLELGADDYLVK
FT                   PFNPRELLARIRAVLRRANSVPQQQRETLKKAKVVRVGHWRVNMGRQELSGDDGVGIPL
FT                   STAEFRLLRVFLERPGLVLSREQLLDLTVGKTADIFDRSIDNQVSRLRKKIEPDPKNPS
FT                   VIKTHWGGGYSLSVDVGFE"
FT   gene            350907..352403
FT                   /locus_tag="Arad_7390"
FT   CDS_pept        350907..352403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7390"
FT                   /product="two-component sensor histidine kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7390"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28907"
FT                   /db_xref="GOA:B9JMX6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMX6"
FT                   /protein_id="ACM28907.1"
FT                   /translation="MIYWWRRSLAAQFIGFTLLALVVSQALTFVISWDERTKALHAAMK
FT                   SEFFSRCASVTRLMESVPEPLRNQALFASETNYSRFWLSKDEPTDAKAWRARAATELTR
FT                   PIENFIDLTGKYGVRSNPKAGSLMSKEVIAADASIRWTTPPPVLWNSPQPAKFVYFGDH
FT                   NGYGLAIKLGDGVWLNTAFYKPDIDQWWSVKSLTSLAMTALILSLIGVFIASRIARPLR
FT                   RLALSAEALGRGENLPPLPENGPDDIRRTAEAFNKMQERLHRFVDDRTRMLAAIGHDLR
FT                   TPLTSLRLRTEFVKDADIQQKMLSTIDELQSMTEAAISFARGESTAEETRAIELEALVG
FT                   SICDDLADLGLPVEYIEGPKTTYRCRPDGLRRAVRNLTENAARYGGHAKVYILHSAATI
FT                   DIVVEDNGPGIPESMREKVFAPFFRLEASRSRDTGGVGLGLSIARAIARQHGGDIQLTP
FT                   NDPGLKAVISLPQEGQVQTPARASRRKRRARSFKLAGQEG"
FT   gene            complement(352456..353070)
FT                   /gene="thiEb"
FT                   /locus_tag="Arad_7391"
FT   CDS_pept        complement(352456..353070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiEb"
FT                   /locus_tag="Arad_7391"
FT                   /product="thiamine-phosphate pyrophosphorylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7391"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28908"
FT                   /db_xref="GOA:B9JMX7"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMX7"
FT                   /protein_id="ACM28908.1"
FT                   /translation="MRLDPFYLIVDSADWIARLVPLGVKLVQLRIKDRTPSEIRAEIQR
FT                   AKAICAAHQCQLIVNDYWQLAIEEGCDFIHLGQEDLAVADLSAIRKAGLKLGLSTHDEA
FT                   ELATALAASPDYIALGPVYPTILKKMPWAPQGLDRLREWKDRIGGLPLVAIGGLNLDRI
FT                   AGVFENGADSAAVVTDITLNADPEARTLEWIAVTHIHAVDQ"
FT   gene            complement(353067..353840)
FT                   /gene="thiG"
FT                   /locus_tag="Arad_7393"
FT   CDS_pept        complement(353067..353840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="Arad_7393"
FT                   /product="thiazole biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7393"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28909"
FT                   /db_xref="GOA:B9JMX8"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9JMX8"
FT                   /protein_id="ACM28909.1"
FT                   /translation="MLALYGTEVASRLLLGTARYPSPAILAEAVRQSATEIVTVSLRRE
FT                   TAGGRNGGAFFEMIRTLGVRILPNTAGCHGVSEAVLTAKMAREVFQTNWIKLEVIGNHD
FT                   TLQPDVFGLVEAARILASEGFEVFPYTTDDLVVAERLLDAGCKVLMPWCAPIGSAAGPL
FT                   NLSALRAMRAHFPDVPLIVDAGIGRPSHATTVMELGFDAVLLNTAVAGARDPAAMAGAF
FT                   AKAIDAGRLAFTAGMLEPRDMAVPSTPVIGKAVFA"
FT   gene            complement(353844..354041)
FT                   /gene="thiS"
FT                   /locus_tag="Arad_7394"
FT   CDS_pept        complement(353844..354041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiS"
FT                   /locus_tag="Arad_7394"
FT                   /product="sulfur transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7394"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28910"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMX9"
FT                   /protein_id="ACM28910.1"
FT                   /translation="MRLIVNGEPQTITVKTLSELLVTLDYEGDWLATAVNGELVHREDR
FT                   ADHALNDNDRIEILTPMQGG"
FT   gene            complement(354038..355012)
FT                   /gene="thiO"
FT                   /locus_tag="Arad_7396"
FT   CDS_pept        complement(354038..355012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiO"
FT                   /locus_tag="Arad_7396"
FT                   /product="glycine oxidase ThiO"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7396"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28911"
FT                   /db_xref="GOA:B9JMY0"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR012727"
FT                   /db_xref="InterPro:IPR023209"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMY0"
FT                   /protein_id="ACM28911.1"
FT                   /translation="MHVLVKGAGVAGLMVAHELHGRGAEVTVFDPRSEFGRAASWLAGG
FT                   MLAPWCERESVEEAVLSRGLDASERWDAILPGEVHRNGTLVVAMARDHGELKRFAGRTT
FT                   GYEWLEEEAIAALEPALAGRFRQGLFFAHEAHLDPRRVLRALQEKLCRQGVTFVSETAR
FT                   GQDFDDIVDCTGGARIGQTHELRGVRGEMLYLQTSEVVLARPIRLLHPRIPVYIVPRGN
FT                   GLFMVGATMIETEFDGPIAARSLMELLNAAYALHPAFADATVVETGAGIRPAFPDNFPR
FT                   VRREGNAVVLNGLYRHGFLLAPAMAAEAANLVFSRTTIGAPFP"
FT   gene            complement(355014..356840)
FT                   /gene="thiC"
FT                   /locus_tag="Arad_7398"
FT   CDS_pept        complement(355014..356840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="Arad_7398"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7398"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28912"
FT                   /db_xref="GOA:B9JMY1"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9JMY1"
FT                   /protein_id="ACM28912.1"
FT                   /translation="MNIAAKNITPTVTTGPLPASRKIYIPGDIHPDIRVPMREIGLHPT
FT                   SGEPPVIVYDSSGPYTIEGADIRIEQGLLDLRRNWVLARGDVEAYQGRHVRPEDNGFAS
FT                   GERLTPEFPTLRQPLRAKDGKAVTQLAYARAGIITPEMEFIAIRENLGRKAQAEAMVRD
FT                   GESFGAHIPDHVTAEFVRQEVAAGRAIIPANINHPEAEPMIIGRNFLVKINANIGNSAV
FT                   TSSMAEEVEKMVWAARWGADTVMDLSTGRNIHNIREWIIRNSPLPIGTVPLYQALEKVE
FT                   GIAENLTWEVYRDTLIEQAEQGVDYFTIHAGVRLHYIPLTVNRVTGIVSRGGSIMAKWC
FT                   LHHHRESFLYEHFEEICDICRTYDVSFSLGDGLRPGSIADANDAAQFAELETLGELTKI
FT                   AWAKDCQVMIEGPGHVPMHKIKENMDKQLAVCGEAPFYTLGPLTTDIAPGYDHITSGIG
FT                   AAMIGWFGTAMLCYVTPKEHLGLPDRNDVKTGVITYKIAAHAADLAKGHPAAQLRDDAL
FT                   SRARFEFRWEDQFNLSLDPETARSFHDETLPKEAHKVAHFCSMCGPKFCSMRISHDIRA
FT                   EAQKEGLEAMAAKYREGGDLYMPVDAVEPSAG"
FT   gene            complement(357163..358185)
FT                   /locus_tag="Arad_7399"
FT   CDS_pept        complement(357163..358185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7399"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7399"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28913"
FT                   /db_xref="GOA:B9JMY2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMY2"
FT                   /protein_id="ACM28913.1"
FT                   /translation="MSDVSRLAGVSKMTVSRVLADPTLVAEPTRNRVMTAIEQLGYVPD
FT                   RTASSLSSRRTNFITAILPTLTNANFADTAQGLAGALRAADYQLLIGYTMYSLTEEERI
FT                   VRAMLARRPDAIVIASAVHTKATNEMLLRAGIPIVEIWDVSEHPVDHAVGFSNYEVGRL
FT                   AARHLISLGHRRIGAIGSAVTADATDFRGESRLLGFASALREADLSDDFIVRQNAAPSS
FT                   YDHGAEALSTLLKKAPDVQAVFAVSDISAVGALMECHRRKIAVPDDLSILGFGDFDIAH
FT                   QCVPALSTIRVDAAMIGRKTGELLLAILEPDGTTGQPMETRLNVGFELVTRETTSTPKT
FT                   "
FT   gene            complement(358241..358561)
FT                   /locus_tag="Arad_7400"
FT   CDS_pept        complement(358241..358561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7400"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7400"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28914"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMY3"
FT                   /protein_id="ACM28914.1"
FT                   /translation="MFTRSAIFEGAIHAGREEEFFRIVEEKLLPVWKRMPNAQAVRVMR
FT                   TGRSDPGAAPIIMVQEIDYPSMEAVEEALASPVRLEGRAITDEMMSMCDGRFYHLVYQR
FT                   IA"
FT   gene            358889..359692
FT                   /locus_tag="Arad_7401"
FT   CDS_pept        358889..359692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7401"
FT                   /product="amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7401"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28915"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMY4"
FT                   /protein_id="ACM28915.1"
FT                   /translation="MNISKSLRGIMAAVGIVATGLLATTQAHATTLNDIVSRGKVRIGV
FT                   LTGAPPMGMVDEKGNPAGYDVDVANLIAGYLSLPVELVPLTPPSRIPALQTGKVDFLVA
FT                   TLAPTGERAKTVMFTQPYSAFNMDIISGPDQKFTQLSDLQGKRVAVNRGSSQETALRKA
FT                   AVPGLEIVVYEDDSTSAQALIAGQTDAAAVPSTVGEAIIKQRPDAGLQVGFTFFQQGNS
FT                   MATKIDDFELRQWLNTAIYLMKVSGDLDKISMKWTGRPMAQLPSF"
FT   gene            359764..360468
FT                   /locus_tag="Arad_7403"
FT   CDS_pept        359764..360468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7403"
FT                   /product="amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7403"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28916"
FT                   /db_xref="GOA:B9JMY5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMY5"
FT                   /protein_id="ACM28916.1"
FT                   /translation="MSYTFQFSALAQYQGEFLSGLWLTIRLSVLSIILGSAFGIVLASL
FT                   RSVRGKWVRFLVDAYVEVIRNTPFLVQLFIVYFGLPGIGLRVGADTAALIGMTINLAAY
FT                   STEIIRAGIEAVHKSQIEAGEALGFTRFQIYRHVIIVPAVAKVYPALCSQFVLMMLASS
FT                   ICSAISTHELAASAAFVESQTYRSFEVYIVVTLMYLALALVLRAGLALVGMWLFGRRVA
FT                   RRTITALPEAQA"
FT   gene            360465..361124
FT                   /locus_tag="Arad_7405"
FT   CDS_pept        360465..361124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7405"
FT                   /product="amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7405"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28917"
FT                   /db_xref="GOA:B9JMY6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMY6"
FT                   /protein_id="ACM28917.1"
FT                   /translation="MTLRTFGINEFTFLLQSLQWTVVLTIIALIGGGLLGFAVALARTS
FT                   SIKAVRIAAGTYIQVIQGIPVLMILFLSYYGLSLAGFELPPLIAAGASMTIYASGYLAE
FT                   IWRGCIQAVPKQQWEASESLAMTRLQQYRYVILPQAVRISLPPTVGFAVQVVKNTSITS
FT                   IIGFVELARAGQLINNATFQPFRVFIAVAALYFVVCYPLSQLSRWLERRLHAGSNR"
FT   gene            361105..361836
FT                   /locus_tag="Arad_7406"
FT   CDS_pept        361105..361836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7406"
FT                   /product="amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7406"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28918"
FT                   /db_xref="GOA:B9JMY7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMY7"
FT                   /protein_id="ACM28918.1"
FT                   /translation="MPEVIVENVHKSFGALEVLKGVSLSVGRGEVFALIGRSGSGKSTL
FT                   LRCMNGLEKINSGRIEIAGHALGGDAKSLRDLRTDVGIVFQSYNLFPHLTVGENIMLAP
FT                   RIVKDVKKAQTREIAREVLQLVGLSEKFDAYPDQLSGGQQQRVAIARSLAMRPKVMLFD
FT                   EVTSALDPELTEEVLLVMERLARDGMTMILVTHEMSFARRVATQTIFMHKGTIWEQGPS
FT                   AELFANPQTPELRQFVKSDVK"
FT   gene            361863..362798
FT                   /locus_tag="Arad_7407"
FT   CDS_pept        361863..362798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7407"
FT                   /product="D-2-hydroxyacid dehydrogensase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7407"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28919"
FT                   /db_xref="GOA:B9JMY8"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMY8"
FT                   /protein_id="ACM28919.1"
FT                   /translation="MTVDILQLCPLTPFLEAELAKRFAVHRLFEMEDKAGFLAANGDSI
FT                   RAAVTGGHLGIPADLVAVLPKLEIVAINGVGFDKVDLAEAKRRGIRVSNTPDVLTADVA
FT                   DLALGLILAFGRQLPRADAYVRAGKWLLADMGLSTRVAGRRYGIFGLGRIGMAIARRLE
FT                   GFDARISYSARSKRDVPYDYHETLAALAANCDVLILAAAATAETRHVVNAEVLDALGPN
FT                   GTLINVARGSLVDERALVDALQDRRIGGAALDVFEDEPRVPEELFGMDNVLLAPHLGSA
FT                   THETRRAMADLVLANLDAHFAGTRLPTAVV"
FT   gene            complement(362870..363769)
FT                   /locus_tag="Arad_7409"
FT   CDS_pept        complement(362870..363769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7409"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7409"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28920"
FT                   /db_xref="GOA:B9JMY9"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR002471"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMY9"
FT                   /protein_id="ACM28920.1"
FT                   /translation="MFGMTKASKFGLVCLAVAAISSFASAAETKVSFSVDGQKVIGTLS
FT                   TIDSNPKAPVVVMFHGFGGSRDELPIKDTKDGVFSRSARLLAESGYASLRIDFRGSGES
FT                   DGKWADTTFSRQIKDGIAAVDWLKASDKVDGSKISILGWSQGGLVGAHVARARPEVKSV
FT                   TLWAPVVTPLYTYGNVLGADNVAKGLTSPPDTEITARLPWGVDTTLKASFFKEMPTTST
FT                   IAAIAHYPGPLQVIVGSKDTTVTPQPASGQVLLDYHDGEERLDVFDMDHVFNAFTGPET
FT                   IDSHLVPATLEWLKKFNP"
FT   gene            complement(363856..364713)
FT                   /locus_tag="Arad_7410"
FT   CDS_pept        complement(363856..364713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7410"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7410"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28921"
FT                   /db_xref="GOA:B9JMZ0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMZ0"
FT                   /protein_id="ACM28921.1"
FT                   /translation="MSFTKAGEELAITQSGVSRQVHSLEHYLGVRLFERSGSRLVLTDP
FT                   GVKYFQEIEQTLNKLEEVSIDVVRGRKADASLMIGAYPTLAARWLAPRLEGFVQGNPDM
FT                   PIEIMLVDPKLDFDHSRIDIAILRGVGSWRNARASLLFPEELAVVASPKLIPATTKLDW
FT                   LDFARFPTLQNASRPSLWLNWLRAANLSYSGAIQGVRFAHSEMLINAAVSGLGLAVVPV
FT                   QYVERELESGELHLPLGKPVRSSESYWAVYSERKSQKHSVIAFRDWLLHESRKSRQVTR
FT                   GTAA"
FT   gene            365100..365948
FT                   /locus_tag="Arad_7411"
FT   CDS_pept        365100..365948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7411"
FT                   /product="amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7411"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28922"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMZ1"
FT                   /protein_id="ACM28922.1"
FT                   /translation="MMKRRDFAGLIGVAATGAAAVALSTPALAQTAPDESTFDRIRNSK
FT                   KLRVAGIVGTEPYYHKDIATGEWSGFCMSMARDLAKSMEAEVEISETTWGNAVLDLQSK
FT                   KIDIMFGLSPTPSRALVVEFTRPIMQNTFTVIAKPGLEPKTWDELNKPEIRVAVDIGST
FT                   HDLFARRVLPQATLVALKTADEATLSVQAGHADLVIQVAMLSLVTIKKIPNLGKIFVPT
FT                   PIIRQPTCAGVRVEDSARFRTFVDNWLEYNRSSGVVTSWITSSLELVGVQKQEIPAEIQ
FT                   F"
FT   gene            366026..366709
FT                   /locus_tag="Arad_7412"
FT   CDS_pept        366026..366709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7412"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7412"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28923"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMZ2"
FT                   /protein_id="ACM28923.1"
FT                   /translation="MSDPANALGIIMLDTAFERPVGDVGNAKSWPFPVLYRKVSGATAR
FT                   TVVAGRDESLLEAFVEAGEELQRQGARALTTSCGFLVLRQSLLASRLSLPVATSSLMQI
FT                   PLVMRCLPAGKRVGVVTYERSSLTPAHFSEAGADPETPTVGLPKEGYFHGLIERGEAYD
FT                   RGNLEMELTGGVQDLLAREADIGAIVFECTNLPPFSGAIARRFGLPVFDILTLGRWLFA
FT                   GTQAG"
FT   gene            366743..367402
FT                   /locus_tag="Arad_7414"
FT   CDS_pept        366743..367402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7414"
FT                   /product="amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7414"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28924"
FT                   /db_xref="GOA:B9JMZ3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMZ3"
FT                   /protein_id="ACM28924.1"
FT                   /translation="MGYQWDFGFLLQYSKLIWIGALYTCGFTIITVVSGLTVGGVIALA
FT                   RLSNFKIVSVLLTGFIEIFRCTPVLVQLVWCYYALPILSGIELTPAVAAFITLTLYGAS
FT                   FYSEIIRGGIVSVDAGQWDAGRAIGMRRHQLMRRVIMPQALRRMLPPLVNQSVLQLKNT
FT                   SLLSVLAVPDLLYQGQLITSASYRPLETYTMIAVIYFIILFPLTRLAHGLEARMAK"
FT   gene            367427..368215
FT                   /locus_tag="Arad_7415"
FT   CDS_pept        367427..368215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7415"
FT                   /product="amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7415"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28925"
FT                   /db_xref="GOA:B9JMZ4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMZ4"
FT                   /protein_id="ACM28925.1"
FT                   /translation="MSDDKMIELVGVKKSFGPVEVLKDITLSVGKGSVVALIGPSGSGK
FT                   STLLRSINLLTVPDKGYIRVGNHTMDFSRSTTLPRDRELASFRARTGMVFQSFNLFPHM
FT                   SVEENVMEGPVTVLGVTKAEARERAHALLEKVGLADKAKSKPEQLSGGQKQRVAIARAL
FT                   AMQPEVMLFDEATSALDPELVGEVLAVVRSLAAEGMTMLLVTHEMAFARDVADQVIFMR
FT                   DGCVVEQGDARQMIENPNHPATRSFLSHFHTGLAGPPHPS"
FT   gene            368363..369637
FT                   /locus_tag="Arad_7416"
FT   CDS_pept        368363..369637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7416"
FT                   /product="D-amino acid dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7416"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28926"
FT                   /db_xref="GOA:B9JMZ5"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMZ5"
FT                   /protein_id="ACM28926.1"
FT                   /translation="MPNAAPKHIAVIGCGIVGACSALALLRDGHRVTIIEPGEPGDRQA
FT                   ASYGNGAFLSPASIIPMSVPGLWKKVPAYLLDPEGPLTIRWGHLLPLAPWLLRFLSAGS
FT                   TLAKVQRTAKILSSLLSDAPMRHRAIAADCGQADMIRQDGLLYVYPDRASFEADAFAWG
FT                   LRRDNSVAWRELSGEELHAFEPSLNRRYTFAAFVEAGGHCVDPGAYVSLLVQRALGKGA
FT                   RLVKAGATGFRIKDGRLTAVDTDAGPIECDGAVIAAGIRSKALAKMVGDRIPLESERGY
FT                   HVEVVDPKTGPRIPIMPSDGKMANTMMPGRLRASGQVELASVDAAPDWRRADILLRQLL
FT                   STYPDLGKNPEDMTVLRWQGNRPSTPDGLPVISRSSATADIMHAFGHGHVGLAAGPKTG
FT                   ELVAASFSRRPPPIDIGPFAASRFR"
FT   gene            complement(369648..370079)
FT                   /locus_tag="Arad_7417"
FT   CDS_pept        complement(369648..370079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7417"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7417"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28927"
FT                   /db_xref="GOA:B9JMZ6"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMZ6"
FT                   /protein_id="ACM28927.1"
FT                   /translation="MTLSEKDRQLLSFLSENARIPTATLARKLGLSRTTVQTKIERLER
FT                   DGVIAGYGVRLSDGFESGLVKAHVLITLTAKMLGRVTQELQAIPHVRSVYSVSGSFDLI
FT                   AIIAAASISELDKVIDRIGEMDGVEKTLSSIILSTRIDR"
FT   gene            370207..371310
FT                   /locus_tag="Arad_7418"
FT   CDS_pept        370207..371310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7418"
FT                   /product="dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7418"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28928"
FT                   /db_xref="GOA:B9JMZ7"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR032095"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMZ7"
FT                   /protein_id="ACM28928.1"
FT                   /translation="MKNIVVIGAGKIGSTIARLLVHSGEYRVTVVDRSEEHLAQIETST
FT                   ALSVAQVDITDASALTAVLSGSFAVLSAAPFHLTIAIAEAAAKAGVHYLDLTEDVASTR
FT                   RVKAIAQTANTAFIPQCGLAPGFISIVANDLASRFDSLDSVRLRVGALPQYPSNALNYN
FT                   LTWSTDGVINEYIEPCEAIVEGKLVQVPAMEEREEFSLDGVTYEAFNTSGGLGTLCETL
FT                   EGKVRTLNYRTIRYPGHAAIMKALLNDLGLRHRREVLKDILEHSLPSTLQDVVIIFVTV
FT                   SGWRNGRLVQETYANKVYSAVVAGRPMSAIQITTASSICAVLDMLSHGHLPNRGFVRQE
FT                   DIGLDLFLKSQFGHYYEQAADTRKMAS"
FT   gene            complement(371440..372216)
FT                   /locus_tag="Arad_7421"
FT   CDS_pept        complement(371440..372216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7421"
FT                   /product="amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7421"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28929"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMZ8"
FT                   /protein_id="ACM28929.1"
FT                   /translation="MKRAYFLATMFAALNLTANMAVAEDGALAEIQKAGVIKIGTTGDY
FT                   KPFSYKGADGSLTGADIAMGKDLATSLNVKPEFVMTTWKTMLDDFKAGKFDVALGGITV
FT                   NPARAEVGDFSLPNVSDGKRPIARCADKDKYATLEAIDQPSVRVIVNPGGTNDKFAHEH
FT                   FSKAPIEEFADNKAIFDEIAADKADVMVTDGIEVDIQSKLHPGVLCPVAVKEPFTHFDN
FT                   AYLLRKDPALKAAVDAFMRKQLDSGDWKKKLDAAIQ"
FT   gene            372386..373381
FT                   /locus_tag="Arad_7422"
FT   CDS_pept        372386..373381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7422"
FT                   /product="oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7422"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28930"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B9JMZ9"
FT                   /protein_id="ACM28930.1"
FT                   /translation="MKKRILGKSGLEVSAIGFGCMGLNFGYGHALGTQEGVTLIRQAVE
FT                   RGVTFFDTAEVYGPFTNEEMVGEALAPVRDQVVIATKFGFAIDPETRKSNGLDSRPENI
FT                   RKVAEASLKRLGVEVIDLLYQHRVDPNVPIEDVAGTVKELIAEGKVKHFGLSEPGAQTV
FT                   RRAHAVQPITALQNEYSLWTRGPETNGILEACEELGIGLVAYSPLGKGFLTGAMGKDTK
FT                   LSENDFRKLLPRFTPEAMEKNQALIDLLKTIAEAKSATTAQIALAWLLAQKPWIVPIPG
FT                   TTKLHRLEENLAAADIELTSDDLTRIQLAAAEIGVEGERYPEHLLKTVGL"
FT   gene            373519..374793
FT                   /locus_tag="Arad_7425"
FT   CDS_pept        373519..374793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7425"
FT                   /product="drug transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7425"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28931"
FT                   /db_xref="GOA:B9JN00"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN00"
FT                   /protein_id="ACM28931.1"
FT                   /translation="MPNQAKTAVKLTTGTAGTPVADAPDTGKIVGAASHGWRVLAVLSA
FT                   LMGFASISTDLYLPAMPAMGRDLGADTGAIELTISGFLIGFSLGQLLWGPVGDRYGRRL
FT                   PVAIGLVLFVIGSAGCAMAGSASTMIGWRIVQAVGACAGVVLSRAMVRDLYEGSRAAQM
FT                   MSTLMTVMAIAPLLGPVVGGQILAFAGWRAIFWTLVGVGLLTLAALFTLPETLPAERRN
FT                   LQPLGRAIIGYGTLLRHRRLLGYAGTGGFLYGGIYAYIAGTPFAYITYHHVPAGLYGLL
FT                   FAIGIVGIMIANIANSRLVSRFGGDRLLLHGSAAAALSGVVLAMAAWTDWGGLWGLVVP
FT                   LFLFISATGFIVANSIAGALTDFPERAGTVSALVGALHYGSGIFGSALVGTFADGTPWP
FT                   MGWVIALAGIGSFVCARSLASSRKI"
FT   gene            complement(374896..375285)
FT                   /locus_tag="Arad_7427"
FT   CDS_pept        complement(374896..375285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7427"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7427"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28932"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN01"
FT                   /protein_id="ACM28932.1"
FT                   /translation="MQIKHSGAQPSRKGPEDYFTGIVRVDAPFNGSGNLSGGTVTFEPG
FT                   ARTAWHTHPLGQTLLVVSGLGRVQREGGPVEDIRPGDIVWFEPGEKHWHGAAPDCAMSH
FT                   VAIVEMLDGKAVDWMEKVTDREYGG"
FT   gene            375423..376322
FT                   /locus_tag="Arad_7428"
FT   CDS_pept        375423..376322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7428"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7428"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28933"
FT                   /db_xref="GOA:B9JN02"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN02"
FT                   /protein_id="ACM28933.1"
FT                   /translation="MRREELVDLNAFLIVAEERSFTRAAAKLGTSQSALSHTIRRLETR
FT                   VGVRLLTRTTRSLAPTEAGERLLATLKPALDSIGTELSSLGELREKPAGTIRITTSEHA
FT                   ANTVLWPALEKFLPNYPDIHVELSIDSGLTDIVTERFDAGVRLGEALAKDMIATRISPD
FT                   IRMIVVGSPAYFEQRKIPLVPQDLAEHQCINLRLRSAGGLYAWELEKDGREVRVRVEGQ
FT                   LAFNNVEMIVRAATAGFGLAFVMEDHVRKHLADGRLLCVLEDWCSPFPGYHLYYPSRRQ
FT                   PSAAFALLVEALRYRDRG"
FT   gene            complement(376351..377136)
FT                   /gene="pcaCd1"
FT                   /locus_tag="Arad_7430"
FT   CDS_pept        complement(376351..377136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaCd1"
FT                   /locus_tag="Arad_7430"
FT                   /product="gamma-carboxymuconolactone decarboxylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7430"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28934"
FT                   /db_xref="GOA:B9JN03"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN03"
FT                   /protein_id="ACM28934.1"
FT                   /translation="MKHLIATAVIMGLPALAMAQSEQSTNRFDMPTTSIEEMKAVSPAL
FT                   EHYARERLAADLWKRTDLSPHDRSLVTVAALIATGQSGELPQYMDMALENGVKPAEISE
FT                   TITHLAFYTGWPNAMSALKVARHVFQSHGIDADQLPPAQDATLPLNEEAETRRVAMVDQ
FT                   ALGPDFKDLAAYTTDVLFKDLWLRPALAPRDRSLVTISALVATGRVAQLTGHTNIGMNN
FT                   GLTKQEISGVITHLAFYSGWPNAMSAAPVVRKVFEERGS"
FT   gene            complement(377347..379542)
FT                   /locus_tag="Arad_7431"
FT   CDS_pept        complement(377347..379542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7431"
FT                   /product="xanthine dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7431"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28935"
FT                   /db_xref="GOA:B9JN04"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN04"
FT                   /protein_id="ACM28935.1"
FT                   /translation="MRFDTPATTNPIDQLKVVGQPIERIDGQLKTTGTARYAYEQHDVV
FT                   PNQAYGYVVGSSIAKGRITSYDLAEARAAPGVIAIVTAANAGKLGKGRFNTAKLLGGPD
FT                   IEHYHQAVALVVAETFEQARAAAQLVRIGYAAENASYALAGAKDRAGTPDRGTPDTAVG
FT                   DFAGAFAAAPVKLDETYTTPDHAHAMMEPHASIAAWNGDDLTLWTSNQMINWSKGDVAT
FT                   TLGIAPDKVRLISPFIGGGFGGKLFVRTDAILAALGARAARRPVKVALTRPFMFNNTTH
FT                   RPATIQRIRIGATPDGKITAIGHEGWSANLEGGGPENAVQQTRLLYAGANRMTATRLSI
FT                   LNLPEGNAMRAPGEAPGLMALEIAMDEMAEKLGLDPVQFRILNDTQVDPENPERPFSQR
FT                   RLVECLQTGADRFGWNDRNARPGSRRDGRWLIGMGVAVGFRNNLLMKSGARVRLDNRGI
FT                   VTVETDMTDIGTGTYTIIAQTAAEMMGLPMHKVEVRLGDSSFPISAGSGGQWGANNSTS
FT                   GVYAACVKLREAVAQKLGFNSADIVFADEQVRSGNRSVPLTEAAGDGLVGEDSIEYGDL
FT                   DKTHQQSTFGAHFVEVGVDMATGETRVRRMLAVCAAGRILNPITARSQVIGAMTMGVGG
FT                   ALTEELAVDTTRGFFVNHDLAGYEVPVHADIPHQDVIFLDETDPMSSPMKAKGVGELGL
FT                   CGVAAAIANGIYNATGVRVRHYPITLDKLIHDLPEMS"
FT   gene            complement(379547..380497)
FT                   /locus_tag="Arad_7432"
FT   CDS_pept        complement(379547..380497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7432"
FT                   /product="oxidoreductase, molybdopterin-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7432"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28936"
FT                   /db_xref="GOA:B9JN05"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN05"
FT                   /protein_id="ACM28936.1"
FT                   /translation="MKAFSYERASSVEAAAKAAAGTKGAKFIAGGTNLLDLMKLQIETP
FT                   THLIDVNGLALDKIEATPEGGLRIGALVRNTDLASDERVRRDYGLLSRALLAGASGQLR
FT                   NKATTAGNLLQRTRCPYFYDTNQPCNKRQPGSGCAAIGGFSRQHAVIGVSDACIATHPS
FT                   DMAIAMRALDATVETVRPDGATRRIPIADFHRLPGDTPHVETVLEPGELITAVTLPKPI
FT                   GGKHIYRKVRDRASYAFALVSIGAIVQPDGTGRVAVGGIAHKPWRVEAAEADLPKGARA
FT                   VTDTLLAGAHPTEQNAFKVTLVERTLGAVLAEARG"
FT   gene            complement(380494..381129)
FT                   /locus_tag="Arad_7433"
FT   CDS_pept        complement(380494..381129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7433"
FT                   /product="xanthine dehydrogenase protein,
FT                   iron-sulfur-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7433"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28937"
FT                   /db_xref="GOA:B9JN06"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN06"
FT                   /protein_id="ACM28937.1"
FT                   /translation="MHNPVDLEISRRDLLVATAASVAITAAPSVAGAQTPTPETPFSSK
FT                   VSFTVNGEVRDLDIDTRTSLLDALREHLHLTGTKKGCDHGQCGACTVIVDGRRINSCLT
FT                   LAVMHEGDTITTIEGLGKPGNLHPMQAAFVKHDGFQCGYCTPGQICSAVAVLEEIRANV
FT                   PSHVSGDLTVEARVSPDEIRERMSGNICRCGAYSNILDAINEVAGRQA"
FT   gene            381482..382681
FT                   /locus_tag="Arad_7434"
FT   CDS_pept        381482..382681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7434"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7434"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28938"
FT                   /db_xref="GOA:B9JN07"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN07"
FT                   /protein_id="ACM28938.1"
FT                   /translation="MSISYRWVIVGAGALMTCVALGAMFSLAIFQVPIVAATNWSHAGI
FT                   ASAMTLNFLVMGLGGFMWGAASDRFGPRIVVLIGAILLGLALVLASRATSLLQFQLTYG
FT                   ILVGLAASAFFAPMIATTTAWFDTNRSLAVSLVSAGMGVAPMTISPFARWLISAYDWQT
FT                   AMMLIGILAWVLLVPAALLVRGPPVSANDPVVDAATDGPRVPLGQIFRSPQFLVLGGTF
FT                   FACCAAHSGPIFHMVSYATICGVAPMAAVSIYSVEGLAGLGGRLLYGTLADRIGVKPVL
FT                   VAGLLVQAVALATYLLVSQLGEFYALAVIFGSAYGGVMPLYAVLAREYFGPRVIGTVFG
FT                   AATMLSSIGMAFGPLAGGWIFDTFGNYSWLFIGSSMVGLGAVAIALAFPPMQRLRLLPA
FT                   "
FT   gene            complement(382738..383490)
FT                   /locus_tag="Arad_7436"
FT   CDS_pept        complement(382738..383490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7436"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7436"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28939"
FT                   /db_xref="GOA:B9JN08"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN08"
FT                   /protein_id="ACM28939.1"
FT                   /translation="MPHDLSLLGTKPRSLPLLTSPIARKLETHIALLPEDKAALASLEI
FT                   RKRVFAKGSDITHEGQSRQSAYILCAGWACSYKLMRNGTRQVINFHVPGDLIGIRRILL
FT                   PNCDDSLCAITRVEVGEINLEELAEAFHGNGHLAMSILWSTLRDEAILVQHLVDVGRRR
FT                   PIDRVAHFFLELSSRLNLVGLGTKTAYQCPLTQSLIADALGLTAVHFNRVLRQLRELNA
FT                   MRFHEGWVELLDPKRLERLADFDSSYLQ"
FT   gene            383740..384255
FT                   /locus_tag="Arad_7437"
FT   CDS_pept        383740..384255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7437"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28940"
FT                   /db_xref="GOA:B9JN09"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN09"
FT                   /protein_id="ACM28940.1"
FT                   /translation="MRSYRGRVKRVMTEACESFYKPAHFWKHGTMPVQADRQQLLMEIE
FT                   MFKTPKPTIVFALLGTTLATLAVSTVPVFAATTCAGDLKLTRTELDGTPASVQKAEAMG
FT                   LYSSAINARSNGQDRQCVGDLNKASAVLASAAPNWVWTDAGSVGVDPASTSSEGHHDGG
FT                   HDHGHRAR"
FT   gene            384873..386717
FT                   /locus_tag="Arad_7438"
FT   CDS_pept        384873..386717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7438"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7438"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28941"
FT                   /db_xref="GOA:B9JN10"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN10"
FT                   /protein_id="ACM28941.1"
FT                   /translation="MTREEKKVIFASSLGTVFEWYDFYLYGSLAVFIGAAFFSEYPEAT
FT                   RNIFALLAFAAGFLVRPFGALVFGRIGDLVGRKYTFLVTILIMGLSTFLVGILPGSASW
FT                   GLAAPVILIALRMLQGLALGGEYGGAATYVAEHAPNDRRGFYTSWIQTTATLGLFLSLI
FT                   VILVVQNWLGKEAFAAWGWRIPFILSFVLLGISVWIRLSLSESPAFKKMKEEGKGSKAP
FT                   LSEAFGQWKNARIALLALLGLTAGQAVVWYAGQFYSLFFLQNVLKVDGQSVNIMIAIAL
FT                   LFGSGFFVFFGWLSDKIGRKPIIMAGLALAILTYFPLFKALTHAANPALAQAEQTIRAT
FT                   VTAAPGDCTFQFNPVGTAKFNNSCDIATSFLSKSSVPYAVVDGPAGQPATVKVGDAIVT
FT                   SYDAVAAGATAAAKSAAFTHDLNLALQKAGFPLARDPAKVPDAKLDGFIAANPELSLNA
FT                   ATVRAGDKTVTPVADLIKAKLLTAEQAAGATDMPVYTVANGGAFKMVADPAAINWPLTI
FT                   AILTILVIYVTMVYGPIAAILVEMFPTRIRYTGMSLPYHIGNGWFGGLLPATVFAMSAA
FT                   KGDIYYGLWYPIAIATMTLVIGLIFIRDTKGVDLNAIK"
FT   gene            387090..387914
FT                   /locus_tag="Arad_7439"
FT   CDS_pept        387090..387914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7439"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28942"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN11"
FT                   /protein_id="ACM28942.1"
FT                   /translation="MPFPYFWRQEQLKHIVVTTFHEKGYRDYGKKCIETFLKYWPKDIS
FT                   LVVYAENVQVEEKDERLQIFDHNESLPRLLEFRKDFGENPLANGVRLSTNSLERDYRWD
FT                   AVRFSNKVFAVTDAIQRYRTEADQLIWLDADTVTHSEIPRSLIDRIAPRGNQLAAYLNR
FT                   KIYPECGWVGYNLRHREILTFVERFESAYSSGYFLALKESHDSFVFWKIVQQMEQDKEA
FT                   SFKFLGSNRTKSHVFINSVLGGYMDHLKGDRKAAGKSRKSDLSWRRREAWWS"
FT   gene            complement(388886..389710)
FT                   /locus_tag="Arad_7444"
FT   CDS_pept        complement(388886..389710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7444"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7444"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28943"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN12"
FT                   /protein_id="ACM28943.1"
FT                   /translation="MRIQSSRIAVAASALLLLASTAYAEPGGGTDHGGGQSTSGRGLGV
FT                   GLGVSVGGIKAGAGLGLNSTGLNTGAGASIGGTNGVNAGVGASASTSRGVNAGAGVSVG
FT                   GANGVNAGLGASANTTSGVNAGVGASVGGSGGVNAGAGVSLGGGGASVGVGVGIGGGSG
FT                   SGGGGTGGGGTGGSGGSGGSGGSSGGSGGSGGSGGIGSVGSGNGGLGGSGSGNGQGIGA
FT                   SRSTLAAFRTMSNAEQRRMLIACRQVTASGNFDAGLVSLCKLLRSTASAGGL"
FT   gene            390062..390217
FT                   /locus_tag="Arad_7445"
FT   CDS_pept        390062..390217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7445"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28944"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN13"
FT                   /protein_id="ACM28944.1"
FT                   /translation="MRQRPVICVKNIDETAQLYENQSCLAPAEDADLRQPRPCPIPTRK
FT                   HCRGTG"
FT   gene            complement(390339..390833)
FT                   /locus_tag="Arad_7447"
FT   CDS_pept        complement(390339..390833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7447"
FT                   /product="acetyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7447"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28945"
FT                   /db_xref="GOA:B9JN14"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN14"
FT                   /protein_id="ACM28945.1"
FT                   /translation="MLIRHETPEDVDAIHDLTWTAFKPMPFSDDTEVDILRALRASGDL
FT                   AISLVAEEDGKILGHVAFSRVKIDGVDNGWFGLGPISVAPERQRQGIGKALIAKGLELL
FT                   DGMGASGCALIGNPDVYRHAGFESDGRLTYQDLDTKYVQRFVLRGPIPSGALQFAPAFG
FT                   H"
FT   gene            complement(390845..392077)
FT                   /gene="pepT"
FT                   /locus_tag="Arad_7448"
FT   CDS_pept        complement(390845..392077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepT"
FT                   /locus_tag="Arad_7448"
FT                   /product="peptidase T"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7448"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28946"
FT                   /db_xref="GOA:B9JN15"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010161"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN15"
FT                   /protein_id="ACM28946.1"
FT                   /translation="MTDTVTDRFLRYVVIDTQSDPTSSTQPSTEKQKNLGRVLVEDLLA
FT                   IGLADAHLDEHGYVYATIPSNVDKPVPVICFCSHMDTAPDFTGTNVKPQIVRNYNGGDI
FT                   QLPGDPQQIIRVSDNPELGNQIGNDIITSDGTTLLGADDKAGLAEIVTAAQFLFDNPDI
FT                   KHGTIKLLFTTDEEIGRGVDKVDLAKLGAAFAYTMDGETAGHVEDETFSADGVEISIQG
FT                   VAIHPGFAKDKMENAIKIAGAIIDRLPKDTAPETTAGRDGFVHPTGVTGSMEKAFLGFI
FT                   IRDFNDEGLTTKEVVLEAIVKDVMAGYPSSTYTFKVKQQYRNMKTILDQHPEIVDYAME
FT                   AVRRANMTPVRGSIRGGTDGSRLSFMGLPCANIFAGGHAFHSPLEWVSSQDMEKAVKTI
FT                   VELSKIWAERA"
FT   gene            392431..394563
FT                   /locus_tag="Arad_7449"
FT   CDS_pept        392431..394563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7449"
FT                   /product="toxin secretion ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7449"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28947"
FT                   /db_xref="GOA:B9JN16"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033838"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN16"
FT                   /protein_id="ACM28947.1"
FT                   /translation="MLLTALHNRSRIEPLLQSEAAECGLACLTMVAGYHGHRVTLSELR
FT                   RRHAVSSKGTTLKSLISVADDLGFTSRPLKLEMEDIGKLKMPCILHWDMSHYVVLSRVT
FT                   PSRIEVHDPASGQRRLSHAEASRHFTGVALELTPAATFRKRKVVGRVHLADLWSRSAGF
FT                   IPSLLQILALSALLQFFALLSPLVNQMIVDEAISKGDLSLLNVIVIGAGLLLLIQSATT
FT                   LLRGYVQMHFSTLLTFQMRGNLLRHALRLPVPWFEKRRLGDILSRFNSLQPVQDLLTGG
FT                   LVSGALDGLMAIITLAVMLIYAPYLASVVLVSLALVVCVRLGTFPWLRSLTNEGIQYQA
FT                   KVDGVFLETIRGARAFKLFGRELERHGVWQNAYADSINNNVRLQKVSLKGSAGLSFLTG
FT                   AEMLLVFYLGAGAIIRGEMTLGMLLAFLSYRSQFSTAALSLVDQYFKFRMTGLHLERLA
FT                   DAVHQDPEPDLDAEARKDRPLAGALDVRNLSFRYAEREAWVLKDVSLSIEPGQSVVFVG
FT                   PSGGGKSTLLKLLMGLYPPSEGEVLVDGLPFSALGMRAYRARIGVVMQDDQLFAGTIAD
FT                   NIAFFDPDMDPARVEAVAGLVGLHDEILRMPMGYMTLVGDLGSTLSGGQQQRALLARAL
FT                   YRNPSILFLDEGTANLDVLAERRVMLALSRLGITQVMVAHRPGAIEGAARVFAVENGHV
FT                   RELMRDVPAQPLQVVP"
FT   gene            394560..395798
FT                   /locus_tag="Arad_7450"
FT   CDS_pept        394560..395798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7450"
FT                   /product="protein secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7450"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28948"
FT                   /db_xref="GOA:B9JN17"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN17"
FT                   /protein_id="ACM28948.1"
FT                   /translation="MSETLFRTQAIEHRRRLRGEVMIAQPMSHGVMTAILGVFVVVGAT
FT                   YLMTGTYARKETVQGYIAPTGGLAQLYATKGGIVTRVLVHEGDVVTQGQPMVELSLETT
FT                   GADGQVGEKLRSETQARIQSIDTQITAAKARFDEEGRRLSARVEGLGGELASQEQRLES
FT                   ERRLQALQTDDAGRYAQLQIKGSGTRFELSRRQQQILAQESVIYELERQKEQRQGDLND
FT                   ARSQLAGLPAERDDKLAQLQGLRSELEQSLAQLQVNRAYVMVAPVAGRVAALQAQPGQT
FT                   AVAQSPLAALVPAGSNLEANLLVPPRAAGLIQPGQEVRLRVDAFPYQRFGVVSGHVVQV
FT                   SRATYREGELLAPIAFKDPVYRVTVSLERTSIAAYGEERPLTPGMTLIGDVITDRRHFT
FT                   DWVLDPLKAIGSR"
FT   gene            395862..396101
FT                   /gene="flgEf"
FT                   /locus_tag="Arad_7452"
FT   CDS_pept        395862..396101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgEf"
FT                   /locus_tag="Arad_7452"
FT                   /product="flagellar hook protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7452"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28949"
FT                   /db_xref="GOA:B9JN18"
FT                   /db_xref="InterPro:IPR019493"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN18"
FT                   /protein_id="ACM28949.1"
FT                   /translation="MSNITEINADMLDLVSGGASTVASTVTIGADGAVSGSYTFGSRSG
FT                   TFSATLPVEVVQKAGTFSFSNASGSFSFDSSFAA"
FT   gene            complement(396212..396667)
FT                   /gene="rpiB"
FT                   /locus_tag="Arad_7453"
FT   CDS_pept        complement(396212..396667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiB"
FT                   /locus_tag="Arad_7453"
FT                   /product="ribose 5-phosphate isomerase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7453"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28950"
FT                   /db_xref="GOA:B9JN19"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9JN19"
FT                   /protein_id="ACM28950.1"
FT                   /translation="MKLAIAGDSAGEGLAKVLADHLKDRYDVSEVSRTDAGPDAFYANL
FT                   ADRVASGVIDGTYDKAILVCGTGIGVSISANKVPGIRAALTHDTYSAERAALSNNAQII
FT                   TMGARVIGTELAKAIADAFLARTFDTNGRSAGNVQAIDEVDAKYNAR"
FT   gene            complement(396664..397449)
FT                   /gene="tpiA"
FT                   /locus_tag="Arad_7454"
FT   CDS_pept        complement(396664..397449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpiA"
FT                   /locus_tag="Arad_7454"
FT                   /product="triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7454"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28951"
FT                   /db_xref="GOA:B9JN20"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9JN20"
FT                   /protein_id="ACM28951.1"
FT                   /translation="MTASPRYWIGTSWKMNKTLAEARGFAEALRDADALRDPAIQRFII
FT                   PPFTAVREVKSILSDTSVKVGAQNMHWADQGAWTGEVSPLMLRDCNLDIVELGHSERRE
FT                   HFGETNETVGLKTEAAVRHGLIPLICIGETLSDRESGRAAEILSEQVVGALSKLSGSQK
FT                   QAQILLAYEPVWAIGEKGIPAEPSYADARQAEIIAVAEKVLGRRIPCLYGGSVNPDNCE
FT                   ELISCPHIDGLFIGRSAWNVEGYLDILAKCAAKLRGDTK"
FT   gene            complement(397458..398222)
FT                   /gene="glpRb"
FT                   /locus_tag="Arad_7455"
FT   CDS_pept        complement(397458..398222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpRb"
FT                   /locus_tag="Arad_7455"
FT                   /product="glycerol-3-phosphate transcriptional regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7455"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28952"
FT                   /db_xref="GOA:B9JN21"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN21"
FT                   /protein_id="ACM28952.1"
FT                   /translation="MKREERQQSIINLLVEHKTVDLDDLADRFVVSKMTIHRDLDDLEQ
FT                   AGVLRKVRGGATIDAGTQFESDFRFRERQGHEEKLAMARAALELVEPGMTVMVNDGSMA
FT                   AVLGEMLLQKRPLTLITNNAAIIDRLKNESGITLIALGGIYSAKFNAFLGVVTEEALFR
FT                   LRADIAFVSTPAVSGGLVYHMDDNIVRTKRAMIASAAKTCLLVSHQRIGHTALHVMADL
FT                   SDFDAVITDRAPDAAILEQLSRDGITLTIAST"
FT   gene            complement(398338..399276)
FT                   /gene="smoC"
FT                   /locus_tag="Arad_7456"
FT   CDS_pept        complement(398338..399276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smoC"
FT                   /locus_tag="Arad_7456"
FT                   /product="sorbitol/mannitol operon transcriptional
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7456"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28953"
FT                   /db_xref="GOA:B9JN22"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN22"
FT                   /protein_id="ACM28953.1"
FT                   /translation="MTDADESLAVRAAWLHYAGGLTQSEVAKRLGVPSVKAHRLIARAV
FT                   ADGVVKVTIDGDIVECVELETKLAARFGLQYCEVAPDLGEEGFEFRALGQAGASFLRRE
FT                   VESGKHKIIGLGHGRTLSSAVHHMSRVNAKGVRFVSLLGGLTRNYAANPYDVMHRIAEK
FT                   TGTQAYVMPVPFFANTREDRDVLLAQRGVKEVFDLANNAELKLVGLGTVDIDAQLVLSG
FT                   MVEPREIKEIAAMGGIGEILGHFFDADGRILETMLSARTLSASLPRSKKEKLVALSGGL
FT                   PKVDAIRAVLNSHCLYGLITDEHTAQALLKS"
FT   gene            complement(399339..400271)
FT                   /locus_tag="Arad_7457"
FT   CDS_pept        complement(399339..400271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7457"
FT                   /product="D-erythrulose 4-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7457"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28954"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN23"
FT                   /protein_id="ACM28954.1"
FT                   /translation="MPLTLSLNTNPLVNRFADADDLIETVARDLRIRDLQLTHEFINPS
FT                   WQAPVIRRLTRTMQAALQRTGVRVTSGMTGPYGRLNHFGHPDADVRRYYIDWFKTFADI
FT                   TADLGGQSVGTQFAIFTYKDYDDPTRREELIKIAIDCWAEVAEHAKSAGLSYVFWEPMS
FT                   IGREFGETINACLKLQSRLTAANLAVPMWMMADIDHGDVSSTNPDDYDPYAWARAVPKI
FT                   SPIIHIKQSLMDKGGHRPFTAEFNAKGRIQPAPLLAAFAEGGAQDNEICLELSFKEREP
FT                   NDRQVISQIAESIAFWAPHIDTGIDDLHI"
FT   gene            complement(400301..401812)
FT                   /gene="glpD"
FT                   /locus_tag="Arad_7458"
FT   CDS_pept        complement(400301..401812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpD"
FT                   /locus_tag="Arad_7458"
FT                   /product="glycerol-3-phosphate dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7458"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28955"
FT                   /db_xref="GOA:B9JN24"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN24"
FT                   /protein_id="ACM28955.1"
FT                   /translation="MTESEILDLFVIGGGINGAGIARDAAGRGLSVMLCEKGDLAEGTS
FT                   SRSGKLVHGGLRYLEYYEFRLVREALIEREVLLNSASHIIWPMRFVLPHSPTDRPAWLV
FT                   RLGLFLYDHLGGRKRLPGTRSLDLRRDPEGAPILDQYTKGFEYSDCWVDDARLVLLNAL
FT                   DAASKGARILTRTACVSARRDEGCWVVQMRDQRSGELRTVRARVLVNAAGPWVNDIIGR
FT                   VAGSNSRRNVRLVKGSHIIVPKFWSGQQAYLVQNHDKRVIFINPYEGDMALIGTTDIPY
FT                   DGKPEEVKADEQEIDYLISAVNRYFKEKLRRSDVIESFSGVRPLFDDGQGNPSAVTRDY
FT                   VFDLDETAGAPLLNVFGGKITTFRKLSEHALQKLAKFFPKMGGDWTRAAALPGGDIPNA
FT                   DYIAFSDSLRSAYPWMPRQLVNHYGHLYGVRTKLVVGNATSLADLGRHFGGNLYEAEAR
FT                   YLAASEWAQSADDVLMRRTKEGLHMTAQEKANFSAWFESELALAA"
FT   gene            complement(401879..403429)
FT                   /gene="lyxX"
FT                   /locus_tag="Arad_7460"
FT   CDS_pept        complement(401879..403429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lyxX"
FT                   /locus_tag="Arad_7460"
FT                   /product="L-xylulose kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7460"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28956"
FT                   /db_xref="GOA:B9JN25"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN25"
FT                   /protein_id="ACM28956.1"
FT                   /translation="MPKSDKIIIGIDAGTSVLKAVAFELSGRQIASASARNHYAMGEDG
FT                   SATQSLSRTWADCVSALRGLSDKVPNLAGRTAAIAVTGQGDGTWLVGSGNAPVDDAWLW
FT                   LDARAAATVTRLGGHPESRARFEATGTGLNTCQQGAQLAHMDRFTPEALDRAETALHCK
FT                   DWLYLNLTGVRATDPSEASFTFGNFRTRQYDPVVIDTLGLNHRRSLLPEIIEGTEITHP
FT                   LSPDAAMATGLLAGTPVCLGYVDMVMTALGAGVRSGGENAACSTIGSTGVHMRAKPVSD
FT                   VQLNAEGTGYVIALPIPGIVTQVQTNMGATINIDWILQVAAELMSEAGKPVTPSDLISR
FT                   IDAWFGESKPGALLYHPYISEAGERGPFVNAHARAGFTGLSTRHGFADMLRAVVEGLGM
FT                   ATRDCYAAMGSMPAELRITGGAARSRALRGSLSAAVNAPVRVSRREEAGAAGVAMMAAV
FT                   AIGVYSNMDDCIAEWVTPLLGDAEAPDADQARRYDRLFSAYVQVRQAIAPAWDTLVAP"
FT   gene            404240..405022
FT                   /locus_tag="Arad_7462"
FT   CDS_pept        404240..405022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7462"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7462"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28957"
FT                   /db_xref="GOA:B9JN26"
FT                   /db_xref="InterPro:IPR014582"
FT                   /db_xref="InterPro:IPR036215"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN26"
FT                   /protein_id="ACM28957.1"
FT                   /translation="MRFHTQCSAGSPIDFHRDRTRAVLLSFQQTGNPAKSAEGLSNMNT
FT                   QTEYAAFKSGGTRLTILASVAAAVIVIGAIAADTKVVKIGSAHDVREQSFSPETFGAQE
FT                   FPKIQADVEKRAVDAATLSGAIIADKKAAGEKYGVATSTGAVMPVSLSGTFGARKANYN
FT                   EIKVDGLPADVTVRVQTGPAINGTDLRDATGAIQFGQFTNQIEYQDAGSAINNEMKKAV
FT                   LSGFDAETLTGKTATVVGVFKLINPKNWLVTPVKVDVK"
FT   gene            405019..406563
FT                   /locus_tag="Arad_7464"
FT   CDS_pept        405019..406563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7464"
FT                   /product="ribose ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7464"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28958"
FT                   /db_xref="GOA:B9JN27"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN27"
FT                   /protein_id="ACM28958.1"
FT                   /translation="MIEAAQNQGANGEVVLAARNISKSYGNVHALKGVNFDIHRGQVTT
FT                   LFGENGAGKSTLMKILSGVVQPTGGEIVLDGSPIAFYSSTHARACGISIIHQELSLAPN
FT                   LSVRDNIFMGREIIKGGVVDFAEEERQTRALMEELEEHIDPLTLVEDLRLGQQQIVEIA
FT                   RALSVNSRILIMDEPTSALSATEVEVLFKVIRDLTGRGVSIVYISHHLEEALQITNHAV
FT                   VLRDGAMTAYAERKDIDLEWIVRNMVGDNFDLGSPPTGHIIGDVALTIDNLTVPGPSGA
FT                   AYNAVDHMSLQVREGEIVCIYGLMGAGRTELLECVAGRLRSSSGRVLLGGRDVARLSIA
FT                   GRIANGLVLVPEDRQRDGLVQTMTVGANLSLASIGAFTKGLFTSGGRERELVGESIRKV
FT                   HIKTDGGEAVIGSLSGGNQQKVVIGKMLATNPQVILLDEPSRGIDIGAKAEVFKLLAER
FT                   AKQGLAVIYSTSEVAECLSIAHRIIVMHRGKISAEFGPDVTKEKIMAASGEAVVAH"
FT   gene            406586..407638
FT                   /locus_tag="Arad_7465"
FT   CDS_pept        406586..407638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7465"
FT                   /product="ribose ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7465"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28959"
FT                   /db_xref="GOA:B9JN28"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN28"
FT                   /protein_id="ACM28959.1"
FT                   /translation="MSVTNITEKKTISNGQRRNFSLVRLILEGRAFFALIVIIAVFSFL
FT                   SPYYFSLSNFLTMASHVAIFGILAIGMLLVILNGGIDLSVGSTLGLAGCIAGFLMQGVT
FT                   LSSFGVILYPPVWAVVVITCVIGAIVGAVNGVLIAYLKVPAFVASLGVLYVARGIALLM
FT                   TNGLTYNNLGGRPELGNTGFDWLGFNRLAGIPIGVIVLAALAIICGLVLSKTAFGRWLY
FT                   ASGGNERAADLSGVPVKRVKILVYVFSGVCAAIAGLVLSSQLTSAGPTAGTTYELTAIA
FT                   AVVIGGAALTGGRGTVRGTMLGAFVIGFLSDGLVIIGVSAYWQTVFTGAVIVLAVLMNS
FT                   IQYGRRVKAS"
FT   gene            407753..408700
FT                   /locus_tag="Arad_7467"
FT   CDS_pept        407753..408700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7467"
FT                   /product="ribose ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7467"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28960"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN29"
FT                   /protein_id="ACM28960.1"
FT                   /translation="MFKRGMRLILAAVAVAPIFASSAWAAGQMTIIVNDPSNPYWLTEG
FT                   NVAKATAEKLGYTASVSAHKGDTNTESNLIDTAITNKSVAIILDPANADGSVGAVKKAV
FT                   AAGIPVFLVNAEINQEGLAKAQLVSNNAQGAAIGAQQWVEAVGDKGKYAELFGAPSDNN
FT                   AATRSNGYETVLTQYPDLQKVAKEVANWDRTQGHNKMQSMLQAHPDIIGVISGNDEMAL
FT                   GAIAALKEAGKLANIKVGGFDGSPDAVAAIKAGELQYTVLQPVAVFSEEAVKQADSFIK
FT                   TGKTGASSEKQLFDCLLITKDNVDKYTGPFVLSQ"
FT   gene            408846..409688
FT                   /locus_tag="Arad_7468"
FT   CDS_pept        408846..409688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7468"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7468"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28961"
FT                   /db_xref="GOA:B9JN30"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN30"
FT                   /protein_id="ACM28961.1"
FT                   /translation="MTQKTNIGAFLSDELPSDSRHSRQLARRQMIAEAVMAEGSMRIED
FT                   LTDRFGISLMTAHRDVDELVSRGLFRKTRGIVTAAATSLIESSDVYRANRQSAEKKMIA
FT                   TAAMQFVEPGQAIFLDDSTTVLQMAAHLPAKVPLTAITNSLTLMNALKDMHDVTLLALG
FT                   GQYYNWCNAFMGRMTINEINRLRADVAFISMSAITDDIVFHQSPEIVDIKRAMFDSAAK
FT                   RILLTDHTKFERRALHSFAALSEFDVVIVDEKTPADHLDRMRNKNINVVVARSDGDRS"
FT   gene            409732..411261
FT                   /gene="lyxX"
FT                   /locus_tag="Arad_7469"
FT   CDS_pept        409732..411261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lyxX"
FT                   /locus_tag="Arad_7469"
FT                   /product="L-xylulose kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7469"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28962"
FT                   /db_xref="GOA:B9JN31"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN31"
FT                   /protein_id="ACM28962.1"
FT                   /translation="MPSLLGIDSGLTVTKAVIFDVDGTQLAVARRRVTQFMPKARHIER
FT                   DMDELWTATADAIAEAISLSGRPASDIQAIAATAHGDGIYLLDRSSKPLGRAILSLDSR
FT                   AGAIVDRWLESPVADEALHLTGQLPHVSAPSALLAWIKEKEPARFADIGHILSCKDWLR
FT                   FCLTGVIGTDRTEASTSFTNVKDQGYSEDALKLFGLDKLKGALPLASRSDEVIGRVTSA
FT                   VAIRTGLAEGTPVVAGLHDVTASALGAGGHASGVVAVIAGTYSINETLSSEPCVDKRWF
FT                   CRNAIAPGQWNNMSISPASTANYDWFLDKLCAGERAGTESAGQSIHALLAPEIEAAFNR
FT                   PSTALFHPYLFGSPYGASASAGFFGLGGWHDRGDMLRAVLEGIAFNHKIHVDALSDGFS
FT                   FSEARLAGGISRNPVVVQMFADVLGMPVMVTETDEAAAWGAALCAGAGIGLYADPQSDP
FT                   RDVGAIAKTCHPDASRSADYRRRYDVFREIADAMTPLWPRIGSLVPAEAQD"
FT   gene            411285..413024
FT                   /locus_tag="Arad_7470"
FT   CDS_pept        411285..413024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7470"
FT                   /product="glycerol-3-phosphate dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7470"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28963"
FT                   /db_xref="GOA:B9JN32"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN32"
FT                   /protein_id="ACM28963.1"
FT                   /translation="MTDTAADLEQRLSTLKDGDIDVVILGAGINGAGLFRDLSVQGVNC
FT                   LIVDKSDFGSGTSAAPSRLIHGGLKYLETGEFGLVAQSTLERNLLLKNAPHCVEALPTF
FT                   VPIFSWTRGIWAALRTLTGSTTAPRSRGAALIKIGLALYDFFGSRSRVMPRHRFIFKKR
FT                   ALKEMPHVTPKIVAGGIYYDAKISRPERLVYELIKDGLEANGNALAANSTTLISSSDGT
FT                   LTFRRSDDSTFSVTPKLVVNAGGPWIDYINEALGAPSHLIGGTKGSHILLDHPELVRSL
FT                   NGHMIYFEADDGRICLVYGYLGLALVGSTDIPSADPDNVRCEEPELEYFLESLRSLLPG
FT                   LRFGPEQVVYTYSGIRPLPASDASSPGLISRDHSAPVMEPQSGRPFAIISLVGGKWTTF
FT                   RGFAEEVADTVLARFKRVRSQSTQQLAIGGGRNFPADPTARAEWVRAVAGKTGVDPKRV
FT                   DELLARYGTTASAILGCVSTYSDTERLSGASHYSHLEIDWITRQEMVVHLSDIVFRRTT
FT                   LAIEGALTMEGLRQIAMIAGAALGWNGQKLRTEIDDVVTTLAKFHGLRLSDTSGRQPAE
FT                   ARI"
FT   gene            complement(413055..414119)
FT                   /locus_tag="Arad_7471"
FT   CDS_pept        complement(413055..414119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7471"
FT                   /product="fructose-bisphosphate aldolase, class II"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7471"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28964"
FT                   /db_xref="GOA:B9JN33"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006412"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN33"
FT                   /protein_id="ACM28964.1"
FT                   /translation="MARITLRQLLDHAAENGYGVPAFNINNMEQALAIMEAADAADAPV
FT                   IIQASRGARAYANDIMLKHMMDAVVEIYPHIPVCVHLDHGNDASSCMTAIQAGFTSVMM
FT                   DGSLKADAKTPADWDYNVGVTKTVTEMAHLGGVSVEGELGVLGSLETGMGEAEDGHGAE
FT                   GKLSHDQLLTNPDEAVKFVRETKVDALAIAMGTSHGAYKFTRRPDGSVLAMEVIEAIHR
FT                   KLPNTHLVMHGSSSVPEDLQEIINKYGGQMKPTWGVPVEEIQRGIKNGVRKINIDTDGR
FT                   MAMTGQIRRVLQEDPSEFDPRKYMKPAMAALTKLCKERFEQFGTAGHATRIKPLPVSDM
FT                   AKRYKAGSLDPIFS"
FT   gene            414514..414957
FT                   /locus_tag="Arad_7473"
FT   CDS_pept        414514..414957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7473"
FT                   /product="acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7473"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28965"
FT                   /db_xref="GOA:B9JN34"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN34"
FT                   /protein_id="ACM28965.1"
FT                   /translation="MDLQKIKTLIEFVGRSQISELVVSQDGTTVRISNGISRQATAAED
FT                   SAVVRQQPARSPVVKDAVSPEGGKADQMVVAPVFGLLHRSPSPGAPPFVKVGDVVEAGQ
FT                   GLCIIEAMKVFNTVSAHKTGPIMRILADDGQEVDAGQPLMEIG"
FT   gene            414957..416330
FT                   /locus_tag="Arad_7474"
FT   CDS_pept        414957..416330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7474"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7474"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28966"
FT                   /db_xref="GOA:B9JN35"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN35"
FT                   /protein_id="ACM28966.1"
FT                   /translation="MSSGESKRRFDTVLIANRGEIALRIQRACRELGLRSVMICSEADR
FT                   DAPYGATADEFVCIGPSAPGQTYLNQAAILLAARTTGAQAIHPGYGFLSENAGFAQAVE
FT                   NTGLVFIGPPASAIRMMGDKIAAKRAMIEAGVPCVPGPDTALPENIAAIREIARDIGYP
FT                   VIVKAAGGGGGRGMRVVHDASALEDAVSVTREEARRAFGTPELYLEKFLEHPRHVEIQV
FT                   LCDNHGNAVWLGHRDCSTQRRHQKVVEEAPAPGMPVEIAAAVGERCVEACRRIGYRGVG
FT                   TFEFLYENGAFYFIEMNTRLQVEHPVTEMTSGIDIVCEQLRVAQGLPLKISQADVQTSG
FT                   HSFECRINAEDPFTFAASPGRITNARFPAGPGVRVDSHVATGYKVSPHYDSLIAKLIVH
FT                   APTRDQAIRRMQIALADTRIDGIATNLPLHREIFEDPAFCAGGTDIHHLEHWLSERKP"
FT   gene            416327..416788
FT                   /locus_tag="Arad_7476"
FT   CDS_pept        416327..416788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7476"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7476"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28967"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN36"
FT                   /protein_id="ACM28967.1"
FT                   /translation="MMKRAKRQAKAMTEDFTDPAVMQEIAAWLESAGASAIEIETGDGR
FT                   HVRIVMDQAASLRADDGPRDTVATSPASVKAAKAPFAGHFLDAHPARGTPAAAQDTAVA
FT                   VGDIVCFVKVGPLLLPVRTPGAGTLNECPVKAGDLVGYGDTIFSIEPAQ"
FT   gene            416785..417495
FT                   /locus_tag="Arad_7478"
FT   CDS_pept        416785..417495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7478"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7478"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28968"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN37"
FT                   /protein_id="ACM28968.1"
FT                   /translation="MTDMQATALSTPGLISPALAAAPKISVIGTSAYLVEAPGDFDLPT
FT                   QRRIWALAKAVETWSEVREIVPGVTNLLVILRRTPEEPDQVEARLRQEWDRVRGIDLAG
FT                   KTIDIPVTYGGDHATDLAAVCDFSGLSDREVVRLHSEGSYTVFALGSAPGFGYLHGLDP
FT                   RIYMPRKTVPSLRMLKGTVTIGGMQTGVSVLTGPNGWNSIGFAELSVFDPERTPPALLA
FT                   PGDRVRFLPERIEL"
FT   gene            417492..418490
FT                   /locus_tag="Arad_7479"
FT   CDS_pept        417492..418490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7479"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7479"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28969"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN38"
FT                   /protein_id="ACM28969.1"
FT                   /translation="MIEILQTGPLNTVQDLGRFGYRNIGVTSSGAMDRLALTVGNLLLG
FT                   NEEGAAALEIQTFPFRLRFEKDTVVAVTGADCDARLDGRPLPPWWAMPVSAGQVLELGT
FT                   PLQSARAYLCLAGGLDVEPVMGSRSTSLRGGFGGLEGRFLAANDRLGIADAQIGAMPDG
FT                   GFGAVPPETALAAHFPAPEDGVLPVRAIPAGEYALFGDEAERFWTQIWKISSQSDRTGY
FT                   RLSGDPIMLASPVEMRSHGVVPGVVQMPPAGEPIIQMSDANTAGGYPKIAGVAEVDLWR
FT                   LGQARIGSRIRFIRSDVAEARAAEQAVKSYLDDIRRTVPMLSQALAVMSRR"
FT   gene            418528..419295
FT                   /locus_tag="Arad_7480"
FT   CDS_pept        418528..419295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7480"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7480"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28970"
FT                   /db_xref="GOA:B9JN39"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN39"
FT                   /protein_id="ACM28970.1"
FT                   /translation="MKIDLNSDMGEGFGPYRLCDDEALMDVVSSANIACGFHAGDPETM
FT                   ARMVRLAKARGVGVGAHPGFPDRLGFGRREMPVEADEMRQQVLYQLGALTAIARGEGVP
FT                   VAHIGFHAAMGNMINRDAALADLIMQAISSVDPDLIVFSMPDTEIERAAKRAGLRTLTL
FT                   FLADRAYDAAGQLVSRKLPNSVIKEEAKVRARVRQFLESGTVTTIDNRTIEVRARSILV
FT                   HSDTPGSLELARIVRSEIEATGATIAPARDVLA"
FT   gene            419347..420549
FT                   /gene="aatAc"
FT                   /locus_tag="Arad_7482"
FT   CDS_pept        419347..420549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aatAc"
FT                   /locus_tag="Arad_7482"
FT                   /product="aspartate aminotransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7482"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28971"
FT                   /db_xref="GOA:B9JN40"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN40"
FT                   /protein_id="ACM28971.1"
FT                   /translation="MPTLADRLKTVSISASAAMTQRARDLASKGINVVSLSSGEPDFPT
FT                   PSHAIEAAHAAALAGDTKYPPLDGTLALRTAIARKFKRENGLDYEPSQIVVAGGGKQVI
FT                   FNAIMATCNPGDEVVIPAPGWISYADIVRFAGGVPVPVACKQENGFKLRAEDLEAVITP
FT                   QTKWLFLNFPNNPTGAACSRAEMAEIAAVMLRHPDVWIMTDDIYEHLIYDDFEFCTIAE
FT                   VEPRLYDRVLTVNGASKAYAMTGWRLGFCGGPKDLISAISNVNGQNSGGTSTITQAAAV
FT                   AVLDGPQDLLKERAAIYKQRRDFVLDRLAGIDGLTCHKPEGAFYIFPSVAGLIGKTSKS
FT                   GRKIENDADFVMGLVEEQHVATVQGGAYGMSPFFRISYATSMEKLAEGCARIAQFCHDL
FT                   K"
FT   gene            complement(420582..421487)
FT                   /locus_tag="Arad_7484"
FT   CDS_pept        complement(420582..421487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7484"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7484"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28972"
FT                   /db_xref="GOA:B9JN41"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN41"
FT                   /protein_id="ACM28972.1"
FT                   /translation="MDIRRFKSFVVIVDTGSITRAADILHIAQPALSQQLAALEEHFGT
FT                   KLLIRSQQGVVMTDAGAELYRHAQIILRQMEQAHADVVAAGKHLAGRVSVGLTPFSGAA
FT                   TLSFELLAETRRRHPGIMLHLTESVGQTYSQMLMNNRLEIALIHGAGPMKGLRFSPLLR
FT                   EDFYLVAHEKFGIEASDTPIAISALESLPFLLPPPYNFVRRAVETAFSRSRTNLTVIGE
FT                   VEVIRTLARAVGTGLGATIMPKAVADRIVSEGTGPIVSRSISPKIEETLSLCVSEHASL
FT                   SDPAAAVQDILRELTERLKQ"
FT   gene            421767..422540
FT                   /locus_tag="Arad_7485"
FT   CDS_pept        421767..422540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7485"
FT                   /product="oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7485"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28973"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN42"
FT                   /protein_id="ACM28973.1"
FT                   /translation="MPFSDYKTALVTGASSGIGAAIVERLCAEGLEVHAVARNGDLLQK
FT                   LAERTGCVAHVIDVTDRAALADLTKRVPFDILVNNAGVDRPKKFLEAEDGDIDLLVDVN
FT                   LRAVLHLCRMVVPGMVARDCGHVINISSIAGVYNFGGNSSYHATKAGVSMLSNQLRLDA
FT                   FGKRVRVTEICPGRVATDIFAHVHGDSPEIRERFIDGFELPQAKDIADAIAFAIAAPVA
FT                   VNIGHMEITPTLQVMGGLQTAKPQSPKPLSSKQGE"
FT   gene            422545..423252
FT                   /locus_tag="Arad_7487"
FT   CDS_pept        422545..423252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7487"
FT                   /product="amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7487"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28974"
FT                   /db_xref="GOA:B9JN43"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN43"
FT                   /protein_id="ACM28974.1"
FT                   /translation="MGKLDLSAILSNPEYVSMLLHGVEMTFVVAIGSWLLAMTLAMLLL
FT                   GLRYAPGPIGNAVVTAYVSYHRNVPTLVQLMLWYFGIFALMPQPVTDWLNDHNAEATFA
FT                   IIGLGLCQAAYFSEDLRSGLRSVNPGQMEAARALGHGYISAMRFVMIPQGIRNALPALI
FT                   NHSVSLFQNSSLAVAIGVAELTYAVKEVENLSFLTFETYLLATVLYLAFSLMIMTAGGY
FT                   VTRRTDPVRSGRA"
FT   gene            423249..424007
FT                   /locus_tag="Arad_7488"
FT   CDS_pept        423249..424007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7488"
FT                   /product="amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7488"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28975"
FT                   /db_xref="GOA:B9JN44"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN44"
FT                   /protein_id="ACM28975.1"
FT                   /translation="MIGDIIQIIHDYWLLLLVGQYPNGPIGGLAATLILSILAIAFAFP
FT                   FSILLALARLSKSPLLNWPVTALVYFTRGVPLLMLILWGYFLVPLMTGADVPSFVTMLV
FT                   TLVVYQGVFLSEVVRGGILALGHGQLEAARALGHSYFGAMRYVVLPQALYNVIPSILSV
FT                   LVSTIKDTTLGYVINVPDLTFAANQINNQLLTQPFQVFFILAAVYYVICWSLTQVASVL
FT                   ERRITRKRAGTAAQKPENVLQLKALTDQSL"
FT   gene            424004..424768
FT                   /locus_tag="Arad_7489"
FT   CDS_pept        424004..424768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7489"
FT                   /product="amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7489"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28976"
FT                   /db_xref="GOA:B9JN45"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN45"
FT                   /protein_id="ACM28976.1"
FT                   /translation="MTLAQSSQNPPMIRLSAVRKSYGHFEVLKGIDAEVARGEVVVVCG
FT                   PSGSGKSTLIRTVNRLEEIASGSITCDGNDMHGSVPASEMNRRRSRIGFVFQNFNLFPH
FT                   LSVLDNIAMSPIRVKGVARDVARNKAKQLLDRVGLADKAGAFPAQLSGGQQQRVAIARA
FT                   LAMEPPVMLFDEPTSALDPEMVGEVLAVMKSLAADGMTMMCVTHEMGFARDVADRVWFM
FT                   DDGLILEAAPPKEFFSNPQHARAQRFLADLRH"
FT   gene            424798..425634
FT                   /locus_tag="Arad_7490"
FT   CDS_pept        424798..425634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7490"
FT                   /product="amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7490"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28977"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN46"
FT                   /protein_id="ACM28977.1"
FT                   /translation="MNMTSWTLSIALAATALAGSANADQLADIMTAKVIRCGTFADVPP
FT                   FASPDPKTREMVGFDVDLCGAIAQALGVKPEIKPVSVEARVPEVKLGHVDIAVANLAYT
FT                   VSRSEQIQFSDPYYLAKEMLIVKVGDAGQKKADFAGVRLASTKGSTSELSIRLNKSQPL
FT                   TFQDTGSAYLAVQQGKARGMVANTMTTTKIVNESKTKGAEMRMIDEPMLYQPIGIGMKK
FT                   DEPALTAKINEVLVSLDKSGEINKIWDKWLGPNTEYKMTRTDKVVPITELKFDPIP"
FT   gene            425674..426450
FT                   /gene="menG"
FT                   /locus_tag="Arad_7492"
FT   CDS_pept        425674..426450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menG"
FT                   /locus_tag="Arad_7492"
FT                   /product="S-adenosylmethionine: 2-demethylmenaquinone
FT                   methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7492"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28978"
FT                   /db_xref="GOA:B9JN47"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN47"
FT                   /protein_id="ACM28978.1"
FT                   /translation="MQPASCRAVSRPHDVFSLPDEAGVQLLICLEDHEVVILKQKIDRP
FT                   SQEEIAAIAKFSPATLHEAQGRRGALSSRIKPIDYRMKLCGPAFTVKCAPRDNIMLQVA
FT                   INYAQPGDIIVVSAGEYEEAGSFGDVLANACLAKGIGGLVTDTGVRDTLQLRDLGFPVF
FT                   SLSVCIKGTVKETLGATNEPILIGDEIVHPGDIIVGDADGLVVVRKSEAFEVAKLSQAR
FT                   EDAEAGYIAAYKAGKSVVEVSNLEAVLKAKGLVIEG"
FT   gene            complement(426545..427453)
FT                   /locus_tag="Arad_7493"
FT   CDS_pept        complement(426545..427453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7493"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7493"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28979"
FT                   /db_xref="GOA:B9JN48"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN48"
FT                   /protein_id="ACM28979.1"
FT                   /translation="MSLSLRQLRYFVATAEYGQISHAAMNLSISQSAVTAAIKDLELTV
FT                   GVMLFNRTPQGMELTAAGRQFLSHAYEILAKVDEATHLNLVSSDIEGDLVVAATYTVIG
FT                   YFLPLHIERMRRLYPRLRIQLYEVNRETIEEGLLSNRYDISVLLTSNILNPMLTTETLL
FT                   SSVRRLWVPAQHNLLRRDGVGLREIATEPYIMLTVDEAAHSSLKYWSGTPYQPKVLLRT
FT                   SSIEAVRSMVANSLGVAILSDMVHRPWSLEGRRIETVNIQDPVPPMDVGLAWRANSEFS
FT                   PQMLAFRRYFQQAFGLPGTNA"
FT   gene            427695..428513
FT                   /locus_tag="Arad_7494"
FT   CDS_pept        427695..428513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7494"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7494"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28980"
FT                   /db_xref="GOA:B9JN49"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN49"
FT                   /protein_id="ACM28980.1"
FT                   /translation="MHEEIRLKEVVDINCDMGEAFGRWRIGDTRDEHLIPLISSANIAT
FT                   GFHAGDPNLMDETVRLAAEHGIGVGAHPGYNDLQGFGRRKINGTSKEIVNDLIYQVGAL
FT                   REFARRHGVPVQHVKPHGALYMEMAANAELSRIFIQYMHTVAPSTPIFCMAASATHIAA
FT                   QEVGQPTVREFYADRDYGDNGWIVFTRDAGRPDPKAIARKVLRACTEGKVRTVTGADID
FT                   IEFESICFHSDTLGALEIAREIRAALVGAGVRIAPVSQFLNNEIARRPHE"
FT   gene            428506..428748
FT                   /locus_tag="Arad_7496"
FT   CDS_pept        428506..428748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7496"
FT                   /product="Biotin/lipoyl attachment protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7496"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28981"
FT                   /db_xref="GOA:B9JN50"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN50"
FT                   /protein_id="ACM28981.1"
FT                   /translation="MSKLEIKSPLPGTFYRASSPDTPVFKADGDAVSAADTIGLIEVMK
FT                   TFQQIPAGLDGKNIKFLVENEEPVMAGQVIAEVEA"
FT   gene            428745..430130
FT                   /locus_tag="Arad_7497"
FT   CDS_pept        428745..430130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7497"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7497"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28982"
FT                   /db_xref="GOA:B9JN51"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN51"
FT                   /protein_id="ACM28982.1"
FT                   /translation="MTIRSVLIANRGEIAVRIIKAAKALGIRTVQVHSAADADMLAVRL
FT                   ADEAIDIGSPAPKKSYLNIEAVIAAAKASGVDAVHPGYGFLSENGDFADAVEAAGMVFI
FT                   GPSGDAIRTLGDKVAARQVAAKAGVPTVPGSDGRVAGLDEARTLAATIGFPVMIKAAAG
FT                   GGGRGIRIVADIAELEQQFPLASAEALAAFGDGGLYMEKVITRARHVEVQIFGDGQNFV
FT                   HFFERECSLQRRRQKVWEEAPAFLLPANVRERLCGSAVALAREVGYRGAGTVEYLYDDE
FT                   TGDFYFIEVNTRIQVEHPVTEMITGFDLVQEMFKVAGGAALSVSQDDIRPSGHAIECRI
FT                   NAEDPFKAFQPSPGTITKLSVPEGEGIRFDTMLYEGYTIPPFYDSLLGKLIVHAETREA
FT                   CLTKLDIALQALVIEGVPTTVPLHLALTRDASVAKGAFHTRFLEHWLENDFVALAGRTQ
FT                   EVD"
FT   gene            430127..431005
FT                   /locus_tag="Arad_7499"
FT   CDS_pept        430127..431005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7499"
FT                   /product="urea amidolyase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7499"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28983"
FT                   /db_xref="GOA:B9JN52"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN52"
FT                   /protein_id="ACM28983.1"
FT                   /translation="MMPARYTFGGDEHLFVECSDEMSLEAFFKSLSMATGVRDSAIKGV
FT                   TEICPANASFQIKFNPDLIKPDDLLKEVQAIEGAAEKAEPVIKTRIVEIPVFYNDPWTH
FT                   ETLMRFRERHQEPSGTDLDYAAGINGYGAVDDFIAAHSGSPWFVSMVGFVAGLPFMYQM
FT                   VERPRQIEVPKYLRPRTDTPRLTVGHGGCFGCIYSVRGAGGYQMFGITPMPIFDPTQTT
FT                   SYLRDFMVFFRPGDIVKFKPIDRDGYDKAVEEVDKGLFSPPIREVSFDLRQYQTDIDGY
FT                   NAKLEGVLYGH"
FT   gene            430995..431966
FT                   /locus_tag="Arad_7500"
FT   CDS_pept        430995..431966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7500"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28984"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN53"
FT                   /protein_id="ACM28984.1"
FT                   /translation="MAIKVLHHGLATTVQDLGRPGYFHLGIPVGGAMDRYAMRAANRLV
FT                   GNDEGAAGLEAVFMGPQLEFLHDAVIAVTGADMPAKIDGVLQPGWTALKIRAGQVLSFD
FT                   FLKSGARIYIAVSGGIDVPLALGSRSTYPIGTLGGYKGRALAVGDELPVGQGSVVQDGR
FT                   SVEEGLRRRPGTPAELRVLPGLYWDRLTDEAKKSFFADPWKVAPEADRMGYRFRGGRKL
FT                   EFVERKQPFGAGSDPSNIVDSCYPYGSIQVPGGTEPIILHRDAVSGGGYFMLGTVISAD
FT                   MDLIGQLQPHTPTRFVEVTMEEALAARAERQALIERMRACLM"
FT   gene            complement(432041..433051)
FT                   /locus_tag="Arad_7502"
FT   CDS_pept        complement(432041..433051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7502"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7502"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28985"
FT                   /db_xref="GOA:B9JN54"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN54"
FT                   /protein_id="ACM28985.1"
FT                   /translation="MTEYGARPNAQKRYEIAEDVLRGNIEDSTLPLGVVLLEGPIAEIL
FT                   QISRAPVQRALQALESEGLVHRFNGRGYLVGPANRGIEPNRTDIKTLGLTIPRHADEAL
FT                   QSRSSWERIYNTVEADVAGCVVFGQYRIIEIELANHFNVSRTVVRDVLTRLRERGLVRK
FT                   NQSSHWIAGPLTAQMIKDHFVLRGMLEPQALIAGAEHVDHGQLSELFQRLSELEKHDTA
FT                   DHLKALEAIYADFIDICILATPNERLKESIRNNLLPVTATERLLRRLGLPGDPAIITEL
FT                   RLVTELLLRGAVTAAAAMMESHLDASVKRMIAQMKIVAIIPGPSVTAAYLTRVLE"
FT   gene            433613..434686
FT                   /locus_tag="Arad_7503"
FT   CDS_pept        433613..434686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7503"
FT                   /product="spermidine/putrescine ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7503"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28986"
FT                   /db_xref="GOA:B9JN55"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN55"
FT                   /protein_id="ACM28986.1"
FT                   /translation="MSTVLQLKQVAKSYGGVPALASVDFSLPGDAYISLLGPSGSGKTT
FT                   LLRVIAGFEEPDSGSILFQGERLDGVEPHARGIGFVFQNFALFPHLSVTDNVAFGLRNR
FT                   KIDPVTDASVVNARVRDMLALVGLKGLEDRAVTQISGGQRQRVALARTLVTEPKMVLLD
FT                   EPLGALDANLRSRMRTELKTIRERCGVTFLHVTGSESEALAMGDMVLVLDQGRIAQAAT
FT                   SDVIYNRPASAAVARFLNCYNLFAGDVVDDHFVSQTGRFPLNASLRKAPQPGYAIRHDH
FT                   VAIRPFDAAISTEEIRIDGDFIASEYSGAAINSFFALDDGRVFEVESHLSHSRPPAFVE
FT                   KSRYALVWKKEDALVFG"
FT   gene            434741..435634
FT                   /locus_tag="Arad_7504"
FT   CDS_pept        434741..435634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7504"
FT                   /product="spermidine/putrescine ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7504"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28987"
FT                   /db_xref="GOA:B9JN56"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN56"
FT                   /protein_id="ACM28987.1"
FT                   /translation="MVVTSEDAVQETTVTRRPSRKALWLLAPGVLWMLLFLVLPLLMMV
FT                   YVSFWTQTTFKIEPTLTLQSWITFLTSPTYLGALWTTVRIWLLVLLSTLVVGYPAALFV
FT                   GLLVKNKTLQTVLLVLCVIPFWTSFLIRVLAWRPMLGTEGAINMILMNLGIIHQPIEVL
FT                   LFSELSVIIGMTQIYCVFMVGPIAFMLGRIDASVIEAAQDLGAGFWRIFRTIILPLSLP
FT                   GVVVGAIFVSVMVLGEFATSAALSGRKVNLLGNIIVTQVGSLKWAFAAVAGVVLTIIMG
FT                   AVVAVLLKIVDLRKEL"
FT   gene            435637..436482
FT                   /locus_tag="Arad_7506"
FT   CDS_pept        435637..436482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7506"
FT                   /product="spermidine/putrescine ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7506"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28988"
FT                   /db_xref="GOA:B9JN57"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN57"
FT                   /protein_id="ACM28988.1"
FT                   /translation="MNASGIKLGLGVYTTLFLVFLYGPLVVLAILSFQTGPEGGPQFPI
FT                   IEWSTYWYRHLFGLTPPSRIAPLPIDQSLIRSLVLAVMTMIVSTVLGVTSAQAFRRKFR
FT                   GSGVVFYLIVLGMMVPGVLVGLGMALVANTFGIDRHWWSTAFVLHVVYTFPFAFLVMLA
FT                   IFNRFDPSMEEASWSLGVTPARTFRKVTFPLIFPGVLSAMLFAFTLSYDEFSRTLFASG
FT                   RELTLPLAIYGTFSVEVHPNVFAFGVLTTLFSFALLGTYATLMGLSVRRARRIRVQEDA
FT                   "
FT   gene            436479..437222
FT                   /locus_tag="Arad_7507"
FT   CDS_pept        436479..437222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7507"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7507"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28989"
FT                   /db_xref="GOA:B9JN58"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN58"
FT                   /protein_id="ACM28989.1"
FT                   /translation="MMTRKPSAIVTGAGSGIGRAIAHRLAADGYAVLVNDLSLDRAQAV
FT                   ANEIGKAGGLASAAASDVSRPEDVAAIHAAAVARHGEVDLLVNNAGIVHQASFENLALE
FT                   DFDRMFAVHVRGTFLMTKAVLSSMLERGEGGIINVASQLGQIGGIELVHYSGAKAAIIG
FT                   MTKALAREVSSRGVRVNAVAPGPINTPLVLGLSDEWRERKKRELPLGRFGEPEEVAATV
FT                   AFLASPAASLFVGQTLGPNSGDVML"
FT   gene            437230..438003
FT                   /locus_tag="Arad_7509"
FT   CDS_pept        437230..438003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7509"
FT                   /product="3-oxoacyl-(acyl-carrier protein) reductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7509"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28990"
FT                   /db_xref="GOA:B9JN59"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN59"
FT                   /protein_id="ACM28990.1"
FT                   /translation="MDMTTTEKRIVIVTGAGIGIGQATAKAFAALGDHVVVTDILTAEG
FT                   EETVRDIVASGGSAEFQFYDVRSTEATNALVVDLEARFGRIDVIVANAGIAHRTPLENL
FT                   SDDKWDLTFDIDLKGIFRLVRAAATGMKRRKSGSIVALSSIMGVAYGWDEHVHYSAAKS
FT                   GVVGLVRGLAVELARDGVRVNGVAPGYIRTAQLLSEENSLGAEGAEKVPELVPLGRIGA
FT                   PDDIADVIAFLASNGARYMTGQVLVVDGGLLVGRY"
FT   gene            438110..439345
FT                   /locus_tag="Arad_7511"
FT   CDS_pept        438110..439345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7511"
FT                   /product="spermidine/putrescine ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7511"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28991"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN60"
FT                   /protein_id="ACM28991.1"
FT                   /translation="MSKMEMNRRSLLKHSAGVMALAAIGGGTSLLSSRAAFAQAANLAG
FT                   EQLRTIGLSVTVQERILADFRKASGVGQTSGTAATFPDAQTKILSGSKDYDCWEIIAER
FT                   LPSIVMTNNVEPVPAASLKNWANIRDTFTKPSDKWGAKQQIVGQIWADDTQTTLNMVPA
FT                   VYNYDSIGYNPDVLSAEEANSWAALFDPKWKGKSGLNTDPLIAFGQAIMAMNTLGLLSV
FT                   KNPGNPSTAEIDEAAKFLVSKKKDGQFRALWGDFGELVNLMASGEMVVCDAWQPAVMAV
FT                   KAQGKPCKYAVPKEGYRGWAIGPSMIAGTTNKEAVIAYADYWLSGEPGITVSEQGYYSP
FT                   STNIKNVMAPDKYAFWYEGKPWVGAAERGIKEGDLRDGGSLEERAKNVAYWHQWPDEYD
FT                   HLVQKWDEFLNA"
FT   gene            439431..440540
FT                   /locus_tag="Arad_7512"
FT   CDS_pept        439431..440540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7512"
FT                   /product="ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7512"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28992"
FT                   /db_xref="GOA:B9JN61"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN61"
FT                   /protein_id="ACM28992.1"
FT                   /translation="MIYDLELINVGKVYDNGTPAVADFNLTVTKGEFIAFLGPSGCGKT
FT                   TTLRMIAGFETISSGDMMIKGERMNDVRPQNRPTSMIFQNYALFPHMSVRRNVGYGLEV
FT                   KGIAKPERDARVDRILATLGLEDIAERKPDRLSGGQRQRIALARGLVVEPDVLLLDEPL
FT                   GALDANLRKAIQNELKLLQKRLGVTFIFVTHAQSEALALSDRIVVMNQGRVEQISPPHQ
FT                   LYTRPNTPFVAQFIGRNTIFHGEVAGIEGENTVVTTPLGLLSGRPNGAVAGKGKVDIVI
FT                   PSEAIEVHASEGVDRQRIAGAFGGNVVGARIERFDVVGHISHLTASLPDGRSLALEAHV
FT                   DKYRPGTFAVGAGVLLAWNPAEATVIPAY"
FT   gene            440572..441453
FT                   /locus_tag="Arad_7513"
FT   CDS_pept        440572..441453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7513"
FT                   /product="polysaccharide deacetylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7513"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28993"
FT                   /db_xref="GOA:B9JN62"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR037950"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN62"
FT                   /protein_id="ACM28993.1"
FT                   /translation="MAKEILCSFGVDVDAVAGWLGSYGGEDSPDDISRGLFAGEVGSPR
FT                   LVKLFERFGIKTTWFIPGHSIETFPEQMQAVADAGHEIGIHGYSHENPIAMTREQETEI
FT                   LDKCIELVTKLSGKRPTGYVAPWWEFSNVTNELLLERGIKYDHSLMHKDFTPYYVRVGD
FT                   SWTKIDYSKKPSDWMVPLKRGQETDLIEIPASWYLDDLPPMMFIKKAPNSHGFVNPHDI
FT                   EQMWRDQFDWVYREMDYAVFPITIHPDVAGRPQVLMMLERLYAHMIKHPGVKFVTMNEI
FT                   ADDFAARFPRKK"
FT   gene            441489..441821
FT                   /locus_tag="Arad_7515"
FT   CDS_pept        441489..441821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7515"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7515"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28994"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN63"
FT                   /protein_id="ACM28994.1"
FT                   /translation="MCSLCGVLGGNEHWTDAAARPGVFTRNDSRLDRRRERANRVAAAN
FT                   RMLSAFGLVLSDWQGASFVLSTKTGKSEIVEDLGHLWPAAERLVGRPCDPLDPGLIARM
FT                   EASRDA"
FT   gene            441835..442875
FT                   /locus_tag="Arad_7516"
FT   CDS_pept        441835..442875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7516"
FT                   /product="cobalamin synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7516"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28995"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN64"
FT                   /protein_id="ACM28995.1"
FT                   /translation="MTVNLLTGFLGSGKTTLLRRLLAEDAFADAAVLINEFGEIGLDHH
FT                   LIERIDDEIVLLRSGCVCCTVRGELADALKDLYSKRERGLVPPFRRVIIESTGLADPFP
FT                   VLSTIKADPILRHHFRPGSVVTAVDAVNGQRQLDTYIESNRQAAIADRLVITKTDLATD
FT                   SERSALESRLRRINPDALLVCAGDDDLDLSSLLQDAATMRGDHVQSPSGFYCEEPVWLT
FT                   NADGAPHRAAISSVTMTVDRPIDWTAFGIWLTMLLNRHGERVLRVKGILNLVGEERPVA
FT                   IHGVQHLVHTPVHMEAWPSDDRSSRLVFILDGLDGEVLKRSFEAFTLAGVVSDGVTRPR
FT                   LAIPAE"
FT   gene            442892..444112
FT                   /locus_tag="Arad_7517"
FT   CDS_pept        442892..444112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7517"
FT                   /product="spermidine/putrescine ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7517"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28996"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN65"
FT                   /protein_id="ACM28996.1"
FT                   /translation="MNKHQSPAKATSAPALHLAGRPKLRILGTAISLLEELRIRAQDDL
FT                   GIEVTFDNNDFLTTQYKAAKEPETYDIYDQCFHNLDIVWHWRAIQPVDTKRIVLWDEIN
FT                   DLTKTGHIGPNPRLGLGDVPARKLYVQPNLALGDTPSRFISMLPTTHNFDSFAYRTDLV
FT                   DNAVAMHSWGALFDERWAGRVALVDEPAIGIFDAALAAQAAGLMSFDDIGNMSITEIDQ
FT                   LIDLLEERKKAGFFRGFWQTAEDAARLMMAGDTAVQSMWSPGIGILNSKGVPVEQAVPA
FT                   EGYRAWHGGLCLSKSLSGRLLDVAYDYLNWWLSGWPGAVVARQGYYISTPQRSRQYMTS
FT                   SEWDYWYEGLAAAEDLPGPDGLTRIKAGSVRSGGSYWQRANCIAVWNTTMDEHNYLVRR
FT                   WMQLVGR"
FT   gene            444126..445496
FT                   /locus_tag="Arad_7518"
FT   CDS_pept        444126..445496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7518"
FT                   /product="amidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7518"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28997"
FT                   /db_xref="GOA:B9JN66"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN66"
FT                   /protein_id="ACM28997.1"
FT                   /translation="MAYSHLGKSIAQLSVLLQSGALDPVALAEESLDAIRSHKDQAIFI
FT                   SLLEERAREEAASASKRLRDGRSRGLLDGIPIAWKDLFAIRGLPTTAGSTVLAREAPAS
FT                   EDADIVQALAEAGMVSVGRVNMSEFAFSGLGLNPHYGTSLNPLSKDVERVPGGSSSGSA
FT                   VAVAAGLVPVSIGTDTGGSVRIPSAFNGLVGYKASRGRYSMAGVFPLATSLDSLGPLCR
FT                   SVQDAIWVDAAMRRLTAPQIVRASLKDISLVVPETIVMDDIEDGVRQAFDAAILRLQQA
FT                   GVRVRRAAFPTFSGVFDLMAKHGPMVTAEAYALHYDRLSGPDATAMDRRVVARTSLGQK
FT                   IGLIDYIALLKGRERLIEEFATATAPNEFIAYPTVAHVAPPLAPLRDDDDLFVKTNAKT
FT                   LRNTLIGNFLDGCGVSLPCGTGDGGMPVGFLLSAKRDRDETLLAAALAVEQVVRSSP"
FT   gene            445635..448328
FT                   /locus_tag="Arad_7520"
FT   CDS_pept        445635..448328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7520"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7520"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28998"
FT                   /db_xref="GOA:B9JN67"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041617"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN67"
FT                   /protein_id="ACM28998.1"
FT                   /translation="MIISQTRFQPPSAGNEHVRRRGLLALLQRSGLRRLTTIVAPAGYG
FT                   KTSLAAQWYEMFKSQGAQAVWIPLDPEDGDQSRFLLALLESLQKLLPDERKGSDANSMP
FT                   VASLLSALVTRLRRIREPIVLFLDDYHFAQNDATESLMAKLLAASDLGHVKFVLISRSP
FT                   PRFPTSALRLNSELKQIGVADLSFSDMEAQEFFGSRAKKLTSEQISELNQRTEGWAVAL
FT                   QMVRVLVNDNMDSSAILSSFDGSNAEMGRYLSEQVFSSLPEDIQHFLTESAALPAVSRP
FT                   LIGAVSAQDNAVALFNRLGDHALPIAVLDGQGTWIRYHPVFNSYLKEEAERLGIDTRQI
FT                   LRKAAHWFESGGDCDAAVRHALLAADATLAAQIIERAGGWRRVYAKTRGGTALFQTLIA
FT                   KAADINLADFPLTTLGLSVINAKAGQLDAANHYLALAERAAATMGEKLAQDLRVVRVLL
FT                   SLYTDRWATTADLSALEADLSQDSGMEPIHRALALNMLSYNFLIRTDLERALHYGQLSI
FT                   RSFRDAGADFGAMHLYTHIGQAAFFSGDSATAADAYRSLITEAQANIGKGCDLDAISHV
FT                   LQSELLSMNGDRQAAAAVLAWALPHLERHDTWFDLLAAGIMAQQRILRLNGEIMAAHAA
FT                   IDSARSAAKRRGFDRLIRLIDGERAALLLASGDINEAVRYAEVSGFGAESISSDTANDF
FT                   AVNLRGNVPALLWTRIYLAQGEIARARSTFDRLIKCQSRELHVPRRIELGFLDIRLLLA
FT                   EGDEATAAARLSEMMLSLPVADYRAILLIEGPEFGRRLCQLAASRGVPDVVMQRLERLQ
FT                   DVVAGASAQDSDLLSVPTAATGGLTDRERSVLRLLSAGLSNKEIGRKLDLSNNTVKFHL
FT                   RNIYAKLNVTTRTAAVTMARDTGILL"
FT   gene            448448..450142
FT                   /locus_tag="Arad_7521"
FT   CDS_pept        448448..450142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7521"
FT                   /product="N-methylhydantoinase
FT                   (ATP-hydrolyzing)/5-oxoprolinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7521"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28999"
FT                   /db_xref="GOA:B9JN68"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN68"
FT                   /protein_id="ACM28999.1"
FT                   /translation="MTIEEISVDPVTQEIIEGKLTAVVDEMGIVMARTSMSPVIYEVLD
FT                   FACGLLTSEGELVAQMNGITLFTGTFGVQVKALIEKSAGNLADGDVLLSNDPYAGGTHA
FT                   CDFAIVKPLFVDGEILGYAINVAHYLDVGGSVPGSLAPNATSVFQEGIRLPGVKIARSD
FT                   VFSNDILSIICENVRLPEIALGDLNAQVATVRVAARRLTELAAKYGSDVVRAAFANLLT
FT                   ASEKRSRAAIAALPDGRYEASDIIDGDGITDAPIPVQVAVTIDGDSIIADFTGCPPAVP
FT                   GPINCARGALQSAVRTIVKALVGPQEPSNEGWFRPLTVIAPPGTIFTAEKPSPTGWYYE
FT                   GSVHASELVWKALAPLVPSRFSAGSYSSLCVVYISGKDRNGQPFIHIEPQHGGWGASEE
FT                   ADGAGALIALTDGDTYNYSVEAIEARFPLRVKSYGYNINAGTGAGRRRGGFGIVREYEI
FT                   LSKDASAYGSFGRTRTRPWGMDGGGSGTVNALQIASASDGRVRTYGRIAHIDLNAGDIL
FT                   RVITGGGGGWGDARQREPHLIERDLRNGFITEAQAVKLYGYQTKVAV"
FT   gene            450139..452202
FT                   /locus_tag="Arad_7522"
FT   CDS_pept        450139..452202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7522"
FT                   /product="N-methylhydantoinase
FT                   (ATP-hydrolyzing)/5-oxoprolinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7522"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29000"
FT                   /db_xref="GOA:B9JN69"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN69"
FT                   /protein_id="ACM29000.1"
FT                   /translation="MIRLATDVGGTFTDLVGYDERSGELFTAKSLTTVPDQSIGVLDAI
FT                   ASAETKDGLRTRDVTFFAHGGTTVINAITERKGVRTALVTTAGFRDVLEIGRGNRPDLY
FT                   NLRFRSPAPFVPRSLRFEVRERLDASGKIITPLHVEDLKPIIAQCKAERIEAVAILFLH
FT                   SYTNPEHEILCADILAAALPDATVCASYEVSRQWREYERSNTVVLNAYVQPIIRRYFAR
FT                   LEDALMRRDLTCPYYAMQSNGGIATFEQAVSSPLSLVESGPAGGVAGAARIGNALGESE
FT                   VLSLDVGGTTAKCSLIHGGRPTLNVEYKLEHTRIEPGHPIQVPVVDIVEIGSGGGSIAW
FT                   LDERGVLRVGPESAGSMPGPACYGRGGTRPTLSDAILTIGIFDPTNFAGGSMHLDKQKA
FT                   AEAIATIAAPLGLSIEDAAIAIIDIAHASMINALKLVTVQRGHDPREVAFVISGGAGPA
FT                   LATRLGRDLSVKSTVVPLHPGLFSAWGMLAAEPRADFRHTWFSALTAEAIKALLARFDK
FT                   LEQEAIAYFAKGHDADIRFTYQVEARYRGQEHGVFAQFHRGDDREVFAERFHAVHERAY
FT                   SFRLPHAAIEITTLHLEAVLNGPVIALPALSKNGRSLEAALTGQRNVYFGAVLGWVSCP
FT                   VYERSLLAPGQSIEGPMIVEEATATTLVQEKQQLSVADNGVLIIRESVSEAG"
FT   gene            452202..453287
FT                   /gene="potG"
FT                   /locus_tag="Arad_7523"
FT   CDS_pept        452202..453287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potG"
FT                   /locus_tag="Arad_7523"
FT                   /product="spermidine/putrescine ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7523"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29001"
FT                   /db_xref="GOA:B9JN70"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN70"
FT                   /protein_id="ACM29001.1"
FT                   /translation="MAISIQIEKVSREYGPVKALDDVTLDIAAGEFFTLLGSSGCGKSS
FT                   LLKLIGGFDRQTSGRISFDGKDMSDVPANKRPVNTVFQSLALFPHMTVAQNVGYGLRLR
FT                   GVSGSALATRINDALDLVELSGFGPRDVNLLSGGQRQRVALARALVMEPGILLLDEPLT
FT                   GLDERLRQQMRDEFGRLHKRTGATFVLVTHNQDEALSLSDRMAVMHKGRIEQVGAPASF
FT                   FEAPANAFVARFVGIDTLVRPEEITTSEGQTYAVIAGQRVPVRVAGPTDPLQSVVAIRA
FT                   DRLFLAAADAPGTLMLTVVETTFRGLYHELKLAFWDGQTLTMAIEEETGLGGLEAGRSV
FT                   RVGLKQDAAVLISNAGLLPTS"
FT   gene            453352..454530
FT                   /locus_tag="Arad_7524"
FT   CDS_pept        453352..454530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7524"
FT                   /product="spermidine/putrescine ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7524"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29002"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN71"
FT                   /protein_id="ACM29002.1"
FT                   /translation="MAKHGGIFSSARHSNVQRREFLKLMGAGSVALSAGSLGLASSAAA
FT                   QDAATVAFWATATLDIGDKWKAFATQNGVAPEFTDNGNDIGPVIARLAAGNANDLFDVG
FT                   GFQGGAEKELARQGVIIPWDLTKIPNYESVWQWAKDIPYLKHEGKQYSIPTVVNADSII
FT                   YRPDKLGKVDSYGVIFDPKLKGRVAMEDAWINSAIFTAMYLKESENKPIVEPGNLTESE
FT                   LGLVMEFLIKHKKDGQFRTFWNGWEQGVQLVADQEVDAMTGWEPIVYEGRKRGLQVEYA
FT                   APVEGYEAWGNNTVLLKGAGDRGVSDTAHKFVNGLLGGFYGCELGQARGYLVPTDNNLA
FT                   YAKAHPDEYKADEVEKLAEHVKAKFAGKVYWQNTRPDNFQLYEEWWQKLRNA"
FT   gene            454598..455467
FT                   /locus_tag="Arad_7525"
FT   CDS_pept        454598..455467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7525"
FT                   /product="spermidine/putrescine ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7525"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29003"
FT                   /db_xref="GOA:B9JN72"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN72"
FT                   /protein_id="ACM29003.1"
FT                   /translation="MSKARLPISSMLMAPPLLAILAFGLVPLIVVVVWSFWSWDPVTYW
FT                   IKPDLSLAGYAGILEAGRWTVVVSTLIKAFGTALLCLLIAYPTSYAIHFLAGRRLNVIL
FT                   LALITIPFFTSYLIRSFSWRLVLGRTGIINEWLQGIGIIDAPLDWLLFSNFAVIVGLVA
FT                   SYLPFAIFPLLLSMRRVDPTYLAAAQDLGAGFWKSLTTILLPLTKSGIFAGFLFVFVMV
FT                   VGSSTEVQMLGGAGASIVSVMINDVMRVANYPMAFAISTIVLVVIFGLVLVGNRIFGLA
FT                   SLFEDQSP"
FT   gene            455464..456282
FT                   /locus_tag="Arad_7526"
FT   CDS_pept        455464..456282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7526"
FT                   /product="polyamine ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7526"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29004"
FT                   /db_xref="GOA:B9JN73"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN73"
FT                   /protein_id="ACM29004.1"
FT                   /translation="MMLREGLANRVLLWVVTIAGLLVIYAPPLYLLAISFNPALQPGLP
FT                   NISELSLKWYASLPQEAALIGALEQSLIIATVTAVLATLMSLLAALAYFELRARRTAWF
FT                   LTVILPMFVPGVIQGLALSAVFARAGVKASMLTVIAGHLLWAMPFAFIVILTSFAAVRR
FT                   SYLVAAADLGADWWHRFFDIILPLIRPGLISAFIFSFLLSLNEFTRAFYLAGRQNTLPV
FT                   VLFGKMNSGASPVIYAMSGAIFLISVLCVALIALRFLWQARIEDSAQRSG"
FT   gene            456603..458081
FT                   /locus_tag="Arad_7527"
FT   CDS_pept        456603..458081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7527"
FT                   /product="sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7527"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29005"
FT                   /db_xref="GOA:B9JN74"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN74"
FT                   /protein_id="ACM29005.1"
FT                   /translation="MEFLLEVEGLQKSFGGVAALRDGRFQLRAGSVHALCGGNGAGKST
FT                   FLKILMGIHARDAGLIRRRGKEVDYASPAEALAAGIAIIEQELSPIPHMTVAENIYLGR
FT                   EPSARFGGIDFKTMNRSAQALLDRLEFNIRATQFMMNLSVAQVQLVEIAKALSHDAEVI
FT                   FMDEPTSAIGEKEAQQLFSTIERLKAEGKGIVYVSHRLSEIFQIADSYTAFRDGSYVGS
FT                   GAIADIDRAGLIRMIVGRELGEEYIKTNTPTATAGFEVSGLTAPGKIDDISFVARKGEI
FT                   FGIYGLMGSGRTEIFDCIFGLDAPTSGNMKLAGQSISVRKPAEAMQHGIAFVTEDRKLT
FT                   GLNLSDSVRNNICLASLPEMSPQFSMDRRAEAAASAAMIERFGIKAARDSMAVSGLSGG
FT                   NQQKVVLGKWFLRKPKVLLLDEPTRGVDVGAKREIYRIICDFAAEGGTVIMISSEIDEV
FT                   LGMSDRILVMRQGRSAGILERKEADAQALVHLST"
FT   gene            458138..459142
FT                   /locus_tag="Arad_7529"
FT   CDS_pept        458138..459142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7529"
FT                   /product="sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7529"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29006"
FT                   /db_xref="GOA:B9JN75"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN75"
FT                   /protein_id="ACM29006.1"
FT                   /translation="MSATDNNRSSAWFSSDRRRLIVQEYGIFLAFLLLAVILSVSNEYF
FT                   LTPGNISNVLLQTSINGVLAIGMTFVILTRGIDLSVGSVVALTGIISASFATTSATAGI
FT                   VGAPYPPYVALAVGLLVGVACGAVVGLIVSRFAVPAFVATLGMLSAARGLTLIYGGGKP
FT                   VPALTPDFRWIGTGTVFSIPMPVILLAIVFAVSWWVLNRTRFGRYIYAVGGNPHAANTS
FT                   GINVTRLRFLVYVISGGLAGLAGMILSARTGSALPQAGIAYELDAIAAVVIGGTSLSGG
FT                   VGRITGTLIGALIIGVMNNGLDLMGIQSYYQQVLKGALIVGAVMLDQKRNLGS"
FT   gene            459228..460217
FT                   /gene="mocBch2"
FT                   /locus_tag="Arad_7530"
FT   CDS_pept        459228..460217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mocBch2"
FT                   /locus_tag="Arad_7530"
FT                   /product="rhizopine ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7530"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29007"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN76"
FT                   /protein_id="ACM29007.1"
FT                   /translation="MKKLLIALAAATALLASPSLAQDKKLKIGAAPYGLNAEFMQIWSA
FT                   ALQQHPAVKSGEVELTIFDGRYDALVQQEQFNTMITQKFDAIIFVPIDIEAGATAVQAA
FT                   HDAGIPVVGSNTRVNSDLLSAYVGSDDTISGYMEAKTVLDKIGCKGNVVILEGPIGQSA
FT                   QISRLEGNKKALAECPNVKVIEDQTANWSRAEAQTLMENWLTSHPGQINGVIGQNDEMA
FT                   LGAIEAIKAAKLNVGDFAIAGIDGITDALHAVKQGTMTSILQDATAQAQGALDLAIFNA
FT                   KKGAYKPESPIWAEYPKMPFNDGKDKNYNVPWTPVTTENVDKLLETRK"
FT   gene            460276..461049
FT                   /gene="smoS"
FT                   /locus_tag="Arad_7532"
FT   CDS_pept        460276..461049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smoS"
FT                   /locus_tag="Arad_7532"
FT                   /product="sorbitol dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7532"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29008"
FT                   /db_xref="GOA:B9JN77"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN77"
FT                   /protein_id="ACM29008.1"
FT                   /translation="MTDKAPDIDLNFPLSGKVAVVTGGGSGIGAAVAAAFASKGAKVAV
FT                   LDINADIATAKAAELGGDAKPFACDVADSASVNKAIADVVSHFGHIDIAVNSAGVVFLA
FT                   PAEDLSEDHWDKTININLKGTYLVTQAVGRAMIAAGKGGKIINLASQAGTVAIEEHVAY
FT                   CASKFGVIGMSKTFAAEWGKHGICVNTISPTIVLTELGKKAWSGEKGEAAKRRIPVGRF
FT                   AFPEEIAAAAVFLSSSGADMINGADLLIDGGYTIL"
FT   gene            461083..462075
FT                   /locus_tag="Arad_7533"
FT   CDS_pept        461083..462075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7533"
FT                   /product="dihydroxyacetone kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7533"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29009"
FT                   /db_xref="GOA:B9JN78"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN78"
FT                   /protein_id="ACM29009.1"
FT                   /translation="MQRFINNPDEVVEDTVKGFVKAHSGTVRLAENPRVVVAKNAPQAG
FT                   KVGVITGGGSGHEPAFIGYAGKNMLDAVAVGELFSSPTAKSFYDAVREANGGRGVICLY
FT                   GNYAGDNMNVKMAIKLAAKDGIEVATVVANDDVCSAPPEEREKRRGVAGEIFMWKIGSA
FT                   KASTGASLEEVRAISQRVIDNCRSVGIGLGPCTLPAVGHPNFKIEPGTMEVGIGHHGEP
FT                   GVRVEPLKTAEEIAKTMSQIVLDDHNLAAGTEVAVLVSGLGATPVNELYILNDTIETQI
FT                   TTRGLKIYKTYVGNYFTSLEMVGATLTVLALDDEMKELLDVEVHCTTLL"
FT   gene            462089..462739
FT                   /locus_tag="Arad_7535"
FT   CDS_pept        462089..462739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7535"
FT                   /product="dihydroxyacetone kinase, L subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7535"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29010"
FT                   /db_xref="GOA:B9JN79"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012737"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN79"
FT                   /protein_id="ACM29010.1"
FT                   /translation="MQTFSNATVGDIVLAMADRIVENRAYLSEIDGKIGDGDHGVNMAK
FT                   GFGMAAERMKGKYLSLAASLDTLGTVLMTEIGGSMGPLYGVMFIEFAEKLEGVDAIDSA
FT                   TYSRMLHAGLEGIQAIGSAKVGDKTLLDTLVPAIEAFDGAIAAGKSFVDALDALVAAAD
FT                   AGRDSTLNLVAKIGRASRLGERSLGVLDAGATSCAIILKELSFGARERLQSAS"
FT   gene            462897..464993
FT                   /locus_tag="Arad_7536"
FT   CDS_pept        462897..464993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7536"
FT                   /product="dihydroxyacetone kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7536"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29011"
FT                   /db_xref="GOA:B9JN80"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN80"
FT                   /protein_id="ACM29011.1"
FT                   /translation="MTGKTSSVGKTGVGKAGVPETSDAMPLRYGDDPYVWACWLYYEDS
FT                   RTQGDIAEIMGISRATVNSYLADARSRGIVNISLEPSRLSSLSIAMELKRHFGLHDCLV
FT                   VPSDDGTRPLIDRLGTAGAQAIAKLLKSGDTLAVAWGRTVLAIAEQASVPNLQDVTIVQ
FT                   ATGGTRARFAYTPELCAAAFANAVGGKLINITAPAIVSTGEVRDILLREPLVEDQFATL
FT                   SKANKALFGISSLRPNSTIHSSGFFESVSLQDYLAKNAVGVVAGRFIDPKGEPVAGPLD
FT                   DRTIGISLDMLKAIGLRIAVAGGFDKVPAILAALRGGYINVLITDAATGRGILNADGVT
FT                   EIDQKISQRSRTDNTVPLPSSFRTHIKKFLNNPDDVVDEMLDGIVKAHAGHVAPIKGSN
FT                   RALVARTGPRPGKVGLVIGGGTGHEPCFVGYVGKGLADAVAVGNIFSSPPPTPILQCAR
FT                   AASGGEGVLFVYGNYAGDVMNFEMAAEMAQEERIDVRTILTTDDIASSPVEDREGRRGV
FT                   AGNFFIFKIAGAACDRGLSLDACEAATRKANDRTYTMGVALEPCSLPQTRRHNFEIGPD
FT                   DIEFGMGIHGERGVIREKMMTADEITDRVMDRIFAEMKPTPGDRVAVLINSFGATPLME
FT                   LYILFRRVEQRLSAKDIRIEASWVGHYCTSLDMVGASISILHLDQELTELLYHPCDTAA
FT                   LKVG"
FT   gene            465053..465700
FT                   /locus_tag="Arad_7537"
FT   CDS_pept        465053..465700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7537"
FT                   /product="dihydroxyacetone kinase, L subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7537"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29012"
FT                   /db_xref="GOA:B9JN81"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012737"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN81"
FT                   /protein_id="ACM29012.1"
FT                   /translation="MPENAARHLSSMFQRISIAITAEKDHLSELDGAIGDADHGITMAL
FT                   GFMAVNAELTKLDLERTLPSEVFTVAASAFLDAVGASTGPLYATAFRKAAQALKQDESL
FT                   SDAGQVAIVEAMTTGIKERGKGQRGDKTMLDAWIPATEAAVNARARQCGTRELWNSIVE
FT                   AAETGANSTRSMIAARGRAARLGERSLGHVDPGAASAVIILRAMGDSFSSSG"
FT   gene            465779..467077
FT                   /locus_tag="Arad_7538"
FT   CDS_pept        465779..467077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7538"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7538"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29013"
FT                   /db_xref="GOA:B9JN82"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN82"
FT                   /protein_id="ACM29013.1"
FT                   /translation="MRNISAPTAGARERFTHDATAFPGVSALPNRDQTYYRHLCLLIIL
FT                   LLPLAGCMTVSRPQYRADQSSAAEVPGFPGVRSYLDEGSSSWEDAFDWQPAAAQGDVNY
FT                   LMISGGGAGGAFSAGVLSAWTKTGKRPRFDIVSGVSTGALIAPFAFLGSSYDDLIAHLY
FT                   TSGVAKNLVDRRLLPNQMLGKSLLRGRTLRSMVDQYITQDVLDAVAREHRNGRRLLVLT
FT                   SNLDSQRAVVWNMGAIAASGRPGALQLFRDVLVASASIPGVYPPVLIKVQAGDRHFQEL
FT                   HSDGGSSSQILTFPSTVLASASHAPRSKPRKLNIFVLVNNALMPEFSNTSERTLPVMAR
FT                   AYATLIKAQERDALMALYGWARRTGATFHAASIDCQIPYDIADPFNDRYMRAVFTLGAR
FT                   ETLNGTLWNDVPLFTTATSNPECQSVPTQLSKL"
FT   gene            complement(467419..467949)
FT                   /locus_tag="Arad_7539"
FT   CDS_pept        complement(467419..467949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7539"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7539"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29014"
FT                   /db_xref="GOA:B9JN83"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN83"
FT                   /protein_id="ACM29014.1"
FT                   /translation="MDACVSQLPLSIAHATEADIPFIMSVERLPGYAALVGSYDAAEHH
FT                   RRLAAPNTNYLLCRLGAEPVGFAVVRLDDDDMGNAQLHRIAMAAIGLGHGTAFLHQICR
FT                   LVFSIHDVARFWLDLLPSNARAKAVYSKIGFLQEGTMRGALRVSDDSRHDLLLMSLLRD
FT                   QWQANIGSQNLRS"
FT   gene            complement(467967..468518)
FT                   /locus_tag="Arad_7540"
FT   CDS_pept        complement(467967..468518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7540"
FT                   /product="Histidinol phosphate phosphatase, HisJ"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7540"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29015"
FT                   /db_xref="GOA:B9JN84"
FT                   /db_xref="InterPro:IPR010140"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN84"
FT                   /protein_id="ACM29015.1"
FT                   /translation="MTLILFDYIVGSVHDICGRWLDYSANDTAALAADLGGPEELRLAY
FT                   FGQVTDMVERLKPDIIAHLDLVRKYDPPGFVFSDRVVRSIDRTLDAIQANGSALDVNCA
FT                   AFRNGYGPVYPLPQILERARKTGIPVTLGDDSHGVQTVGVGLDQSLAAIAAAGYRSVAY
FT                   LTRTEGWREAPLESIGPLTC"
FT   gene            complement(468755..469597)
FT                   /locus_tag="Arad_7541"
FT   CDS_pept        complement(468755..469597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7541"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7541"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29016"
FT                   /db_xref="GOA:B9JN85"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN85"
FT                   /protein_id="ACM29016.1"
FT                   /translation="MTLTPIPRLEIGVGQTTSGTSPCLYRSMICFILQGSKEVAIHDDL
FT                   LRYDASQYLVSALDLPLSGQIHDADDGSPYVAISLVLDPALLAEVASTMPAVRDADAPG
FT                   SGIAINPMTPPLRDTLLRLLALLDTPADIPALAPMAERELLYRLLQGPQGRLLRHIARP
FT                   EGAIGGIRRAVEWIRDRGNTRLRIEALCEAAGMSRASLHRHFLALTGLSPIQYQKQIRL
FT                   QEARQLLLAGDHSASDVAYAVGYESASQFSREYLRRFGAPPVRDVRRLRQSISDHTIS"
FT   gene            469827..470585
FT                   /locus_tag="Arad_7542"
FT   CDS_pept        469827..470585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7542"
FT                   /product="dehydrogenase/reductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7542"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29017"
FT                   /db_xref="GOA:B9JN86"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN86"
FT                   /protein_id="ACM29017.1"
FT                   /translation="MSQKIALITGASRGLGRNMALHLAKRGVGVIGTYRNSAAEAQTLV
FT                   DEIEALGGKAAMLVLDVTDTASFSNFTQAVTDALRTTFGVDRFDYLVNNGGEGIYVMVA
FT                   DASEDQFDQMVDMHLRGPLFLTQKLLPLIVDGGRILNVSSGFVRTTMAGYGLYGAAKAA
FT                   MQTLTKFMAVELGARQIRVNAIAPGAIATDFGGGRVRDDKHINDFVAGNIALGRVGQPD
FT                   DIGGAVAAILSDDLGWANGTTFDVSGGQSL"
FT   gene            470615..471289
FT                   /gene="gstch1"
FT                   /locus_tag="Arad_7543"
FT   CDS_pept        470615..471289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gstch1"
FT                   /locus_tag="Arad_7543"
FT                   /product="glutathione S-transferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7543"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29018"
FT                   /db_xref="GOA:B9JN87"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN87"
FT                   /protein_id="ACM29018.1"
FT                   /translation="MTEQNLTLVSHPLCPFVQRAAIVLLEKGVAFDRVNVDLSAKPDWF
FT                   LALSPTGKVPVLKVRQPNGEEAILFESVVICEYLNEKQGGAAMYPDDALLRARHRAWIE
FT                   FATQTFAEGWQFLHAKDMATADAKRAAFRDRLSKIEAELGDGPYFAGANFGLVDAVYAP
FT                   LFRYFGIIDPEVADPIFAGLPRVTAWRAALAERSSVKNAVIDTYPDLFRDHLRQQGAMI
FT                   AA"
FT   gene            471316..471912
FT                   /locus_tag="Arad_7544"
FT   CDS_pept        471316..471912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7544"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7544"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29019"
FT                   /db_xref="GOA:B9JN88"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN88"
FT                   /protein_id="ACM29019.1"
FT                   /translation="MTDPSNSALILIEYVNDWLSPTGGIYPVFQDREQVDTAIANSKII
FT                   LEEARRRGLHVIHAALKFEPTFKVLGEAKYGLRKMTRDHGAFLGEQADFFPGFAPAEGE
FT                   HVVRERAGGSSVFVGTTLDGYLRNNGIFDIYLAGFSLRQCVESSMRNAHDLGYHTNVIY
FT                   DASAGYTRKQQDDFVAEIAPFYANAITTQEFVSHE"
FT   gene            471976..472254
FT                   /locus_tag="Arad_7545"
FT   CDS_pept        471976..472254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7545"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7545"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29020"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN89"
FT                   /protein_id="ACM29020.1"
FT                   /translation="MIGLMVELAVTPDSGAAFERAFAVQAAAVQANEPGNRLYELFKST
FT                   NLSDSYTLVEIYKDDAALQAHRASPHMAANRPLTAPFLAGLSFGTKL"
FT   gene            complement(472293..473048)
FT                   /locus_tag="Arad_7546"
FT   CDS_pept        complement(472293..473048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7546"
FT                   /product="dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7546"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29021"
FT                   /db_xref="GOA:B9JN90"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN90"
FT                   /protein_id="ACM29021.1"
FT                   /translation="MTKRLENKIAVVTGATSGIGLSTAKLFAAEGARVYITGRRKDALD
FT                   KAVAAIGRGAVGVQADSAKNEDLDKLFAQVKVEHGRLDTLVVNAGGGTMLPLGQITEEQ
FT                   VDDTFGRNVKAVIFTVQKALPLLGKGSSVVLTGSTAGTEGTAAFSVYSASKAAVRNLAR
FT                   SWALDLKGTGIRVNVVSPGATRTPGLVELAGDDKEQQQGLLDYLASRIPLGRVGESEEI
FT                   AKATLFLASDDASFVNGAELFADGGQAQV"
FT   gene            complement(473216..474157)
FT                   /locus_tag="Arad_7548"
FT   CDS_pept        complement(473216..474157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7548"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7548"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29022"
FT                   /db_xref="GOA:B9JN91"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN91"
FT                   /protein_id="ACM29022.1"
FT                   /translation="MDQILAIKTFVRVAEAGSFAKAADTMNLPRSSVSKLVQDLEAHLG
FT                   TKLVERTTRSVTMTTEGVAYHERALKLLADLDDMDGTVAGSRSAPKGKLRVDIGSVLAN
FT                   QILIPSLSDFQSQYPDIDLMLGVSDRPADVVSEGIDCVIRGGSLSDSSMKARKLCELDY
FT                   VICASPAYLDGLELPQRPDDIQAHRIVSYFSASSGKRFPLRFQRGDERSEYLPTSAGIS
FT                   VNESTAHLNALLSGLGIGQSFGFLARPHFESGALVELLPEWKPDNHPLHLVYPADRFPN
FT                   PRLRAFTEWATKVFEAVDARRNVATETIHAYG"
FT   gene            complement(474511..475788)
FT                   /locus_tag="Arad_7549"
FT   CDS_pept        complement(474511..475788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7549"
FT                   /product="adenylate cyclase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7549"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29023"
FT                   /db_xref="GOA:B9JN92"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN92"
FT                   /protein_id="ACM29023.1"
FT                   /translation="MDRKTSMFSNSDSIREIRSASLRLVALAVLFANLVLGDGRTSVVT
FT                   HITIMLIYLMISIASIFSATYFAKNKWLTEIFVALDAGLVVIVLYEHILANPITENHNL
FT                   TTSSLVVAFILLNHVALKLEQRLVLLFSGIVIIAWIAMLALMAYRHHSNEPGTLLANFF
FT                   NQDLGLTISFAFTAFAVFLLARDHDRTRKAAMRIEDRRMNLSRFFSPMVVAELEVASSV
FT                   LDLERRNAAVMFIDIRDFTSYSETATARELARVLAEYRRIVAGTVFAYGGTVDKFIGDG
FT                   VMAVFGQPKSRSDDAHRALACAIELMARLECWKISNIELGGPSLETGIGLHYGSVISGV
FT                   LESGYHDELTVIGDTVNVAQRLETLTKKLEAPLVVSITMMGQVPGAEAALNWVRKDEVA
FT                   LAGRRELIDIAYVRRAAPAARLQEAS"
FT   gene            complement(475906..476244)
FT                   /locus_tag="Arad_7551"
FT   CDS_pept        complement(475906..476244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7551"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7551"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29024"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN93"
FT                   /protein_id="ACM29024.1"
FT                   /translation="MAMSRSQGSNTQDWKDRTMNIAIRLTLVALLSLMAAFGVLAQEFT
FT                   KGVVNKVDAKAKKVTIRHEDLKNLDMPAMTMVFRVEDPVLLQKFKEGAAIEFVAERVNG
FT                   KLAVTQVK"
FT   gene            complement(476216..476605)
FT                   /locus_tag="Arad_7552"
FT   CDS_pept        complement(476216..476605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7552"
FT                   /product="copper-containing oxidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7552"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29025"
FT                   /db_xref="GOA:B9JN94"
FT                   /db_xref="InterPro:IPR000923"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN94"
FT                   /protein_id="ACM29025.1"
FT                   /translation="MAVGEVGDKAKATQTIRVTMKETDDGKMIFIPDVIKVRKDQTVRI
FT                   AIKNAGTVEHEFVLDQEDKILEHKVQMEKFPEMEHADANSIRLSPGASGDIIWKFTTDG
FT                   EFKFACLVPGHYEAGMHGDVTVAGK"
FT   gene            complement(476732..478078)
FT                   /locus_tag="Arad_7553"
FT   CDS_pept        complement(476732..478078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7553"
FT                   /product="copper-containing oxidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7553"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29026"
FT                   /db_xref="GOA:B9JN95"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN95"
FT                   /protein_id="ACM29026.1"
FT                   /translation="MFNRRQIIGAGAALLSTAAWTKTSAMGLPDAPIMVSAEMQPPIHP
FT                   DTGPDYQPVVTLNGWTLPHRMNNGVKEFHLVAEPVEREMADGMTAYLWGYNGQSPGPTI
FT                   EAVEGDRVRIFVTNKLPEHTTIHWHGMILPSGMDGVGGLTQPHIPVGKTFVYEFDLVKS
FT                   GTFMYHPHSDEMVQMAMGMMGFFVIHPKDPKFMPVDRDFVFLLNAYDIDPGSYVPRVME
FT                   MTDFNMWCWNSRVFPGISPLVVSRNDRVRVRVGNLTMTNHPVHMHGYDFEVTSTDGGWV
FT                   RPEARWPEVSIDIPVGAMRAYEFDAKYLGDWAIHCHKSHHTMNAMGHDIPTFIGVDKKG
FT                   VAEKIRKLQPEYMPMGTKGMADMGEMEMPIPENTIPMMTGWGPHGPIEMGGMFSVVKVR
FT                   EGISADDYSDPGWYENPPGTQAWEWTGELPDATKIKDAKTQITPRPTKG"
FT   gene            complement(478090..479550)
FT                   /locus_tag="Arad_7554"
FT   CDS_pept        complement(478090..479550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7554"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7554"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29027"
FT                   /db_xref="GOA:B9JN96"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN96"
FT                   /protein_id="ACM29027.1"
FT                   /translation="MTPSLKNAALLLLPIALGGCVSTEYAKRDAGFATVANTAGTATAK
FT                   HTVWIQNKLQAQAVADEVKGLINKRKTLDVETAVQVALLNNKGLQAAYADLGDSAADAW
FT                   QSTMLINPSVSIGTTGLGTPELEAFRTIEGMVATNILALATHKKNVEIADSRFRQAKLA
FT                   AAVATLKLAADTRRAWINAMAASETVGQLQRAQLAADASSELASKLGETGAMTKGSQAR
FT                   EHVFAAELAGQTAQARLAVRLSKEELTRLMGLWGSSIDYQIPSSLPALPKVLIKRDAIE
FT                   AEALLKRVDLQMAKLDLAATAKSYGLTEATRYVTDLEILTGFETERAIEDGKKKTKTTG
FT                   QVELEFAIPIFDTGKARLRKAELAYMRAANQLAEKAVNVRSEARSVYEAYRSNYEIAKH
FT                   YRNSVVPLRTKIEEESLLTYNGMISNTFELLTDTRDKINSILLSVNAKRDFWLADANLM
FT                   PTIYGGGAGEAARPSEPASASNAGAAGH"
FT   gene            complement(479547..479771)
FT                   /locus_tag="Arad_7555"
FT   CDS_pept        complement(479547..479771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7555"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7555"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29028"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN97"
FT                   /protein_id="ACM29028.1"
FT                   /translation="MRPTILVVALPLIAGGCSSTLPPDAPTPDGDLLSTARPIQYRTPL
FT                   SGYVARQPVDPKSWKRQNELQSPSKGDAS"
FT   gene            complement(479868..480191)
FT                   /locus_tag="Arad_7557"
FT   CDS_pept        complement(479868..480191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7557"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7557"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29030"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN98"
FT                   /protein_id="ACM29030.1"
FT                   /translation="MPSANAAMHGSAFPEIQKTMSDVTSPGGDHHMEHASADDHRHGSA
FT                   SSDDGGTAKLVKKECCKDFCGGFAIMCDGPRLGGPVVSSIREFMNDQHSFGELPTLQRP
FT                   PTI"
FT   gene            480321..480416
FT                   /locus_tag="Arad_7556"
FT   CDS_pept        480321..480416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7556"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29029"
FT                   /db_xref="UniProtKB/TrEMBL:B9JN99"
FT                   /protein_id="ACM29029.1"
FT                   /translation="MIGKDSRRFYDMDVTRKMDPLKDAYLLRFAK"
FT   gene            480503..481066
FT                   /locus_tag="Arad_7558"
FT   CDS_pept        480503..481066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7558"
FT                   /product="cytochrome c-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7558"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29031"
FT                   /db_xref="GOA:B9JNA0"
FT                   /db_xref="InterPro:IPR002321"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNA0"
FT                   /protein_id="ACM29031.1"
FT                   /translation="MHEVPLTRYSATFYIGLITAIASVMAIAGHAADDLVTVRQGDMKA
FT                   MAFSAKIIADMFKDPPTYSSAGFRRAADTIADKSGNALIVHFVGETATANSKAKPNLGE
FT                   ERDRFDRLATDLRNYANALAAAAERNPGTMGANMRMKLGEPMGGGPLGTHVRNETKLSS
FT                   MSAEHIFHLMLQTCTTCHARFRTD"
FT   gene            481437..481673
FT                   /locus_tag="Arad_7559"
FT   CDS_pept        481437..481673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7559"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7559"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29032"
FT                   /db_xref="InterPro:IPR025528"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNA1"
FT                   /protein_id="ACM29032.1"
FT                   /translation="MANRPRRPINPMDAAEALFKPAKKAAAPPAVERPALPNTKELVSL
FT                   KIDSDVLMFFQEDGPGWQDRINDTLRLAIQSKI"
FT   gene            481834..482277
FT                   /locus_tag="Arad_7560"
FT   CDS_pept        481834..482277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7560"
FT                   /product="insertion sequence transposase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7560"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29033"
FT                   /db_xref="GOA:B9JNA2"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNA2"
FT                   /protein_id="ACM29033.1"
FT                   /translation="MLCIHQATAIPPSGTRWVNPSSVTADGAYDTKHIYDAIINHSADV
FT                   AIVIPPRINAVEAAGNRSPGQRDLHIAAIRRDGRMKWQASTCYGKRVRVETAIGRYKSI
FT                   IRPRLRARSFHAQQTEVAIGCAVLNRMLTSARPKSVRRKAKVA"
FT   gene            complement(482412..484406)
FT                   /gene="rcdA"
FT                   /locus_tag="Arad_7561"
FT   CDS_pept        complement(482412..484406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rcdA"
FT                   /locus_tag="Arad_7561"
FT                   /product="Curdlan Synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7561"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29034"
FT                   /db_xref="GOA:B9JNA3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNA3"
FT                   /protein_id="ACM29034.1"
FT                   /translation="MVQYLLALAPTLLILALFLLGPFNWSRHHTWTRAITCALVAAVAL
FT                   RYMLWRLTQTVLPYPNDGFNFYWVWFVFFVEMLAFTEVVLFLVLMSRYVDRSAEADRLA
FT                   KIFFARDEVELPTVDIFIPTYNEPLDVLERTIVGALALDYPADKLKVYVLDDQRRDWLK
FT                   SFCEKKKAIHVTRGDNSHAKAGNMNNGLKVSSGEFVAVFDADFVPYRHFLRRTLPFFSD
FT                   ESIGIVQTPQHFFNVDPVQSNLGLENIWPDEQRLFFDEIAPSRDTWDVSFCCGSCSIAR
FT                   RKAVDAIGGFPTESITEDLLTTLSMLNRGYKTRYLNERLSMGLAAENLTGYFVQRERWC
FT                   QGGIQTLYLQNGPLRGPGLSLFQRIMFLPASWLVQYLVRFMILIVPIAYLWFGLLPLYF
FT                   TDIADYVSYQVPLLTAYFLLMLWITPTRYLPVISSAVGTFATFRMLPTVVSSLVRPFGK
FT                   PFKVTPKGSSNEANQFDRYSFAWIAGLITITTIGLLINIVPETTNVQGQFSPIAALWAG
FT                   INIIVLVIASLICFEKPRRLFHAFRLEEDVTVDDVPGQVVSLALDKAVVAVSPEARFQS
FT                   SSVLLKLNGFAPFKTELKRVTQRRRSISRGGDRQAYYLHLHFELSAVDRDGMIVKLYTG
FT                   QYSQDIRDIDKVAVSVNLLLRSFGRTRTL"
FT   gene            complement(484388..485686)
FT                   /gene="rcdB"
FT                   /locus_tag="Arad_7562"
FT   CDS_pept        complement(484388..485686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rcdB"
FT                   /locus_tag="Arad_7562"
FT                   /product="Curdlan synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7562"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29035"
FT                   /db_xref="GOA:B9JNA4"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNA4"
FT                   /protein_id="ACM29035.1"
FT                   /translation="MYLFASDSAAPIIVNAISLSTNMIWNHRITRITVGLLLLAIAIIV
FT                   SLPAITGFTSRDGTVNARFAIINAPIDGVIAGEPAKVGVPVKESQTLAEISNPRVNRAI
FT                   LASLEADRNTARDRVIALKTERDELSQLREQLSNRLEVFKQTTISNLEREVEILRKKVE
FT                   VSQAQDLVAQVDLNRRMDLESKGILTRRMVDAARAAGAATGGEVEISNLTVEQLQQRLN
FT                   ALRQGIFVSGDGQNDVPYSRQRQDEVVVRISDLNSRIAENETRAAEVEKQLVEEGSRVS
FT                   NLESAAATAPFDGVVWSRSIVNGSNVVLNNELVRLLDCRELFVDILVPEVDYDEIYPGL
FT                   AAQVRLFGRSDVFKGTVTSVRGSSAAVESDSFAASLPVSSQRNARIRVRLETSFMNGDF
FT                   ANFCQVGRTVQVRFPKHSISLSNWVKNLWFSIF"
FT   gene            486186..487257
FT                   /pseudo
FT                   /locus_tag="Arad_7563"
FT                   /note="conserved hypothetical protein; Frameshift
FT                   (pseudogene)"
FT   gene            complement(487943..489025)
FT                   /gene="adhA2"
FT                   /locus_tag="Arad_7565"
FT   CDS_pept        complement(487943..489025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adhA2"
FT                   /locus_tag="Arad_7565"
FT                   /product="alcohol dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7565"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29036"
FT                   /db_xref="GOA:B9JNA5"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNA5"
FT                   /protein_id="ACM29036.1"
FT                   /translation="MITKTMMAAVVHRFGEPLVIESVPVPVPGPGELLVKVIACGVCHT
FT                   DLHAADGDWPVKPSPPFIPGHEVAGIVAALGQGVTDFKLGDPVGVAWLHDACMRCEYCE
FT                   TGWETLCEHQHDTGYSCDGGFAEYVIASAAFTARLPANVDFAQIAPILCAGVTTYKGLK
FT                   ETEARPGEWVAISGIGGLGHVAIQYAKAMGLKIVALDVTPEKLTLARATGADVVIDARS
FT                   PDAIADVLKATGGGAHGILVTAVSPPAFSQALQMVRRKGTIALVGLPPGEFPTPIFDVV
FT                   LKRITLRGSIVGTRRDLDEAIAFAVEGKVKADITKVPLNDINAIFAKLKAGKVEGRMVL
FT                   DFTIPITTSKQKEERAPVEV"
FT   gene            489198..490589
FT                   /locus_tag="Arad_7566"
FT   CDS_pept        489198..490589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7566"
FT                   /product="aldehyde dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7566"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29037"
FT                   /db_xref="GOA:B9JNA6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNA6"
FT                   /protein_id="ACM29037.1"
FT                   /translation="MTYATTNPYTGEVLKVFPNATDAEVKLAIDNAHATFLSWKETAFA
FT                   ERAKVMQSAAHILRNDIQAYAELLTIEMGKLLSEAKAEVELSADIFEYYARNAEKLLAP
FT                   QRLAVTNPAEGEAMIVHDPLGVLLAIEPWNFPYYQIARIIAPQLSAGNTMLLKHASNVP
FT                   QSAAAFEKLMWEAGLPNGAFKNLYATRSQVELILDDPRVHGVALTGSEGAGAIVAAQAG
FT                   KALKKSTMELGGADAFVVLADADLEKTTKWAVFGRHWNGGQVCVSSKRMIIVDKVYDQF
FT                   LERYSVGVAGLRAGDPFDPATTLAPLSSQAAADEIKDKIRQAVSHGAKATEVGPKVPNR
FT                   GAFVQPTILTEIADDSPARYWEFFGPVSMLFRAKDEDDAVRIANDSPFGLGGSVFTSDP
FT                   KHGVEVAKKISTGMVFVNHPTMVKADLPFGGIRRSGYGRELLGPGIKEFVNHKLIDVVD
FT                   IDAEF"
FT   gene            complement(490969..493383)
FT                   /locus_tag="Arad_7568"
FT   CDS_pept        complement(490969..493383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7568"
FT                   /product="phosphoketolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7568"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29038"
FT                   /db_xref="GOA:B9JNA7"
FT                   /db_xref="InterPro:IPR005593"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR018969"
FT                   /db_xref="InterPro:IPR018970"
FT                   /db_xref="InterPro:IPR019789"
FT                   /db_xref="InterPro:IPR019790"
FT                   /db_xref="InterPro:IPR023962"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNA7"
FT                   /protein_id="ACM29038.1"
FT                   /translation="MEKQPAATFTHPLDDAELDLINRYWRAANYLSVGQIYLLDNPLLR
FT                   EPLKAEHIKPRLLGHWGTTPGLNFIYAHINRIIRNRDLDIIYICGPGHGGPGMVANTYL
FT                   EGTYSEIYPDISTDTSGMHKLFRQFSFPGGIPSHAAPETPGSIHEGGELGYALVHAYGA
FT                   VFDNPDLIAACVIGDGEAETGPLAASWHSNKFLNPARDGAVLPILHLNGYKIANPTILG
FT                   RDTEEDLRHLFIGYGYEPFFVEGSDPHQMHQAMAATFEQVFDRIRAIQAEARTGMPGNF
FT                   CPRWPMIVFRSPKGWTGPKEVDGKKVEGFWRAHQVPVSNCRKDANHRQILEDWMRSYDP
FT                   QDLFDTDGRLKEELRALAPTAKRRMGANPHANGGLLRRELIVPNIRAYAVAVKERGRTM
FT                   AQSTEVLGHYLRDILTLNSDHTNFRIFGPDETESNRLGSVFEVTDRVWMEEIKPYDVSL
FT                   APDGRVMEVLSEHLCQGWLEGYLLTGRHGLFSCYEAFIHIIDSMFNQHAKWLKVSRELP
FT                   WRKPISSLNYLLTSHVWRQDHNGFSHQDPGFIDLVANKRADTVRIYLPPDANTLLWTGD
FT                   HCLKTYDRINVIVAGKQPEPQWLSMDEAIKHCEAGIGIWEWAGNEQGAVEPDVVMACAG
FT                   DVPTMEMLAAVDLLRQNIPELSIRVVNVVDLMALQSKEQHPHGLADAVFDKLFTPDRPV
FT                   IFAYHGYPYLIHRLTYRRTNHGNIHVRGFIEEGTTTTPFDMTVLNELDRYHLAIEAIER
FT                   VPGLREKAMNVIKLFRDKLEEHGRYIRQYGEDMPEISNWKWPYDSNGYRLS"
FT   gene            complement(493454..494638)
FT                   /gene="ackA"
FT                   /locus_tag="Arad_7571"
FT   CDS_pept        complement(493454..494638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ackA"
FT                   /locus_tag="Arad_7571"
FT                   /product="acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7571"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29039"
FT                   /db_xref="GOA:B9JNA8"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNA8"
FT                   /protein_id="ACM29039.1"
FT                   /translation="MTDANLLLTFNTGSSTIKIGLFQCNANEARRIGKGLIDFGRRPLS
FT                   FHLTEGPAVFDTSLHAEDGVDLRNVISETFEVLGRHFDMDAVRAAGHRVVHGGDRFAGP
FT                   VRLDEASISDIDGLTALAPLHQPQALRLIRAVQHLRPTLAQTASFDTAFHATQSDLVRR
FT                   FALPRALHDHGIKRYGFHGLSYAFIAAELGRRAPKIAAGKVIVAHLGSGASLCALDGGK
FT                   SRDCSMGFSTLDGIPMATRCGALDPGVVLHLLGPKGRTLRNIEDMFYHRSGLLGVSGIS
FT                   GDTRDLLKDERVAAREAIDLFTLRVAGEIGRMTATLGGLDGIVFTAGIGEHQPEIRAAI
FT                   CDRLRWMGLALDSEANAANATIVSTSASSVAAFVIATDEEQVIANEAFSVLAAE"
FT   gene            494913..495746
FT                   /locus_tag="Arad_7572"
FT   CDS_pept        494913..495746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7572"
FT                   /product="universal stress UspA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7572"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29040"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNA9"
FT                   /protein_id="ACM29040.1"
FT                   /translation="MQVKTILSVIGVDQNDDDLRSAIELCSAVEAHLSVLITVLAIPPI
FT                   GGNGEVVSTVWVEEREREMEVLDRKVVSAKTLLQSSGISFDVDSLFTESGWADNEIGER
FT                   ARYVDLTLIGGGLLAKDDMRWPILNGALFQSPSPIFVVPKGYSASLRPSTVLVAWDSRN
FT                   EASQAVRAAMEQLTGAVNVCVAIVDPYASIRSNGEEPGADVAAFLARHGVRVSVDVLAS
FT                   GGRSVADVLRQHATDIGAELIVMGAYGHSRMREWIFGGVTRSMLETTPIPLLMTR"
FT   gene            complement(496280..497005)
FT                   /locus_tag="Arad_7575"
FT   CDS_pept        complement(496280..497005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7575"
FT                   /product="two-component response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7575"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29041"
FT                   /db_xref="GOA:B9JNB0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNB0"
FT                   /protein_id="ACM29041.1"
FT                   /translation="MAPDQQRREHVLVVDDDPRIRQMLTRYFEDEGYAVSTASNGLEMR
FT                   ACLQQENFDAILLDWVLPGGKDGLDLAREIRAQSDVPIIMLTGRDDVVDRIVGIEVGAD
FT                   DYIAKPFHLREVHARLKSILRRRQPAIRSPDKNPDDVIRFEGWQLDTGKRQLLAAEGHE
FT                   IELTTGEFDILVVFARHAGRVLSRELLMDLTRGRNLEAFDRTIDAQIARLRKKIETDPA
FT                   RPQLIKSIRGVGYVFTGKV"
FT   gene            497149..497907
FT                   /gene="fixKf"
FT                   /locus_tag="Arad_7576"
FT   CDS_pept        497149..497907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixKf"
FT                   /locus_tag="Arad_7576"
FT                   /product="nitrogen fixation transcriptional regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7576"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29042"
FT                   /db_xref="GOA:B9JNB1"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNB1"
FT                   /protein_id="ACM29042.1"
FT                   /translation="MLSANHAVQAQNYNEIAVVCGADPICLQSLFRKLPVEQLETGRSL
FT                   FFEGDPAKHLFELVEGVLRIVKIMADGRRVITGFLFPGDLVGVSLRNRYLYSAEAVTPA
FT                   KLRRFSRKTFEDIVSGSPELRPQLFARLCDEMAAAQDQMVLLSCKNAEERLCSFLLQQL
FT                   RRKQEQDRSASVVDLPMTRLDIADYLGLTIETISRTVTKLTNRGIINPVGRHSIHIAKP
FT                   GMLAHLAGDGEECHDGNSSVVVFDSARRRH"
FT   gene            497971..499848
FT                   /gene="fixL"
FT                   /locus_tag="Arad_7578"
FT   CDS_pept        497971..499848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixL"
FT                   /locus_tag="Arad_7578"
FT                   /product="two-component sensor histidine kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7578"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29043"
FT                   /db_xref="GOA:B9JNB2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNB2"
FT                   /protein_id="ACM29043.1"
FT                   /translation="MDEIAEVLDSANIIVHGFDGVISRWTTGCERLYGWSRQEAIGQVV
FT                   HELLATVFPEPLDKIRDKIARQVDWQGELIHHGRDGKPIVVASRWVVASSVDPARPVIV
FT                   QTNTDISDLKRIQADLAEREAHLRSILATVPESMVVIDEGGTIASFSSAAEKLFGYSAE
FT                   EVYGKNVRMLMPSPDREAHDGYLSHYLTTGERRIIGYGRVVSGQRKDGTVFPMELSVGE
FT                   AIANGKRIFTGFVRDLTSRHKIEEELRQSQKMEAVGQLTGGLAHDFNNLLTVISGNLEM
FT                   IEARLQDPKLLSLVLEAQAAADDGAKLTGQLLAFGRRQPLNPKLVDIGQLVSSFSDLLR
FT                   RTLGETIELRTVVTGSMNEALVDGSQLQNALLNLVLNARDAMPRGGFLSIEISPVRLDA
FT                   DYAQMYPQVRTGEYVLISVTDTGVGMSSETQEHAFEPFFTTKGMGAGTGLGLSMVYGFA
FT                   KRSGGHVQLYSEIGQGTSIRIFLPALKARAAKEPPRAAEDKKLQIPKGFERILVVEDDA
FT                   RVRRVAVSRLLDAGYSVIEATNGAEALAAFQENPDIALLFTDVVMPGGMAGDELAHKVR
FT                   ALRPEIKVLFTSGYAEPTIAGRELAEAGSWLKKPYTARELAIRLRELLD"
FT   gene            complement(499944..500057)
FT                   /locus_tag="Arad_7579"
FT   CDS_pept        complement(499944..500057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7579"
FT                   /product="cyd operon protein YbgT"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7579"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29044"
FT                   /db_xref="InterPro:IPR011724"
FT                   /db_xref="InterPro:IPR012994"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNB3"
FT                   /protein_id="ACM29044.1"
FT                   /translation="MWYFAWLLGFPLAAAFAVLNAMWYELVDDNAKKNKRG"
FT   gene            complement(500080..501234)
FT                   /locus_tag="Arad_7580"
FT   CDS_pept        complement(500080..501234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7580"
FT                   /product="Cytochrome bd-type quinal oxidase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7580"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29045"
FT                   /db_xref="GOA:B9JNB4"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNB4"
FT                   /protein_id="ACM29045.1"
FT                   /translation="MILHELIDYETLRIIWWLLLGVLLIGFAVTGGFDLGVGTLLPFVS
FT                   KTDTERRIAINSIGPTWEGNQVWLLLGGGAIFAAWPPLYAVSFSGFYLAMFAILFALIL
FT                   RPVAFKYRSKHESARWKAGWDCALFIGGFVPALIFGVAVGNVLQGVPFRFADDMRIYYE
FT                   GSFFGLLNPYALLCGLLSVAMLTMHGAAWLQLKTSGNVAERARRYGSLAALATVVLFAL
FT                   GGLALWYGVDGYRITSQINSIGPSNPLLKTVDHSAGAWFANYGSHPWMMAAPIFGFIGA
FT                   VATLLSMLARRELAPLLFSKLAIFGIISTVGVSMFPFILPSSLDPRSSLTVWDASSSHM
FT                   TLFVMLVAVLIFLPIILLYTTWVYRVLWGKVDAQTVNDKNGHAY"
FT   gene            complement(501240..502841)
FT                   /locus_tag="Arad_7581"
FT   CDS_pept        complement(501240..502841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7581"
FT                   /product="cytochrome d oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7581"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29046"
FT                   /db_xref="GOA:B9JNB5"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNB5"
FT                   /protein_id="ACM29046.1"
FT                   /translation="MELDIVALSRLQFAMTALYHFLFVPLTLGLSVLLAIMETTYVMTG
FT                   RQIWRQMTKFWGTLFGINFVLGVATGIVMEFQFGMNWSYYSYYVGDIFGAPLAIEGLMA
FT                   FFLEATFVGLFFFGWEKLSKVGHLVATWAVALGSNFSALWILIANGWMQNPVGSALNPQ
FT                   TMRMEITSFYDVVFNPVAQAKFVHTVSAGYVCASIFVLGVSAWYMLKGRHIEIAKRSMT
FT                   VAASFGLASALSVVVLGDESGYLSTEHQKMKLAAIEAMWETEPAPAAFTAFGFPDQQAR
FT                   ETHYAVHIPWAMGLIGTRSLTTEIPGINQLEKQAETRIRDGIKAYDALMKIRAAQSTAA
FT                   SAATQDPAAEQARSSFEDIGHELGYALLLKRYVDDPRQATEAQIAQAARDTIPHVPTLF
FT                   WSFRIMVGLGMFFILLTAIFFWLSARRQLDRYPLLLRIAVFAIPLPWVAIEFGWIVAEF
FT                   GRQPWVIEGVLPTAAAVSNLGAGSVLITLLGFAAIYTALIVIEMSLMVKGIRKGPEPDD
FT                   EPEADLISETLIPAAE"
FT   gene            complement(502923..504611)
FT                   /locus_tag="Arad_7582"
FT   CDS_pept        complement(502923..504611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7582"
FT                   /product="ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydC"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7582"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29047"
FT                   /db_xref="GOA:B9JNB6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNB6"
FT                   /protein_id="ACM29047.1"
FT                   /translation="MTSTFSALYPICRFFLAGRKRALLLGALLSALTVLAGIALLGLSG
FT                   WFITAASLAGLTATAITFDVFAPSAGIRLLAILRTGARYGERLTTHDATLGLLAALREN
FT                   LFRGWAAPGAATILMHRPAKLLFRLTADIDALDSLYLRVLVPATVAIVSGLAVSIALML
FT                   LSVPFGLLAGLWLIAAGLGIPALAGRLALKPARRRAHAIEALRSRAVDLIAGQMELVMA
FT                   NRLQAQCTAIAAADHRLSKADDILNRIESGVTVGFGLASAALLSGTLLTVTSLAERGII
FT                   GAPVAACGLLMALAALEPFAVLRRGALELGRTMLAARRLSPRLVQVSHSPAHQMPPDGL
FT                   AVRLSSVSARYEGAAVASLEDISLSLALGEHLAVIGPSGAGKSTLFAILASELAAESGT
FT                   VETVMASTLTQRTELFQDSLRDNLRLAASEANDDMLYSALADAGLLADVQALPKGIDTR
FT                   LGEGGLGLSGGQSRRLALARLFLRGTKLWLLDEPTEGLDRETGRDVMRRLASRSRGRSL
FT                   VIATHIRREAEIADRIVVLDKGHIVVTARRGETEFDTALARLRQD"
FT   gene            complement(504608..506374)
FT                   /gene="cydD"
FT                   /locus_tag="Arad_7583"
FT   CDS_pept        complement(504608..506374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydD"
FT                   /locus_tag="Arad_7583"
FT                   /product="ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydD"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7583"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29048"
FT                   /db_xref="GOA:B9JNB7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014216"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNB7"
FT                   /protein_id="ACM29048.1"
FT                   /translation="MTSPFFDTAAIPENGQEPDIGIASTSTLSDSTKDSSRKVMPAKLA
FT                   RAALVQTLAALLWIPQAALLALGVGALADGRGVAETVVPALLVFLLGALRAGLDAIGGR
FT                   LAFRAARVELTRRREIAVTALAARSPLDSNRPASGFAASLIAEQAETIVPYLARFRPAR
FT                   LKASTVPLTILVCVAPVSWVAALILLFTAPLIPVFMALIGWRAKEASEKQLAETGGLNA
FT                   FLLDRLRGLATIRALGAVDLTALRLRADAEQLKIRTMAVLRIAFLSSAVLELFAALGVA
FT                   AIAVYVGFNLLGAIDVGTWSGKLSLTPGLFILLLAPSFFEPLRELSAVWHDRAAGEAAL
FT                   DALNALSSTGVMLPGWRDEKAAETSRDRTLPSINISRLRFRHQPERMPVFDDFSLAIAA
FT                   GEHVALLGESGAGKTTMLSLIAGLAPSESGTIHIGGRRLDDISAAKLRRRMAWIGQRPH
FT                   IFAGTMNSNITLGRPEVSPHTVQQAIDLACLRRVATQRGTASIGESGAGLSGGEALRLA
FT                   IARAAATPHIDIILADEPTAHLDTETARDITDALLAVARGRTLVVATHDPVLAARMGRV
FT                   IHIDASVREKAA"
FT   gene            complement(506371..507048)
FT                   /locus_tag="Arad_7584"
FT   CDS_pept        complement(506371..507048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7584"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7584"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29049"
FT                   /db_xref="GOA:B9JNB8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR026282"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNB8"
FT                   /protein_id="ACM29049.1"
FT                   /translation="MGDIAIAKVLNWNTVISEISEITVSTEIAMNLPPLVQSFVLHFGE
FT                   MGSRWGINRTVGQIYALLYVSPQPLCAEEIVDALGISRSNVSMSLRELQAWNLVLLKHR
FT                   PDDRRDFFTTPDDVWQILRTLAEERKKREVDPTLTVLREILMQHPASDDERYAQGRMSE
FT                   MHGLIEQLTNWYDEVRLLETDRLATLLSLGAKVTKLLEAKDRVVSLGRRRTNTSPIDKR
FT                   QGQ"
FT   gene            complement(507301..508038)
FT                   /locus_tag="Arad_7586"
FT   CDS_pept        complement(507301..508038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7586"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7586"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29050"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR017080"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNB9"
FT                   /protein_id="ACM29050.1"
FT                   /translation="MLIQAVMNAPAITVSPETSVVDAARIMLDRRVSGLPVVDASGNLV
FT                   GIVSEGDFLRRGELHTERNRFWLLDFLSSPGKLADEYVLSHGRSIEEVMTSEVVTIAPN
FT                   APLIEAVDLMEKHGIKRLPVVVKGKVIGIVCRSDLLQALAKMLPKQTVHVSDETIAEAV
FT                   IAELSQQSWSQNGYIKVKVLNGVVELSGSIFDERERLAAKVAAENVPGVKSVTDQITWI
FT                   DPYLGVAMPAPGALVQPELSLRV"
FT   gene            complement(508287..509603)
FT                   /locus_tag="Arad_7587"
FT   CDS_pept        complement(508287..509603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7587"
FT                   /product="manganese transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7587"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29051"
FT                   /db_xref="GOA:B9JNC0"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNC0"
FT                   /protein_id="ACM29051.1"
FT                   /translation="MTQELIADEHHSWRSRLLGRLARLREHPLASVGPGLITGVADDDP
FT                   SGIATYSQAGAQFGLNMLWTMPVSFPMMAVVQSTCARIGRVTGRGLAANIKETFPPLVL
FT                   YAVVFSLLIANILNIAADVAAMGEVAELVTGVNRHLMTMFFVFGTLALQVFIPYHRYVA
FT                   FLKWLTISLLAYAAVLFTVHIDWQQVALRTIWPAITPTPAYAAVVVGVFGTTISPYLFF
FT                   WQASEEVEDMNANPNATPLSTDSAAAPKELRRIGWDTWSGMLYSNLTAFFIILATAVTL
FT                   NVAGITHIDTAAQAASALRPLAGPFAALIFALGILGVGLIGVPVLAGSAGYAFAEAMGW
FT                   KFGLERAPNDARGFYTVIAISVLLALVIQYSPITPMNALFWSAVFNGLLAVPLLIVILL
FT                   LAANSKVMGAYTMGKTAACVGWTTVALMAVAAMMMSIPS"
FT   gene            complement(509600..510304)
FT                   /locus_tag="Arad_7588"
FT   CDS_pept        complement(509600..510304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7588"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7588"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29052"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR017080"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNC1"
FT                   /protein_id="ACM29052.1"
FT                   /translation="MQAKDIMTKNVIAIIPALNVRNAALLMRAKNISGLPVIGDDGEVC
FT                   GILTEGDLMRRVGDNWVSSVNDAREHDGRHGLNTFVQIHSWSVGEAMNRNVISVPPDTD
FT                   VGRIGTLMLAHRIKRVPVINDHRLVGIVSRRDLLNPIIDAPGQNIESEDDTIRLAVTAR
FT                   LATDLGFGNDQVEVTVKDRQVQVQGKLDSNIQRLAIRILVEGIQGVGGYIDQTTLLPSN
FT                   VISFSTTSNGAR"
FT   gene            complement(510425..510736)
FT                   /locus_tag="Arad_7589"
FT   CDS_pept        complement(510425..510736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7589"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29053"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNC2"
FT                   /protein_id="ACM29053.1"
FT                   /translation="MLRARRDSLGGAASKAIPSLGEVEGRMMVLELIALTALTRLMRLH
FT                   DVGARADLMKAMRHAIDRKCHDARLCGTDTQSAETYAEELLACAQEQSIDLEEARKHA"
FT   gene            complement(510865..512799)
FT                   /gene="actP"
FT                   /locus_tag="Arad_7590"
FT   CDS_pept        complement(510865..512799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="actP"
FT                   /locus_tag="Arad_7590"
FT                   /product="copper-transporting ATPase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7590"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29054"
FT                   /db_xref="GOA:B9JNC3"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNC3"
FT                   /protein_id="ACM29054.1"
FT                   /translation="MIFASVTSTVVSLLKTDGSSLVLIASSGLLAGLTFAVIDSVALAS
FT                   FVWALATLPILSALLLQTFRSLRRGDLGLDIVAALSMAFALSYGESLAANVVALMYAGG
FT                   QMLEGYASGRAAREMTMLMGRMARTAFRYVGDRLELTPIEKIVAGDHIMIRQGEVLPVD
FT                   GILLSARAILDESALTGEPLPVDRRAGEEVLSGSASIGPVFTVKALRPASESTYAAVVR
FT                   LVETAQKSKAPMARLADRYGLVFLLMTVVIASTAWLLSDDPRRALAVLVIATPCPLILA
FT                   VPVALMSGISRCASIGCLVKDGSALEALSRVRVAILDKTGTLTHGKAQVVAVGCGDWVN
FT                   KDELLRLAASLDQASSHVMAAALIAAAHERNLLLSPPTNVEEVGGTGLEGMVDGRRVVI
FT                   GGSRFVKSRSAPGASHAFEDHHRSGEAAVAVAIDGVVAGNIIMADPVRAEAISVLQRLR
FT                   SAGIAKIVLASGDRLDVASHVGNILGIEQVLGEQTPASKVEAVIAAKSFGPVMMVGDGV
FT                   NDAPALAAADVGVALGARGAAASSEAAGVVLLVDRLDPLASALVVARRTVAIARQSVVA
FT                   GLGLSVAGMIAAAFGYLPPLQGALLQEVIDVAVILNALRALGPSKSEDDPYKQFANIAT
FT                   RPASKAQLS"
FT   gene            complement(512873..513013)
FT                   /locus_tag="Arad_7591"
FT   CDS_pept        complement(512873..513013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7591"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7591"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29055"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNC4"
FT                   /protein_id="ACM29055.1"
FT                   /translation="MIEIKEWNRPSRLTEAHGSIMGLSFASGLPTLKIETDQCPLRWDR
FT                   L"
FT   gene            513521..513967
FT                   /locus_tag="Arad_7592"
FT   CDS_pept        513521..513967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7592"
FT                   /product="universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7592"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29056"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNC5"
FT                   /protein_id="ACM29056.1"
FT                   /translation="MYKTIVCAVGLGSRERAEHLVRTAYALLNTGGILHVAHTVERFPS
FT                   LVQQRPDDWAVSIISEAEEKMSQLCKQLSVPALVHVHVHVHVRTGRAADTILAIAAEMS
FT                   ADLIVVAAHTPDVLDHVFGSTVDHIVHHAKCSVHIDRILPAAKQ"
FT   gene            complement(514522..514698)
FT                   /locus_tag="Arad_7594"
FT   CDS_pept        complement(514522..514698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7594"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7594"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29057"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNC6"
FT                   /protein_id="ACM29057.1"
FT                   /translation="MIVPVVQSKLLDRMILYTAIPRSMKTVVLVGDIDLINEIVAAIPK
FT                   SLDREQNLRFNGI"
FT   gene            515067..515321
FT                   /locus_tag="Arad_7597"
FT   CDS_pept        515067..515321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7597"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7597"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29058"
FT                   /db_xref="GOA:B9JNC7"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR022789"
FT                   /db_xref="InterPro:IPR038296"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNC7"
FT                   /protein_id="ACM29058.1"
FT                   /translation="MATMNVSLPDPMKDWVEAQAKTGRYSNASDYVRDLIRRDQVRSDK
FT                   IAAMQRFVDDGLKSGVGGRSKDELFATAIAHGEMTRGDR"
FT   gene            515321..515614
FT                   /locus_tag="Arad_7598"
FT   CDS_pept        515321..515614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7598"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7598"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29059"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNC8"
FT                   /protein_id="ACM29059.1"
FT                   /translation="MRFSLFVEAEEDIIAIAEQGVRLFGSAYAKRYHDELFSLLDLIAA
FT                   NPRMAREREEISPPVRIHPFKAHLVVYRIEEDGAIFVIRIRHGHEDWASDSV"
FT   gene            516012..517049
FT                   /locus_tag="Arad_7600"
FT   CDS_pept        516012..517049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7600"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7600"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29060"
FT                   /db_xref="InterPro:IPR039498"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNC9"
FT                   /protein_id="ACM29060.1"
FT                   /translation="MTGPANLIVDQLASCLLGNPSTVVDWEPVLTLANDSLLTPAMWSS
FT                   ISERGQLGLLPEEVASFLCFIHRCNVERNERLRAQLEEVVAAMNAAGITPTLTKGAALL
FT                   ALAKTERPTARIMRDLDLVVGDDERQTAEKCLVQLGYAPIEAFGWGRSKDVGAVDLHYP
FT                   PGRYPRYWPSDTTLAQHKREIDVGRGRAHILSATLQAQHWIVHDMLKDGHLWRFHIDLR
FT                   NLFELYLLSKSQDKIDWTEMDILLSDPLGRAMLNAQILALNAVFEANIAAARTIPSWLG
FT                   VHHHLRRNEYHPQVGGVIRSFGRIAWGIRVAQIHWRFRGPWHELPARIIRKGQKVIAAQ
FT                   VSQEI"
FT   gene            complement(517046..518149)
FT                   /gene="virB11d"
FT                   /locus_tag="Arad_7601"
FT   CDS_pept        complement(517046..518149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB11d"
FT                   /locus_tag="Arad_7601"
FT                   /product="transport secretion system IV"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7601"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29061"
FT                   /db_xref="UniProtKB/TrEMBL:B9JND0"
FT                   /protein_id="ACM29061.1"
FT                   /translation="MIDPPMNIMLLPGRRISITQLGDAFALFNSREQHLYEIDKLAAWA
FT                   WQRVFNSTAGMSRRHLLTKFSSEFGLTSEDAGNLLDRYIELGILDTCASSTSVFALHLN
FT                   GTRWLIECPKVLSGELKELFRGLVVPLKSQWGHHYLTIKVNSYRYELMADGEYRGIFAQ
FT                   AEIVPAVKAFLTDALLQTDFMLALHAALLRFGDSQLLIAGASGAGKTTLALALAAEEEC
FT                   AILGDDIVIIDETNRLRGIPFPVAVKDGSWLLLQDFCPQIASLPVHIRPDGKIVKFLPG
FT                   EVESDDNWSMKTRTIIFIRQNPGRQCSLSRIHPLAAFQRLLAEAAAPGHRLTDAAFGAL
FT                   RELVNTSQAFEMEFSRLDDAVETIREL"
FT   gene            complement(518146..518370)
FT                   /locus_tag="Arad_7602"
FT   CDS_pept        complement(518146..518370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7602"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7602"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29062"
FT                   /db_xref="UniProtKB/TrEMBL:B9JND1"
FT                   /protein_id="ACM29062.1"
FT                   /translation="MDREDQREKVGPSRREFVEGCGKYAALAPPVLTFLLSTTMTSGAI
FT                   AKSGNGNNGFGNGGGDGVPGHSGKEDVNR"
FT   gene            518953..519174
FT                   /locus_tag="Arad_7603"
FT   CDS_pept        518953..519174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7603"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7603"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29063"
FT                   /db_xref="UniProtKB/TrEMBL:B9JND2"
FT                   /protein_id="ACM29063.1"
FT                   /translation="MVSTRSTIQISKPQHSANDAYRAVEREEVLAVAFRDFVHATLVAG
FT                   WKEPEVALTLADIADDYVMALAGRVTEI"
FT   gene            519364..519828
FT                   /locus_tag="Arad_7604"
FT   CDS_pept        519364..519828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7604"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7604"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29064"
FT                   /db_xref="InterPro:IPR009725"
FT                   /db_xref="InterPro:IPR028973"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:B9JND3"
FT                   /protein_id="ACM29064.1"
FT                   /translation="MKIRQHLWFRRDMESAIELYTSLIPGSSIGWISNIPADNPNGPAG
FT                   CVKVAGITLCNHSYMAFEAGPLAPFDHDSSITVLCETQAEIESLYDTLKEGASTEQGGI
FT                   LQDRWGLRWKILPRQLGDRVPAPAKTEHVGEDQLHKAKFDIAGLEATAKG"
FT   gene            complement(519857..520195)
FT                   /locus_tag="Arad_7605"
FT   CDS_pept        complement(519857..520195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7605"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7605"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29065"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B9JND4"
FT                   /protein_id="ACM29065.1"
FT                   /translation="MEIREEAFRVWSEGTAVYFDGTMRLAGPDAYAPIYNLAMKALEDK
FT                   SGKAVFDLTGLQFLNSSGINLLAKLTIEARKHPHLHLTVRGSSQVPWQMKSLPNLKKLH
FT                   PSLDLRLT"
FT   gene            complement(520773..523097)
FT                   /locus_tag="Arad_7607"
FT   CDS_pept        complement(520773..523097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7607"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7607"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29066"
FT                   /db_xref="GOA:B9JND5"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B9JND5"
FT                   /protein_id="ACM29066.1"
FT                   /translation="MRSFRAKFLIVVGGAVLFDLLVSGGLALWNVQRLSRNATAEVGEG
FT                   LEKASQDYIRSYTNSTASQVALLLDQVHSDVKALTGVLQGQIDQPTRNNDIGAAMAKAS
FT                   PGAVTVTYDTTGQWAQNLPGSPSVVSVWGYLLDKDHHPLPQVQADIDTSAVLDLVAPSL
FT                   LNNGASKLQMYYIGPKERPLFRTAPYTAQAQTFDRLYPGHNSADFWNFFFPGLYESWQQ
FT                   WALNPTSRPVADDITQTAPYTDAITGKQIVSFFHPLWTADRHNVAGAAGADITLNQLAE
FT                   IVENVKVAQSGFGFLTMSNGNVVAINPVGEKIIGLRSASDLANKGVTGLDRSLRNSTQK
FT                   AISTLPLDADGAIQHISLNEQGEDVPYLVVVKQLRPTNLWVNGPVQREVMSLGIVVPER
FT                   EIYASLIAAKDQISRATNRILLYQILAVLVSLMIVTAAVFAASKRITSGISALADAAKR
FT                   IQAKDYSVRVDIPTKDEVAEAGFAFNRMAEEISFHTENLEKLVVERTTEIEAAKEEISV
FT                   LNGQLKSENSRLGAELDVARQIQLMVLPRAKELMAIEHLEIAAYMRPADEVGGDYYDVL
FT                   QNGNNLKIGIGDVTGHGLESGVLMLMVQSIARALQETGEMTPAKFLTDLNRAIFKNIER
FT                   TETDKHLTLSFLDYDGERLTVSGQHEDMIVVRRNGELERIDTGDLGLPVGLEPDISPFI
FT                   ETREISFQKGDMIVLHTDGVTEAENPSGELFGFERLCEDARRLHGGTSEEVLKGILDHL
FT                   MGYISTQKIHDDITLVVMKHR"
FT   gene            complement(523130..524233)
FT                   /locus_tag="Arad_7608"
FT   CDS_pept        complement(523130..524233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7608"
FT                   /product="menaquinone biosynthesis methyltransferase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7608"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29067"
FT                   /db_xref="GOA:B9JND6"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B9JND6"
FT                   /protein_id="ACM29067.1"
FT                   /translation="MLRPHSVAELADDLALLRNGIETVKGVFYINLKRVTHMNNTAFRA
FT                   LTHVLVDASRSRPELKLVVIASSVVAWASRLFHHLSDLSPNIAVEIYDSAFYPGQTFVE
FT                   NQSFIPILRTQTKMTWRHEREILPRHGLREGMIIADICCGIGDFAMLLRKEFRPSRIVA
FT                   LDHSMLSLDYARTVAEDFDVQDIEYTYGDASQMLFESNQFDFVTCRHSLQIFDRPDVLL
FT                   RELYRICKPGGRVYITNEKNSHCLGEPRADTIQWTYNEVAKLFEYFDMDVEMGPKGRRM
FT                   LLDAGFTAVKLESFMVTNLDGDPQEFADIIAAWQNVYADEMAVKRGDSPAFIKRFKQGF
FT                   ADHIFAALHPRGYAGWPIWAASGQKPL"
FT   gene            complement(524302..524817)
FT                   /locus_tag="Arad_7609"
FT   CDS_pept        complement(524302..524817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7609"
FT                   /product="Conserved Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7609"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29068"
FT                   /db_xref="UniProtKB/TrEMBL:B9JND7"
FT                   /protein_id="ACM29068.1"
FT                   /translation="MNIKETPTDIGFEPLLDLKMNMAAFTADWLHCDQCSNYVARMVSH
FT                   DRRDPIRHANLLSSALNELLEMSFHSNEYDGEFVYRFYRYRETERIELTFPCSPQKRRF
FT                   YHEIVQELQGEQALASYLDVIANDAAPADRAILFGLAVNYDADIKARDLGTSALTFIVD
FT                   LPLERLLN"
FT   gene            complement(524853..526556)
FT                   /locus_tag="Arad_7610"
FT   CDS_pept        complement(524853..526556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7610"
FT                   /product="kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7610"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29069"
FT                   /db_xref="GOA:B9JND8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B9JND8"
FT                   /protein_id="ACM29069.1"
FT                   /translation="MPENRANWPLLVPQKSEFDDRPEALFSLWGLDFKLIDCSEELKDR
FT                   AGTASLTAMTLWEIYPSLANPAFADLVQFVVDTGHSRRVRLNPSMSAGQDLLLFHTRDG
FT                   LAVIEIDSSGTNRATLPEDQERARLLHQATHDVLTGLPNRRQFSQELDRLLPTGDEAGL
FT                   ALMQIDLDDFKPVNDTMGHGAGDIVLRLAAERISRTLAHDEVAYRLAGDEFAIIQVAAQ
FT                   QPMEAERLAEALVAEFKKPFVVDGISLFVGASIGVAIAPRDGNEGEQLMKAADVALYAA
FT                   KKDGRRRARTFDPGMLVVLEQRELLRRSLRVALQRDEFFLEYQPLVEPPFTVVGFEALL
FT                   RWRHPSLGIIPPIAFIPMAEADGLMSEIGEWILEQACREALTWPVHYTVAVNLSPAEFL
FT                   TPGFTDRVAQTLDVVGFPSERLELEITESVLLERTINNLDTLNTLNVLGIQISLDDFGT
FT                   EYSSLSYLKNFPFDNIKIDKYFIKDLLRDGKSQTIVRSVIALAHGLDMRVTAEGVETAQ
FT                   QATWLQSEGCDRLQGYFLSPPMGADRLADFIAQRSRTHPTVSFDGVRVGP"
FT   gene            526861..527082
FT                   /locus_tag="Arad_7611"
FT   CDS_pept        526861..527082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7611"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7611"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29070"
FT                   /db_xref="UniProtKB/TrEMBL:B9JND9"
FT                   /protein_id="ACM29070.1"
FT                   /translation="MKVGGRQPVAALASARKGKHFVQEGLAFADVAGFRRDHMRLAKLV
FT                   FLGLCEVGPPRTPKPIWAAYLVQRVSVF"
FT   gene            527319..528449
FT                   /locus_tag="Arad_7612"
FT   CDS_pept        527319..528449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7612"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7612"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29071"
FT                   /db_xref="GOA:B9JNE0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNE0"
FT                   /protein_id="ACM29071.1"
FT                   /translation="MRSEETAPPHGERRRFPRQAAATEEGQPASSALKPLLFSTRDLAP
FT                   IDQFAAWQAYVAPLMDIQRPDVSSQDTEFVADHASWNLGGMLVVQQNAPPHSYMRSQAK
FT                   VRSDLIDHWHVSILRNGHMWTEVDGHVSEGEPGNVELRSLGHPFRGRSTQSRSLSLYLP
FT                   RELFFDIPGSTEIKNNTALSGTYTKLLIEYLDSLEENLSRFAAKDLPHVVQTTRDMILT
FT                   CVSSSAVDATVSEQHSNWALMERMRRLVQRNLMSPDLTTEWLCRELGVSRTRLYQLLEP
FT                   DGGIHHYIQRRRLLSAHAALSDITNRQQIGDIAFAVGFSSAAHFSRAFSKEFGYSPREA
FT                   RNLTVPPYLGHVAAPTSEIEDDHSFDKWLRMLGHSR"
FT   gene            529015..530028
FT                   /locus_tag="Arad_7613"
FT   CDS_pept        529015..530028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7613"
FT                   /product="dTDP-glucose 4"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7613"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29072"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNE1"
FT                   /protein_id="ACM29072.1"
FT                   /translation="MSMTFRSSHLSLMHTARRVILVAGGAGFLGSHLCERLLLEGHEVI
FT                   CVDDFSTGRMENMRHLLRFDTFSFIRHDIIGSIDLPVDEIYNLACPASPQHYQADPIHT
FT                   LKTCVFGSLNLLELAAHHQARIFQASTSEIYGDPQVHPQPEGYWGHVNSFGPRSCYDEG
FT                   KRSAETLFYDFHKKYGVDIRIARIFNTYGPRMRPDDGRVVSNFIVQALKGQDITIYGDG
FT                   SQTRSFCYVDDLIEGFTRLMRSQPAIHTPVNLGNPTEFSIRNLAEQVVAMTGSPSKIVY
FT                   QPLPVDDPRQRRPDITVAKRELKWEPSVALADGLKSTVSYFERQLVRPNGELVEVA"
FT   gene            530028..531014
FT                   /gene="galE"
FT                   /locus_tag="Arad_7614"
FT   CDS_pept        530028..531014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="Arad_7614"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7614"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29073"
FT                   /db_xref="GOA:B9JNE2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNE2"
FT                   /protein_id="ACM29073.1"
FT                   /translation="MSMRNILVVGGAGFIGSHTAKLLRKQGYEPIVYDNLSTGHEESVR
FT                   WGPLEKGDILDTQRLVEVLTKYSPDAVIHFAASAYVGESVEDPAKYYANNVNGTHSLLE
FT                   ACRRSGTDKLIFSSSCAIYGIPDHLPIREHQIPQPINPYGRTKLIAEHMLADYSAAYGL
FT                   HYAALRYFNASGADPEQELGEWHDPETHLIPRALLAASGSIDFLQVYGDDYDTPDGTCI
FT                   RDYIHVMDLARAHILAVEYLMRGGANLAVNLGTGHGTSIKEILTAIRRISRCPVPVEMR
FT                   ARRAGDPPALYAASGLAAEKLGFQPLYSNIETIIRTAAPFFGLEVHE"
FT   gene            531011..532846
FT                   /locus_tag="Arad_7615"
FT   CDS_pept        531011..532846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7615"
FT                   /product="cellulose synthase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7615"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29074"
FT                   /db_xref="GOA:B9JNE3"
FT                   /db_xref="InterPro:IPR025993"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNE3"
FT                   /protein_id="ACM29074.1"
FT                   /translation="MSVREIQAQAIRDEPLMVPVLAGYRRAEYLAGTALWLAAVVYFWR
FT                   WWFVPAHHVYLVGSILVTSVLAWVTIIPVYFIVVFYRARKPGGRLRLPAGGRVAMVVTK
FT                   APSEPFEIVAKTLSAMLAQKVPHDTWLADEDPSPATLDWCHKQGVHVSTRKGREDYHRQ
FT                   TWPRRTRCKEGNLAFFYDHYGYARYDFVAQLDADHVPEPDYLYQMLRPFADPAVGYVSA
FT                   PSICDHNAHESWSARGRLYAEASMHGSLQAGFNGGLAPLCIGSHYAVRTAALKDIGGLG
FT                   PELAEDHSTTLMMNAHGWRGVHALDAIAHGDGPRTFTDLITQEFQWSRSLMMILLQYSP
FT                   KLVGHLPLRLKMQFLFSQLWYCLFSLFMALMFFLPVAALISGRIFVDVSYPDFLLHFVP
FT                   QSVLLILLAYRWRKTGTFRPIDAKILSWEMTLFLFARWPWALAGTLAAMRDWATGSFVD
FT                   FRVTPKGTSDVDPLPSRVLAPYILLSLISVLPVLFVANARDTGGFYIFATVNAAIYTLL
FT                   VLVIVLQHARENVVCMASRFYRPALAGSLLTLIVLPCVATIERGRSGIESLTWDTSGYT
FT                   LFEYRFSVAGAGIGGHDLHRIVFNPRWRTSGANTN"
FT   gene            532880..534301
FT                   /gene="rkpK"
FT                   /locus_tag="Arad_7616"
FT   CDS_pept        532880..534301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rkpK"
FT                   /locus_tag="Arad_7616"
FT                   /product="UDP-glucose 6-dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7616"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29075"
FT                   /db_xref="GOA:B9JNE4"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNE4"
FT                   /protein_id="ACM29075.1"
FT                   /translation="MKIAVIGTGYVGLVSGTCFAEWGNTVVCVDKNARKIADLQQGRMP
FT                   IYEPELDELVERNYASGRLDFTCNLAEAVDGAAVVFIAVGTPPRADHGDADLSFVYMAA
FT                   RELAPLIADNTVVVVKSTVPVGTGDVVQKIIGSVRKAGTFSVASNPEFLREGVAVSDFL
FT                   APDRVVIGVEDERASKRLIELYDGPIASQNTPVLITMRRTSELIKYAANAFLATKITFI
FT                   NELADLCEQVGSDVNELALGIGLDKRIGTSFLTAGPGYGGSCFPKDTLALLRTAQDHGV
FT                   ALRIVEETVSANEARKRRMALKVMEALGNDIDGLTIAIFGLTFKPDTDDMRDAPSVPLI
FT                   EALQRFGGCIRAYDPVGMENAAKILNDVEFCDDPYECARGAAAVVVITEWETIKKIDLA
FT                   QLKQNMRQPILIDLRNALNADAAEQLGFRVSSIGRSARTESDIQNTARRRNSTLRAVNI
FT                   TTAKAASVAVREEQK"
FT   gene            534298..534861
FT                   /locus_tag="Arad_7617"
FT   CDS_pept        534298..534861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7617"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7617"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29076"
FT                   /db_xref="InterPro:IPR009337"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNE5"
FT                   /protein_id="ACM29076.1"
FT                   /translation="MTPSNNKTTHLACATALAFATAFGLAASSNAAAAKVDVKLPTSAR
FT                   PMTAGELYVLYRDKTWQWSDGAGRMQDADRRFFAWIDGAGGQSWAEGRWTVTDTGRLCF
FT                   VAAWHATNGKFPAKTCFVHQISNGTIYQRHEPDGSWFVFRHAVAQKADEAEKLVADDLV
FT                   SQRLDVVKATLSAGKTEQKKETLQ"
FT   gene            534858..535805
FT                   /locus_tag="Arad_7618"
FT   CDS_pept        534858..535805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7618"
FT                   /product="cellulase H precursor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7618"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29077"
FT                   /db_xref="GOA:B9JNE6"
FT                   /db_xref="InterPro:IPR000805"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022790"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNE6"
FT                   /protein_id="ACM29077.1"
FT                   /translation="MKTISKLTAAMLCTAAICGAAYTASDVLEAKAENQSLFHDKRPII
FT                   TPQSLASGAYDPNGDFANDHNPKIEHLFLAWEDVDLATLSTADAYARTRGRALLITIEP
FT                   WSWARDWRVAPEDLLSGILAGRYDANMAAVCSAAAKLQSPVTIRWAQEMDEKNGQFTWA
FT                   YWKPEGYVKAYRHAITVCRQYLPSAKYMWSPMGKEGLEAYYPGDRYVDVVGLSVFGYQP
FT                   FDQKKIGRDSTFVEATKPGYDRVKAFGKPIVIAELGYQGNDAYNRAWAEEAAKPHAEFP
FT                   DMTAVVYFNDREVYPWPDGLGRPDWRVVASPLVN"
FT   gene            535839..536339
FT                   /locus_tag="Arad_7619"
FT   CDS_pept        535839..536339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7619"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7619"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29078"
FT                   /db_xref="InterPro:IPR009337"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNE7"
FT                   /protein_id="ACM29078.1"
FT                   /translation="MSSFRFVILNAALATLLLFGTASAATQQQADRVIARAASKAMPMS
FT                   AVEVRRLYVGRSWVWKNGAGFFSKNRNHFIAWSHTGAQKSYAKGRWYTSNRGKLCMNAL
FT                   WHSRKFATQNVSCFMHREKAGVIYQKRASGGKWYVFRHNPLKHDDEVRKLRRGDYVSKH
FT                   LPG"
FT   gene            537305..538435
FT                   /locus_tag="Arad_7620"
FT   CDS_pept        537305..538435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7620"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7620"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29079"
FT                   /db_xref="GOA:B9JNE8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNE8"
FT                   /protein_id="ACM29079.1"
FT                   /translation="MMWSKADVSSEQPTFVERRRWPRISQVPLCSGTQGVPQLVSLPFS
FT                   TRDLGSDQQFPAWQDRMAPLIDMRLPENAKVDDCFPVNQTVWNLEGVLLIQQATPAFSY
FT                   ERSAEKVRFSSVDHWQITFLRTGRTWTGVNGRVAENEPGMMEIRTLGYPFYGRTLSAES
FT                   VTLILPYDLFADRGGLPGASNNVVFSGARVKLLSDYVAFLEANLDRLTRDDLQGVRSQL
FT                   REMVYHCVAPLMDCHMVNDQTSQIGLMTRARRFIQNNLGSEDLTPETLSRELAISRTRL
FT                   YELFQTSGGVLNYIRKRRLLAARSAIADPANNRKIIDIASKFGFDSAANFSRAFTHEFG
FT                   YSPSEVRKHMGELRIEHPPHTEELPTFDSWLSTLGL"
FT   gene            538432..538935
FT                   /locus_tag="Arad_7621"
FT   CDS_pept        538432..538935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7621"
FT                   /product="insertion sequence transposase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7621"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29080"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNE9"
FT                   /protein_id="ACM29080.1"
FT                   /translation="MTTHGGDRLLVRAVRFELTNGLGSRVQIPSRALCHWHSIKSRRGV
FT                   GASANRAKMPQHGRQPQSHSAPFEVRLRWLHGGYRPFAAKNTVSLAFCWSHVCRRFYEL
FT                   AAARPAPIATEPLRRIAELYRSEDEIRGRTQDDRCAIRQDREYRVQTSKIMIDIATLNR
FT                   LVAG"
FT   gene            complement(538966..540189)
FT                   /gene="exoF2"
FT                   /locus_tag="Arad_7622"
FT   CDS_pept        complement(538966..540189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exoF2"
FT                   /locus_tag="Arad_7622"
FT                   /product="exopolysaccharide biosynthesis protein (OMA
FT                   family outer membrane saccharide export protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7622"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29081"
FT                   /db_xref="GOA:B9JNF0"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNF0"
FT                   /protein_id="ACM29081.1"
FT                   /translation="MKIISLSALSIVAALSLLPQKGFSDERDAYKLGPGDILQLSVFGV
FT                   ADFARRVTVNIDGNISVPFLGELHGEGLTIHDLRVALTDGLTKDGRIQSADVSVEIVEL
FT                   RPFYISGDVSRPGAVPYRPGLTVRHAIALAGGYDALRFRTENPLMTAPDLKSENESLWI
FT                   DLARQKARAISLRAELNRTPDIDLTSIYSAPLQRKTLDEIASFEESDLKMRLANYAKQR
FT                   TFLQISVKNAEGTIKALQDRQERNEESITLQQGAVDRMNISASKGLVMANRVDDERRSL
FT                   AEIRSQQGDTEARLVQAEHDRDELARNIEVQDEQHNTQLNDALRDTSIEIAKLAGRIRA
FT                   SSEKLLYTGAVKAQMRGGEGGPSLVIYRKNGEQTMQIAAQEDTPLRPDDVLEVTIRPEQ
FT                   MVMSPNSQ"
FT   gene            complement(540186..541052)
FT                   /gene="exsH"
FT                   /locus_tag="Arad_7623"
FT   CDS_pept        complement(540186..541052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exsH"
FT                   /locus_tag="Arad_7623"
FT                   /product="endo-1,3-1,4-beta-glycanase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7623"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29082"
FT                   /db_xref="GOA:B9JNF1"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNF1"
FT                   /protein_id="ACM29082.1"
FT                   /translation="MAFLAFLGSAQAAAVKQEPAQTSVAGWKTIFKDDFSTLDFRAGGK
FT                   GTWKPLYPWGARNNASNREMQYYVDPRPSGDNAAVQALAPFTIDNGILAIRASKIPESL
FT                   RIHTAGFEYASGMLTTAGRFSFTYGRVEIRARMPSGKGLWPAFWLLPADKTWPPEIDVF
FT                   EVLGQDTRRLHVTAHSSLHIPAGARSAQKGTELVTADLSDNFHVYGVTWTKDSLVWSLD
FT                   DQIIFSTPTPPDMHKPMYLLVNLAVGGSWPGSPDASTHLPANLLVDWIQVKQPEVDNAV
FT                   QEKGITQ"
FT   gene            complement(542491..543924)
FT                   /gene="exoQ"
FT                   /locus_tag="Arad_7624"
FT   CDS_pept        complement(542491..543924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exoQ"
FT                   /locus_tag="Arad_7624"
FT                   /product="exopolysaccharide production protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7624"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29083"
FT                   /db_xref="GOA:B9JNF2"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNF2"
FT                   /protein_id="ACM29083.1"
FT                   /translation="MTVPAHSSAVRWAEPGLVFAIPLAIGLTWLGLCFTMPQNPAAALA
FT                   PFGIIGAAGFALVLIAAALGRRWAVASLLVFVIFGLSLSLRQRASGETGLDWQNGLKLA
FT                   TWMLIPLVCLANFQRLLPYVREPTIALGALYGLLAIASGAWSLTPAYTVANALGFVAYL
FT                   MLACLSVSVLGLQATLRLATFTLLAFVVSGLVAAIVFPDAAWLPPSAFEADFRLRGLSG
FT                   HPNVLGEQAAVLVTFAIICYRRGILNRWVFIAALIAGFGALIAAESRTSAAAAMAACII
FT                   IELRERHYLRPMAGIALVIGAIALPFIAIGGLPSMSPFLGSLARSGSATEIVTLTGRTE
FT                   LWAVASDLIARKPLLGWGFNGTEALMMGSVGRNFAGDPVNAHNMYVQTLLCMGFLGSLP
FT                   AFVFLGIAIKRMVTRPDAVRDQVVLLVMIIGIAEVSLFATPGLLTLAFFIVLAGELHSS
FT                   SQPATVHSDIPAPQENSSS"
FT   gene            complement(543921..545384)
FT                   /locus_tag="Arad_7625"
FT   CDS_pept        complement(543921..545384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7625"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7625"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29084"
FT                   /db_xref="GOA:B9JNF3"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNF3"
FT                   /protein_id="ACM29084.1"
FT                   /translation="MTKQNAADPVSPITLVAPATENHALSPDTTHDAPGNPAPRYSLRR
FT                   FLLGGTAVIAIALFAWPMLPRVYESTATLVLRPTDNEGQTDYAQAMRQPLDENSIISAL
FT                   DAFNSVALAQNVIDANQLAMDDEFKVKQGLASKIHSTVISMLDSILPETLARNTPALSA
FT                   KDVMAGNVSSADTPEASKLRSNLWAKLVVNRNRLSYTVNVGFRSNDPLKAATLTKSLVS
FT                   AYLDAQVKRKIENVDGMNKLLEDHVRQARDRANTSASEMEAFLEKSGLIDQGAEISLEA
FT                   QLSALSTELATARARSIDSRTRADSLEVMKSKGTLDSAPEVLASPTIQHLNQSLTESMS
FT                   RLAVMSTESRNILEQAQVERDRIVASVRVEADNWAEREQLLSAEIDKIRLNMVERRKAG
FT                   LRLDQLRREADNDAQVLADAQTRLKTRAPTLEALKPDAEVLSPATVPVRPVFPILPLYA
FT                   AGSLGMAFLAGAGMNASAIRRDAKRLLKI"
FT   gene            complement(545412..546290)
FT                   /locus_tag="Arad_7626"
FT   CDS_pept        complement(545412..546290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7626"
FT                   /product="glycosyl transferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7626"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29085"
FT                   /db_xref="GOA:B9JNF4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNF4"
FT                   /protein_id="ACM29085.1"
FT                   /translation="MKNVVMSDAAAFDGGNRSEIAGVSILMATYAREEASNLYASLESL
FT                   RIQTRPADQIVLVIDGAIDEAQEKVIATFATLDAPWEFTVLRLQQNGGLARALNAGLGV
FT                   CTRSVIMRMDSDDICLPDRIQVEVEFLETHPEIGLVASWAEEFYHENPSSTRLRVAPTV
FT                   HDAVVQALRWRNIIVHPSVAIRAHFLRSAEGYNSKFGLLEDYDLWIRLVLAGVRFHVIP
FT                   KVLIKSRTGMGLNERRGGWRYVTNEVRFRLHFLKAGFLSFNQFLVVTTLYTGFRMISGS
FT                   LRGRMYAFVRN"
FT   gene            complement(546293..546985)
FT                   /gene="exoY"
FT                   /locus_tag="Arad_7627"
FT   CDS_pept        complement(546293..546985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exoY"
FT                   /locus_tag="Arad_7627"
FT                   /product="exopolysaccharide production protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7627"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29086"
FT                   /db_xref="GOA:B9JNF5"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNF5"
FT                   /protein_id="ACM29086.1"
FT                   /translation="MNQPPKLSQDIRSLRPMPAVRYLPQQRAFNAYIKRAFDICASLVL
FT                   LLVTAPLFAVIGLLVALDGGPIIYRHVRVGKDITPFDCLKFRTMMLDADGCLQEYLSYH
FT                   PQAKAEWVRDQKLLFDPRITPTGKFLRATSLDELPQLINVLRGDMSLVGPRPVTSAELS
FT                   HYNRHVSEYASVLPGITGLWQVSGRNDLSYERRVELDCEYVLQHTLFMDFKILMRTVGV
FT                   LLSRKGAR"
FT   gene            547370..548197
FT                   /locus_tag="Arad_7628"
FT   CDS_pept        547370..548197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7628"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7628"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29087"
FT                   /db_xref="GOA:B9JNF6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNF6"
FT                   /protein_id="ACM29087.1"
FT                   /translation="MLSPAYIFDSSRLFREGTRLILGSSSFEVVGMGETLEDLHELPRM
FT                   ESLAVCVIGTVANVAILDFVTAVLSINPKVRVVVLADTYNHAEATAILDRGAKGYLHKG
FT                   LSSESFIKALQLISEECSVISGWSVSSAGGRDDPRTPALPADKPDLRLLALDDAKSFAL
FT                   KQLALGDAIICPDAGSDVFDVHEHDAHMAAAPVQTTRIVNGVRNLSPREKSILKLVMGG
FT                   ESNKQIARRLEITESTVKVHIKTILRKIDVRNRTQAAIWAMADPDFLESRQHT"
FT   gene            complement(548278..549021)
FT                   /gene="hemK"
FT                   /locus_tag="Arad_7630"
FT   CDS_pept        complement(548278..549021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemK"
FT                   /locus_tag="Arad_7630"
FT                   /product="protoporphyrinogen oxidase (methyltransferase)
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7630"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29088"
FT                   /db_xref="GOA:B9JNF7"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNF7"
FT                   /protein_id="ACM29088.1"
FT                   /translation="MTDNARANDTQTTNVKPYFTRQTEDFPTMPTEKETIVTFMNLDFE
FT                   LGPNVLVPRKETELLGTVCIDRLSQGTVTPIVVDMCCGCGNLGIAIAMNIADAQVWSCD
FT                   LTPETVDVAWRNVIRFGLQDRMSVVQGDMFENIRSIGLEGRVDLIVCNPPYISTGRLEA
FT                   DRAHLLENEPREAFDGGPYGISIQQRLIREAFEFLKPGGWLAFEFGEGQERQAAALLAR
FT                   TRAYAPVQFILDASDIPRVALAMKL"
FT   gene            549300..551261
FT                   /gene="asnB"
FT                   /locus_tag="Arad_7631"
FT   CDS_pept        549300..551261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnB"
FT                   /locus_tag="Arad_7631"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7631"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29089"
FT                   /db_xref="GOA:B9JNF8"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNF8"
FT                   /protein_id="ACM29089.1"
FT                   /translation="MCGILGYFGNGMVPADAVSLLERMAGSLQHRGPDEDGVFTSVGVG
FT                   LGHRRLSIVGLVDGQQPMSNVDGSISISFNGEIFNHVELRQSLEAKGYVFRTTSDTEVI
FT                   IHLYQDIGPDCVYLLNGDFAFAIWDATRQRMLIARDRMGVRPVFYVEHSRMLFFASEIK
FT                   ALLKVPGIDAEIDPFALDQVFTMWAPVPPRTMFKGVSELPAGHLMIVDTNGVSIRQYWD
FT                   VSFPDAGDMADERDEADIAEELLALLDDATAIRMRADVPVGAYLSGGLDSSIICALAKP
FT                   YATAGLRTFSVTFDTAEHDESHFQNEMVQALGTRHSAVACGPDQIAGIFPSVIAQTEKP
FT                   VIRTAPAPLHLLSRHVREEGMKVVLTGEGADEVFAGYDIFKEARVRSFCARQPASSRRP
FT                   LLFRRLYPYLPGLSQQTPEALAAFFGAGNANLDDPLFSHRPRYRSTAAAKIFFSCDLKA
FT                   RLAGYDATDEVLSRLPRDFARWHPQHRAQYLETKFLLPDYILSSQGDRMSMAHGVEGRF
FT                   PFLDHRLVEFASRISPGMKLKGFVEKHILRRATAGLLPPSIGNRTKQPYRAPDSRSFFA
FT                   GQEPAYVERLFSPRALQETGLFNPAAAEKLLAKCRRQTDGFRDNTAFVGILSTQLWNET
FT                   FVTRSAGDRGDREMTAVI"
FT   gene            551276..551551
FT                   /locus_tag="Arad_7632"
FT   CDS_pept        551276..551551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7632"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7632"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29090"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNF9"
FT                   /protein_id="ACM29090.1"
FT                   /translation="MIPLKEQIRAFVVESFLFGDTTRTIADDASLIENDIIDSTGILEL
FT                   VTFVEDSFGITVGDAEILPANFDSISKVAAFIASKRSATGPIAAVA"
FT   gene            551573..553126
FT                   /gene="matB"
FT                   /locus_tag="Arad_7633"
FT   CDS_pept        551573..553126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="matB"
FT                   /locus_tag="Arad_7633"
FT                   /product="long-chain-fatty-acid-CoA ligase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7633"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29091"
FT                   /db_xref="GOA:B9JNG0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNG0"
FT                   /protein_id="ACM29091.1"
FT                   /translation="MRVENFLRYSARRWGDKLALVTRDMSLSFTDLDALSDHLAADLQI
FT                   RGLRPGDRTMIFMDNCWEAVVSIFAVLKAGGVFSPVNPSTKADKLAFMLRNCRARAVIT
FT                   QARLAGVLEQALAEETNVEVAIISGDPGSLLPGASRFSDGIAGLARPVGHVGIDMDLAM
FT                   LIYTSGSTGRPKGVMMTHRNIEAAATSITAYLRNTADDVILNVLPIAFDYGLYQILMAI
FT                   KVGATIVLEKSFAFPQAIFDIMRREKVTGFPLVPTMAALILNMRDMVPGSLPALRYITN
FT                   TAAALPPEHIERLRALFPDVMIFSMYGLTECKRCTWLPPSQLDVRPGSVGIAIPNTQAY
FT                   VVDNQGRKVAHGVVGELVIRGPHVMQGYWENEEATAKVLRRGPNPWERVLYTGDLFRAD
FT                   ADGFLYFVGRKDDIIKTRGEKVAPKEVEAAIHACPGVAEVVVFGRQDPILGQAIHAVVV
FT                   AYDPSLNEQMVIRHCQRNLEDFMVPRSVSFRTELPKTDTGKVSRRLAAEEFEHSMELAE
FT                   "
FT   gene            553123..554121
FT                   /gene="nadE"
FT                   /locus_tag="Arad_7634"
FT   CDS_pept        553123..554121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadE"
FT                   /locus_tag="Arad_7634"
FT                   /product="NAD(+) synthase (glutamine-hydrolysing) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7634"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29092"
FT                   /db_xref="GOA:B9JNG1"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9JNG1"
FT                   /protein_id="ACM29092.1"
FT                   /translation="MNPSPLSIHSALSSDALRIDAAAEVDRIAQAMRDQVRNKMRRRGL
FT                   VIGLSGGVDSSVCAALAAYALGAQNVFAIFMPENDSDPESLSLGQEVAKAFSLEGAIED
FT                   IGSALAAMGCYERRDDFIRQVEPAYGSGWSCKVVISSPLAGEGYALSTLVLQAPDGSQT
FT                   RHRMPASVYLGIVAATNMKQRTRKQMEYYHADRLNYAVLGTPNRLEYDQGFFVKNGDGA
FT                   ADLKPIAHLYKSQVYQIAEYLGVPEEVRRRPPTTDTWSLTQTQEEFYFALPYDRMDLCL
FT                   HALNEGLGVEETAKATQLTTDQVERVWLDIHSKRKATRPLHLAPLLVQPVF"
FT   gene            554143..555147
FT                   /locus_tag="Arad_7635"
FT   CDS_pept        554143..555147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7635"
FT                   /product="non-ribosomal peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7635"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29093"
FT                   /db_xref="GOA:B9JNG2"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNG2"
FT                   /protein_id="ACM29093.1"
FT                   /translation="MNDENRTRDDIRGRRLEKLRFWRRACAEESETLKLYNAEMEGNPL
FT                   IFLHGDFEMGGFYVRRLAAECGYPIAALASHGLEDPGLRPSIEWMAKERLKDILAFRPA
FT                   GPYRLGGYCNGALVAYECARLLKEQGREVELILMIEPPSLNTWPFYRRLHGAIAATLAT
FT                   VERRSLAVQKSFGHLMNAFWNIGRTVRLPSGDIVRLARNLATHHLKHVAKTENLVGAEE
FT                   RRIRETNAALRSVYLAATASYLPPPTTTPIVVLSTGIDHGGRRCGLYDGTQWSRLASSF
FT                   LHIQLSGHHLTCLSEHASELAANLARVLQGPLCVSSRIPAYNDRLKLAVAHRT"
FT   gene            complement(555225..556310)
FT                   /locus_tag="Arad_7636"
FT   CDS_pept        complement(555225..556310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7636"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7636"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29094"
FT                   /db_xref="GOA:B9JNG3"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNG3"
FT                   /protein_id="ACM29094.1"
FT                   /translation="MKERRLLYICGFAPHPNSSSSGQKIAFAKIEEFSKSFARIDVLYF
FT                   INELEELDAGRALPPWPANVGDKIPMHITRSMRVAAGLLMPHLPMFVSVRRLAARREVA
FT                   RRLSDPAYTDFYSDFSQGSAVLSRRQLARFIVRQHDVVSKLYGRQADNAGGLKKFFYRM
FT                   EAAKTRAWERGVWSSAAGIETLSEDDAALIRDAHPSTPVKCVPPMTTVALDPQMRTAAT
FT                   IVPGRMIFFGNMSRQENIDAVVWMARDILPQIHQRNPEAHLWIIGAHPSDEVLALSGPS
FT                   IHVTGFIESPMELFAQAEIAVVPLRLGSGVKIKVIETIAAGIPTITTPVGAEGIPSHRL
FT                   LMIAESALEFAESVCRALTRE"
FT   gene            556966..559110
FT                   /locus_tag="Arad_7637"
FT   CDS_pept        556966..559110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7637"
FT                   /product="sensory box/GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7637"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29095"
FT                   /db_xref="GOA:B9JNG4"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR007892"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNG4"
FT                   /protein_id="ACM29095.1"
FT                   /translation="MSLNRATGQARAQTFSVFVVTTCFLLIALVLTGLVAHVVTTMTHS
FT                   ANEMDDARAGRAAQAGVAALISRLSGTTTDNAVWDDAYNAIGSAAATDWAYTNWGKTSA
FT                   NYPLYDGAIVIGPDGATISAYAKGKPFQPRDLFGEAFDRQIEAAADPRQEPIINFMKTE
FT                   SGIALVASQAIQPFTAGAALPKLSVLSYYKELTSDVLDTLSDEHELEGLHLAPAPTQGL
FT                   LSTPVKDMNGATIAYLVWPSVAPGTAVLHNVYPYIVAAVVILLLFLGGVLFAGASEARR
FT                   LRALAEAARFEASHDSLSGLLNRHGLLDALDHPGNSDNRSMSLYLIDLDGFKAVNDAWG
FT                   HAVGDDLIRIIAKVLPTCHHEIIAAARLGGDEFALVQIGSATPEEVEKAILGLFIEPFK
FT                   LDGRTIEAGASIGSAVGTSSIAPLELLRRADMALYRAKEDGKGHAVEYDAELDRDRQRI
FT                   AELESELRSAINNGTIEPAFQPLVSASTGVITGLEALARWPSPAGNISPEVFIPLAEKS
FT                   GLIDALGIHMLRRSIAHAKNWNGLTLSVNVSPIQLCNPDFGAQVIAVLKDFAFDPARLT
FT                   LEITEGVLITNPDQARRSIDQLKSIGIKFALDDFGCGYASIGALRQFGFDRMKIDRSLV
FT                   SGVKEAGNGADVLRATISLATALGIPVTAEGIETAEQAEVLRNAGCDQLQGYMVGRPVS
FT                   ADEISRKLFQADSRSERVRA"
FT   gene            559316..559777
FT                   /locus_tag="Arad_7638"
FT   CDS_pept        559316..559777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7638"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7638"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29096"
FT                   /db_xref="InterPro:IPR014922"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNG5"
FT                   /protein_id="ACM29096.1"
FT                   /translation="MRKATAVTENSDPKEGEGGTPSQLIDARIEELGDWRGDTLARVRA
FT                   LIKQADPEVVEEWKWRGVPVWSHDGIICTGETYKNVVKMTFAKGASLEDTSGLFNASLE
FT                   GNTRRAIDFQEGAKIDEGALKALIRAAVALNTSVLAAARVRSRKTPKSA"
FT   gene            559984..561567
FT                   /locus_tag="Arad_7639"
FT   CDS_pept        559984..561567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7639"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7639"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29097"
FT                   /db_xref="GOA:B9JNG6"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNG6"
FT                   /protein_id="ACM29097.1"
FT                   /translation="MPSSFANEIFPPEGKAMDSVEGGERSAKSGLFSDLRWVTWVLAAY
FT                   FLVQAIVRIALPNSLRVDEAQQFVVAQWLDWGYDAQPPLYNWIQQGVFAVFGTTLASLV
FT                   VLKNVLLFLVYYTYHRVARLLLADKGLAAIATLSLLTMPQMFWQAQRDLTHTVGTLLAI
FT                   CLFLHSVVSTLRKPSFISYASMGVWVGVGMLTKYNFILIVLATFVAVLRHPDGLKRVLD
FT                   KRLLLTILLAILVFLPHGLWMTSHMSAVIDQTTRTMSEQGEGGKLSDIGNGLKELFGTG
FT                   IVIILPTAVIFLIFFRKAFLRSFRARGEWSDFVGTILVATLSILLLMILVVTLTEFRDR
FT                   WLLPFLFLTPLYFCLKLEASGVGSAEVFRKFLYVPLTMMVVLPLVIAGSVILPKFFGSY
FT                   EHLNTPYTPFLEQVVAAEGRKPAAVVTTTWQKAGNVRINMPDTPVISIAYPLFDIDHAS
FT                   IGHQPLLLVWNERDGKPSTMPISLTAWLKEKYGEALSNPEQHDMAVPYYYGREPDRYHF
FT                   GYAWVYPNGK"
FT   gene            complement(561635..562237)
FT                   /locus_tag="Arad_7640"
FT   CDS_pept        complement(561635..562237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7640"
FT                   /product="2-hydroxychromene-2-carboxylate isomerase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7640"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29098"
FT                   /db_xref="GOA:B9JNG7"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNG7"
FT                   /protein_id="ACM29098.1"
FT                   /translation="MTKTIDYFFGIGSPWAFIGLEPFTALAARFGADIRPYIIPLVEEN
FT                   GAIFSRNRPEPRRAYWFKDLKRWAALRGKSLDLDNRTGLSDPTPAGLTVIAAQLDGKDW
FT                   IGLTKALQEAFWSRAEDIGNADVRKAIADTADFDGAALEARAQQGDVQELWRSNYDTAK
FT                   AAGVFGFPTFRYDGELYWGQDSLPFLERHLNGEKLIA"
FT   gene            complement(562234..562818)
FT                   /locus_tag="Arad_7641"
FT   CDS_pept        complement(562234..562818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7641"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7641"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29099"
FT                   /db_xref="GOA:B9JNG8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNG8"
FT                   /protein_id="ACM29099.1"
FT                   /translation="MTTSISEQIVNVAGALFYKEGIRAVGIDRIVEEASIAKATLYRHF
FT                   PSKDHLVAAYLSQRHDRVMSSLDEVTRTIGEPRDQLATIFDRLFEKADSPEFRGCAFAL
FT                   AVAEHGDSERVVFVAREHKSAVRAIFKSIMLRAGAISEQPAAHLALLYEGALATVAVDR
FT                   DPNAVLVARDCALTVFDGAVVSRGLQSRNGK"
FT   gene            complement(562833..564020)
FT                   /locus_tag="Arad_7643"
FT   CDS_pept        complement(562833..564020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7643"
FT                   /product="FMNH2-dependent monooxygenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7643"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29100"
FT                   /db_xref="GOA:B9JNG9"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNG9"
FT                   /protein_id="ACM29100.1"
FT                   /translation="MSHSTIDLTDLTRTLSDAAPAADATGAFPWVGIQAVHKSGLLEST
FT                   VGTRFGGTGASLAETGRILAALGRGDPSVALISAMTIFTHLGEASRNRWPEGLYRRLLN
FT                   EAKERPILLNAARVEPDLGSPARGGLPDTLARRSPHGWSITGKKRFVTGALGLTHFLVW
FT                   ARTDEEPQRVGTFVVPSGLPGINVIENWRSLGMRASGSHDVEFTNVEIPREDVLDLTDI
FT                   AAGTQDNRAHASMTLALTAIYLGAAEAAQEAFVRFAHERVPSNLGYPIARTERFVTLAG
FT                   EIDLQVSGARQIIFDALDYGLDSPERLIRARLLAGRQIRQAVQLAVGALGNPGLSADVG
FT                   IERHFRDIQSVLVHAPQEDTAISILGRAALEQSAKTQRPPELSPTLVSRSILKTG"
FT   gene            complement(564168..565268)
FT                   /gene="ssuD"
FT                   /locus_tag="Arad_7644"
FT   CDS_pept        complement(564168..565268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuD"
FT                   /locus_tag="Arad_7644"
FT                   /product="alkanesulfonate monooxygenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7644"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29101"
FT                   /db_xref="GOA:B9JNH0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNH0"
FT                   /protein_id="ACM29101.1"
FT                   /translation="MSAEFISVTFTNPSTEINPLPQPAIDPRFLVRYARSLDDYGFNYT
FT                   LVPYDSSSFDPFTIGATIAAHTKNIKIIIALRPNTLYPTVAAKALATLDQLSEGRVVVH
FT                   FIAGGSDVEQAREGDFLTKEQRYERLEEYIRILRRAWESPEPFDFDGRYYQFKQFSNQV
FT                   RPVNGKIPVSVGGSSDEAYRIGGALADIFGLWGEPLAETKEQIDRINAEAKRAGRTDRP
FT                   RIWVTFRPIVAETDELAWAKAHRVLESLQENRAKGLGKAPASAPPPQNVGSQRLLDIAA
FT                   RGEVHDRALWYPTVTATNARGASTALVGSPQTIADSILDYIDLGADLISIRGYDNLNDA
FT                   IDYGRYILPLVRSGIDGRAAQQRNVA"
FT   gene            complement(565331..565573)
FT                   /locus_tag="Arad_7645"
FT   CDS_pept        complement(565331..565573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7645"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7645"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29102"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNH1"
FT                   /protein_id="ACM29102.1"
FT                   /translation="MSASPSTGRWHQIDPTLPLILATGASGKKLPASIYVEQDIARPRR
FT                   ASPSDIPYAMRSFPGATSCENNFYKITRQQKDWSF"
FT   gene            565714..566670
FT                   /locus_tag="Arad_7646"
FT   CDS_pept        565714..566670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7646"
FT                   /product="solute-binding periplasmic protein of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7646"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29103"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNH2"
FT                   /protein_id="ACM29103.1"
FT                   /translation="MRHLKCRLLLAAVALMVATSVNAADKVRLGNLKFAHYGAISYMKE
FT                   LAPKYDLEIEERFFAKGIDILPAIVAGEVDVAASAVDAAIAGRAKGVPIYAVAGFAKGG
FT                   ARIVAGTKSGITSIAEFKGKKVGVARGGAQELVLLAELDKVGLTWSEKPGKDVQILYMA
FT                   YADLNQALMAGDIDAMSQSEPQASQAINKAFGVEILKPYDTPMGMPVRSLVFSEEFYKK
FT                   SDVAERTMKLFVEATKTFIDKPDLAEKYVINDMFKGQITPEDFKDAIGNSPYSYEITPE
FT                   HVQITTDLMMKYGVGKLVNPPKATDWVKTDLLEDALK"
FT   gene            566667..567473
FT                   /locus_tag="Arad_7647"
FT   CDS_pept        566667..567473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7647"
FT                   /product="aliphatic sulphonate ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7647"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29104"
FT                   /db_xref="GOA:B9JNH3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNH3"
FT                   /protein_id="ACM29104.1"
FT                   /translation="MIKRLLQNLAVPVVLLTIWQLMSIFGLVRPEILPSPVAIMERLWL
FT                   YLMPEETFQEAGGIGAWIMSSELLGDLLASLQRVVLGFAVGAGLALPLGLLMGTDKTIE
FT                   RYLNPVIQFLRPIPPIAYIPLAILWFGLGNPPAIFLIAIGAFFPVLINTISGVRNVDSI
FT                   YVRAATNLGADRLTLFRRVILPAATPYILTGMRIGIGTAFIVVIVAEMIAVNSGLGYRI
FT                   LEAREYMWSDKVIAGMIAIGLLGLAIDIGVNRLNSHLLRWHRGIES"
FT   gene            567587..568426
FT                   /gene="tauB"
FT                   /locus_tag="Arad_7648"
FT   CDS_pept        567587..568426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauB"
FT                   /locus_tag="Arad_7648"
FT                   /product="taurine uptake ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7648"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29105"
FT                   /db_xref="GOA:B9JNH4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNH4"
FT                   /protein_id="ACM29105.1"
FT                   /translation="MSIIPVNLASLAGATSAPQIFARGVNKIFGKEPATVTALKDIDLE
FT                   INAGEFVCLLGPSGCGKSTLLNAIAGFSLPTAGTLEVSGKAVTAPGPDRGMVFQEYALF
FT                   PWMTVERNIAFGLEIRGLAKQQIAETVTQLLDLLGLKEFRQRFPKDLSGGMRQRVAIAR
FT                   VLALDPPIMLMDEPFGALDALTRRSLQDELLRIWQAVGKTIVFVTHSIEEAIYLGSRVV
FT                   ILTYRPGTIKRDIRIELPYPRDTNSVEFNEIKRELAQIVHAEQDRFASDERQGLTLD"
FT   gene            568426..570348
FT                   /locus_tag="Arad_7649"
FT   CDS_pept        568426..570348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7649"
FT                   /product="two-component sensor histidine kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7649"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29106"
FT                   /db_xref="GOA:B9JNH5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017055"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNH5"
FT                   /protein_id="ACM29106.1"
FT                   /translation="MDRNVARSRAYTDTTLPRDRSCYDQEIGVQFGGASLRWKYLILAF
FT                   VFALLGVGIPGLVQDATRKYGLREAAAQSHERLRLISATLSARIERFRYLPDVVARSSE
FT                   IEDLFRAGMAEAKRPDINRFLARLSNASGAVALYVTDTKGLTIAASNYDTLDSFVGHDY
FT                   SYRPYFRDAMANGNGSYYAIGTTTGQPGYFLSVPIKVEDKVVGVSIVKIDLLPVEKQWR
FT                   DASEHVAMADSEGIIFLSSQPDWRYTATSPISPTALAQLKLERRYGDAALTPKIRVQQS
FT                   SGFDLATVENDDTSEQRLQVAAPFGEKGWTLIYFADLTDIRRQEDIVAIATALAGLLVL
FT                   AGITIAVQRRRGRQAARRAFEQLEHRVAERTQQLKLSHDRLELEIAERKEAERQLSVTR
FT                   SNLSQAEKLALMGQAFAGLAHEINQPLAALSTYIASTRLLLKRRQYAPIGENIDTMNEV
FT                   IGRISDLTDQLKRLARRSDDDFADVDLGAIIRRNLKLLKFRFSDLGIEVSQEIGSGLKV
FT                   QGSAAQLEQVILNLLSNAIDAVRGRKEPCIHVSGAAEGACCVIAVDDNGPGIAADTGTQ
FT                   LFEPFYTTKLPGEGLGLGLATAHRIASDHGGTLSFDQSPLGGARFILRLRQNGKSALRR
FT                   EGEVA"
FT   gene            570345..571697
FT                   /gene="dctD"
FT                   /locus_tag="Arad_7650"
FT   CDS_pept        570345..571697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctD"
FT                   /locus_tag="Arad_7650"
FT                   /product="two-component response regulator protein
FT                   regulating C4-dicarboxylate transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7650"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29107"
FT                   /db_xref="GOA:B9JNH6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNH6"
FT                   /protein_id="ACM29107.1"
FT                   /translation="MTDALPGVLLIEDDAALRRSLAQWLSLNELSVTEAADGNEALKVL
FT                   RSDTIDVVISDVRMPGISGLELLAVIRKTWPELPVIILSGHGDVPMAVAAIQAGAFNFL
FT                   TKPYVPEQLIGTLQNALEQTRLRRRVVSLEQSNAIQARLERQLLGADQATTRLKSTIEQ
FT                   LAPYHVDVLIKGETGSGKEVVARLLHECSPRQAGPFVAINCAALPLDIVESELFGHETG
FT                   AFTGASGIRIGKFEFAKGGTIFLDEIESMPLSIQAKLLRALQERTVTRLGSNRDIPIDI
FT                   RILSATKEDLRDLASRGLFREDLYYRLAAADIAIPPLRDRGHDALLLFEHFMLSMAERL
FT                   ERKALSLTDEETRFLLAYAWPGNVRELKHLAERRALGLDWRPDTDQQDDLTVENSSLAD
FT                   LVDQFELNLIEQALRNADGRTSLAAERLQLPHRTLNEKLKRLSTKNRSDRA"
FT   gene            complement(571724..572794)
FT                   /locus_tag="Arad_7651"
FT   CDS_pept        complement(571724..572794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7651"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7651"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29108"
FT                   /db_xref="GOA:B9JNH7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNH7"
FT                   /protein_id="ACM29108.1"
FT                   /translation="MNEPIESSQKLGARRARGNSGRVKLEEVAQRAGVSTATVSRAFNE
FT                   PEKVSQSVRERVLEAARALNWIPNAAGRALASSRTHIAGAIIPTLDNEIFAHQISGMQS
FT                   VFAERGFTLFLGCSNYDPDEGLKQVQAMLARGVEALAIVGENHPPELFAALQQRKVPYI
FT                   LTYSYRPSSPHPCIGFDNGAAFQQIVEHLLSLGHQRFAGIFQPETENDRVKARLDGVRS
FT                   ALTAAGVTMDDDNLMIGPSTMDFGASSFARLMKQSARSRPTAIICGNDNIALGALTAAA
FT                   EMGLNAPADFSITGFDDLTISSRLSPRLTTMKVDNQEIGILAARQLLAVIDGTSDAPHS
FT                   IEVHPQMKIRESTGPA"
FT   gene            572955..574325
FT                   /locus_tag="Arad_7652"
FT   CDS_pept        572955..574325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7652"
FT                   /product="tartrate transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7652"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29109"
FT                   /db_xref="GOA:B9JNH8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNH8"
FT                   /protein_id="ACM29109.1"
FT                   /translation="MENRLSKTDNTTGPTRGQKTDPAVLARAVSRAKWRILPFLILMYM
FT                   LAYLDRVNIGFAKQSYQATTGVTEAAFAFGAGVFFLTYALFELPSNLMLHRVGARKWLA
FT                   RIMVTWGLISALMMFAYDDTTFSLIRVVLGAAEAGLFPGAIMYLTLWFPREARGKILAI
FT                   FYFGSPLALIFGGPISGMFLDLDGLFGLHGWQLMFLIEGGITVLVGIWAYFYLTDSPQE
FT                   AKWMPADERQALAATLAAEQAEKARTGEVKFGKAIRNPRLFYFAAIYFLIQITGLGVAF
FT                   YLPTQVAALLGVKVGLLVGFVSAIPWICALIAGFFYPDWAVRTGRRHICFLFSLAAIGL
FT                   GLIASAHASPALAIVALCFVTMGIMTAQPIFWTFPTQYLGGAAAAGGFAVINSLGALGG
FT                   FVAPNVRAMAVSWSGFEQYGIYAIALAAFLAFILVLFITKVGRKQLENTVSTTAVRT"
FT   gene            574341..575354
FT                   /gene="serA"
FT                   /locus_tag="Arad_7653"
FT   CDS_pept        574341..575354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serA"
FT                   /locus_tag="Arad_7653"
FT                   /product="D-3-phosphoglycerate dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7653"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29110"
FT                   /db_xref="GOA:B9JNH9"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNH9"
FT                   /protein_id="ACM29110.1"
FT                   /translation="MISVRYDMTKARKILVNTEQFKNGDALFEPLIAAGYSVEVNETFR
FT                   LPSEAELIEKLKDGVVATIAGGEPYTARVLETAPDLKIVARWGVGYDKVDVAAATKAGI
FT                   PVAMAFGANHESVAEYAYALALALACRIGPRDAMVKSGKWFFDGFHPGLWGRTAGIIGL
FT                   GRIGGAMARRCVAGGMTVLVYDPFASDEQLASLGAQRAELNEVFSRADLISVHAPSTPE
FT                   TRHLVNAERLALIKPTAILVNTSRGPLIDETALVAAIDAGRIGGVGLDVFEIEPLPEAS
FT                   KLRSFDNVLFSPHVSGMDRMAERLVTERCVSNILEYLGGRPQAIVPYVVNPQVLAG"
FT   gene            575359..576288
FT                   /gene="dapAch2"
FT                   /locus_tag="Arad_7654"
FT   CDS_pept        575359..576288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapAch2"
FT                   /locus_tag="Arad_7654"
FT                   /product="dihydrodipicolinate synthase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7654"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29111"
FT                   /db_xref="GOA:B9JNI0"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNI0"
FT                   /protein_id="ACM29111.1"
FT                   /translation="MLKKIEGIVPVMITPFTESGKIDYPGVARLVEWYIANGSDALFAV
FT                   CQSSEMQFLSLEERVELAAFVKTAAAGRVPVIASGHVSESLEDQCAELSAIAATGVDGM
FT                   VLVTNRLDAKKEGGTKFIDDLNWLLERLPKDLTLGLYECPAPYRRLLTDDELLFCASSG
FT                   RFAILKDVSCDLETVKRRVALTKDTPLAIVNANAAIAYDAMKAGSRGFTGVFTNFHPDL
FT                   YKWMLTKSASNPALADELSVYLALSAMAEPMGYPKLAKLYHQRLGTFSCADSRVINFDI
FT                   RERFWALDALMDKIVEGTEHFRRRIAAG"
FT   gene            complement(576375..577268)
FT                   /locus_tag="Arad_7656"
FT   CDS_pept        complement(576375..577268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7656"
FT                   /product="nucleoside-diphosphate-sugar epimerase
FT                   dehydratase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7656"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29112"
FT                   /db_xref="GOA:B9JNI1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNI1"
FT                   /protein_id="ACM29112.1"
FT                   /translation="MRVFVTGATGWVGFAVVKELLAAGHEVLGLTRSDAGAAALATAGA
FT                   EVHHGSLEDLESLRRGATAADSVIHTAFNHDFSKFAANCELDRRAIETLGAALEGTDRP
FT                   LIVTSGTALVAPGRTSVESDPAVQPSDNFPRASEATALALALRGIRTAVVRLPPSVHGH
FT                   GDHGFVPILIRAAREKGVSAYIGEGLNRWPGVHRLDAARIYRLALERGAADGPYHATAE
FT                   EDVPFKDIAEVIGRRLNVPVVSKTAEEALDHFGWIGHFVGRDAPASSARTRQLLGWEPT
FT                   QPGLIADIDHPAYFEA"
FT   gene            577393..578367
FT                   /locus_tag="Arad_7657"
FT   CDS_pept        577393..578367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7657"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7657"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29113"
FT                   /db_xref="GOA:B9JNI2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNI2"
FT                   /protein_id="ACM29113.1"
FT                   /translation="MDPLSDVLSLLKPRSYMFGGFDAGGDWSIRFGQHEGIKCYAVVSG
FT                   QGWLLVESVSDAVRLTTGDCFVLPRGWPFVLTSNPSLSPIDYRQLFPTRPNGSMRVLNN
FT                   GGDFSIVGGHFTLTGGHVGVLLAMLPPIVHIRTEADRESLRWCMERMRQELREPQPGGF
FT                   LIAQQLAYTMLVQALRLHLAEGVTGGVGWLFALADRQMAVAITAMHEDPAHRWTLASLA
FT                   ERAGMSRTTFTLKFKETVGTSPMDYLTRWRMMVAGERLTHSSDSISVIALSLGYESESA
FT                   FSTAFKRMMGCSPRQYGRGADPAASFHDRSETVGADRREAMAS"
FT   gene            complement(578373..578840)
FT                   /locus_tag="Arad_7658"
FT   CDS_pept        complement(578373..578840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7658"
FT                   /product="acetyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7658"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29114"
FT                   /db_xref="GOA:B9JNI3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNI3"
FT                   /protein_id="ACM29114.1"
FT                   /translation="MISMTDVTFRPAQAADLPAIIALLSDDVLGQQREDPGSPPNPRYV
FT                   DAFQAILVDPNQLQAVAILREEVIGTLQLTFIPGLARKGAWRGQIEGVRVSVAHRGSGV
FT                   GQQMFEWAIGQCRAKGCNLVQLTTDKERPDAHRFYETLGFVGSHIGYKLAL"
FT   gene            complement(578962..580230)
FT                   /gene="ttuD"
FT                   /locus_tag="Arad_7659"
FT   CDS_pept        complement(578962..580230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ttuD"
FT                   /locus_tag="Arad_7659"
FT                   /product="hydroxypyruvate reductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7659"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29115"
FT                   /db_xref="GOA:B9JNI4"
FT                   /db_xref="InterPro:IPR007835"
FT                   /db_xref="InterPro:IPR025286"
FT                   /db_xref="InterPro:IPR037035"
FT                   /db_xref="InterPro:IPR038614"
FT                   /db_xref="InterPro:IPR039760"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNI4"
FT                   /protein_id="ACM29115.1"
FT                   /translation="MRWTDAESRAVLRRLFDAAVASADPAAAVLRHLPEKPRGRCVVVG
FT                   AGKASAAMAAALDAAWPEVDVSGVVVTRYGHAVPAGRIRILEASHPVPDTMSETAARYI
FT                   LAAVRGLTPDDLVVALISGGGSALMVAPAGNMTLADKQTVNRALLASGATIGEMNALRK
FT                   HLSAIKGGRLAQAAQPAHVVTLVISDVPGDDPAAIASGPTVSDASTMADVRDIIRRYGL
FT                   DLPPAARAVIEAGDEAPKREALPNEITIIAAPSLALTAAAEEARRNGLAPLILGDAIEG
FT                   EAREAGIVMAGIARSAKTKGLPIRAPAVLLSGGETTVSIGKGPAGAGGRNTEFLLGLAV
FT                   GLAGMEGIYAIAGDSDGIDGTEDAAGAIVTPDTLVRARLLGLDTRAYLAAHDSYRYFAE
FT                   LGDLVKTGPTLTNVNDVRAIMIV"
FT   gene            complement(580242..581315)
FT                   /locus_tag="Arad_7660"
FT   CDS_pept        complement(580242..581315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7660"
FT                   /product="tartrate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7660"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29116"
FT                   /db_xref="GOA:B9JNI5"
FT                   /db_xref="InterPro:IPR011829"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNI5"
FT                   /protein_id="ACM29116.1"
FT                   /translation="MREYAIATIPADGIGPEVIAAGTTVLAALEKRDGGIRFNVENFDW
FT                   GSDYYKKHGVMMPADGLSQLKKFDAIYFGAVGAPDVPDHITLWGLRLPICQGFDQYANV
FT                   RPTKILPGITPPLRNCGPGDLDWVIVRENSEGEYSGHGGRAHRGLPEEVGTEVAIFTRV
FT                   GVTRIMRYAFKLAQSRPRKFLTVVTKSNAQRHGMVMWDEIAAEVAEEFPDVTWDKMLVD
FT                   AMTVRMTLKPQSLDTIVATNLHADILSDLAGALAGSLGVAPTANIDPERRFPSMFEPIH
FT                   GSAFDITGKGIANPVATFWTAAQMLDHLGEQDASARLMRAVERVTGAGILTPDVGGTAT
FT                   TKDVTDAVVDAIYSSNV"
FT   gene            complement(581340..582671)
FT                   /locus_tag="Arad_7661"
FT   CDS_pept        complement(581340..582671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7661"
FT                   /product="tartrate transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7661"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29117"
FT                   /db_xref="GOA:B9JNI6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNI6"
FT                   /protein_id="ACM29117.1"
FT                   /translation="MSSFWEEMAVTNELETRVLRKITIRIVPFIMLLYLIAFLDRVNIG
FT                   FAALEMNKDLGFSSTVFGFGAGIFFLGYFLFEVPSNLILNKVGARIWIARVMITWGIVS
FT                   GLMAFVQGATSFYVLRFLLGVAEAGFFPGIILYLSFWFPARRRAAVTALFMAAAPLSTV
FT                   LGSPISGALMQMHGLMGLAGWQWMFLIEAAPALIFGVVVLFYLTDRPAKAKWLSDEERN
FT                   WLVKTMEDEQKSRGVKASHSIWAGLVDIRVLALALVYFGTSAGLYTLGIWAPQIIKEFG
FT                   LSSLDVGFLNAIPATFAVVAMVLWARHSDRTGERTWHVVLACLLAAAGLAFAAGATGVL
FT                   AVLVALTLVNIGISCSKPPLWSMPTLFLSGPAAAAGIATINSIGNLGGFVGPSMIGWIK
FT                   DLTGGFAGGLCFVAGLLVLSAALTLILSRAAAKASAIQAAGQQS"
FT   gene            582774..583688
FT                   /locus_tag="Arad_7662"
FT   CDS_pept        582774..583688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7662"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7662"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29118"
FT                   /db_xref="GOA:B9JNI7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNI7"
FT                   /protein_id="ACM29118.1"
FT                   /translation="MELQQLRCFVAVAQELHFGRAARMLGILPASLGRQIRLLEDFLGT
FT                   RLMERTTRNVMLTRDGTELLKEAKQVLAQADAMTERFRHRRHLPRTGIRIGAIDSAAAG
FT                   LIPQLLHDLKLEHPEISVQISEEKTVRLLPKLISGRLDLVFIRPPEIVDRKIKLLRLFN
FT                   ETAVVAISDRHRLADRKNIAVEELEDEPLIVPDRRSRPHSHDMTIKLFTEAGLTVRIAQ
FT                   MADEKQTIVNLVAAEIGLAIVPQWTSRLAVSGVRYIPLRPGRERTTGQLPLYAAWLKGV
FT                   RDPLRDSLISILMKHLAVYSENA"
FT   gene            583927..584421
FT                   /gene="rpoI"
FT                   /locus_tag="Arad_7664"
FT   CDS_pept        583927..584421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoI"
FT                   /locus_tag="Arad_7664"
FT                   /product="RNA polymerase sigma factor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7664"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29119"
FT                   /db_xref="GOA:B9JNI8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNI8"
FT                   /protein_id="ACM29119.1"
FT                   /translation="MLHSLHAGEEKRLHRFFHRRLKNRDDVADATQETFLRMLEASHAT
FT                   LIENPQAYLFQVARSVARVILTRQTREQAMFAPDDAGMEEPDDFPLPDRIVNARQCLLI
FT                   MAKAIEALPTRCQQVFILSRLRGLSNGEIAAELGISRNMVEKHIIKALLHCRKVRAEIF
FT                   F"
FT   gene            584516..585469
FT                   /locus_tag="Arad_7665"
FT   CDS_pept        584516..585469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7665"
FT                   /product="FecR iron sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7665"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29120"
FT                   /db_xref="GOA:B9JNI9"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="InterPro:IPR032623"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNI9"
FT                   /protein_id="ACM29120.1"
FT                   /translation="MSRSYDEEIDDRLAEAAAGWVARLQSADATDLDRADFQCWLHADP
FT                   SHAAAYDEMNALWGSLRDAPVSLDSLKARRSSGARAVGLAVMLGVIAASSYTIQQLGLI
FT                   DRWRADYYTDVGEVRSVVLEDGTQVDLDTDTAIAVRYTAGERRVELLRGQAFFDVTKNP
FT                   ARPFVVDEGQLSATALGTHYSVQAPTGSLPQMVQVEEGIVEVKTGDNDTVLRAGDAMTV
FT                   DASGKATLAKADVANETAWRQGKLVFSATPLSKVAETLARYRRGRVLVVDAQAADRKVS
FT                   GVFDLSNTDEALAIIESNLPVSVTRVTDALVFIRSK"
FT   gene            585570..587990
FT                   /gene="fhuA"
FT                   /locus_tag="Arad_7666"
FT   CDS_pept        585570..587990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuA"
FT                   /locus_tag="Arad_7666"
FT                   /product="ferrichrome-iron transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7666"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29121"
FT                   /db_xref="GOA:B9JNJ0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNJ0"
FT                   /protein_id="ACM29121.1"
FT                   /translation="MIKGARVASMNWKVKRGAFAATVFVGISAFAGAALAQTANKPEAN
FT                   AGQTTVNVSIAAGSLESAILAFGHQANIRLLYPTALTVGKTTRGVSGNLPAKAAVAQLL
FT                   AGSGLVYSFTGPNTVRIYDRADQSARAGGVAADGSTVLEPLVIQGQDQGIKGVLETDGY
FT                   VGKSGRSATKTDTPIAETPQSISTVSQKQLQDLRPQNLSEALNYTPGARLGQYGAEPRY
FT                   DAFKVRGIDLTYTGIFRDGLRQIASPNGLFRLEPYGVEAIATLRGPSASVYGASSSGGI
FT                   VDIISKRPTEEKLREIEVQYGSYGRLQSAFDFSGPVTDDNTLLYRVTGLVRDGRNQIAA
FT                   IKDDRQYIAPALTWQPDEDTKLTLLGEYMNSTTGGTWGYINKYGLAGTSIGATSEYGGD
FT                   ARFNDFKQKQWRIGYELEQALSDSVTLYHKLRYSDISARQEWVFADYPGIVREDNSGLA
FT                   TDTYLKTDFDTGPLQHQLITGIDYSYMKYTSRQGSGPDLFTNSYSYMPNINYSETQKQN
FT                   SLGIYVQDQIEYDAWRFTAGLRHDWHKSDYTPGGTSYSRDDSETTFRVGLGYVTPWNVM
FT                   PYVSYGTSYVANPGVIQTFNSVAQQADPTLGKQIEVGVKYQIPDRNVSITAALFNIDQE
FT                   NATVYETSSGLNLLRQLDLKSRGFELEATASLDNGLKLIAAYSYNDVEITKLTSETKGN
FT                   TLNSSPYHMFSLWADYEVQSGALEGLGIGAGLRYVGSSFGDNVHTPVLDNKARTFVDAS
FT                   LRYDLGKINPSFEGVRLQVNATNLLNEVKQVCTTGFCYWDEGRKVVASVRYRF"
FT   gene            588092..589249
FT                   /locus_tag="Arad_7667"
FT   CDS_pept        588092..589249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7667"
FT                   /product="major facilitator superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7667"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29122"
FT                   /db_xref="GOA:B9JNJ1"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNJ1"
FT                   /protein_id="ACM29122.1"
FT                   /translation="MLGLPAVLRAQGLPLDQIGLLYLTVIPWALKFLWSPYVERFRLPA
FT                   QGHNRSRLIVFAGGLLCAAGLAAIGLTGPYPLAPVLCVLLLVALVTSTVDIACDGYAVE
FT                   TLAKEHHGWGNTAQVGGSYLGSAIGAGLFLVLVDSIGWSYAAFAMAFLVIILGLPFVFG
FT                   PATRGTTETRPHAPSLLLALKRPQVQKGLMIAAIYVAGQKWGLSMLGPFLIDRGLDLAT
FT                   IGALNGIGSMVVGFSGALLGGLLVRLWGATAVLILAILLQAALLAGLALFSFDDSLPRV
FT                   FIMPIAIASSSGVMSVGFVALYSQFMGWSDPKQAGVDFTLFQCVDGLISMAGGLGAGWI
FT                   AEHLGYAVFFTVAAIIAVLAVPAIGLLMRGANGNAVAIVRPADGL"
FT   gene            589270..590346
FT                   /locus_tag="Arad_7668"
FT   CDS_pept        589270..590346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7668"
FT                   /product="Siderophore-interacting protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7668"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29123"
FT                   /db_xref="GOA:B9JNJ2"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR013113"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNJ2"
FT                   /protein_id="ACM29123.1"
FT                   /translation="MQASTIIRSDRAGALVTDFAERFRDVANVEAEGGKATLISRYGRA
FT                   DLTAQGDAISIAVAAKDQIDLCYIKMVVAEYFSSAAAPDAVRWSGDGEAESSLPPFFRE
FT                   MRVISVENVTPQMRRLRLSGAELNRFAADGLHVRLLFPPRGAKPVWPALGADGRIVWPG
FT                   GDDRLVSRVYTIRSRDSERGEIEIDFALHHHEDGRSPGASFAVHAQPGDLVGLFAPAGD
FT                   EIPKAQSLVLCGDDTALPAIARILEEIPSSVSARLFIEIDNPDCRYELRSGDNIELNYL
FT                   YRQGRPAGTTGLLPEALSHLDADSLGEDTYFWAGCEFGDFVELRKLARRTWKLPRERHL
FT                   VVAFWRRGFAEGESAKQA"
FT   gene            complement(590379..591677)
FT                   /locus_tag="Arad_7669"
FT   CDS_pept        complement(590379..591677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7669"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7669"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29124"
FT                   /db_xref="GOA:B9JNJ3"
FT                   /db_xref="InterPro:IPR021830"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNJ3"
FT                   /protein_id="ACM29124.1"
FT                   /translation="MVKEQKAASKKPSTASLSFPPAENRAQALGEIHARPFVAVTSPRV
FT                   ILQLAFLMETGQTSHHEAIETMARSQGVSVPDRTSRHCTVQWGQGTLRWERHTEFSTWF
FT                   WDGPAMAAPWTAIALHPFGGSFHAPGSFISGIRLEIWPEGAQAEAALTSFDGASLCRSR
FT                   IRDGLAEVATDFRQDGDGLTRMLLIDRGLTDLGRGATVQCLLDIETYRTLAMLALPLAQ
FT                   SLSPEIRAIEEALGAVTQRMKGQVWENADEMLAEITRLASELQANAAQSLYRFGASTAY
FT                   DFIVSERIATLGEEPIAGETLGSFLERRLAPAMRTCKSVEERQESLSIKLSRTTELLRT
FT                   WVDVGLARQNTALLTSMDRRVKLQLRLQQTVESLSVAAISYYIVGLINYAAKGLGHDIV
FT                   EPMLSIALGISVPIIVVSVWFFVRSVRRRHQDS"
FT   gene            592015..593217
FT                   /locus_tag="Arad_7670"
FT   CDS_pept        592015..593217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7670"
FT                   /product="hippurate hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7670"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29125"
FT                   /db_xref="GOA:B9JNJ4"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNJ4"
FT                   /protein_id="ACM29125.1"
FT                   /translation="MTQSNTITNDAPAPKVIERIASYVPELVAIRQDIHTHPEIGFEEV
FT                   RTSGIVGDKLASWGIEVHRGIGKTGVVGRLVGRHPGNRSVGLRADMDALPMPEETGLPY
FT                   ASIYPNRFHGCGHDAHTAILLGTARYLAETRDFAGTVIFIFQPAEEGLGGARAMIADGL
FT                   FDRFPVDEIYGLHNATFLAPDHLHVTAGTVLAGADFFDVTFKGKGAHGAHPDAGRDPIP
FT                   AITELVQALQTIVSRNVPPTEPAVLSVTKIGAGSAYNVIPETASVGGTIRAFSDGVREL
FT                   IRSRLTTIARNVAAAHDLTAEIDIRDIFSVLTNHAEHVDIVADIGREVLGPTRVSTAPK
FT                   RAMGSEDFADFLLHAPGAFFTLGHSGTVPAHNPGFIVDDAILPVGATLFARLVESRLKA
FT                   A"
FT   gene            593414..595048
FT                   /gene="dppAch1"
FT                   /locus_tag="Arad_7672"
FT   CDS_pept        593414..595048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppAch1"
FT                   /locus_tag="Arad_7672"
FT                   /product="dipeptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7672"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29126"
FT                   /db_xref="GOA:B9JNJ5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023920"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNJ5"
FT                   /protein_id="ACM29126.1"
FT                   /translation="MTIARNLKTLTLLGFVSLALPQAAFSAEDNKPVQGGTLIYLEQQA
FT                   HTNLYPPAGGFYPNGGILNQITDKLTYQNPKTLQVEPWIAESWVVNDSATEYTFKIRKG
FT                   VTFSDGTPLDASAVAKNYDTFGLGNKELKQPASEVINNYDHSEVVDPYTVKFYFKKSSP
FT                   GFLQGTSVIGSGLVSLKTLALPFDQLGDATKIIGSGPFVVESETLGKQLALKARTDYNW
FT                   GPAKLEHQGRAYLDGIKYIITGEDSVRIGALLSGQADFIRQLQAYDEKQVSDQSFAIYA
FT                   APTRGVNDSVAFRPDNPFVADIKVRQALLHATDNKEIVETLFSANYPQAKSIISSAAAG
FT                   YEDLSSKLTYNPALAEKLLDEAGWTKGSGGVRQKDGKPLALAVYESLPQPQNKAVLQLV
FT                   AQQWAKIGVKLQVLAGTSGNVVTDTVDPTKTPLVVAEVGRADPDVIKSQFYPKNRDALL
FT                   QKGGLNSKATFFDEELNGILETVASETDSSKRLAAAKAAQEYLLDQAYVIPFFEEPQVF
FT                   AGAPYVKGIAFEAVGRPAFYSTWLAEH"
FT   gene            595109..596053
FT                   /locus_tag="Arad_7673"
FT   CDS_pept        595109..596053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7673"
FT                   /product="peptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7673"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29127"
FT                   /db_xref="GOA:B9JNJ6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNJ6"
FT                   /protein_id="ACM29127.1"
FT                   /translation="MTRYILSRIGQSLLVLWAAFTVSFVLLQSMPGDAVLIKFQSPDYG
FT                   LSPEQLADIRAAYGADGSILQQYVHTIWNFLTGHFGYSLQAGVAVSTLIATNLPSTLLL
FT                   AGFGFLVAAILAVLIAVLSNLPGLAWLRGAIQSLPSLFISVPTFWLGIMFIQIFSFRFR
FT                   LVPVINPGPWEGLVLPILTVAVPISAPLAQILLKNIDEVLTRPFVPVARAKGLSHMQVL
FT                   WRHVAKNTLLPVLTVAGLLLGQLIASAVVTETVFGLNGIGGLTKQAVDSQDVAVLQAIV
FT                   VIAATAFVTINLVVDLLYPVLDPRLKAKLGTTR"
FT   gene            596050..596964
FT                   /gene="dppCch1"
FT                   /locus_tag="Arad_7674"
FT   CDS_pept        596050..596964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppCch1"
FT                   /locus_tag="Arad_7674"
FT                   /product="dipeptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7674"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29128"
FT                   /db_xref="GOA:B9JNJ7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNJ7"
FT                   /protein_id="ACM29128.1"
FT                   /translation="MTIFETAERHHNTDAADPIDSAQVTPLDGGEGQAEARRFSLRIQP
FT                   GLVLACLVLALVVLWAILPGVFTVYDPVQGLPGQHLRPPSATHLLGTDSLGRDLYARIV
FT                   YGSVHSLSGAFAAVCIALVVGTALGVLAGSLGGRLETAIMRLVDVMLSIPDLLLSLSII
FT                   VLLGFGTVNAAIAVGITLIAKFARLVRSEVVTVRRSDYVEAAFGSGGTFFKVLWRHILP
FT                   NSLTSVIAFAALQAGWAILQLSTLGFLGYGAPPPTPEWGLLIAEGRNYIATAWWLTAAP
FT                   GIVVVLVVISINRISRAIGSVNR"
FT   gene            597009..598643
FT                   /locus_tag="Arad_7675"
FT   CDS_pept        597009..598643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7675"
FT                   /product="peptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7675"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29129"
FT                   /db_xref="GOA:B9JNJ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNJ8"
FT                   /protein_id="ACM29129.1"
FT                   /translation="MDVSGLTIAYRDRSGSRPAVHGIDFKVNAGEVVALVGESGSGKSS
FT                   TAQALIGLLPEGGLLQQGSIRLNGQDIAGWPQKRLDGIRGSVISLVPQDPGNSLNPVRT
FT                   IGDQVAEILIIHGRASGAAAYLQAIELLERVGLNQPRLRAKQYPHELSGGMRQRVLIAI
FT                   AIALKPSLIIADEPTSALDVTVQKHILDLIDDLRREYGTAILLVTHDLGVAADRSDRLI
FT                   VLQHGRIQEQGRTADIVRNPQSAYTRRLLADAPSLNARVPRAARPDTTASKPADDIIVV
FT                   DGLVQDFGPGGKGGSFRAVDGLSFRVRRGTTHAIVGESGSGKTTAIRIVSAFQRPTAGK
FT                   VFINGLDLSSLRGETLRLFRKKIQLVYQNPFSSLDPRQTIAKIVEEPLLNFERLPQADR
FT                   LARVTATIEKVGLPADVLQRRPHALSGGQRQRVAIARALVLDPEILVLDEAVSALDVTV
FT                   QAQILSLLDELQRELGLTYLFVSHDLAVVRQISDTVSVLNDGKLVEGGPIDDVFGNPQN
FT                   AYTRELIDAVPGKKFPRLLEPTHSNAG"
FT   gene            598633..599697
FT                   /locus_tag="Arad_7676"
FT   CDS_pept        598633..599697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7676"
FT                   /product="oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7676"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29130"
FT                   /db_xref="GOA:B9JNJ9"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR024003"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNJ9"
FT                   /protein_id="ACM29130.1"
FT                   /translation="MQDDPMSTPASPKRLGFFSRVLDQVDVATRYRLVSEQIIHAEAQG
FT                   FDSAWVAQHHFNGEEGGLPSPLVFLAGLASRTSRIRLGTGVITLPMEDAVRVAEDTAVL
FT                   DILLDGRLEVGVGTGGTPQAFLPFGLESADRGLIYGQHLTLVRDAWAGGELAGGNRLYP
FT                   TAPHLRDRVWQATFSVGGGERAGLAGDGLMLSRTQPRPPETPDAELWDLQNPIIDAYLA
FT                   ALPDGRSPRILGSRSLFVADSRKQALHFAEIGLRRSIERFTASGFTIRGETTTDLIKAF
FT                   DVHVGTPEDVIASLQVDTALARVTDLVFQVHSVDPPHEHILRSLELIAAQVAPALGWTP
FT                   RAPALSERRFATKA"
FT   gene            599728..600336
FT                   /locus_tag="Arad_7678"
FT   CDS_pept        599728..600336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7678"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7678"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29131"
FT                   /db_xref="InterPro:IPR023982"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNK0"
FT                   /protein_id="ACM29131.1"
FT                   /translation="MTSPITDVIDLLVGITAGSPLDRLRAERPETRLNAQKSYQALFEP
FT                   AHQGDVTQDERLAIAVFVADLHAATDISGFYASGLTDKALATAVGAEVEKGRTHGPYGR
FT                   YPAGPLSSEDRAGLVYEVSGDSRNALGPKLAAALEHSHLLVFRPRESNAGALQKLLDAG
FT                   WTTTGVVTLSQIVAFLAFQIRVVTGLKALATATAQSLSA"
FT   gene            600359..600961
FT                   /locus_tag="Arad_7679"
FT   CDS_pept        600359..600961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7679"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7679"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29132"
FT                   /db_xref="GOA:B9JNK1"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR010195"
FT                   /db_xref="InterPro:IPR023923"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNK1"
FT                   /protein_id="ACM29132.1"
FT                   /translation="MTDTVIHPEIENRPNVFTQAEIGWTPWLEPLVEGDLTERHWAGLV
FT                   DASRSKSPYFMLLARDPEILQARTKTDKDIFYNVAAGLPRADRELAATAASRTNGCIFC
FT                   ASVHSRFASHHSKRTEDVQRLLDEGTETDLGSRWNALVSASSTLSETPAEFGTADIGKL
FT                   RDEGLSDLEIADLIHASAFFNWANRLMLSLGEPTPAK"
FT   gene            601162..602766
FT                   /locus_tag="Arad_7680"
FT   CDS_pept        601162..602766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7680"
FT                   /product="oligopeptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7680"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29133"
FT                   /db_xref="GOA:B9JNK2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNK2"
FT                   /protein_id="ACM29133.1"
FT                   /translation="MTINRRQFNQLLLLSGASLAFTGIPDIGEAAGEPPVRGGTLNWAY
FT                   YPDPTSLIAINTSSGTGQAIGPKINEGLFDFDYDLNPIPLLATEWSVSEDGLRYTFKLR
FT                   QGVKWHDGQDFTSEDVNFTIFRLREAHPRGRITYQNVTAVETPDPYTAIIVLSKPAPYL
FT                   ISALSSSESPIVPKHVYEKFKPEQQPNLAQTIGTGPFILKEWVPGSYLIFDRNPDYWDA
FT                   PKPYLDRVVLRVILDPAARAAALETGEIDIGANPVPLSDIERLKTNPNLVVDTTTYAYS
FT                   GPQQQLFFNYENEILNKREVRLAIAHAIDLQKLVDIALYGYGQVSPSPISTALPKWYDP
FT                   SIKAREPDPKLAEKLLDEAGYPRGAAGKRFKLRLAYNSFLTPAYADFIKQSLAVIGIDA
FT                   EILKLDLATFLKTVYTDRAWDIVIESLSNTFDPSLGVQRAYWSKNFKIGLVFSNASHYS
FT                   NPEVDRLLEAAATEPDEGKRRALWYQFQHIIHEDVVSVDLVAAGAQIVANKKVRNFAPG
FT                   AQGINNSFGQIWLSPTA"
FT   gene            complement(602824..604047)
FT                   /locus_tag="Arad_7681"
FT   CDS_pept        complement(602824..604047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7681"
FT                   /product="FMNH2-dependent monooxygenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7681"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29134"
FT                   /db_xref="GOA:B9JNK3"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNK3"
FT                   /protein_id="ACM29134.1"
FT                   /translation="MTQIDLAWGAGPTLRYDELAERFRPVFARIRSSAIERDLVRELPH
FT                   EQIGWLKESGFTTLRLSADDGGFAATLPELFNLLIELSAADSNVTNALRSHFGFTEDVL
FT                   NSSVVAWRSEWLRRIAARELIGSGFSEVGEAKVGSFSTKLTRNGDHWLLNGAKYYTTGS
FT                   LFADWINLGGNDENGEPIGVLVPRQAQGVDVVDDWDGFGQSLTASGTALFSDVVIKAEL
FT                   VTPPGGRFKYSAAFFQLVHLATLAGIGRAAATDVARLVSERKRIYSHGNASSVSEDPQI
FT                   LQVVGRVRGAAYSAGTIVLKAAEALQRAYELRSHVDPTISERANAIAEIEVNQSVHAVT
FT                   SLILEATTLLFDALGASATKRGLGLDRYWRNARTISSHNPRIYRDRIVGDFAVNGTPPP
FT                   AQYKIGQI"
FT   gene            complement(604127..604438)
FT                   /locus_tag="Arad_7683"
FT   CDS_pept        complement(604127..604438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7683"
FT                   /product="desulfurizing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7683"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29135"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNK4"
FT                   /protein_id="ACM29135.1"
FT                   /translation="MKGTTMTSNAISEIWYTRCPVPTPVGLAAQLGYLEETFRKDGVTL
FT                   NSIIDSPDRDVCQSYFDHTLGWSFRHGANLPPIRARSEGIVDFMRNRVERAGFSAFVE"
FT   gene            complement(604435..605613)
FT                   /locus_tag="Arad_7684"
FT   CDS_pept        complement(604435..605613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7684"
FT                   /product="monooxygenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7684"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29136"
FT                   /db_xref="GOA:B9JNK5"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNK5"
FT                   /protein_id="ACM29136.1"
FT                   /translation="MSIQHQPGSFVGLPKFAAPTDFPESPLSQALKQPVLLGLFLPIQA
FT                   GGWTQSTLERSTDWRFDYNKALTLRAEELGFDLVFALSQWLPKGGYGGVFDGQALDSFV
FT                   SIAALAGLTKKIMLISTMHVLYGPWHPLHLAKFGATLDHITGGRWGINVVTGHRAVEHE
FT                   MFGWPRIEHDKRYDLAAEFLEVLQRLWSDTENFSYEGESSWKLGGGFVTPKPNYGRPIL
FT                   VNATGSDAGIAFAGRYSDIVFITSPTGADIDSALQSLPAHTKRVKDTAISVGRSIRTLL
FT                   NPMVICRPTEKEAWALADKIVAHADQRSPQGFQSLNSDAHAWKGRDAQDPYRSVGGNIR
FT                   VIGSPEQVVDQFLKLKAAGVDGLQLSFFDFRDDLDFFGSDVLPLMKQASLRN"
FT   gene            606087..607076
FT                   /locus_tag="Arad_7685"
FT   CDS_pept        606087..607076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7685"
FT                   /product="oligopeptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7685"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29137"
FT                   /db_xref="GOA:B9JNK6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNK6"
FT                   /protein_id="ACM29137.1"
FT                   /translation="MSAYRRIARTIRRTVIQAVPTMLGIVILNFFLLKLAPGDAADVMA
FT                   AEAGSATVESMAALRSRFGLDNPILVQLVDYLNNLAHFSLGFSPRYGMPVADLIGQRLP
FT                   GTLMLMLAALAIAITVGLILGSLMATFAGRIPDRLISIVSLLFYSIPGFWIGLMLILFF
FT                   SVKLGWLPSGGDSTIGSRLTGLPALLDRARYMILPATSLSLFYLAIYARLTRASMLEVK
FT                   SQDFVRTARAKGVSPFFVTTRHVLRNALIPITTMAGMHFGGMLGGAVVVETVYSWPGLG
FT                   RLAFEAVMARDFSVLLGILLLSSFLVIVANAAVDLLQAWLDPRIGASR"
FT   gene            607073..608074
FT                   /locus_tag="Arad_7686"
FT   CDS_pept        607073..608074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7686"
FT                   /product="oligopeptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7686"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29138"
FT                   /db_xref="GOA:B9JNK7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNK7"
FT                   /protein_id="ACM29138.1"
FT                   /translation="MNTYKLRPYTGEPIELVAATTEPEPVAEPRPVARWAHIHAPDARI
FT                   ASVGKQRWRGARREVKVFLANPNALFGLAFLAAVALAALLAPVFYPGDPMEMVSRPFLW
FT                   PGQNGAYPLGTDSMGRDVLAGILHGARVSLLVGIAATLLGLGAGITIGALAGYFGGLVD
FT                   DLLVKLIEIFQTIPSFVLLVVLVAIAQPTTTTVTIAIALVSWPTVARLTRAEFRAIHEK
FT                   DYVLAARSLGFGHGRIIFREILPNALPPLIVTSSVMVASAILMESALSFMGLGDPNQVS
FT                   WGSMIGSGRDVIRTAWYLTALPGLAIVFTVLALNLIGDGLNDALNPRFAEER"
FT   gene            608076..609071
FT                   /locus_tag="Arad_7687"
FT   CDS_pept        608076..609071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7687"
FT                   /product="oligopeptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7687"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29139"
FT                   /db_xref="GOA:B9JNK8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNK8"
FT                   /protein_id="ACM29139.1"
FT                   /translation="MPALLDVRDFSVRFAAAEPVKGVSVSVTPGEMLAIVGESGSGKSL
FT                   TALGLMGLLPRQAKAGGQILFDGRDLLTLPEKELRRIRGRDIAMIFQEPMTSLNPVLTI
FT                   GDQIVEVLRIHEDLSRKQARARAIELLDLVSIPDAARRVDDYPHQLSGGMRQRVMIAIA
FT                   VACDPKLLIADEATTALDVTIQAQVLQLLDDLRSKLNMAVILITHDLGIVAQWADRVVV
FT                   MYAGRKVEEGLPDVVFETPYHPYTQGLLAASPRLNANYHYRDGRLSEIPGSVVSAAGET
FT                   GCSFRPRCPVARASCSSSVPPLLHLPAGRQVACPFGSSLTEAAHAVAIGR"
FT   gene            609049..609984
FT                   /gene="appF"
FT                   /locus_tag="Arad_7689"
FT   CDS_pept        609049..609984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="appF"
FT                   /locus_tag="Arad_7689"
FT                   /product="oligopeptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7689"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29140"
FT                   /db_xref="GOA:B9JNK9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNK9"
FT                   /protein_id="ACM29140.1"
FT                   /translation="MPLLSVDRLSTHYSANAGTVRAVDDVSLEIGEGETVALVGESGCG
FT                   KSTLGKSLMRLVNPSAGRVTFKGRDVSAMSAKELRSIRRNIQMIFQDPFASLNPRQTIR
FT                   AILTAPLAVHGIGDRKRRDQIAASMVEHVGLPPDALDRYPHEFSGGQRQRIGIARALIL
FT                   QPELVICDEPVSALDLSIQAQILNLLVEMKTELSLSYLFISHDLSVVRYFADRVLVMYL
FT                   GRIVESASTSALWTGAKHPYTQALLAAVPDPSRRRQAAPITGDLPSPHNPPSGCRFHTR
FT                   CPLATDLCRAEDPALRQFHGDHAVACHHAQ"
FT   gene            609998..611056
FT                   /gene="mocA"
FT                   /locus_tag="Arad_7690"
FT   CDS_pept        609998..611056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mocA"
FT                   /locus_tag="Arad_7690"
FT                   /product="oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7690"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29141"
FT                   /db_xref="GOA:B9JNL0"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNL0"
FT                   /protein_id="ACM29141.1"
FT                   /translation="MVDYRYLGRSALKVSPLSLGTMMFGGPTPDDVAFRIIDKAREQGI
FT                   NFIDTADVYHDGKSEEVVGRGIKNHRDHWVLATKFVNSHKKGPNLGGHSRKWVIETVEN
FT                   SLRRLKTDYIDILYFHRAVFDAPLEEPVRAIADLIRAGKLRYFGVSNFRGWRIAEVAQL
FT                   ADQLGIDRPVASQPLYNIVNRTAEAEQLPAAHHYGLGVVSYSPLARGVLTGKYEPGQAP
FT                   GSDTRAGRGDKRILETEWRPESIAIAKEIAAHATRKGIAPTEFALAWVLNNKLISAAIT
FT                   GPRTEEHWDSYIRALDVKLDAEDEALVDRLVTTGHPSTPGFNDPSHPLEGRVPRSNLSA
FT                   SENVVPLARAVA"
FT   gene            611126..612367
FT                   /locus_tag="Arad_7691"
FT   CDS_pept        611126..612367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7691"
FT                   /product="FMNH2-dependent monooxygenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7691"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29142"
FT                   /db_xref="GOA:B9JNL1"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNL1"
FT                   /protein_id="ACM29142.1"
FT                   /translation="MPTIAPAIQPVQAASRSRDLTALLAKVPELATEIAKEAARRDLER
FT                   ELPFEAFRLFREAGLGTLRIPVDLGGPGGSVVDYIEMIMTIGAADSNVAHALRSHFNFT
FT                   EGLLLNPNTALDRTQLSRVLSGKLFGGAHTEQGTKRPGEVTTRLTKFGDSYRLNGRKWY
FT                   ATGTAFSDFAFFSARNDDDQLVGVLLPVDRKGITILDDWDGMGQRLTASGGVLLEDVEV
FT                   LPHEISTRGLNTLVGRHVSTLRQLHLAASMAGAVRGVLAEGMDYVRRQARSTAHSAAET
FT                   ANADPFVQKILGEIAAGSFAVDTLIRESARALDRTVAAFGEGDPQQLEAALVESALTTA
FT                   RTQVVTSQLALAAATNVFELGGGSATSRYLNLDRHWRNIRTLLNHNPLLHKARVVGDYY
FT                   INGTTTHLEEGKVF"
FT   gene            612651..612869
FT                   /locus_tag="Arad_7694"
FT   CDS_pept        612651..612869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7694"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7694"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29143"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNL2"
FT                   /protein_id="ACM29143.1"
FT                   /translation="MQIIDMILAYVRLVVFDKGFRLNILDHKTAGSKESAGNYSNKNVP
FT                   DSSIYWLIRSLHDLLGVPRRYKENKLV"
FT   gene            complement(613061..613405)
FT                   /pseudo
FT                   /locus_tag="Arad_7696"
FT                   /note="conserved hypothetical protein; Frameshift
FT                   (pseudogene)"
FT   gene            complement(614203..615813)
FT                   /locus_tag="Arad_7697"
FT   CDS_pept        complement(614203..615813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7697"
FT                   /product="oligopeptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7697"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29144"
FT                   /db_xref="GOA:B9JNL3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNL3"
FT                   /protein_id="ACM29144.1"
FT                   /translation="MNIRRRQFNQVLAFATIGTVAPLGRFARAAEPAAGGTLTLLVQPE
FT                   PPTLVTLAHTAGPTTRVSGKVTEGLLAYGLEDFKPIPQLATEWQVSDDGLQYTFKLRQG
FT                   VKWHDGKDFTSADVAFSILALKEVHPRGRATFSSVTEVATPDDHTAIIKLSKPAPYLLG
FT                   ALQASESPIVPKHVYEGSTDLPGNANGRAPVGTGPFIFREWVVGSHVILDRNPDYWDKG
FT                   LPYLDRIVIKFIPDASARLAALETGEVDIAPDTPVSLSEIDRIKTLPTLSVEDRGNDYS
FT                   PTVYRIEFNLANKYFQHDKVRQAIAHAIDRQKIADIAFYGYAIPAPSPISPYLKTFYNP
FT                   DVPIYAFDQAKAETLLDEAGFPRGADGIRFEVPHDVMPYGDTYSRIGDYLRDTLSKIGI
FT                   KVDLRGQDVPTWLKRVYTDRDFAFVTGGMGNTFDPTIGVQRLYWSKNFKKGVPFSNGSG
FT                   YNNPEIDSIFEQAAVENDHAKRVELFNRMQVIIATDLPDITLVSFRQLTILNKKVQDHT
FT                   VVADGLSGSLSNAYLLKNA"
FT   gene            616078..617106
FT                   /locus_tag="Arad_7699"
FT   CDS_pept        616078..617106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7699"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7699"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29145"
FT                   /db_xref="GOA:B9JNL4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNL4"
FT                   /protein_id="ACM29145.1"
FT                   /translation="MCCNRPMMTIANPRKKSIQPTLARLPPLTSLRAFVATARHLNFLR
FT                   AAEELHVTSAAVGQQIRLLEDYLGQPLFHRTRGQLQLTSAGQALVPGLTDAFDAVLGAM
FT                   TQFAASDHEQPIRVSVAPSFASKWLIPRLDGLRRAAPGLQVLVDASAQLTDLDSGDADC
FT                   VIRYGSGAYPGLVVDHLFSEAVIPICSPEFAERHWLRNGPKAIEGVPLLHEDGAEHDHS
FT                   CPDWNAWLRAEGLSYRLSQGGFRLSQSSLVIDAALAGQGLGLGKVRLAEAELRAGRLVS
FT                   PFGSPQPVSFSYFFATTATKARLMRVDLFRNWLQAEAKTLQAVDEVLTWNTRPDLSIIA
FT                   AE"
FT   gene            complement(617116..617964)
FT                   /locus_tag="Arad_7700"
FT   CDS_pept        complement(617116..617964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7700"
FT                   /product="oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7700"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29146"
FT                   /db_xref="GOA:B9JNL5"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR016446"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNL5"
FT                   /protein_id="ACM29146.1"
FT                   /translation="MTSLAPVRTEEDDRLTVLATERYRNDQRLSGDWNETLDTLLSHRS
FT                   VRNYLPKAVPDSVLHLAIAAAQSAPSSSNLQAWSVVAVKDEARKSRLNTVAGTQRQITQ
FT                   APLLLIWLADLNRPRNIAAEGGSSAEGLDYVESFLLGVIDAALAAQNAVSALESLGLGT
FT                   CYIGAIRNDPELVARELELPEGVFPVFGLTVGYPDPAVPAGVKPRLPQTTVLHREHYDT
FT                   TPRPEDLRDYNAALGSFQAEQSLPLADWTELVKNRIGTVEALKGRHLLGAAVRKLGFKL
FT                   K"
FT   gene            complement(617978..619309)
FT                   /gene="ntaA"
FT                   /locus_tag="Arad_7701"
FT   CDS_pept        complement(617978..619309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntaA"
FT                   /locus_tag="Arad_7701"
FT                   /product="nitrilotriacetate monooxygenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7701"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29147"
FT                   /db_xref="GOA:B9JNL6"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNL6"
FT                   /protein_id="ACM29147.1"
FT                   /translation="MNAKRQLHLNINILHSGFSPAAWRMEGSDPRASFDINHYVNVARV
FT                   AERGTFDAIFLADQAAISDRVDFRPLTSLEPTIVLATVAAHTDRIGLIATASTTYNEPY
FT                   NIARRFATLDHASGGRVGWNIVTSADLSQSRNFGLEKPVAHGSRYERASEFTTVVKALW
FT                   DSWEEEAFLGDVATGRFVDPTRVHAIAHRGKHFSVHGPHNIPRPPQGHPVLVQAGGSDD
FT                   GRQLAAEHAEAVFSASQSFEEALDYAGDLRARAARFGRAPDSLLVLAGLATIIGSTEAE
FT                   AKRRQEELRELIPLEYSLARLSGVLQIDPKRLTLDEPLPDDIPLPPDGGHTFFQATLAL
FT                   ARRDQLTVRGLIRALNGGTGHRTIIGTPQAVADDIETWFRSGAADGFNLMPDVLPHGLE
FT                   VFVDEVVPILRRRGLFRQDYAGRTLRDHLGLARPANPYAIAAAE"
FT   gene            complement(619306..620529)
FT                   /locus_tag="Arad_7702"
FT   CDS_pept        complement(619306..620529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7702"
FT                   /product="acyl-CoA dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7702"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29148"
FT                   /db_xref="GOA:B9JNL7"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNL7"
FT                   /protein_id="ACM29148.1"
FT                   /translation="MTVKPAGFELPLLSPTLFAPDTTNPYLAKAVELRDIFARDAIERD
FT                   QQGGRPEEQVRLLKESGLVNLLIPREFGGIGERYSTAMRIVREFAKVDGSIGHLYGYHF
FT                   SPLQNTVTASSDSYSAGILRRSAAGRWFWGNTTNSFSKSLFGRRESDGGVVLNGFRPFA
FT                   SGSHVADYLTVAWEDEETNQRSTAYIPPSREGITIADDWDGIGQRQTGSGKVFYKDVKI
FT                   RADEILPERPRDAIALLTPMQQQSVLLNVFIGSAQGALIAARDYTITKSRPWIHSGVER
FT                   HQDDPWIKRQYGELWIKVQAATALADRALTALDDAYAKGTNLTAEDRGKTTIAVASANV
FT                   LAGRVALEVTSEIFEVMGARSAVRPYGFDRFWRNVRIHTLHNPAEYKTRNVGNWFLTGE
FT                   FPEPGIFQ"
FT   gene            complement(620543..620884)
FT                   /locus_tag="Arad_7703"
FT   CDS_pept        complement(620543..620884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7703"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7703"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29149"
FT                   /db_xref="InterPro:IPR021439"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNL8"
FT                   /protein_id="ACM29149.1"
FT                   /translation="MARDKLFLISPGFSDPKHPGTTFACPHCNAIEGLLASFPDLAARI
FT                   DVERVPFARPRQKVIDAIGEENQSLPVLILAGEAPADAGDRNGTRFVSATDRILELLSE
FT                   RHGFPRLHK"
FT   gene            complement(620895..622250)
FT                   /locus_tag="Arad_7704"
FT   CDS_pept        complement(620895..622250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7704"
FT                   /product="monooxygenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7704"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29150"
FT                   /db_xref="GOA:B9JNL9"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNL9"
FT                   /protein_id="ACM29150.1"
FT                   /translation="MARRKDKIKLGAFLLFTGHHVAAWRHPQASVGTEFENYIELAKLA
FT                   EAAKFDAIFFADGVAARLKDVDAASRKAHSGVYPFEPITLLSALSSVTKNIGLIATAST
FT                   SYSDPYNLARQFGSLDRLSGGRAGWNLVTSSDPDAAYNFGHDTQILHGDRYDRAEEFAD
FT                   VVLGLWDSWDDDAFVRDRESGRYFDPEKLHRLEHKGLHFKVRGPLNIPRSPQGRPVVVQ
FT                   AGASEPGKELAARTAEAIFAAQITLEEATAFYADVKGRLAKFGRSHDDLKILPGIFPVI
FT                   GRSEAEAQEKFEALQELIQPEVGLNLLSQLSGVDLRSYPLDGPVPLDPPVTNAGKSRQE
FT                   LLLDLARRENLTIRQLYLRIAGARGHWQVVGTPTQIADVLEERFENYGADGFNIMAPIM
FT                   PGDLADFINLVVPELRRRGLFRQEYEGSTLRENLGLKRPPNRFSAGNAVAAE"
FT   gene            complement(622262..623614)
FT                   /locus_tag="Arad_7705"
FT   CDS_pept        complement(622262..623614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7705"
FT                   /product="acyl-CoA dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7705"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29151"
FT                   /db_xref="GOA:B9JNM0"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNM0"
FT                   /protein_id="ACM29151.1"
FT                   /translation="MRIDQEPDACTRLELNMAIRKEFLLTRSNRYCWTCGISRRTLTHD
FT                   AKQGRQGQMREATMSFEPDTTDPLVARSVELRRIFDRDAVQRDKQGGRPVEQIRLLKES
FT                   GLPSAQIPRHYGGQGASWLSILRVVREFARTDGSLAHLFGYHHLPLNLVLFRGSSAQKD
FT                   HWLRAAAAGNLIWGNSGNAMSKTSSGRRIDNGWIVSGKRPFSSGSHIADYIQISWENPE
FT                   GERITAAVPTGRDGIVIEDDWDGIGQRQTGSGTVSFHNVEVLDDEVISAPNVPLTPYTS
FT                   LISLLQQSVLLNVFVGSAQGALDEGQNYTTTSSRPWIYSGVEKHSDDPWIKRQYGDLYI
FT                   KTLAATELADKAARSLDEAFNQGPSLSHEDRGIAAIDVATANVYAGEIGLAVSSEIFEV
FT                   MGARSATNANGYDRFWRNVRTHTLHNPAEYKKRTVGTWLLTGEFPIPAMYR"
FT   gene            623828..624670
FT                   /locus_tag="Arad_7706"
FT   CDS_pept        623828..624670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7706"
FT                   /product="aliphatic sulphonate ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7706"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29152"
FT                   /db_xref="GOA:B9JNM1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNM1"
FT                   /protein_id="ACM29152.1"
FT                   /translation="MSDPLHLKISHVMRRFQVNGESLTALDDVSLDIAEGEFVTIVGAS
FT                   GCGKSTLLRLGAGLDTATSGSITHAGKPVTEPSLDRGIVFQEPRLFPWLTVARNVALGL
FT                   ENSGHSKADKKRLVEEHLELVGLSGFAKAYPHQLSGGMAQRAGIARGLVNRPDVLFLDE
FT                   PFGALDAITKARLQDELQEIWAKERITMVLVTHDVDEAAYLGDRVVVMSPRPGRIREIV
FT                   PVDLPRLRARTSPALTEVRNRVLESLNATTHSSPSLRAVSPGGGQRPADARPAIAAVR"
FT   gene            624692..625768
FT                   /locus_tag="Arad_7708"
FT   CDS_pept        624692..625768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7708"
FT                   /product="sulfate ester transport system substrate"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7708"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29153"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNM2"
FT                   /protein_id="ACM29153.1"
FT                   /translation="MKLASISRLAAGVALALGMFAASAQAEEPLVIHIGYAAIGVDNRP
FT                   YSEGTSAATARAGEYLEKEFANDPNVKIEWTFFKGAGPAVNEGFANNQLDFAYQGDLPA
FT                   LIGRATGLKTKYLLASGARKPLYLAVAKDSGIKKIEDLKGRKIALQRGTNGHLAAIKIL
FT                   EAHGLKERDLQVINLDSAGTVAALVSKDIDAAFGDTQLINLAAKGSADVIYTTKGDDPH
FT                   FGRNAGIVAREAFIDAHPEITQRVVDAFVKAAQWSSEEPNRAALFELWHKSGTEIPILE
FT                   EYFRNDTLVYRNSPLIDDLLVSQYKEQAVKSKEYGLIRRDVDLNGWFEPKYLNNALEKL
FT                   GLKTFWQPYGADGKPVAS"
FT   gene            complement(625735..625833)
FT                   /locus_tag="Arad_7709"
FT   CDS_pept        complement(625735..625833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7709"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7709"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29154"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNM3"
FT                   /protein_id="ACM29154.1"
FT                   /translation="MRGSLEKRGHARSLYSVFKARDQDATGFPSAP"
FT   gene            625909..626622
FT                   /locus_tag="Arad_7710"
FT   CDS_pept        625909..626622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7710"
FT                   /product="aliphatic sulphonate ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7710"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29155"
FT                   /db_xref="GOA:B9JNM4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNM4"
FT                   /protein_id="ACM29155.1"
FT                   /translation="MLVLWWVASARGWLPQQILPPPDYVYQAARDLIVSGELLYHTGVS
FT                   LRRVIIGFAIGASAGLVLGISMGLSERVEDYVKPLFLAFAQIPTLGWIPLLMLFVGIDE
FT                   TLKIIIIAKGAIVPMTLNTLTGIRGVSPRYLEVGRALRFSRWQTLRLIVLPGAVPSIFT
FT                   GIRYGLTHSWTSLVGVELLASSEGLGYLLVWGRQMFWLDTVIVAMIAIGLVGFIMDKSL
FT                   DRTEVLLQRWKRQEI"
FT   gene            626601..627401
FT                   /gene="tauC"
FT                   /locus_tag="Arad_7711"
FT   CDS_pept        626601..627401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauC"
FT                   /locus_tag="Arad_7711"
FT                   /product="taurine uptake ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7711"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29156"
FT                   /db_xref="GOA:B9JNM5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNM5"
FT                   /protein_id="ACM29156.1"
FT                   /translation="MEAAGDLTMATASRAVRFRRGITLPILMFVAWEVSSRTGLADPRF
FT                   LPSLEEVARTAKRELFDNDLIGELGFSLMRNIAGFLIGCVIGIVFGTFLALSRIADRLL
FT                   APTFNGLKQISLLAWIPLISVWFGFGEQAKIVFVALASFIPIALNTYDGMRDAPEDLIE
FT                   VGRALKFNARQRVLRIYLPSAMPSTATGVHLGLIYAWLATVGAEYFLAVGRGVGGLVIA
FT                   GRERFDMALVMVGVLVLGLVGFSLNRLAHVLESYLLRWRPKQTP"
FT   gene            627530..628534
FT                   /locus_tag="Arad_7712"
FT   CDS_pept        627530..628534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7712"
FT                   /product="oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7712"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29157"
FT                   /db_xref="GOA:B9JNM6"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNM6"
FT                   /protein_id="ACM29157.1"
FT                   /translation="MSYALSLLDKSPIDGPEEASTALARTLILAQQAERWGFHRFWVAE
FT                   HHNNARLASSSPEVLIAFLLAHTSRIRIGSGGVMLQHYSAYKVAENFNLLATLAPGRVD
FT                   LGVGKAPGGLPLSTRALQGAYDPARKPTFAEQLAELGAFLGDEAAEDDPKAGLRAYPVP
FT                   VTPAKRFLLGASIESAELAATHGWEFVYAGHLNGDEALLDKVLATYRDASGGKIPLLAI
FT                   GVIAAETDAAAERLAGDLRRFKVEVTNGQSVTVGSLGQAEEYIRQAGVTDSRIEEKMPG
FT                   VIRGTATHIHGELDRLHRRYGISEFILDCPVAEAQARLISIDLLAATHLAVAA"
FT   gene            628647..629204
FT                   /locus_tag="Arad_7713"
FT   CDS_pept        628647..629204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7713"
FT                   /product="GCN5-family N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7713"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29158"
FT                   /db_xref="GOA:B9JNM7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNM7"
FT                   /protein_id="ACM29158.1"
FT                   /translation="MSDSIRIATVDDAPVLHRLLQAAYQPLREMNIQFTATTADVDLVR
FT                   EKVRRHTTFVVERDAAIIATVSVRFPWPMGETHLTSYPFIHWFAVSPDFKRQSIGSALL
FT                   DHVELTFLRDQIKAPAVYLATATRHPWLAGIYERRGYEGFYKHTKNDEEIVLLRKILNP
FT                   DIYETLEVAEYKRFEPQLLAQA"
FT   gene            629246..630880
FT                   /locus_tag="Arad_7715"
FT   CDS_pept        629246..630880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7715"
FT                   /product="peptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7715"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29159"
FT                   /db_xref="GOA:B9JNM8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNM8"
FT                   /protein_id="ACM29159.1"
FT                   /translation="MAVTRRGFIGTAGVVALTVAIGHRAAWAGSNAVPVKGGSLVYGVE
FT                   TEPNTLNPHLNGQAKAKLVLRNAYESLLARTADGGYVPWLAAGYEISDDGKTYTFKLRE
FT                   DVTFSDGEKLDAAAVVLNFTKLKEPLYSGSISAGYLSYVMEAKAADQHTVVLKLDRVYA
FT                   PFLDGVASIDILSPRAFASTQIKSGGPEIAGTRPFILDRYVRGQEIHFVRNPDYKWAPA
FT                   SAGHQGPAYLDEVTYRFLSESSVRTGALISGQVDVIEGISGNDAALFKDNSDFTYQSAL
FT                   NPGTPYTLYLNTTYGPTKDVRVRKAVIAATDVGQIVDSVYRRERTRAWGVLTPADKDFY
FT                   DASIEGSYGFDPKLANQLLDEAGWTARDADGFRTKDGARLSIEIVQAQVTLRDQRDVLL
FT                   QALQAQARQSAGIELILNNVDSGTYSERQKSGKYGAIPNSTTNQGNAVTIYFHYLPPDQ
FT                   GGSINYSRTEAPEVLAWLNKAASTLDAKERFATYADLQRFAIVEQAFGLPLYVPEDQIA
FT                   ASTRVRGVGFRPFKQLPENAYDIWLGT"
FT   gene            630951..632573
FT                   /locus_tag="Arad_7716"
FT   CDS_pept        630951..632573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7716"
FT                   /product="peptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7716"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29160"
FT                   /db_xref="GOA:B9JNM9"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNM9"
FT                   /protein_id="ACM29160.1"
FT                   /translation="MFSRRSFLNATAATLASVLLPITAYAQDGNPVSGGKLVWGVETDP
FT                   ATLNPQLNGQDKTKLLLRNVYESLLARTADGGYVSWLATGYKISDDGKTYTFTLRDGVT
FT                   FSDGEKLDAAAVVTNFTRLKDAAYSGSVSAGPVSRVVDAKAVNAHTVVLTLGDVYAPFL
FT                   DFAASLEILSPKAFTSSQLKSGGTEIAGTGPFILEHYVKGQDIHFVKNKAYNWPPKIAF
FT                   HQGPAYLDEVTYRFLPESSVRTGALTSGQVDVIEGISGNDAGLFKDNPDFSYQTALNTG
FT                   TPYSLFLNVTYGPTQDIKVRKALAAAIDVDAVLKSVYRGERTRAWGITSPIDTQFYDKT
FT                   IEGAYGSDPKLANSLLDEAGWTARDADGFRTKDGKRLTIEVVQAQATVRDQRDVLLQAL
FT                   QAQARQNAGIDLLINYVDAGTYTDRRKTGIFGSIANSNTPTNAIDIEYHYLPLDKGGSI
FT                   NYSRASAPELLSWLKAAASTLDDKERFALYAKLQRFAIVDQAYALPLYEPEDQVAAASY
FT                   VKGISFRPFKQLPESAYDVWRSE"
FT   gene            632630..633631
FT                   /locus_tag="Arad_7717"
FT   CDS_pept        632630..633631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7717"
FT                   /product="dipeptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7717"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29161"
FT                   /db_xref="GOA:B9JNN0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNN0"
FT                   /protein_id="ACM29161.1"
FT                   /translation="MDVENATALRQAPASPVSRRLFPARGTLLSQVLGRVGSGIVVLWA
FT                   AVTLSFVSLHIAPGDIVDLLIGEQLRTPAVEAAIRAEWGLDQPLYSQYLSYLWRILHGD
FT                   FGRSYILQTNVSALVLSQLLPTLKLTAAALVVAVVFAVVSAVATAGRRWSRRIAGGLEL
FT                   VLISTPSFWLGIVLLFVFSFTLKLFPVAGDRTFSALVLPALALGLSLGAVIGQVLREGL
FT                   ERALEEPFALTVRSWGASSVTLRLRHGLRHAALPAVTLTGWLVGGLLSGAVITEQVFGR
FT                   PGLGKVTVDAVLGKDLPVVLAVAILSAFIYVVLSTLVDVLYLFLDPRLRSRA"
FT   gene            633642..634514
FT                   /gene="dppCch3"
FT                   /locus_tag="Arad_7718"
FT   CDS_pept        633642..634514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppCch3"
FT                   /locus_tag="Arad_7718"
FT                   /product="dipeptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7718"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29162"
FT                   /db_xref="GOA:B9JNN1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNN1"
FT                   /protein_id="ACM29162.1"
FT                   /translation="MSLSITVSPAAGLNFRRILVAAVARPGLLAASTFLLLVALGAAWP
FT                   HLLSSYNPIAADPLQAQLPPDAAHWFGTDQLGRDVFSRVVHGARYSILIGVSAVVIAAT
FT                   VGSILGLAAGLARGLVDEAITRFLDVVSAFPDLLLALVLISFTGPGTYNLIFALGVASI
FT                   PRFARVVRAQTFVIAESGYVEQARTFGLAPAVLILRHVLPHAIAQVPILATIGLGTAII
FT                   SAAGLSFLGMGPQPPTPEWGAMLAEGRNYLRVAWWIGVWPGVVITLTVISVSVLGRQWQ
FT                   AAFEGRRRA"
FT   gene            634511..636193
FT                   /locus_tag="Arad_7719"
FT   CDS_pept        634511..636193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7719"
FT                   /product="peptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7719"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29163"
FT                   /db_xref="GOA:B9JNN2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNN2"
FT                   /protein_id="ACM29163.1"
FT                   /translation="MTPLVHVRNLTIAFPGAGEANVVVRALDLTIQRGESVALVGESGS
FT                   GKSVTARSLVGLSGPGATVSADIFDVDGESVLEFRERDWRRLRGHKVGFVLQDALVSLD
FT                   PLRRISQQLSDAIGNRSLLRRRELRDDSAALLRSVGIADSERRLRQYPHQLSGGLRQRA
FT                   LIATAIARQPVLVIADEPTTALDATVQKQILDLLAERRRAGNTLLLISHDLAVVSRLAD
FT                   RVLVMRNGEVVEEGRTQEILSAPRHPYTRQLLDAIPSAHSRGYRLAPASDDAGKPQAEG
FT                   LTKVPAQAKGAERLRIPLPTKQIDARRSLLVAEHLSKRYGSGASASHVVNDVSFRLAAG
FT                   EALGIVGESGSGKTTVARIILGLVAADAGRVLIDGRPWSGLTEAQRRAQRAGIQLIAQD
FT                   ALSSFDPRYTVEKIVGESLDSVGIFGAERRKRVIEILDAVRLGTNFLGRYPRELSGGQR
FT                   QRVAIARAFAPRPKLLVADEPVSALDVSIQAQILDLLAELQAASGTSLLFISHDLGVVH
FT                   HLTDRVVVMKEGRIVETGDVGTVFSAPRHSYTQALLEAIPTLA"
FT   gene            636323..637609
FT                   /locus_tag="Arad_7721"
FT   CDS_pept        636323..637609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7721"
FT                   /product="nitrilotriacetate monooxygenase protein component
FT                   A"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7721"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29164"
FT                   /db_xref="GOA:B9JNN3"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNN3"
FT                   /protein_id="ACM29164.1"
FT                   /translation="MSAWRHKDAVADASINFDYCKALAKKAEEGKIDFLFIADGLYINH
FT                   KSIPHFLNRFEPITLLSGLASTTSHIGLVGTLSTSYSDPFTVARQFSSLDHLSDGRAGW
FT                   NVVTSPLEGSAKNFSRAEHPEHGKRYHIATEFLQVTKGLWDSWEDDAFIRDKETGVFFD
FT                   PDKLHTLHHKGEYFSVEGPLNVGRSRQGRPILFQAGASEDGKKLAAGEADAIYTRQETI
FT                   ELAREFYLDVKRQLVENGRSEDDLLLFQGISIIVGDSAEDAERKYWETAELVTIENALD
FT                   YLGRYFEHHDFKQYPLDAPFPDIGDLGQNSFRSTTDTIKSNARERGLTLRQVALQAATP
FT                   LPSFIGTAETVAKGLQQWFEAGATDGFIVRGGTPTAFDDFVDQVIPILQARGLFRHDYE
FT                   GETLRGHLGLPFPVNRYAATTNEELARAS"
FT   gene            637655..638992
FT                   /locus_tag="Arad_7723"
FT   CDS_pept        637655..638992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7723"
FT                   /product="monooxygenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7723"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29165"
FT                   /db_xref="GOA:B9JNN4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNN4"
FT                   /protein_id="ACM29165.1"
FT                   /translation="MTIAHPRRLKTLVGAGNFAFASNDESPVAGARRSVELARKAEAEK
FT                   ITGLFTADLLHADPDGLSGTTGTQEPIVALAALSQVTSHIGLIATVSTTYHHPYNLARL
FT                   IGTLDHASGGRAAWNAVTSSVGEENFGGDTLPDPAKRYARATEFIEVVNALFDANSPET
FT                   AWRGSSGSISVDPSKLHRIDYRGEHFQVQGPLNVPPPPQGRPVLFQAGQSTEGVTLGAR
FT                   YAEVVYTSQPTLEAAIAFVGELRRQARGFGRGADLPLVMNSFHSVIGESEADVARRLRE
FT                   KHEKIDYQKGRLKLADMLGGDIDLSDLPLDQALPQSLLPEIDSVNRRRGRVEIFRRYVQ
FT                   QGLSLRELIIQAQETGHWSVAGTPEQLADALEERFLAGVLDVISLHGLGNPDQEDLLLN
FT                   GLLPELRKRSLLDMDYLDGDFRTNLELPKPWILHDREAVARQVNGR"
FT   gene            complement(639023..639970)
FT                   /locus_tag="Arad_7724"
FT   CDS_pept        complement(639023..639970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7724"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7724"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29166"
FT                   /db_xref="InterPro:IPR007893"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNN5"
FT                   /protein_id="ACM29166.1"
FT                   /translation="MLRAIGFLLFSLLPSLCLAQSCSFTATDMSFGPVDTLTGGPVNST
FT                   ATISVSCTGDLLTQRRILICPGIGAGSGGASSAAARQMLNGTHTLNYQLYSDSGRSIVW
FT                   GSNNWAYPAKPPAYAVNLNLLGFVNSSTTLYGTVLGSQGAAAPGPYLSAFATADTYFIY
FT                   RYSADTTCDAPAGTLTGVSFNVNANVAANCLVSVGNVDFGTRGVLSANVDATGSVTATC
FT                   TAGTTYTISLGGGLANAAPTARKMSKAAETVTYGLYKDTNRSQPWGDATTPGSTVAGTG
FT                   TGAAQVLTVYGRVPPQTTPTPGTYTDTVVVTLTY"
FT   gene            complement(639986..642400)
FT                   /locus_tag="Arad_7725"
FT   CDS_pept        complement(639986..642400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7725"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7725"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29167"
FT                   /db_xref="GOA:B9JNN6"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNN6"
FT                   /protein_id="ACM29167.1"
FT                   /translation="MPISQSRSASLWIAIACSIFCVSALHAQEVPNEPATANTDDMPAD
FT                   ARDLFLEVFINDASMKMIGNFKQQPDGSLKASAGELREVGIKPPAGAADDELIELDKLP
FT                   DLSYRVDAQNQQIYVTTTNSGRAARIINIGKNQRNDIPEPQSGYGSVLNYSLFASSNSL
FT                   GDSDAGLFQGISGSFDARVFSPYGALSQSFIAGYSDGSLDGITRLNTTWSYSDPKKLIT
FT                   YRVGDFTTGGLSWTRPVYFGGIQAQRNFALRSDLVTEPLPAFEGTAAVPSTLEIYTQNV
FT                   RSYSGDVPAGPYQVTNLPVFSGAGEARVVLRDSLGRETTATLPFYSSNRLLRQGLHDFS
FT                   VEIGAPRRNFGIESSDYDGRIMGVATARYGLTDWLTLESHFEGGANLLNGGIGAAFPIG
FT                   AWGVASAAVAGSSSGSRSGALFNATLEMSYNDWSIYTRMQRAFDNYDDIASVTAEPTSN
FT                   GSGQFTVLSAGVPRAIDQITLSVPAPLDLSSLNLSYTRFENADGRKSQIAGLSYSQTFK
FT                   RASFYATAFADLDDRKSFGIFAGLSIPFGNNISASTGIESGPDGFNVVADISKSEQPED
FT                   GSIGWRARTSEGKDANRQASMSYRAPFARFEAGVQQYDGNVRATGQMDGAIAVAGGDIF
FT                   TSTRIDDAFAVVDVGTPGVEVQQQNRRVGKTNNSGRILVPNLNSYEPNTVSIDPKNLPI
FT                   DADVPATKEVVVPAARSGVVVKFGVSETPKAALITITDKNGVPLQAGLNGKLRGTSEEF
FT                   VTGYDGQVYLRGLGARNAIDISLQDGSTCHAEFPYKPQPGKQVVINDVRCL"
FT   gene            complement(642372..643091)
FT                   /locus_tag="Arad_7726"
FT   CDS_pept        complement(642372..643091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7726"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7726"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29168"
FT                   /db_xref="GOA:B9JNN7"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNN7"
FT                   /protein_id="ACM29168.1"
FT                   /translation="MQRMFTCLATTALVLLNACLASAASLRAAPTNLELIAPDSTGVLN
FT                   LTNDGDHPINVQVRVFKWSQTGGVEKLEPTTNVVASPPATKMAPNAGYTVRVIRTTKAP
FT                   VRTEETYRVIVDELPDPSRAKAGTVTLIVRHSIPVFFKNADARAADVSWNLSRQGDSLF
FT                   LTGKNNGASRFRLSNVILKQGATKIGGRNGLVGYVLGGTTMQWPIGSAKSLSGAAVTLQ
FT                   GQSDLGPFNANIAITKR"
FT   gene            complement(643113..643610)
FT                   /locus_tag="Arad_7727"
FT   CDS_pept        complement(643113..643610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7727"
FT                   /product="Spore Coat Protein U family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7727"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29169"
FT                   /db_xref="InterPro:IPR007893"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNN8"
FT                   /protein_id="ACM29169.1"
FT                   /translation="MLNALRGALLVGAAIFITEAPVMAATASGNMTVRIVIQAECKVQS
FT                   AGDLDFGTKGVLDATNDQTSSIGVQCTTGQTYNVGLSAGAGASATTAVRQMTGPGAATV
FT                   NYSIYRDSGHTLLWGVTVGTDTVAGTGNGNVQNIPVYGRVPAQTTPAAGTYTDTVAITV
FT                   TY"
FT   gene            644106..646667
FT                   /locus_tag="Arad_7728"
FT   CDS_pept        644106..646667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7728"
FT                   /product="sarcosine dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7728"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29170"
FT                   /db_xref="GOA:B9JNN9"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR032503"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNN9"
FT                   /protein_id="ACM29170.1"
FT                   /translation="MAEFPQKAKVVIIGLGGIVGASIAHHLIERGWDDIVGIDKSGIPT
FT                   DIGSTAHASDFCYTTSHDYLSVWTTQYSIDFFEKMGHYARIGGLEVARTGDDTWMEEIR
FT                   RKASSGKAFGTNVRLVTPSEIKEMFPLIEEDQVQGGMFDPDAGLVVPRSQTVAGKLVDA
FT                   AEKSGKLKVFGNTPAQSLIVEGGRIKGVVTHRGTIMADYVIVCAGIWGRLIAEMVGEDL
FT                   PVMPVDHPLTFFGPYNEFEGTGKDIGFPLLRDQGNSAYMRDTGDPKTTEGGQIEWGYYE
FT                   TTNPRLCHPRDILEKHEARLSPSQRDLEMEQIIEPLERAMELTPILGELGYNEGHSFNG
FT                   LLQVSAAGGPSCGESQKVRGLWYCVAIWVKDGPGYGKLIADWMTDGRTEIDHNSIDYAR
FT                   FYPHQLTEEFIEGRCYEAAQKIYFPAVHTREPYASGRNVKRSPFYEREKELGGYFMELG
FT                   GWERAHGYAANEHLLEKYGDRVPVRQNEWDSRHFWRVSNAEHLAMSEDCGIVNLSHFHM
FT                   VDIEGPDHVELLEWLCAAKIGGDGNIGKGIYTHFLDDEGMVRADFTVIRMADRCRLING
FT                   ADAGPRDFHYMRRVAEDRGLDVTITDVTEKFITIGIWGPNARETLKKVVADPAGLDAEN
FT                   FPFAAIKQIQIGGKSVTAFRISYVGEQGWELHMKYEDGLAVWDALRSTGVMAFGVETYA
FT                   NSRRMEKSLRLQNADLLTQYNLIEADLARPKVKEADFRGKAKHLEYKARDHQPAMLCTL
FT                   VMTDNTDKNGVKRYPVGNLPVMDPETGKVLIDELGRRSYTTSIAFGPTIGKNIALAYLP
FT                   WAYCQEGRKLNVEYFTETYPVEVVSIGYKPLYDPENLKPRS"
FT   gene            complement(646775..647275)
FT                   /locus_tag="Arad_7730"
FT   CDS_pept        complement(646775..647275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7730"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7730"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29171"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNP0"
FT                   /protein_id="ACM29171.1"
FT                   /translation="MDMLVKLYELKPDPALQKRMDSEGIVIRRVLAPELNALTSWIQPL
FT                   FGAGWAAEATAATMRQPPTCFIAVKDDVLVGFACHEATAKGFFGPTGVDPSMRGKGVGQ
FT                   ALLLTTLLDMHAQGYAYGVIGGAGPMEFYRRSVGAIPIEGSVPGIYRGMLPLANPSEVS
FT                   ESD"
FT   gene            complement(647295..648188)
FT                   /gene="thuG"
FT                   /locus_tag="Arad_7732"
FT   CDS_pept        complement(647295..648188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thuG"
FT                   /locus_tag="Arad_7732"
FT                   /product="trehalosemaltose ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7732"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29172"
FT                   /db_xref="GOA:B9JNP1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNP1"
FT                   /protein_id="ACM29172.1"
FT                   /translation="MADAITQGSGIQKPQRKSSSYYRMRRRCVRGLQIVALLFVLFYTL
FT                   FPYYWAFVSSTKQGAALYHSALLPAFDFTYYRQLIDNPVFMRSLLNSVYVATTTTFLSL
FT                   IIGLSAAYALGRIDFPQRRAMLMIVLMVSIFPQVVVLSGMFELINWFGLFNRPSALVLT
FT                   YLLSTVPFTTWILTTFIREFPRELEEAAIIDGCSHFRILMKILLPLMGPSLASTGILAF
FT                   ILAWNEFLFALTFTLTDENRTVPVAIGLIAGTSRFEYPFGQIMAASVTVTLPLIIVVLF
FT                   FQRRIVAGLTAGAVKG"
FT   gene            complement(648194..649084)
FT                   /gene="thuF"
FT                   /locus_tag="Arad_7734"
FT   CDS_pept        complement(648194..649084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thuF"
FT                   /locus_tag="Arad_7734"
FT                   /product="trehalosemaltose ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7734"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29173"
FT                   /db_xref="GOA:B9JNP2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNP2"
FT                   /protein_id="ACM29173.1"
FT                   /translation="MSARLARRDHRAAWLFLVPIIVVMLVVALWPLVRTFFFAFTDAYL
FT                   DNPSAYSMIGFDNFIEVIQDRGWWVAVKNTLIFTVISVAIETVLGIAIALLVNEAIPGR
FT                   GLARAAILVPWAIPVVVSTKIWEWMLNDQFGVINKLLIELGFIDHGIAWTANSSLIMGA
FT                   VIFVDVWMTTPFMVLLILAGLQLISPEIFEAAEVDGIPAWKRFWSITLPMLRPAIGVAV
FT                   LFRVLDALRMFDLAYVMAASNENVMTVSIYARDRLISFQELGVGSAASTWVFLLVALAA
FT                   IIIIGVLRLDRAAGH"
FT   gene            complement(649081..650181)
FT                   /locus_tag="Arad_7735"
FT   CDS_pept        complement(649081..650181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7735"
FT                   /product="sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7735"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29174"
FT                   /db_xref="GOA:B9JNP3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNP3"
FT                   /protein_id="ACM29174.1"
FT                   /translation="MASVSLESVSKSFGTHSVIQDVNLQINDGEFVVFVGPSGCGKSTL
FT                   LRIVAGLISASKGVVSIGGDDVTDVPASKRGVAFVFQSYALYPHMSVARNIGFALETLG
FT                   MGRDAVRQKVASVARMLKVDHLLERRPRELSGGQRQRVAIGRALVRQPEIFLFDEPLSN
FT                   LDSDLRMEMRMEIAKLHDDLKTTMIYVTHDQSEAMTLADRIVVLNHGRIEQIGTPQELY
FT                   HAPDNRFVAGFIGSPRMNFLSVAMRQAAGADRIEGPGGLSIGAVVQASAEPVAAIGIRP
FT                   EALRLVDALEGRIVGTLERVEDLGHEHFGYCRITDDVIWVIRLAMAPAQHLIGKPVGLD
FT                   FADTAMFVFDADGKRLALDSPEATDQ"
FT   gene            complement(650296..651552)
FT                   /gene="thuE"
FT                   /locus_tag="Arad_7736"
FT   CDS_pept        complement(650296..651552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thuE"
FT                   /locus_tag="Arad_7736"
FT                   /product="trehalosemaltose ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7736"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29175"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNP4"
FT                   /protein_id="ACM29175.1"
FT                   /translation="MFRKSLAALSLCAGLWTVSAHAETISVFCAPTEFELCTNVANAWK
FT                   EKTGNEAKINKMPALLDDAIPLYQQLLAAKSTDVDVLFLDVIWLGMFKSNLLDLKTLVP
FT                   QADQDKHFASTLNAAKLGGNLVAMPAYMDVGLMFYRKDLLEKYGKQPPKTWDELAATAK
FT                   EIQDKERAAGHPDMWGYAWQAKSYEGLTCDAIELIASNGGGTIISDDGKVMIDNPQAAE
FT                   AIGKAKGWIGSISPDGVLNYDEEASRAIFESGNAVFHRNWPYVWGTSHQAGSAIIDKVG
FT                   VMPLPVGKEGQKSSGCLGPMYYGVSKYSAKPKVAADFVNFITGPDMQKMRALKDAVNPS
FT                   IPALYSDPEILAKIPFLKDNQQAFADSAVRPSGYTGTSYNRVSQAFYRTVHDMLSGGAD
FT                   IKSGLTSLAGRLEKLKESR"
FT   gene            651787..652512
FT                   /locus_tag="Arad_7738"
FT   CDS_pept        651787..652512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7738"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7738"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29176"
FT                   /db_xref="GOA:B9JNP5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNP5"
FT                   /protein_id="ACM29176.1"
FT                   /translation="MHKQVYEALLASIRDGKLPLRGKLPSERELVDLYNVSRITVRHAI
FT                   RELIQQGVVQSQPGKGLYVTEHGGGFELQVLKSFTSTALANGRNPGHRLIEASIVRAPL
FT                   DISRPLFLAPGAEVVVLTRLRLIDNIPAVIQTDWIPAGRVAGLLDLDWGVANRSLYAEL
FT                   RERYRIYPKRGQTTLSARIATDEETAILELTPPAAVLTVDQIAFDDRNRPVNMTALVHH
FT                   PARYPLTLLQSETGDFTQY"
FT   gene            complement(652560..653591)
FT                   /gene="lysM"
FT                   /locus_tag="Arad_7739"
FT   CDS_pept        complement(652560..653591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysM"
FT                   /locus_tag="Arad_7739"
FT                   /product="cell-wall lytic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7739"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29177"
FT                   /db_xref="GOA:B9JNP6"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018077"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNP6"
FT                   /protein_id="ACM29177.1"
FT                   /translation="MRISAVSAILLASLALSGCSTSSGAGDLAAGLPSAETTNSIARSD
FT                   DPVPSVSVGEVIAQAEQQQGLYAPSAPGPRPQAFLSVAKTEGTPLPAERPVALLMPANP
FT                   RISSIAPLARSPIYARRFRDAKPINFGVSSPRKLAVHGVDVSRWQGDIDWQTLQTQGAN
FT                   FVYIKATDGGDHLDPMFRQNWRKAKEAGLKRGAYHFFYWCRTAGEQADWFIRNVPKEAG
FT                   ALPPVIDVEWNGESSCKQRVSRERVLEKMQTFMDKLERYYGQRPIIYTAPDFYRDNLRG
FT                   AFLEHPFWLRAVAEHPSKVYPGRKWLFWQYSGSGLSHGVEGRIDLNAFHGSEDEWHKWV
FT                   ATN"
FT   gene            complement(653772..654959)
FT                   /locus_tag="Arad_7740"
FT   CDS_pept        complement(653772..654959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7740"
FT                   /product="isomerase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7740"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29178"
FT                   /db_xref="GOA:B9JNP7"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR034623"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="PDB:4JN7"
FT                   /db_xref="PDB:4JN8"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNP7"
FT                   /protein_id="ACM29178.1"
FT                   /translation="MKIDRMRVFMTRDKDRPRVIVALDTDDGLTGWGECYNHGPDKALP
FT                   PILDYLYGFLSGQDPTRIDYLVNLLIQQSRFPPGALGLSAISALDHCLWDLSAKAANVP
FT                   VYKLLGGAVRDRVKVYAGVYTAPDAPAARDEFDRLNAEWGFTAFKLSPWRVDIHAHRWG
FT                   NVVKASADYFRSLRETVRDDYEIAFDAHAQIFEPVAARQLGNALAPYDPLFYEEPLRPE
FT                   NIDMWGDLKQGLNCVLATGESLYNRNEFLRLLQVKGADLIQPDICVVGGISEMRRIATL
FT                   AEAYFVGVAPHNPMGPLATAVNVHFSAATQNFRILEYRLPKGQAYVYGGKDIEKRQGET
FT                   RYVVDPYLPKDGYLELRPDRPGWGVEMDEKAMEEEGYIHWQRRVPKRPDGSYAFA"
FT   gene            complement(655040..656761)
FT                   /locus_tag="Arad_7741"
FT   CDS_pept        complement(655040..656761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7741"
FT                   /product="oligopeptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7741"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29179"
FT                   /db_xref="GOA:B9JNP8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNP8"
FT                   /protein_id="ACM29179.1"
FT                   /translation="MTDIVSMTGVRPLLQVKNLSVDFPLRTGNFRAVDNLSFSIEPGKT
FT                   LCVVGESGSGKSVTARSILQIVDAPGRIASGSIILNGSDGSSIDIVSLNPRGRQIRAIR
FT                   GRDIAMIFQEPMASLSPVHTVGDQIIEALRLHTKMSKAEARAEAISLLKQVEIPSPDKA
FT                   VDRYTFQYSGGMRQRAMIAMALACKPQLLIADEPTTALDVTTQAEILDLIARLQKAYGM
FT                   AVLFITHDMGVVAQIADDVLVMHNGVAKEYAPVEQIFHAPKDDYTRMLIGSVLKLEEKA
FT                   EIRLARPPLDRTAAPILELRNVSMAFGEVRALDDISISLLPGETLGIVGESGSGKTTMG
FT                   RSIMRLLDPTAGEILYRRADGGIVDLATAKGESLAAARRELRMVFQDPFGSLNPRMTVS
FT                   QIIGEPLLVNGIAKGRALDERVCDLMEQVGLDPKTRERYPHAFSGGQRQRIGIARAITL
FT                   NPRIIVADEATSALDVSVRSQVLDLLMRLQDKLGLAYIFISHDIGVIRYMCDRVGVMYK
FT                   GRLVEVGDADKVCNTPEHAYTQALISAIPRPDPRDRDHSRRFRYVEPDVLKNGSAA"
FT   gene            complement(656769..657890)
FT                   /locus_tag="Arad_7742"
FT   CDS_pept        complement(656769..657890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7742"
FT                   /product="oligopeptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7742"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29180"
FT                   /db_xref="GOA:B9JNP9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNP9"
FT                   /protein_id="ACM29180.1"
FT                   /translation="MADIAVTNIPPDRAAVASQWQLIWWAFRRHKLAMVALVVTVIMYI
FT                   VAIIPGFFAINDPALQNARATFHPPQQLHFIDTDNGFSLGLHYYPLKLTRDPETLAAIF
FT                   KEDRTKRVDVSLFGRGYEYSVLGLFTSNIHLLASSDKTTPLLLFGADRLGRDVFSRTVQ
FT                   GSQISLSIGLVGVFFSLLLGIVLGGISGYYGGRLDFFIQRLIDFVLSLPTIPIWLAMAA
FT                   ALPQGWPAALQYMMITIILSLTGWAQLARVVRGRFLSLRTEEFVAAARLDGARESRIIF
FT                   RHMLPSFASHIIASITLAVPAMILAETSLSFLGLGLQPPTISWGVLLREAQNIRSIATA
FT                   PWLFMPGLAVVIAVMALNLLGDGLRDAADPYNK"
FT   gene            complement(657900..658886)
FT                   /locus_tag="Arad_7743"
FT   CDS_pept        complement(657900..658886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7743"
FT                   /product="oligopeptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7743"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29181"
FT                   /db_xref="GOA:B9JNQ0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNQ0"
FT                   /protein_id="ACM29181.1"
FT                   /translation="MLVFITKRLLWMIPSLFAISFLAFVLIQLPPGDYVTTYIATLASS
FT                   NEVVDQNTAAQLRERFGLDQPMIVQYIKWIWGILSRGDFGISFEWQQPVSGLIWERMAL
FT                   TLVLALATLIATWGIALPIGVYSAVKKYSIGDYLFTAFTFLGLAIPSFLLALVLMYVAA
FT                   VEFGQDVGGLFSSEYETAPWSIAKMLDLLTHLWLPVIILAVSSTASLIRVMRANMLDEL
FT                   PKPYVTTARAKGLSEFRLLVKYPLRIALNPFISTIAWLLPNLISGSVVVAIVLNLPTAG
FT                   PLLLQSLMAQDMYLAGAFVLLICALTLIGSLISDILLALVDPRIRLE"
FT   gene            complement(659016..660956)
FT                   /locus_tag="Arad_7744"
FT   CDS_pept        complement(659016..660956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7744"
FT                   /product="oligopeptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7744"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29182"
FT                   /db_xref="GOA:B9JNQ1"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNQ1"
FT                   /protein_id="ACM29182.1"
FT                   /translation="MRDEILSRGVTRRAVLGGMAGVAALSLAGRAAAAGGEAPALAELV
FT                   KGGKLPPLADRLPKKPMVVTPFEKVGTYGGTLRRGLRGSSDHNGILRMVGNQSLVRWNM
FT                   EFTQVLPNLAERWEVNDDASQFTFHLIEGARWSDGHPFTADDVVFAIEDCVKNTDLYSA
FT                   APAQLSVAGKVVNVEKLDDFTVKFTFAAPNALYLENLATPLGQHPTLFPKHYCSQFLPK
FT                   YNPNVADDAKKAGVSSWPELFRARCGDIEIPSRWGNPDKPTLDPWVVKEPYTGGATRVV
FT                   MTRNPYFWQVDTEGNQLPYIDEINFGISQDVESLMLNVISGKIDIQERHISVLANKPTL
FT                   SQNMKKGDYRLLTLVPSTSQQCQIYFNITHKDPAMRKMFADKSFRQALSLGINRQEVID
FT                   IVYFGQSEGYQAGPRPEHPWYHEKLARQFTDYDADKAGAMLDKAGYDKKDGNGFRLRSD
FT                   GQKIFFAIDVIPTLYPDLVDALELVKAHWAQIGIDMKVNTIERALYYTRGDDNAHDAQV
FT                   WPGPGGLDPMLDPRDFFAFHPQGSRYAIPWSVWYTSNGKQGEEPPESQKKRMKLFDEAR
FT                   STADLDKRGAAMKQIFDIAAEEFETVGLCLAVGGFGIIRNNLRNVPEKQPDSWSWPNPG
FT                   PALPQQFTFTS"
FT   gene            661167..661883
FT                   /locus_tag="Arad_7745"
FT   CDS_pept        661167..661883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7745"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7745"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29183"
FT                   /db_xref="GOA:B9JNQ2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNQ2"
FT                   /protein_id="ACM29183.1"
FT                   /translation="MMTLSAVTAPDGGATRFGDIIYEKIVGMIADGNFPVNERLPSEEK
FT                   LAVMFGASRPVIREALERLRGDGLIVSRKGSGSYVRQRPDSSVLKMVPVGSLADVQRFF
FT                   EFRAGLEAEAAELAARNWQPADKERISAALLNIEQCLSDGKLGAEEDQALHDAIAMATG
FT                   NQFHITLREWFKPHFAIGHSVTRSLSLKRTPEQIRTVQDEHAVIVKAIFERQETEAHDA
FT                   MKRHILNARARMFQGV"
FT   gene            661982..662881
FT                   /gene="dapAf2"
FT                   /locus_tag="Arad_7746"
FT   CDS_pept        661982..662881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapAf2"
FT                   /locus_tag="Arad_7746"
FT                   /product="dihydrodipicolinate synthase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7746"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29184"
FT                   /db_xref="GOA:B9JNQ3"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNQ3"
FT                   /protein_id="ACM29184.1"
FT                   /translation="MSIATIRQALKGVSGVPVTAYDDRGEVEPRITAKVYHRVAAAGIH
FT                   NIVAAGNTGEFYALTPEEIRHVHEAAVAGVDGKAPVTAAIGRSLREAIAMAKNAAVIGA
FT                   SAVMSHQPVDPFAAPAAQIDYFCDLAEASPLPLVAYVRADGFSVDDMVRLAGHANIAGI
FT                   KFATTDLMLLSRAIAASDPAGALFVCGLAESWAPTFTAAGARGFTSGLVNVAPQLSLAV
FT                   LDALDRGDFAAARAIVNKLEPFERMRTKFRNGANVTVVKEAVTYSGLNVGPVRVPGLPQ
FT                   LDQKDREELHRLLKDWEG"
FT   gene            662960..664546
FT                   /gene="dppAf"
FT                   /locus_tag="Arad_7748"
FT   CDS_pept        662960..664546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppAf"
FT                   /locus_tag="Arad_7748"
FT                   /product="dipeptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7748"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29185"
FT                   /db_xref="GOA:B9JNQ4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNQ4"
FT                   /protein_id="ACM29185.1"
FT                   /translation="MLKSLLTSVAIAVALIAAQPSLAASPPNMLVIGTNLTGIRTLDPA
FT                   QNNARTVSELISNLYDNLVQLSPDDLQTLKPMLATKWSVSPDGKIITLTLRDDATFQSG
FT                   NPVTAEDAAWSIQRVIKMGQVGSTDIAPWGFTAGNVDKLIRAKDAHTLEIELPQAVNTD
FT                   LVLYSLAGSSIGIIDKKTALSHEANGDFGGTWLSANSAGSGPFALAQWRPNDVAIFNAR
FT                   KNYWGGAPAMTRVVARHIPESGNLRLQLEAGDVDIGQYVSSGDLDALATNKAMVIDNVP
FT                   GLGFYYIALNQKDPDLQKPKVREAFQHAFDWKAISDNIMRYTGFPWQSMIPRGMIGAPE
FT                   SATSRYDYDPAKAKQLLAEAGYPNGLKKVLNPSAAATLPFTEALQASARVAGIDLDLVP
FT                   GEFIPAFRERKYQVLLGNSGARLPDPFAVATQYAYNPDNSDEARLGSYYLWRAGMKVDE
FT                   LNTLVDQSMKERDTAKRTDLFKKMDGIYGGMDSPLIIFFQRTDPYVMRANVKGYHGHTT
FT                   WSTRWHDVTKE"
FT   gene            664553..665650
FT                   /gene="dppBf"
FT                   /locus_tag="Arad_7749"
FT   CDS_pept        664553..665650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppBf"
FT                   /locus_tag="Arad_7749"
FT                   /product="dipeptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7749"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29186"
FT                   /db_xref="GOA:B9JNQ5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNQ5"
FT                   /protein_id="ACM29186.1"
FT                   /translation="MTSAELTPKRDSRGSMDRDAFADTPPHPLVALLRRLAGRVVAIVT
FT                   TLLGLLFLTFSMGRLLPADPVLAITGSEVSKAVYDRVYNELGLGQPIWMQFLTYVGKIA
FT                   TGDLGTSATTGQPILTDLLSIFPATIELAIIAMIIGIVVGVPLGITAAVRRGTILDHIA
FT                   RIVALAGHSIPIFWMGLMALFVFYAKLQLVGASGRVDVLYEGLVTPVTGFLLIDSAMEG
FT                   QWDVFQSALNHIILPGAILGYYSVAYICRMSRSFMLEQLGQEYIVTARAKGLGRRKVVW
FT                   RHAFRNIRVQLLTIMALTFGGLLEGAVLIETVFGWPGLGQYLTRGLQMNDMNVVMGAVL
FT                   TIGAVFLTINIISDVLYRILDPRTR"
FT   gene            665656..666591
FT                   /gene="dppCf"
FT                   /locus_tag="Arad_7750"
FT   CDS_pept        665656..666591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppCf"
FT                   /locus_tag="Arad_7750"
FT                   /product="dipeptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7750"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29187"
FT                   /db_xref="GOA:B9JNQ6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNQ6"
FT                   /protein_id="ACM29187.1"
FT                   /translation="MTISAEHTDRASGNSFRKWLLAPEPQGWFQSSVQQFHQGWLKFRL
FT                   HPLGLIGLAIIVLLILVAIAAPLLTRYDPIVQDMAGRLAPPSTQHWLGTDNFGRDVFAR
FT                   IVYGGRTTLYIIMLVSIIVAPLGLLIGTCSGYFGGIVDEILMRITDIFLSFPGLVLALG
FT                   FAAALGPGITNAIIAISLTAWPPIARLARAETLSLRKADFIAAVRLQGATPLAIITRHI
FT                   LPMCIPSVIVRVTLNMAGIIITAAGLGFLGLGAQPPWPEWGSMAATGREFMLDSPWVIA
FT                   APGIAIALVSLAFNLVGDALRDVLDPRGAE"
FT   gene            666588..667445
FT                   /gene="dppDf"
FT                   /locus_tag="Arad_7751"
FT   CDS_pept        666588..667445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppDf"
FT                   /locus_tag="Arad_7751"
FT                   /product="dipeptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7751"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29188"
FT                   /db_xref="GOA:B9JNQ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNQ7"
FT                   /protein_id="ACM29188.1"
FT                   /translation="MSSSLIDIHNLEIAFGGGSVRAVRGVSFSLGQEKLGIVGESGSGK
FT                   STVGRAIMRLLPPTAMVSAERMSFRDVDLLKADERKMMTIRGRRIGLILQDPKYSLNPV
FT                   MRIGEQIAETYRLHYPKASAKQAYGQTLEMLEAVKIRDVERVARLYPHEISGGMGQRVM
FT                   IAMMLIAEPEVLIADEPTSALDVTVRLEILALLDELLARRNLGLIFISHDLNLVRNFCD
FT                   RVLIMYAGRVVEVLEARDLDKARHPYTQGLLASLPSIDDPPIRLPILKRDPSWLDSKIL
FT                   ERTR"
FT   gene            667442..668200
FT                   /gene="dppFf"
FT                   /locus_tag="Arad_7752"
FT   CDS_pept        667442..668200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppFf"
FT                   /locus_tag="Arad_7752"
FT                   /product="dipeptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7752"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29189"
FT                   /db_xref="GOA:B9JNQ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNQ8"
FT                   /protein_id="ACM29189.1"
FT                   /translation="MIEIDNLTIRFAAGQRPVVRNVSFDVEKGTAFGLVGESGCGKSTV
FT                   LRAVSGLNPNYQGSIELDGDILDRRRDRPFFRRVQMVFQDPYGSLHPRKTIRSQLKEPL
FT                   RNQGIATGSMDVDALLRSVGLDPSLSYRFPHQLSGGQRQRVAIARALVLNPAVLLLDEP
FT                   TSALDVSVQAEILNLLDDLRRERGLTYLLVSHDLAVVSHMCSRVAIMEAGKIVEEVDIE
FT                   RLRKGVVEHPYSQRLLRASRMYGKQREVLA"
FT   gene            complement(668590..669378)
FT                   /locus_tag="Arad_7753"
FT   CDS_pept        complement(668590..669378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7753"
FT                   /product="inositol monophosphatase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7753"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29190"
FT                   /db_xref="GOA:B9JNQ9"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNQ9"
FT                   /protein_id="ACM29190.1"
FT                   /translation="MAAAHERLSQASAIIEEAADKALHFFAAHQTVATHAKGVQDFVSE
FT                   ADTTVENLIRDRLAAAFPGEAIVGEEFGGQPEGAHWIIDPIDGTSNFLRGSPLWGISLG
FT                   FVRNGRPEFGVVAMPVMGEIYAAAEGTGLLMNGKPLARTSPLEDVRVMSLGDNPAEDFD
FT                   DAARFQVGLRRAGWVVEAFHSTSVSLVFAARGIFDGHLQKVTTMWDIAGGAVLAREAGL
FT                   EVRIGEDLASRVPWIAAGTPALLAATEPLWPEIRMDHLND"
FT   gene            complement(669378..670391)
FT                   /gene="ugpQ"
FT                   /locus_tag="Arad_7754"
FT   CDS_pept        complement(669378..670391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugpQ"
FT                   /locus_tag="Arad_7754"
FT                   /product="glycerophosphoryldiester phosphodiesterase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7754"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29191"
FT                   /db_xref="GOA:B9JNR0"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="InterPro:IPR032160"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNR0"
FT                   /protein_id="ACM29191.1"
FT                   /translation="MPRGAFLLDPSQILHLKCINWNENNISRRNGQDLILLPNLNHPKV
FT                   LPMPSQTAASRFADIFSLVSRSNPDILTIAHRGLWTAAPENSLTSIRDAAALNVEIVEI
FT                   DTQATSDGKLVVIHDATLDRTSTGTGVISACDLATIRNARLRSGGGGETASVTDERIPT
FT                   LEEALEEARGRIFVNIDTKYSRDLPLVIATIKRLDMQDQIIIKTDIEPASGHFPVIDAD
FT                   WFGSIPHMPMFRVRPGQFAEDLKLIEPLRAPMVEVKFSDITDLAGGREELKRQNIRLWI
FT                   NTLDVSHNLDFNDSRALGDPEGVWGTLVEVGVGAVQTDTIAPFKQWLAGHETKRIA"
FT   gene            670438..671586
FT                   /locus_tag="Arad_7755"
FT   CDS_pept        670438..671586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7755"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7755"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29192"
FT                   /db_xref="GOA:B9JNR1"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNR1"
FT                   /protein_id="ACM29192.1"
FT                   /translation="MTLQAASPTRFDMSPLASDNERMILDIVRRHEPIARSTITAHTNL
FT                   TQQSVHRLVETLMERGLLRAGAPLKGARGQPSPTIELVKQAVYSVGISINTDSAILYLA
FT                   DFGCNVVAEETLRMVPSDRQATIARLLETLQTILKKHGISRERLAGLGFSMSGFFVMDN
FT                   REFNAPEPLRDWSLVDLRPGLERAFELPVWLENNATTGAIGESLRGAGLWCSTFAYLSF
FT                   NYGFGGGLILDSKPFHGFHGNAGEFSGIYNPDESPKRPALQYLIRMLQENGIDIHSIDE
FT                   LHQRFDPSWPGVEAWLEQTMPLLDRLVASLIAVLDPQAIVFGGQLPRELGRMMIGRVHM
FT                   PSSRAHRYDVGPREAKLVLSETRGDAAAIGAALLPLKLRYFL"
FT   gene            complement(671617..673704)
FT                   /locus_tag="Arad_7756"
FT   CDS_pept        complement(671617..673704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7756"
FT                   /product="sensory box/GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7756"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29193"
FT                   /db_xref="GOA:B9JNR2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR005330"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNR2"
FT                   /protein_id="ACM29193.1"
FT                   /translation="MRVISCITTEHNLWLILLAAFVCISGGWITLNLLRRSETTLGLQR
FT                   GGWLFLTSVAAGSSVWCTHFIAMLAYETEAAITFGPILTMVSLLVAVTGCAFGFTTASL
FT                   RGFRLAPEAGGLVVGLAISAMHYTGMMAYHVDGIIEWNVDYVASSIMLSMVIAAFAFSQ
FT                   AIRRPWRHSPLLALALFVLAVVTLHFTAMAAVSLTPLATGAAGTDPHVLQAMAIAVAGV
FT                   GLLIVGTGVASYMIDEHATQESIQKLQHMALNDLLTGLPNRGSFADHLNQEMEQAEREN
FT                   AKLAVIGIDLDRFKEINDLRGHKAGDQALKAIGRRLARLVKDGEFVARVGGDEFAAVKR
FT                   FNGQNELLDFVARLEKTMFEPIRIDDFETVTGASIGVAVYPDDGRDQERLVSNADLAMY
FT                   RAKADVGRAVCFYESRMDEAARERHTLAQDLRRAVELDQLELHYQVQTSVRTGEVCGYE
FT                   VLARWNHPERGKVPPAEFIPIAEESGTILAIGEWVLRTACKQAASWDKRYKIAVNLSPV
FT                   QFAHADLARLVHEILLETGLSPSRLELEITESTIIADKTRTLHVLRQIKALGVTIAIDD
FT                   FGTGYSSLDTLRSFPFDKIKLDRSFMSEVEGSIQAKAIVRAVLTLGRSLEIPVLAEGVE
FT                   TNHQLEILKVEGCDEAQGFFLGRPKPVGQIFLSEETIDAEFPASFSGRIPPVRIRRRSI
FT                   A"
FT   gene            complement(674038..674994)
FT                   /gene="casA"
FT                   /locus_tag="Arad_7757"
FT   CDS_pept        complement(674038..674994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="casA"
FT                   /locus_tag="Arad_7757"
FT                   /product="calcium-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7757"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29194"
FT                   /db_xref="GOA:B9JNR3"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNR3"
FT                   /protein_id="ACM29194.1"
FT                   /translation="MLGLQHSARPSAHIGIKDRAATDQSARRDGNMFITSKRKKPESFQ
FT                   RSHPEAPMTSITSISSNSYYQSLRSRSAASSTDDALSSVLGSGSSSKDSSSSSDDQSLA
FT                   TTAQQLAAQLMSMMLNLQSGSSDDDSSSSSDTASTSSTSSTQAASSTSDQTNMIKAMDT
FT                   DGDGNISEAEFVAARPSDVSEEQATNLFASFDTENTGSLTESQLASAMQSGQQPPPPPA
FT                   GGPPSDDQLSSMFSEMDTDGDGSVSEAEFVAARPSDVSEDQATSLFDSLDTSSSGSLTQ
FT                   SQFETAMKAQQPPQPSDFGSLYASSEQVDTTSELLAL"
FT   gene            complement(675369..676508)
FT                   /locus_tag="Arad_7759"
FT   CDS_pept        complement(675369..676508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7759"
FT                   /product="ABC transporter, substrate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7759"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29195"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNR4"
FT                   /protein_id="ACM29195.1"
FT                   /translation="MFNLNKVASVATLVFALFSGMAIAGEKVTVKDITGRDVQVSVPVE
FT                   RVILGEGRQIYFTAALDTEAPFKRIIGWRDDFQKADLDGYNAYLEKYPEMKKIPTFGGM
FT                   KDGTFDIEQAVTLKPDVIIMNIDAKSATEESGYIEKLAKVGIPLVYVDFREKAMENTTP
FT                   SMRLIGKLFGKEARAEEFVKFHDEQLARVTDVLAKAGDIKKPVVFIERAGGYSDDCCMS
FT                   FGNENFGRMVEMAGGINLAKDIIPGTFGTVNPEQIIASNPDQVIVTGANWELYVPGGDW
FT                   VGVGPGADKALATSKLEKLMHRPAFTDITAVKTGNVHAIWHQFYNNPYQFVAIQQIAKW
FT                   LHPDLFKDLDPEATFKELHERFLPVEYRSGYFVSLNASL"
FT   gene            676625..677428
FT                   /locus_tag="Arad_7760"
FT   CDS_pept        676625..677428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7760"
FT                   /product="methyltransferase transcriptional regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7760"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29196"
FT                   /db_xref="GOA:B9JNR5"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNR5"
FT                   /protein_id="ACM29196.1"
FT                   /translation="MQTLNLRSNHDLRDEIKAYWSIRAETFDSQPGHEIFSEEERAAWH
FT                   ALLQRHLGDGTGQTALDLACGTAVVSHLLDDIGYRVTGMDWAEPMLERARAKAKTRGRP
FT                   IRFLMGDAENTMEPDGAYDVVINRHLVWTLVDPLAAFKEWHRVLKPGGKLLVIDGDFVN
FT                   TTLVAKITGRLAALMARLRGRNARPQNGPGAVLAETHRSILSRVYFSEGARAEAVADLL
FT                   KAGGFSSVIIDTDMGAIHRTQRKNFDFLKGLERAAQHRYAICASK"
FT   gene            complement(677496..677903)
FT                   /locus_tag="Arad_7761"
FT   CDS_pept        complement(677496..677903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7761"
FT                   /product="urease-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7761"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29197"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNR6"
FT                   /protein_id="ACM29197.1"
FT                   /translation="MRITAFAIALILATPTFALAEQNCGDLTTQTDMNICAGKAYAKSD
FT                   AELNVLYKQIEARLKDDADTKKLLVSTQKAWVGYRDAECNFSSSKVTGGTVYPFISSSC
FT                   LNNMTRSRIEDLKGYLKCGDGDLDCPVPSAN"
FT   gene            complement(677941..678069)
FT                   /locus_tag="Arad_7762"
FT   CDS_pept        complement(677941..678069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7762"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7762"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29198"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNR7"
FT                   /protein_id="ACM29198.1"
FT                   /translation="MKIIRRDIASVAADAAISGSTNICGRGSDACYRKMVLYIRHK"
FT   gene            complement(678316..679152)
FT                   /locus_tag="Arad_7763"
FT   CDS_pept        complement(678316..679152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7763"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7763"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29199"
FT                   /db_xref="GOA:B9JNR8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNR8"
FT                   /protein_id="ACM29199.1"
FT                   /translation="MSGFSIDLLLKTKTVTIRDVLCDGACRHKSVEECAHSTSLVYPYR
FT                   GVFMRHVGRKDVVAEANQVLFFNREQEYRISHPIEGGDACIDVSIDEALLDELAPKDQA
FT                   QTADALIFRRQRRRIDPRAQALVALLRHSLKRGAAETLEAETLALTLVRRSLGERTSHA
FT                   AGATIGRQKLVDRAKLVMSSDLARRWTLADIAHDVGVSPVYLTQVFQQVEGIPLYRYQL
FT                   RLRLARALDLLGEYDDLTALGLDLGFSSHSHFSAAFKQAYDRTPAEFQRLAHLRAR"
FT   gene            complement(679208..679441)
FT                   /locus_tag="Arad_7765"
FT   CDS_pept        complement(679208..679441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7765"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7765"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29200"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNR9"
FT                   /protein_id="ACM29200.1"
FT                   /translation="METTMTTTAIRVSFRRTERKIYPALRWLLAIPMQIAAKLTARSNR
FT                   NALLELSDDQLKDIGLSRGQAYSHEHIYTRYR"
FT   gene            complement(679536..681380)
FT                   /gene="mcpZch2"
FT                   /locus_tag="Arad_7766"
FT   CDS_pept        complement(679536..681380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcpZch2"
FT                   /locus_tag="Arad_7766"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7766"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29201"
FT                   /db_xref="GOA:B9JNS0"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033462"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNS0"
FT                   /protein_id="ACM29201.1"
FT                   /translation="MLRFLSTSIVRQVVAITLGLLAVSTAAIVAVTYYNLSRDVMDSAV
FT                   ADARDASRAMAILYAAGDDGAKIALKDTELASVTEEKIPAFSDHDLVDRAAQSIAGVAT
FT                   IFEKQDSDYVRVSTNVKKQDGSRAVGTKLAADHPAQPVLARGEAYYGPAQLFGRNFMTG
FT                   YFPVKNAAGANVGILFIGIPMEVYFARLNNLQLLVLTAGGAVMAFVGLFAFFAIRRTIR
FT                   PLQALTTTVHTISAGNLGGSIPCVEKKNEFGEIGRALEAFRDSARARRDLETQAAEQRT
FT                   LAEAERSRNDTDKRTLDDQIEFAVNQIAVGLGRLAQGDVSQTIETPFVGRLEQLRIDFN
FT                   ASLVRLQDTLSRIRNSATTIQHNSNAMRSSAGELSKRTEAQAANLEETAAAVEEITVTV
FT                   RSSAERAREANNAVALTKKTADSSDTVVGDAVAAMNRIEQASRQIEQIIEVIDDIAFQT
FT                   NLLALNAGIEAARAGDAGKGFAVVAQEVRELAQRSAVAAREIKGLIEKSTREVAAGSEL
FT                   VQKTGGMLASISQEIVAISKHVETIATGSRDQATALQEVNGTVNAMDQMTQKNAAMVEE
FT                   TTQASRGLAEEADILMNLLQQFRIEGTAQDDRRARRAA"
FT   gene            complement(681465..682469)
FT                   /locus_tag="Arad_7768"
FT   CDS_pept        complement(681465..682469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7768"
FT                   /product="ribose ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7768"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29202"
FT                   /db_xref="GOA:B9JNS1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNS1"
FT                   /protein_id="ACM29202.1"
FT                   /translation="MTMSLSNSAAPSQAWPRRAVAVLARCGLILALLFVFAIFSAATPT
FT                   FLTPGNLQSILVNNFTLLAIVSIAMTFAVSSGGIDLSVGTAIDFASFAFVSLVLAGQPV
FT                   ALAVLAGLAAGAAVGAFNAVLISGIGVSPFLATLGTLFIGRSIQQLLTNGGNPVYLPPT
FT                   GVSEAFRFLGHGAIAGIPVPLVIAIVIIAAAATLFARTRFGRVVLSIGIQPSVVRYSGI
FT                   RLRGHVAITFILVGLIAAIAGLILTATVTVYIPFSGNAFLLNAIGATFIGTTLSPLGRP
FT                   NVAGTVLGVLLLSIVANGLLLTGLNFYWQQVGTGVLIFAVLAFSFINSKAGGA"
FT   gene            complement(682466..683488)
FT                   /locus_tag="Arad_7769"
FT   CDS_pept        complement(682466..683488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7769"
FT                   /product="sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7769"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29203"
FT                   /db_xref="GOA:B9JNS2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNS2"
FT                   /protein_id="ACM29203.1"
FT                   /translation="MSADIQYAPVTGFEAEKTAGRTGSNIAATTLRFGSLITFALILIV
FT                   FSLTAPYFLSIGNIGNVLGQSAISGVLAIGLTIVLIAGGANVVTGGIDLSLAANMGLSA
FT                   AVYATLTQLGYGDAVAITATLLTGLAIGAVNAAAVVLAGIVPLLATLAVMNIVAGLELV
FT                   LTQNTVLPASTDLLTLLSASDSFGIPVLAYVLLGFTAIVTAIVQYTPLGLRLYAVGEFP
FT                   DAARAAGLPLKRLLAGAFLASGLCGGIAGILSVSYLSGSTTGAGEMLLPVVAAALLGSV
FT                   FSRRLVPTIAGALLSTLLVGFLVNGFQLLNLPSTLVNGIQGLLILIVVSATTLLRKREI
FT                   "
FT   gene            complement(683478..685028)
FT                   /locus_tag="Arad_7770"
FT   CDS_pept        complement(683478..685028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7770"
FT                   /product="sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7770"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29204"
FT                   /db_xref="GOA:B9JNS3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNS3"
FT                   /protein_id="ACM29204.1"
FT                   /translation="MTASSPSAPPHSDDHVIRFDHVVKHFGGAQALAGASLTVRRGTVH
FT                   GLVGQNGAGKSTLIKLLAGLHRPDEGRIEVEGESFDHLTPHLAEALGIHFIHQDRLLVP
FT                   TFTVGEALFLGREPRIGRTPFLDRRRMQRRAGDLLANYFGVNLPNKALISELSTAEKQI
FT                   VQITRALLNQPKVLVFDEPTAALIRREADILFRLIRRLRDEGVTIIYISHYLNEIEELC
FT                   DHVTVMRNGLDVATLPIAETSAAAIARLMVERDIADMFPKRQIELGEEILKVEGLTTPN
FT                   RFSDINFTLRHGEVLGITGLLGSGAKDLVRTLFGLERASSGHIAVAGKPTRSISPTEAV
FT                   ERQIALVPEDRRGHGVALDLSVAENITLSSLARYTRFGFLDRKRERRDTDDLIKRLEIK
FT                   TAGREALVRTLSGGNQQKVAIAKWLSRHSEIYLLDEPTVGVDIGSKVEIYTLIGELATR
FT                   GAGIIVLSSDLPELIGITDRILVLFRGRVTREFISSETTTDEVLAESSGASGGLRHVG"
FT   gene            complement(685085..685963)
FT                   /gene="rbsBch3"
FT                   /locus_tag="Arad_7771"
FT   CDS_pept        complement(685085..685963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsBch3"
FT                   /locus_tag="Arad_7771"
FT                   /product="ribose ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7771"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29205"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNS4"
FT                   /protein_id="ACM29205.1"
FT                   /translation="MKGKRIAISATGTDHYFDLQAYNAQIAEVKRLGGEPIAVDAGRND
FT                   GKLVSQLQTLIAQKPDAIVQILGTLSVIDPWLKKARDAGIPVLTVDVGSTNSINNTTSD
FT                   NWGIGKDLALQLVSDIGGEGNILVFNGFYGVTPCAIRYDQLVNVIKYFPKVKIIQPELR
FT                   DVIPNTVQDAFTQVTALLNKYPEKGSIKAIWSAWDIPQLGATQAIAAAGRTEIRTYGVD
FT                   GSPEVLQLVADPNSPAGADAAQQPAEIGRTAIRNVAKLLAGQTLPRETYVPALLANKAN
FT                   VAEVVKKLGIG"
FT   gene            complement(686267..686632)
FT                   /locus_tag="Arad_7773"
FT   CDS_pept        complement(686267..686632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7773"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7773"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29206"
FT                   /db_xref="InterPro:IPR010385"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNS5"
FT                   /protein_id="ACM29206.1"
FT                   /translation="MLSGVLVQRLAWNGSCVVTNVLTIRRPCVMKWHTSHQFPALRLVV
FT                   RGREKYRVIKSVRDAAVTLISDWPSDDGEEYVVAVRTCLDALHDVVPPEAVREALIRAA
FT                   NEERISHISVVASAYPE"
FT   gene            687020..688357
FT                   /locus_tag="Arad_7774"
FT   CDS_pept        687020..688357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7774"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7774"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29207"
FT                   /db_xref="GOA:B9JNS6"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNS6"
FT                   /protein_id="ACM29207.1"
FT                   /translation="MQTSTGIRTPKRAALASWLGSAVEYYDFFVYGTAAALIFPKIFFS
FT                   SADPQAAAMASFATFGVAYITRPLGAVVLGHIGDKFGRKKVLTFTLLLMGFSTFLIGCL
FT                   PTYDHVGVLAPILLVIARLLQGISAAGEQAGANSMTLEHAPEHRRAFFTSFTLSGTQTG
FT                   LILATLVFIPISRLSEEDLLAWGWRIPFFLSVIVVFVGFWVRRTLAETPVFVEESKKGE
FT                   VEGVPLITLFSNYWMDVVRIVFAALISVVSTIFSVFTLSYAVNTMHIDRSLMLTVLVLA
FT                   NVAALVAIPLWAMLADRIGRKPVFIFGALGCAVLIWPYIWAISQGDLTLIFVLGILLSG
FT                   IVYSASNGVWPALYGEMFDTRVRLSGMAIGTQIGFALGGFAPTISAALLGTGPTGWMPV
FT                   AAFTSITAVIAAISAATASETFKIPMVQLGRQKNQVLQAPAGKQSI"
FT   gene            688487..689155
FT                   /locus_tag="Arad_7775"
FT   CDS_pept        688487..689155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7775"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7775"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29208"
FT                   /db_xref="GOA:B9JNS7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041474"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNS7"
FT                   /protein_id="ACM29208.1"
FT                   /translation="MRKTQSVKIESRSRKNDPDATKENILRIASEEFVASGFAGARVDE
FT                   IAERTKTSKRMIYYYFGGKEGLYLAVLEQAYTKIRSLEGALDLQSMPPVQAMRKLIEST
FT                   FDHDDQNPDFVRLVSVENIHRAENMKRSSVLSEMNIVVIDIISDILRRGYEDGSFLRKV
FT                   DPIDLHMMISAQCFFRVSNRYTFGAIFNRDLSEKDTKNRHKAMICDAIIAFLKSPGTGE
FT                   "
FT   gene            689359..690147
FT                   /gene="aroEc"
FT                   /locus_tag="Arad_7777"
FT   CDS_pept        689359..690147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroEc"
FT                   /locus_tag="Arad_7777"
FT                   /product="shikimate 5-dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7777"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29209"
FT                   /db_xref="GOA:B9JNS8"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNS8"
FT                   /protein_id="ACM29209.1"
FT                   /translation="MHMQEGARLGLDYSYDLIDLQELGCTVSDLPRLIEDAEKNGFAGL
FT                   NITHPCKQAAVTLVDELSADAAVLRSINTIVFRNGRRFGHNTDWWGFAESFRRGLSGAS
FT                   LDRVVQLGAGGAGVAVAHAVAGMGAKSIEIYDLDQAKVSALIFQIQSAHPRCVFVAGKD
FT                   LPAAVREATGLVHATPTGMLGHPGLPLDEALIDPRFWVADIVYFPLETELVRAAKSKGC
FT                   RVLDGGGMAVFQAVGAFELFTGRQADSSRMIAHFKSLQAR"
FT   gene            690287..690742
FT                   /locus_tag="Arad_7778"
FT   CDS_pept        690287..690742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7778"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7778"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29210"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNS9"
FT                   /protein_id="ACM29210.1"
FT                   /translation="MISTTISYKNHRFSPQIIAHAVWLYFRFPLSLRLVEEMLLERGVV
FT                   VSYETIRRWGFKFEAAYAKQLRRKKPSQKDIWHLDEVLISIGGRKHWLWRAVDQDGYVL
FT                   DEIVQARRDTKAAKRLLVRLLKKQSLSPKRIVSGVGAAFGDRSSCGL"
FT   gene            complement(690751..691749)
FT                   /locus_tag="Arad_7779"
FT   CDS_pept        complement(690751..691749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7779"
FT                   /product="insertion sequence transposase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7779"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29211"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNT0"
FT                   /protein_id="ACM29211.1"
FT                   /translation="MLHKHNAARRHHIGKMKFKVTNWAEYEAGPRRRGSLTLWVTPEAL
FT                   DGWATSRRKTRGGQPRYSDLAIETTLMLGMVFGLRLRQSEGLLSSVLAMMGLDLAVPDH
FT                   TTLRRRARTWKPPARSNDRQHVTDGPIHVLVDSTGLKIYGASQWLEEKHGTKSRRSWRK
FT                   LHLAVDADSGEIIAHSPTDKEAGDATQLGPLLDQIDEEIDQFTADGAYDGTPTYDAVLR
FT                   HSAGARVVIPPRSNAVERPNAQAACQRDDHIASMQINGRLKWQTSISYSKRALVETAIG
FT                   RYKGVIGPRLRARLFIAQQTEAAIGVALLNRMLASGRPKSVRCPASAGATK"
FT   gene            691865..692155
FT                   /locus_tag="Arad_7780"
FT   CDS_pept        691865..692155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7780"
FT                   /product="insertion sequence transposase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7780"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29212"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNT1"
FT                   /protein_id="ACM29212.1"
FT                   /translation="MPYKFHDSRHGKFQKGRYRVTNWPAYNESLRRRDDLTIWVSEDVA
FT                   QEWMAARRQTRGGQRRYSDLAIEICLTLRVAFSLPLRQTRGFMRSIAKLMG"
FT   gene            692159..692632
FT                   /locus_tag="Arad_7781"
FT   CDS_pept        692159..692632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7781"
FT                   /product="insertion sequence transposase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7781"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29213"
FT                   /db_xref="GOA:B9JNT2"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNT2"
FT                   /protein_id="ACM29213.1"
FT                   /translation="MPVPDFSTLSWRGMGLEVAQKSRAPDKPITLIVDRTGLKVTARLA
FT                   GTVTSTVPKALVRPGERLHLALDPDSGDILASELTTEHVGDETALPSLLKRVDAPVARF
FT                   LADGAYDGSGVSDCLAAAFGYDVVVPPPKNAVPGGNWQRNQHIEHIAKHGRMA"
FT   gene            693071..693739
FT                   /locus_tag="Arad_7783"
FT   CDS_pept        693071..693739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7783"
FT                   /product="transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7783"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29214"
FT                   /db_xref="GOA:B9JNT3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNT3"
FT                   /protein_id="ACM29214.1"
FT                   /translation="MSRFSELKAIGPSSTVSNSPISQVERDFSSGAHRMKLLDAGMTSM
FT                   DDRAAEAFVKHSQFPRSAGRDIDTPSIHPIDRHVGQQLRIIRIHSNLSQTELGHKVDLS
FT                   YQQIQKYESGKNRMSASVLYEIANCLNVPISRFYDGLPQAGSELVNGGLPEIDERIAYL
FT                   ATSEGRRFVEEILRLPPRLRTRTFALIQVLTGDDEETAGQGAPANAETTHQTEGDEHEH
FT                   "
FT   gene            complement(693876..694580)
FT                   /locus_tag="Arad_7785"
FT   CDS_pept        complement(693876..694580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7785"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7785"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29215"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNT4"
FT                   /protein_id="ACM29215.1"
FT                   /translation="MISTTISYKNHRFSPQIIAHAVWLYFRFPLSLRLVEEMLLERGVV
FT                   VSYETIRRWGFKFEAAYAKQLRRKKPSQKDIWHLDEVLISIGGRKHWLWRAVDQDGYVL
FT                   DEIVQARRDTKAAKRLLVRLLKKQSLSPKRIVSDKLRPYGAARRNVMPGVEHRSHKGLN
FT                   NRAENSHAPLRKRERMMQGFRSVGGLQRFISVFSAIRNLFVPAHQKRSALATHIHRIRA
FT                   MAHWKAVTGATA"
FT   gene            694976..695998
FT                   /locus_tag="Arad_7787"
FT   CDS_pept        694976..695998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7787"
FT                   /product="polymerase epsilon subunit protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7787"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29216"
FT                   /db_xref="GOA:B9JNT5"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNT5"
FT                   /protein_id="ACM29216.1"
FT                   /translation="MFSILKPDHQSSKARMDPQLDMFAKPVEARLQPREAPARKSRSLP
FT                   VPASLTDEEMVRKLEDGGQYRILRKLVPRKIAVSRRPEFQRVGVILDTETTGLNHRNDE
FT                   IIEIGLVAFTFDDFGHIGDVIGVYGGLQQPGTPIPPEITRLTGITDEMVEGQMIDMQQV
FT                   RRMVAPADLVIAHNAGFDRPFCEAFSNVFATKAWACSVSEIDWNARGFEGTKLGYLIGQ
FT                   AGYFHEGHRAIDDCFALLEVLDRNVGEEETPFAELVRTSGQSRVRIFAEHSPFEMKDHL
FT                   KGRGYRWSDGSDGRPKSWWIEIDEDALCDELHYLRSEIYRWEEADPPIQHLTAFDRFKA
FT                   "
FT   gene            complement(696107..696586)
FT                   /locus_tag="Arad_7788"
FT   CDS_pept        complement(696107..696586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7788"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7788"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29217"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNT6"
FT                   /protein_id="ACM29217.1"
FT                   /translation="MSAELPLVRRLEPWHANVGKRLVKSPRVYVRDSGITHTLLGLTTQ
FT                   KDLLGHPVVGASWEGFVIETLIAAAPAGTESNFYRTSAGAEIDLLLTPPGGRPWAIEIK
FT                   RSLTPKLEKGFYLACEDIDPARRIVVYPGQEVFPLKNGIEAMPLASLGKSLLDLV"
FT   gene            complement(697028..697621)
FT                   /locus_tag="Arad_7790"
FT   CDS_pept        complement(697028..697621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7790"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29218"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNT7"
FT                   /protein_id="ACM29218.1"
FT                   /translation="MLAVLHQNDLNPGDPGIGQPCRLRDRSLKHRLLQPSGVLTPSPAD
FT                   SFARLQMAVEQNLREQRFLRSTGPHAQAAGKSSVINGASEGSASLIFDYDFQPPNKSRS
FT                   NLPFGLSKNRSLNNFETTRGRKPTLSSISTTENFFISMVIVRVSSQRRYVSESSELKPF
FT                   CVAHAAIACAVMTCPIAEMKTATMHVQIIPLLSE"
FT   gene            complement(697685..699721)
FT                   /gene="mcpGd"
FT                   /locus_tag="Arad_7791"
FT   CDS_pept        complement(697685..699721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcpGd"
FT                   /locus_tag="Arad_7791"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7791"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29219"
FT                   /db_xref="GOA:B9JNT8"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNT8"
FT                   /protein_id="ACM29219.1"
FT                   /translation="MSISIFSRISTKLVMFSGTGIFLVAVMLITAWQGAQLTSERSTYQ
FT                   KDMLVVSRDLVDAKASLRGMQVGVRDLRLATSPDELAAATDYIAARHHSVIKYLDEAMD
FT                   KLRLQLNRDRIVKLKTLTESIFAMTSDMNEVVKVKVQLKAGDPSVDAKEREVQAKLLAV
FT                   SDEASKLLDEGVDSAKAVATKAEEEANAASASALRLDLGVGLLTIGTLIAAAVVGARLI
FT                   AKPIVRITESMNILAQGDLDANIPFGDRRDEIGSMARAVRVFKENGIKVREMNTQEAAL
FT                   QAKSADLQSSIGAVVTAAVAGDFTQRITRDYDNPDLNRFAAQVNELVTSVDRGITETRR
FT                   VVSALADGDLMESMRGEFHGAFGELQQNVNATMTNLRSVLGEVRAAIDTINGGAGEMRI
FT                   ASGELSKRTEQQAASLEETSSALEEITVAVKNSTERALEASRMVDEARRSTEQSSAVVK
FT                   DAVSAMGRIELASGEIGQIINVIDEIAFQTNLLALNAGVEAARAGEAGKGFAVVAQEVR
FT                   ELAQRSAHAAKDIKGLINRSGDEVNSGVRLVTATGNALGLIQGHVAKINEHMHSIATAA
FT                   KEQSTGLHEVSTAVNEMDQVTQRNAAMVEESTAATSRLAEEAASLSRLIARFKLDGKGA
FT                   IPRATDQSSKPVTSPAHSLRQKLTGAYGGRSATAVAVSSWEEF"
FT   gene            complement(699997..700408)
FT                   /pseudo
FT                   /locus_tag="Arad_7792"
FT                   /note="site-specific integrase protein; Frameshift
FT                   (pseudogene)"
FT   gene            701318..701461
FT                   /locus_tag="Arad_7795"
FT   CDS_pept        701318..701461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7795"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7795"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29220"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNT9"
FT                   /protein_id="ACM29220.1"
FT                   /translation="MPNLGAAQIREASSQRSKGETITDRERELAVTLRKPRAYHYGIGK
FT                   RV"
FT   gene            complement(701527..702648)
FT                   /locus_tag="Arad_7796"
FT   CDS_pept        complement(701527..702648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7796"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7796"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29221"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR025230"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNU0"
FT                   /protein_id="ACM29221.1"
FT                   /translation="MKWNWTQRGWPQFTYDAAALEPLERRFLLSSGEVIGAVRHISDEE
FT                   RNLLRIELLSDEAVKTSEIEGEMLDRLSVQSSLRRQFGFDADNRPIKPQERGIAEMMVD
FT                   VYDSWSVPLNHETLFRWHDMLMTGNRHIGTIGGYRTHDDAMQIVSGRLDRPTVHYEAPP
FT                   SRQVPAEMAAYTEWFNRSAPKGEIPLPALTRAGIGHLYFESIHPFEDGNGRLGRALAEK
FT                   SLAQNIGHPSLIALAYTIEHGRKAYYDQLERHQRTLDITEWLVYFGETILEAQQTTLMR
FT                   VTFYISKAQFYDRFRGQFNERQEKAVARMFREGPTGFKGGLSAENYIAITRTSRATATR
FT                   DLHDLVEKGALTRSGERRHTRYALNLWEINGTE"
FT   gene            complement(702813..703994)
FT                   /gene="intA"
FT                   /locus_tag="Arad_7797"
FT   CDS_pept        complement(702813..703994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="intA"
FT                   /locus_tag="Arad_7797"
FT                   /product="site-specific integrase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7797"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29222"
FT                   /db_xref="GOA:B9JNU1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNU1"
FT                   /protein_id="ACM29222.1"
FT                   /translation="MTRKAITQPVPADPVQRRAEELDALDAILPFDRRDQLTTLLTDDD
FT                   VATLKHLANQGMGDNTLRALASDLGYLETWCRLSTGARLPWPAPESLLLKFVAHHLWDP
FT                   AARAEDSSHGMPTQVEDSLRAQGLLRVDGPHAPDTVRRRLTSWSILTRSRGLTGAFSAP
FT                   SLKTALRLAVRAAPRQRRRKSKKAVTGDVLAKLLATCAGDRLVDRRDRALLLLAFASGG
FT                   RRRSEVAGLRVEDLVDDEPVRADPADANSPPLPCLTIHLGRTKTTTADDDDDEQVVLIG
FT                   RTVIALKQWLAQARIETGPLFRRIDQWGNIDRQALTPQSVNFILKARVKQAGLDPEAFS
FT                   AHGLRSGYLTEAANRGVPLPEAMQQSLHRSVTQAASYYNNAERKNGRAARLVI"
FT   gene            complement(703991..704395)
FT                   /locus_tag="Arad_7798"
FT   CDS_pept        complement(703991..704395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7798"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7798"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29223"
FT                   /db_xref="GOA:B9JNU2"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNU2"
FT                   /protein_id="ACM29223.1"
FT                   /translation="MIAVDTSVILAMALGEPEAERFISLVGREALAIGWPTLLEARMVL
FT                   TGRGFPNASDIVDQFLRLPNVTAIAFDEKHYREAERAFDRFGKGRHPAALNMGECFSYA
FT                   VAAVARAPLLFKGQDFGRTDVKCHPASASQ"
FT   gene            complement(705148..706041)
FT                   /locus_tag="Arad_7801"
FT   CDS_pept        complement(705148..706041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7801"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7801"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29224"
FT                   /db_xref="InterPro:IPR009492"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNU3"
FT                   /protein_id="ACM29224.1"
FT                   /translation="MTEARNAFYLLYPVEIRDRYREVSPESWPVSVSPLADELLSSWLH
FT                   RVAIANGVAPASFAETLGLQNGMWSARLDVAIPPKIASLLADRTGIEQETISRMSFQGC
FT                   GLAALLLPLRHDSKQRFSTWMQYCPDCLDSDEFPYFRRAWRLATRISCFGHRKGLRDRC
FT                   PSCRSGIASFAQMHLIPQHICAVCGFDLCRAPKVSVMLSARRLERFIEAICSPEAIRKW
FT                   TSTGPLLSQVLRTPRMVCGFSARPLTSLSVARRRRCFERLSGELDDYSFDDDDWRGSAT
FT                   THLSFQLEEMTRRLLL"
FT   gene            complement(706038..706922)
FT                   /locus_tag="Arad_7802"
FT   CDS_pept        complement(706038..706922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7802"
FT                   /product="TniB NTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7802"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29225"
FT                   /db_xref="InterPro:IPR008868"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNU4"
FT                   /protein_id="ACM29225.1"
FT                   /translation="MTAHLFDHVRAYLDRSVEEKIAYIQAPRWVGYPIAEAAHARLAEL
FT                   LARPPGLRTHGLMIVGPYANGKTMLVERFAVDHLKMTPLPQRKVWIVQTREGAGLVHFY
FT                   GSILHALRAPICNNQSIGRKIEQIDRLFEHVKPKVLIFDEFHNALRGRSRDIEAIFAFL
FT                   RRIGRQYDISPVLVGEVSVFDCINTTSEMASRFELQAAPRWRYDEDYLALLDSLEAAMP
FT                   LARSSDLSDEPLARKIHELSEGLIGEIFAIITRAALVALRSGKERITRTGVNDLHYIPV
FT                   SRRGRAPQRDCLL"
FT   gene            complement(706923..708575)
FT                   /locus_tag="Arad_7803"
FT   CDS_pept        complement(706923..708575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7803"
FT                   /product="transposase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7803"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29226"
FT                   /db_xref="GOA:B9JNU5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015378"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNU5"
FT                   /protein_id="ACM29226.1"
FT                   /translation="MQKRLKALDGCRTPRVTDERWLTARRIASELDRILEGSGSRCAAV
FT                   DRAAAELRLTTRQVYNLLARYRVTRRLSSLLPRRAETRKKRLAPDIVQIIDKTLREQWL
FT                   VLEAPPLAPVVAEIRARCEEAGFPPPSYGSVSNRIALLFTPEEIARRRSANPHHLQRLK
FT                   PRPGYIHASHPLDICQIDHTPTDINFVEVVEGEGTFVGRAYLTIVTDVFSRCILGFCLT
FT                   LEKPSVLSVALCLAQAMCPKEAWLAARYIDESWPMFGRPHLLVTDSAKEFKGHAFQRGC
FT                   EEYGTRVRYRDRGRVHEGGVVERLLGKLNGVLSICPGSTGRSIADRDQYPSQSRARLSF
FT                   AELERCVALAIIDHNLHQNDKTLKIPAREWQSRAGEIRQFGDDPAQVLLTFLPQVERRL
FT                   TPQGVSIFALDYYSQWLGGVVSRRDRLPKLEARYDPRDVSHIYVRDPDTGEFRPVARRD
FT                   GRLTSLTLWEHRGDRGRRRGTNARSEVDKVALRRQIAAVVGGSKRTRSELRDAVRSVQA
FT                   AEAPKPYDTMHPPSSGPSSHPARQKRRLPVEDW"
FT   gene            complement(709345..710115)
FT                   /locus_tag="Arad_7804"
FT   CDS_pept        complement(709345..710115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7804"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7804"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29227"
FT                   /db_xref="InterPro:IPR019207"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNU6"
FT                   /protein_id="ACM29227.1"
FT                   /translation="MKARHASHLALSTAAALLFLAAGAMAQEKHQKEPRIEPASIAALK
FT                   TMGEHLQSLQNFTIKASTTAEVVLDTDQKLEIGSEATYQVKRPDHLRIDLLTDVVHGEL
FT                   VYDGKTLIYASPEQKTYAQVPAPPTIKETLERAAQRYNLSFPLADLFAWGTKDAPTDII
FT                   REGFFVGHAFVDGKETDHWAFRGPDQDAEIWIATQGSPLPLKISLVDREDLTRPRITTV
FT                   LQWTENAEIPADTFEYKPPEGSERIGFVGEEDKK"
FT   gene            complement(710330..710929)
FT                   /locus_tag="Arad_7805"
FT   CDS_pept        complement(710330..710929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7805"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7805"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29228"
FT                   /db_xref="GOA:B9JNU7"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNU7"
FT                   /protein_id="ACM29228.1"
FT                   /translation="MRRNQMRKAALPALAMALSAVMLAPSLSNAQQVTEQRITSSLGKL
FT                   TGAAPIVDVELLRQEATNGAGKTVATLPNWSKVTHLPQMVVEIDFQNDSVAIEPRSYRT
FT                   LGLIADALHHPNLWAYKFLIVGHASATGGDKHNFELSSKRADAIKEALATTFAVDSERL
FT                   YAVGVGEYFPIDAAKADAADNRRVQLFNLGLFTKKP"
FT   gene            complement(710934..711356)
FT                   /locus_tag="Arad_7806"
FT   CDS_pept        complement(710934..711356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7806"
FT                   /product="cysteine rich repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7806"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29229"
FT                   /db_xref="InterPro:IPR039728"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNU8"
FT                   /protein_id="ACM29229.1"
FT                   /translation="MRKLRNLIATAILACLAVAPTARAETISYADAVTTLANDCGADIQ
FT                   KLCKGLNLGNGRIADCLHQNEAKISPACKSSLAGVATSISRREQAQTAYTKICAHDIAQ
FT                   HCRGIKGDGYILACLVKAERIVGSSCNAAITDAGWR"
FT   gene            complement(711472..711678)
FT                   /locus_tag="Arad_7807"
FT   CDS_pept        complement(711472..711678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7807"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7807"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29230"
FT                   /db_xref="GOA:B9JNU9"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNU9"
FT                   /protein_id="ACM29230.1"
FT                   /translation="MWFPIVVRLPFAVAGIVAGWFLTEGTLRYDVAQMGIALVMFAAFC
FT                   ACVIYAPRIWRTFTGWRKTGGGS"
FT   gene            complement(711691..712833)
FT                   /locus_tag="Arad_7808"
FT   CDS_pept        complement(711691..712833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7808"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7808"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29231"
FT                   /db_xref="GOA:B9JNV0"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNV0"
FT                   /protein_id="ACM29231.1"
FT                   /translation="MPEDTLEDSRIRLMHGGPFYQLMSRLGLRSRIWRAIVFGLVCWAA
FT                   PLLMLLVSEGASGAGAFMQDWGAWAKFALAPVLFTLAERPIGFAVDECTSILFKTPLIA
FT                   SQSMNDARAALAGTRERTTARLPEASCLLVAVAASSLNLSGFLHGVGPGWAQSGGELSI
FT                   AGIWCVAVSNTLYWFLLTRLFWKHAIWVRFLSAIAGCRLRLAVTHPDGHGGLGFLGLYP
FT                   AGYTLFTLGISCVAAAGIGHIMQQEPVTSTLFTMVCVVWLVVVLLYYGLPLAGLATQIA
FT                   RLKQKALMQSMAKATDFERKTEHLLMGENIIPDEAEPKTDEFRDVKPVYQAALKISALL
FT                   INKHNVLPVLVPALLPLLAVGASYLSYSQLGPIAKRLLLL"
FT   gene            complement(712835..714751)
FT                   /locus_tag="Arad_7809"
FT   CDS_pept        complement(712835..714751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7809"
FT                   /product="small-conductance mechanosensitive channel
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7809"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29232"
FT                   /db_xref="GOA:B9JNV1"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNV1"
FT                   /protein_id="ACM29232.1"
FT                   /translation="MRWLALGLLIFCMSVTANAQTSRPQKVDELVQLLRDPDVRSWLEK
FT                   EAPSVAASADVGSKDFLSAWEAATRSRVDDILAAFPRIPGQLAEAVSRTRQEAISHGFA
FT                   PVVIILVGLIAIGAMAERLFAREWRANASDLAAARLLPLAVFATVMAIVFFAVEWPPLV
FT                   RMVLLVSLLALVAYRIVSALISMAAPPPSILRRARLFVAVLILAVASASLGAPLSVDPA
FT                   VTLAISWCFSIALLLLAVEAVWMTAAKPLRTKVALTVFLLAIWLLWCLGLKGLFWLGVY
FT                   ALALPAIVRTVGNAAEVMFPSKPDSTRHVLVGHGSRSLVILLAVAWLSLVWRLDPNSLT
FT                   RIDPAVGAIAHGLLKSVIILLGADIIWHLARSWIDRTLAIQGDTLPADETARRARLHTL
FT                   LPIFRNVLAVMVIVMAALIILSELGVKIGPLLAGAGIFGVALGFGSQTLVKDVISGVFY
FT                   MLDDAFRVGEYIQAKSYKGTVEGFSLRSVRLRHHRGPVFTVPFGELGAVENLSRDWAID
FT                   KFKISVGYNTDIDKARKILKEIGATLLADPELGPLFIQPLKMKGVEEFGDYGMVLSFAM
FT                   TTVPGQQTFIRRKAYAMIRDAFQKNGIDFAQPSVQVGDDKTAAAAATAIKVSAEAKLPA
FT                   AEG"
FT   gene            complement(714748..715542)
FT                   /locus_tag="Arad_7810"
FT   CDS_pept        complement(714748..715542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7810"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7810"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29233"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNV2"
FT                   /protein_id="ACM29233.1"
FT                   /translation="MADFRGIAVGLAFMASSAVAQEHQDVNDANNPLTPKITINLQDYY
FT                   VPSFTDSPGHPTSNQFLLRGLIPSDLGGLPQLFRFTLPLGTAPDVPTGYVTGLGDLTLM
FT                   DIFILPKHGDVTFGAGPLFVLPTATDESLGTGKWQAGAVGIAVAPQSWGLLAGLATYQT
FT                   SFAGNEDREDVSLLTFQPIVNFNLKDGWYLRSTATWNFNLESGDSYIPVGLGVGKVMPL
FT                   QKGITMNAFIEPQYTVWNQGSAPRWQIFAGINFQFPIRKHSE"
FT   gene            715758..716039
FT                   /locus_tag="Arad_7811"
FT   CDS_pept        715758..716039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7811"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7811"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29234"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNV3"
FT                   /protein_id="ACM29234.1"
FT                   /translation="MSGGDGVEHARTGLSERGLWKLMLKLPAVRGRLQIVGRLHPSITN
FT                   LFEAYEEASSALERMRKIGSTTPEMIAEYEIICAEIESEVIQICLESR"
FT   gene            716323..718083
FT                   /locus_tag="Arad_7812"
FT   CDS_pept        716323..718083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7812"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7812"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29235"
FT                   /db_xref="GOA:B9JNV4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNV4"
FT                   /protein_id="ACM29235.1"
FT                   /translation="MLQSLVMRAINASGLSELGDCAVGAAMGAEERLAEACSITDEEAR
FT                   SEFERLLLDSRFHATERSRLILSYLAERHFSGHEDAVKAYTIAIDVLGRPSNFDASTDP
FT                   IVRIEISRLRSFLDQYYEAYKGSGVAIDIPTGRYVVRFSRCHVSHQDEVGAGTDDTVRN
FT                   EADTGPSVQNGFKARARPSRKLILCGSVGASIAVVLGGLIALYAQRPVLTQKPVVVLNI
FT                   TAADQALGPETGLTKDYLMTALMRFNTLSFASLRTTASRNIYSVDIKYYSDDDDRTAWW
FT                   QVSSPDGDILKSGIETVSLEGRSPAAARDELVSALARRLGSSRGVISNIEMHRAPAGAL
FT                   GNACILRVEHDLDERGLKELANEDGCLKQTIARNPTDAEAIATLARAKLAADPGNVKEA
FT                   LDLANRAVSIAPTSDRANIALMSAQFLDGRSAAAIEIGNKALALNPSNPEISAKLGAVM
FT                   FATGFYESAVSLASDAAKAADGAPRDAMLVLALDAYRRGNWSDASLLSEQITCNDFVVS
FT                   ALRAASLGQLGSPEAQQRLEDLRKRTPDFERGFSKRMAGIHYAPTLTVALQDGLKMAGA
FT                   HFVPEQFATK"
FT   gene            718202..719188
FT                   /locus_tag="Arad_7814"
FT   CDS_pept        718202..719188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7814"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7814"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29236"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNV5"
FT                   /protein_id="ACM29236.1"
FT                   /translation="MRASSVIGTMVAAIVAATATQSMAAEGAAGFYLLGSKGPAAAVTP
FT                   PPGVFFQNDIYYYSGSLGGGKSLPTGGRIAVGVDGKAAVEIPTVLWVLPEDIAGGHLGL
FT                   SATVPLGWKDTEASAIVSGPIVGSRGGGVGDTVFTIGDPLIGGFLGWQSGNLHWQVGTL
FT                   VNVPIGDYQKGEISNIAFHHWGADVYAGASWLDPNTGLDLSGVVGMTFNAENPATNYKT
FT                   GNEFHFEWAVDQHFNKQFDAGIIGYYYDQVTGDSGSGATLGGFKGRAVAIGATIGWNFE
FT                   VGQLPVSTRLKYFHEFDVTNRAQGDAVFLTVSVPLSITKPTSVADAQ"
FT   gene            complement(719359..719856)
FT                   /locus_tag="Arad_7816"
FT   CDS_pept        complement(719359..719856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7816"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7816"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29237"
FT                   /db_xref="GOA:B9JNV6"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNV6"
FT                   /protein_id="ACM29237.1"
FT                   /translation="MLGKLKADIKAFLVLSAYLYVCLSALILYKMTIVGGSGDGFWPFG
FT                   LPAIKALLLAKFMMVGHAARLGDRYVERRLIFIIALKATLYLILLILLSVAEEIVVGLI
FT                   HGTTISASLQDLGGNKLPQILATSVIMLLILIPYFASIELNASFENGLWGMLMTRRTAP
FT                   RR"
FT   gene            complement(719890..720906)
FT                   /locus_tag="Arad_7817"
FT   CDS_pept        complement(719890..720906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7817"
FT                   /product="nonspecific acid phosphatase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7817"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29238"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNV7"
FT                   /protein_id="ACM29238.1"
FT                   /translation="MKNFFQAHDATPTSLFVSLVFILVGVFSPALAQEPLASWNDTAAK
FT                   NRIIDFVKKTTTAGGEGYVAPEDRIAVLDNDGTLWAEQPYYFQLGFMLDRVKTLAPQHP
FT                   EWKTKEPFKSVLDGDLKNIAKSGEKGIIELGMATHAGMTTDQFSKIVTDWFATAKHPKT
FT                   GKPYDQMTYVPMRELLDYLRENGFKPYIVSGGGVEFMRPMTEAMYGIPPEQVVGSTIAT
FT                   EYTIVGDVPVLRRLPKIDFIDDGPGKPSGINKFIGRRPIFVAGNSDGDYEMLRWVTAGK
FT                   HPGFAMVIHHTDGDREYAYDRTSAFGKLDKVLNEAERRNWLVVDMKADWKKVFAFAQ"
FT   gene            complement(720917..721885)
FT                   /locus_tag="Arad_7818"
FT   CDS_pept        complement(720917..721885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7818"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7818"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29239"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNV8"
FT                   /protein_id="ACM29239.1"
FT                   /translation="MAFAFDTDRQAADRPEGMAWIPGGTFIMGSNSHYPEEAPAHPVKV
FT                   DGFWIEETPVTNRKFMAFVKATGYVTLAEKAPDPEQYPGALPEMLRAGSLVFTQPKSVS
FT                   GPNISQWWIFKFGANWRRPLGGLSDLRGKLDHPVVHVAWCDAKAYADWAGLELPTEAEW
FT                   ELAARGGLDDVEYAWGSEFQPNGVVMANTWAGTFPTHSLKAKGHERTSPVRAFPPNRYG
FT                   LYDMIGNVWEWTADYWSPRHEKPALHACCIPTNPRGGDQEASFDPRQPEILIHRRVLKG
FT                   GSHLCAPNYCRRYRPAARHAEPEDTSTSHVGFRCVKRKPAL"
FT   gene            complement(722025..723347)
FT                   /locus_tag="Arad_7819"
FT   CDS_pept        complement(722025..723347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7819"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7819"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29240"
FT                   /db_xref="GOA:B9JNV9"
FT                   /db_xref="InterPro:IPR025738"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNV9"
FT                   /protein_id="ACM29240.1"
FT                   /translation="MRVLIAVAVLLMTARIALAAEPFAQASVDGKGDLVPGQQVHISVD
FT                   IFVPDFFTSPPQYSLFELPNAVVTLPDERAQNLIRTVDGVQYSGIRRRYAVVPEAPGNF
FT                   TLPEISIPLGYSRDGNPVKFEVKVPPVTFTVEGISGGSAQAQALAFAARGLQLDQSFDR
FT                   DPAKLTAGDAFVRTITVFAEDTQAMLIPPVDIKAASGLRQYENPPRLEDNARHDTAAGS
FT                   SRTQTVVYTADKAGNFDIPAITFSWFDIDGHKTQSASLPELKVTVSDVPPSQHVITPQV
FT                   RDDARSPAARHALWLAPALLGVAIASMALLIWLSRLIIAWIEKAKKRRSGSLRGDLKRL
FT                   RRIIHEGDDIGIYAALSQWAARLGHRSIAAWVSSEESQELAAQVETLELRLFRSGVAEI
FT                   DRKRLSALIDIRPARERGPKASRLPELNPTLSRSGAAADVS"
FT   gene            complement(723344..724894)
FT                   /locus_tag="Arad_7820"
FT   CDS_pept        complement(723344..724894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7820"
FT                   /product="Tetratricopeptide TPR_4"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7820"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29241"
FT                   /db_xref="GOA:B9JNW0"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNW0"
FT                   /protein_id="ACM29241.1"
FT                   /translation="MISDFHFLRPWLLLTLFLPIAMLWLSYRSGDVRSQWRGMIAPHLL
FT                   DSLVVDATKRSRLRPAWLLALILVFGAVAAAGPTWQREMPPFVEDTASLVIAVDLSQTM
FT                   DAIDVSPSRLERAKLKIRDVIAARPGARTAIIAYAGSAHLVLPLTEDASLIETYVDALA
FT                   TRIMPKPGKDTTAALKLAAALLKQDGAPGTILLMTDGVETSAIEPMKSMTSGIVALGIG
FT                   TAAGGPVKTPGGGFLSDSNGARVFAKLDIDALNKLRAETGADVATITDDGTDVRWINQR
FT                   IRTNFTRKAAATGDRWHDMGWWLLPPLAILFALSFRKGWVVRAGIILLAFNLASPGGAH
FT                   AGEFTDMWLTRDQQGRMAFERGDSAAAADLFQDPMWKGIALYRTGRFQEAIDAFASIDT
FT                   AQSWYDQGNALLRLSKFDEAIAAYGKALEKRKGWLDGEVNLAIAKRLSKARKDDEQKEQ
FT                   EGEGKPDQVQFDDKGKDGVRGRIDSEMQTSEIWMRNIQVSPADLMARKFSLELQEKKP"
FT   gene            complement(724891..725880)
FT                   /locus_tag="Arad_7821"
FT   CDS_pept        complement(724891..725880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7821"
FT                   /product="von Willebrand factor, type A"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7821"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29242"
FT                   /db_xref="GOA:B9JNW1"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR033881"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNW1"
FT                   /protein_id="ACM29242.1"
FT                   /translation="MYQLDLPWLLLLLPLPLLVWWLLPAHLQMSASVRLPFFAEVTEAA
FT                   GLRPTEGAIIAHRTWPQLILESLAWSLLVLALARPQFVEPPIEKVEPQRDLMLGLDLSQ
FT                   SMDTKDFRAPDGNLEARVDAVRKVVGDFVARRPGDRIGLIAFGDAPYPLAPFTMDHELV
FT                   REIISGTLPGIAGPRTSLGDAVGLAIKMFEKTTVPEKVLIVLTDGNDTASKMPPLKAAE
FT                   IAKRNGVVVHTVGIGDPQATGEDRLDATALEKIAETTGGRYFFGGDQAQLAAAYDVLDK
FT                   MTPENQKNLSWRPRVELFQWPLIASVALLGLYNLASAVVAMLRRRAAA"
FT   gene            complement(725867..726391)
FT                   /locus_tag="Arad_7822"
FT   CDS_pept        complement(725867..726391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7822"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7822"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29243"
FT                   /db_xref="GOA:B9JNW2"
FT                   /db_xref="InterPro:IPR025489"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNW2"
FT                   /protein_id="ACM29243.1"
FT                   /translation="MVAQVSHPNAMTETALSGMHDIALPPPVSWMPQTFGWALLGLILL
FT                   AGLAIAAFRWFRNYRANAYRREALLLLKNIEVRLRHEEAFGDTICEVAELLKRTALATW
FT                   PREKVAALSGREWVDFLDQQNDGKTGDVLKQLLNDAEYRSHSDLGTRSPAAGADLITAA
FT                   RKWIEQHHVSA"
FT   gene            complement(726391..727326)
FT                   /locus_tag="Arad_7823"
FT   CDS_pept        complement(726391..727326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7823"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7823"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29244"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNW3"
FT                   /protein_id="ACM29244.1"
FT                   /translation="MTNGVYVDTEHLVALEPLARDLAFVQKAKSHQQLAGRMQSSMRGR
FT                   GLTFEELRDYLPGDDIRSIDWRVTARTRKPAVRVYSEEKERPAILLVDQRINMFFGSRL
FT                   AMKSVAAAEAAILCAWRILGSGDRIGGFVFNDTSIEEVKPHRSRNAVIAFAEKIAKQNG
FT                   SLRADAPTPPNTAQLDAALASVTSVAHHDHLLIIISDFDGHTAWTRDALLGLASCNDVI
FT                   CLLVYDPFLLQLPTSGDIVVSGGGLQAQLAFKRSNVRSAIDNFARSRGRELRAWQRELG
FT                   LPMLPVSAAEETAPQLRRLLEQSAWRQRRR"
FT   gene            complement(727323..728300)
FT                   /locus_tag="Arad_7824"
FT   CDS_pept        complement(727323..728300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7824"
FT                   /product="methanol dehydrogenase regulator MoxR-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7824"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29245"
FT                   /db_xref="GOA:B9JNW4"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNW4"
FT                   /protein_id="ACM29245.1"
FT                   /translation="MTARDDILQLGKRIGQSIIGQDAMIERLLLGLLANGHLLVEGLPG
FT                   LAKTRAIKSLAKNLDSELSRVQFTPDLLPADITGSEIYFSDGGKSEFKFQQGPIFANLI
FT                   LADEINRAPAKVQSALLEAMEERQVTVGGKSYPLPPLFMVMATQNPIEQEGTYPLPEAQ
FT                   LDRFLMHVEVGYPDEASEAAIMRLNRDEENLAHSDHPATTPTRLAPQAIFNARKQIGAV
FT                   KVSEPVEKYIVALVFATRYPDRYDKDLAKLLQVGASPRGVIGLDKVSRAKAWLAGRDYV
FT                   TPDDIKAVVNDVFRHRLILSYEAHASNVTADQVIDRITALVAVS"
FT   gene            complement(728368..730011)
FT                   /locus_tag="Arad_7826"
FT   CDS_pept        complement(728368..730011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7826"
FT                   /product="sulfatase (sulfuric ester hydrolase) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7826"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29246"
FT                   /db_xref="GOA:B9JNW5"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNW5"
FT                   /protein_id="ACM29246.1"
FT                   /translation="MTTSFSHKLRTATAAVAFTLTSVSVAPLAAYAQQATPATTPAAAD
FT                   GSRPNILVIFGDDIGQTNISAYSMGVVGYKTPNIDSIAKQGMMFTDYYAENSCTAGRST
FT                   FITGQVCLRTGLCKVGAPGAPVGLQPGDMTIAQALKPLGYATGQFGKNHLGDKDEYLPT
FT                   NHGFDEFFGNLYHLNAEEEPEAPYWPKDDPAFLKAYNPRGVVKASADGKIEDTGPLTKK
FT                   RMETIDDETTAAAIDFMGRQVKQNKPFFTWMNTTRMHLFTHVRDSMRGQSGMSGNEYAD
FT                   GMIEHDGDVGKLLKALDDLGIKDNTIVVYTTDNGPNQFSWPDAATTPFRSEKDTNWEGA
FT                   FRVPAMVRWPGHIQPGQVVNGMFSGLDWFPTLLAAVGDPGIKDRLLNGWQPPGSSTTFK
FT                   DHLDGYNQLDYLTGKSDQSARHDFYYFDDDGDLVATRYDDWKVVFKEQPAPGGFAVWQT
FT                   PLITWRLPKLFNLRMDPYERADIVSDQYNDWLTRNDYLLVKGQLQAGAFLETFVKYPPS
FT                   QRVASFNIEGVRAQVDKAIDQSFKDRGIEK"
FT   gene            complement(730202..731410)
FT                   /locus_tag="Arad_7827"
FT   CDS_pept        complement(730202..731410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7827"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7827"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29247"
FT                   /db_xref="InterPro:IPR010297"
FT                   /db_xref="InterPro:IPR014586"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNW6"
FT                   /protein_id="ACM29247.1"
FT                   /translation="MSKKTVLAILLALSGCGHPSGVMVPVALTAMKPKISQVDMLVATT
FT                   RQPSGNPATLFNGERSPRPYMTEVAVSIPPKRAAGTVQWPKKLPPNPATDFAVTRVRQI
FT                   ETVAEGRIWFRQHIEGGHALVFIHGFNNKYEDSVFRLAQIVHDSGMQATPILFTWPSRA
FT                   SLFGYEYDKESTNYSRTALEQSLRVLAADPAVKDITILAHSMGTWLAMESLRQMGIRDG
FT                   HVDPKIHNVILASPDIDIQVFAKQFVEMGTPHPKFTIFVSQDDRALAASSLITGRVARL
FT                   GGIDPTAEPYRSKLEEAGITAVDLTKVKSGDSMNHGKFAESPQIVQLIGQRLMTGQPLT
FT                   DSNVSLGEGVAAVVGGTARTVGTVAAAAVSTPLTVIEQPTKRKTIDVGDTLQSNPKSAP
FT                   LTQ"
FT   gene            732008..733072
FT                   /locus_tag="Arad_7829"
FT   CDS_pept        732008..733072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7829"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7829"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29248"
FT                   /db_xref="InterPro:IPR011670"
FT                   /db_xref="InterPro:IPR021068"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNW7"
FT                   /protein_id="ACM29248.1"
FT                   /translation="MARLDERIARSPVGQGWIERSHFADACASLWIDGELVHLEDLVLH
FT                   DAGADIRAPTHELTIARDVLRTRRRIASQPPGWALSADGLRSLRGQAWPAASFDADSAG
FT                   AIDTAEPDAVAVGEGEGEHGDDGASPLDAEFAAIDAVLARSEAAIEQAKKPGGATAREK
FT                   DPFIYDLDWDEDERLDEWRAVLRELDGFPPVLQAIVALDAWNGLEVLQHAPWLGRLLAA
FT                   SLLRQAGVTTGVHLGAINLGLKSIPVDRRRNRDRETRLLAIAHGLISVAEIGLKEHDRL
FT                   TLARQSMERRLIGRRQSSKLPALIELVLSRPLVSTGMVAKAIGVTQQAAVRIVGELGLR
FT                   EMTGRGRFRAWGIT"
FT   gene            complement(733152..734369)
FT                   /gene="cpxP2"
FT                   /locus_tag="Arad_7831"
FT   CDS_pept        complement(733152..734369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpxP2"
FT                   /locus_tag="Arad_7831"
FT                   /product="cytochrome p450 monooxygenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7831"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29249"
FT                   /db_xref="GOA:B9JNW8"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNW8"
FT                   /protein_id="ACM29249.1"
FT                   /translation="MVAGVAIEEAPTHMRLIFGPALQSDPHSTYRLFRENWPVARIDWP
FT                   HRGSGEYLITRYSDVISIATSQGVSIDRSLAALPLSKQNRIEEPLFGTVLTLDNSVHAN
FT                   ARRVLSSRLHRRTSALEPVLERTFAQLVGNYADGCELDIIEDLAEPICETMVAWITGFD
FT                   LAAVKAMQVPSEKFVSKGFTFGSEFVSPGVLDCVAYLKDAIRRQLMSSLPDETLLEARL
FT                   ASGDRDVASYDINTCLLVITAGLQTTKHSIGNVLATLLEHPKLIEELRTSPTSVPSAVE
FT                   ECLRFDGPSQAVGRVLLRDTFMRDVLLKKGAFVRLALSAANRDPEHFPDPDVPNIHRES
FT                   CRHLAFGFSQHACLGARITRICLNVVVQGLLNEFPAIELSPRGSERLLGSSLRGYRSYF
FT                   VTVKRA"
FT   gene            complement(734378..735568)
FT                   /locus_tag="Arad_7833"
FT   CDS_pept        complement(734378..735568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7833"
FT                   /product="beta-alanine-pyruvate aminotransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7833"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29250"
FT                   /db_xref="GOA:B9JNW9"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNW9"
FT                   /protein_id="ACM29250.1"
FT                   /translation="MRRARQVDALLDARPSLFFTGIERIGGYPLFVSRAAGPYIWDVDG
FT                   NRYIDYILGYGSVVLGHAASAVEAAVAEARNELGANPTLLNVRQVELAEKIVSLVPGIE
FT                   SVAFLKTGTDATTAAVRLARAITRRRLIVRWGMNGWADWCAPVTAGVPVSVQDNTIVLS
FT                   YNDIEQARAIFSKHGSEIACVIMMPYDQIAPAEGYLEELRQLCQLHGALFILDEIRSGF
FT                   RVAMGGAQEYFGISADLVTFGKAIANGHAISVLAGRKAHMKHVLSIGMTVTYYRMPDAM
FT                   AAANATIGELERNDGPNRLANFGLSLIEGINRTAQAAGIRAQMKGLACTPWLNFDYGER
FT                   NNERALRMFCNGLLSRGILMSPVHHMFLCTAMTQNDVNQTISAASEVFDEIRHSLA"
FT   gene            complement(735621..736613)
FT                   /locus_tag="Arad_7834"
FT   CDS_pept        complement(735621..736613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7834"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7834"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29251"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR041667"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNX0"
FT                   /protein_id="ACM29251.1"
FT                   /translation="MLAQSQEWLEWAAYNIAVGVSETAVKEEILKSGLTEGEFSSFLSS
FT                   LKSSPEFRAMKKLSRKYKLACDLNEALIALESEVFNFNEISRIEGLPPDEFLLKFYAAN
FT                   RPVILTDIASKWPAVEKWSLEFLSETYGEEPIVYQNGRSADDHRDSFVDHTVKGTLGDY
FT                   IKLIQNVPAGVNPPYLIAHDRLLDRASFKPLLNDVVFDDRYLSAHDSHGRVFFWLGPAL
FT                   SSTPMHRDLGNVYMAQIAGRKLIRMVPSKEIQFIYNEIGYHSEADFDNLALDKFPLLRN
FT                   AHIMEFTLHPGEFLFIPVGWWHFVKSLDTTITVTGNNFRFLNNLRPIFE"
FT   gene            complement(737462..738682)
FT                   /locus_tag="Arad_7836"
FT   CDS_pept        complement(737462..738682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7836"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7836"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29252"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNX1"
FT                   /protein_id="ACM29252.1"
FT                   /translation="MNTIFWSWQSDLEGRVTRNVIREALAGAIEDLDVELDERHELTSD
FT                   TQGVAGSPDIVATILAKIAGAKVFVGDVTPLAVSPKGKALANPNVLIELGYAKRAIGLE
FT                   RVILVWNSAFEGATIDKLPFDMRGRRAPMSFHLPIEATTAELRAVREKLRRGLRDALRL
FT                   SIAAGSSAETPSLPSWQPTGQSPGLWFNPESRLTINEDGRPGTKEMSPGPYRYVRILPR
FT                   SWTAPAVFGLEGLRPAILGPTQGSSWGSTKGGFLVFTGSLRAGRERPLRNMVMQFRESG
FT                   ELWGVDPFESNGETGERFFADAAISHFFAFIRDNLPVLARQGAKGPFEVIMGVTGLEGR
FT                   YWVTQTRWGGNPIALEESAEARFTLNGTNEEQWLDALVPAWGTIASAFGVGQPPHDVMR
FT                   QQIRGRR"
FT   gene            complement(738689..742717)
FT                   /locus_tag="Arad_7837"
FT   CDS_pept        complement(738689..742717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7837"
FT                   /product="adenylate/guanylate cyclase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7837"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29253"
FT                   /db_xref="GOA:B9JNX2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNX2"
FT                   /protein_id="ACM29253.1"
FT                   /translation="MTQEKSAKQYGELAAKIIEGRTRLGLSQTELAAELGLKQQAISRW
FT                   EAGTHRPSVDQVPAIAKLIEAESSTLMTLAGYGQPVASSLSTLFPVEALPPDVFERFVE
FT                   ALLGDLYPEAEVNILGSRGHAQKGSDVIVTYPDGRVLSFQCKRVERFGIADIEKAVADH
FT                   TLDAERKFLVLSKIATPAAIETVTAHPGWGLWDKQVLTRKVRSLRIEAQERLVDIYFRG
FT                   QRMALLGRNEPGPWVTNEEYFAPFQGRSAIFTHDWPLVGRDSDVERVVEALRNGADRFT
FT                   LLFGPGGIGKTRILKEAIARFIDQHRGTLVRFLSASQEPNAASLAALGTGRKLLVVDDA
FT                   HDREGLKLLVEYAVNEGNQTKLLIASRPYAEQRIRNELALYGIAEPQTITLDRLDRDSL
FT                   RKLVVDVLIEFGGDPGSADAILAAASDSPLVAAMAARVVAEEGLAPELARGETKLRRFI
FT                   LSRFTNVITGHLGAPSDAPLLRAVLEVIALIQPFHIDDRRVAELVQGTRSSIQSSDVGR
FT                   ALKLLVDGGVLYKRGTLYRLMPDLLGDFLIEDTCIGADGRLADFAIAVADHVEADRLTQ
FT                   VLVNLGRTDWRMADGDPSNSQRLEPIWQTLRAIDEPHDGRIAAVEAVAYYQPAQALLFV
FT                   QAQIEHGRILREFGNILKRVAYSPEHRRDALGLLWDLGQTDDRDTNPHPAHPIRILADL
FT                   VGYDEYKPVSFNEEVAEFGFELLEKPDVWSRRYTPFDILKPLLSGEGMTTRSTGRGISM
FT                   SPFLVEYDVVAKLRARLIDRIIELLESDDERAAFHAARMIEDSVRSPYGMMNNDVPAAL
FT                   KTKYESEFSETIARIATLLTKGTLAPTTIIRVIRSLDWYAKYGRGPLHDQVSKLFRMLP
FT                   ADLDFRFHAAIAEGAEYTFIGQTPFDSWSREKEWRTAFVTELLAAYPDRNVLCDALVAR
FT                   LKTVRSVGMSVFPAAQLVNRMINADPRIGATIIERSLSDPDTILRIYLGHAVGAVFETQ
FT                   PDQGRSMIARMIEANDPEIRMRGAEGLIGLRRPYDRLDIDLLTAGLSSAHLDVASNAVK
FT                   ALQNWRDMSARVAVPLLLCVEFGENAALFDDFAAALTQRFEGALEEMDPAEVETLLKRM
FT                   KALRRLDDYWAGELLTRLAQNHGLAVAEFLLARADIALAKKDGEDYRAVGHGHRGGGLA
FT                   LETSPDISAILECVWRWLGTHDDVWPRARYSIGETIAAMFKLDSPPVVEFLNTMLERAT
FT                   ASDLEWIGRILHKAHHTFVITQRRFVEAYLNRCKAVEPRLVDLAIDQLGSAAVSGSWSG
FT                   TAGEPMPRDVEARDASAAILASMSRLSPAYKLYRRVHENAQQNIARTLAEAAAFDDED"
FT   gene            complement(742957..744273)
FT                   /locus_tag="Arad_7838"
FT   CDS_pept        complement(742957..744273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7838"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7838"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29254"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNX3"
FT                   /protein_id="ACM29254.1"
FT                   /translation="MAERIEITFDQHYARTSDQPTSWQQTMLSDRESNYEWDRDGEQTV
FT                   YAIMNSADMPEAAAEDIQQILEDKFDDFDSAAMGEETEFSSDAYYEQKGTSDQAWQEEW
FT                   RSFEKSLKTEARFFSRDAASHLAAIFNGIDALRSLDGRPLVVDAGPGTSFTSVYRARVF
FT                   QSADKLEAALCQPDQQLGSPPTFLASAGRMNARGISVFYGANDPTAAIAEVRPPVGSQV
FT                   AVARFEIIRPLRLLDLTALSAVSDGGSVFDFELAGRLERAMFLRSLSQRITRPVMPDDE
FT                   AFEYLTTQAVADYLATEGAVPLDGILFPSVQAAGAVLNAVLFHKAARVEKVDVPVGTEI
FT                   SARSGHMEDDGWEIEYEVIERVPPAVAEEPTERQDTSRWPNFASLAMSPWEPADPDWRE
FT                   PALRIISDSICVHIIRRVQFETDEHHVTRHRWVKRDANF"
FT   gene            complement(744443..746149)
FT                   /locus_tag="Arad_7839"
FT   CDS_pept        complement(744443..746149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7839"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7839"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29255"
FT                   /db_xref="GOA:B9JNX4"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNX4"
FT                   /protein_id="ACM29255.1"
FT                   /translation="MVLVLCDQRRRLLETEGSILVRGGAGSGKTTIALAKACADLAAGR
FT                   LGNTGKALFLSFARATVARVAEQATATIPREQLARIEINTYHGFAWTILKSHAYLLCAR
FT                   PGVSLLLPAQARGRLAGLDGAARLARQRELFDQEGLIAFDLFPSLLTELFALVPLLAQA
FT                   YARAYPLIIVDEFQDTNTAEWQMVARLGQHSRLIALGDPKQRIYDFKGADPRRFDEFIE
FT                   AFRPTLFDFQGENRRSPGTQMTDFADDMIDGVFKAVAYTGVSIARYGGQSLRPLKQEIL
FT                   RAVGRLRRANEWSLAVLVPANALAVGVFDYMARADHGLPRYPVEILVSAEGPMLAAAMI
FT                   ALLLEPRDHPDHLGALVLDGLAAFELGRNEAASAGGITKAARLRTIARSLRAQGDAGFG
FT                   VRGIGPDVRALLESVAAHPLSGDPMTDWRSIRAIFEASPRAELQAVAKEARHMRLLRRG
FT                   AQIESRFAEVWRGHGTYRDARGLLSAAVVEDQFAATTRPHHGVTVMTIHKAKGKEFDEV
FT                   IVFEGAYQRYLQPRGADAERSARFNLHVAVTRARRAVTIMTPQANPCPLLP"
FT   gene            complement(746155..747951)
FT                   /locus_tag="Arad_7840"
FT   CDS_pept        complement(746155..747951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7840"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7840"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29256"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNX5"
FT                   /protein_id="ACM29256.1"
FT                   /translation="MRIVRVHIENFRGIKLADIYFDGTTVLLGDNNTGKSTVFEAIELA
FT                   IGADRLARTQAIDEHDFYGGDYRAGENQVPKIIVVEVVIADLDEQHCTKFRNNLEFWRT
FT                   AARSLLGAGVAGGAAQAGTEPAVRVRFEGAYDSENDEFTAKTWFAVPRQEDGTPISECR
FT                   SGDKREFGFLHLRALRTGNRALSMERGSLLDVILKTYEVRTRMWEGLLGRLRGLDVVGA
FT                   EDAEFGRILTAIRDAMREIVPGEWADAPHLRVSELTREDLRRVLKSFLATGVPGYAAPF
FT                   QHQGSGTINALVLAMLGLIAQRRNGRVIFAMEEPELSLPPHVQKRVVDKVRELAAQALF
FT                   TSHSPYVIEQFTPEQMAVLTRDNAGLLTAMSVVLPDSLKLKIFRDGFRTRFCEALLARR
FT                   VVVVEGKTELVAYSAVARRAAELAPAQYKRLDALGWVPFDAGGQTAVAPFASFFRGLGK
FT                   TVATIFDQQQPDARAAIVAACHAPFEQPYAGFEHMLQAEVSPAMQAWFVQWFVGAGEWP
FT                   PALAHLVPPNGSPEAAYRAPFLSLFTHKKGDDYLTVFFDLCQVGHFPQTMLGILTALKN
FT                   MVAPPVPPVPQPPAPQPPGIFG"
FT   gene            complement(748119..749753)
FT                   /locus_tag="Arad_7842"
FT   CDS_pept        complement(748119..749753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7842"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7842"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29257"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNX6"
FT                   /protein_id="ACM29257.1"
FT                   /translation="MASRDRFMSAKEFGALIADLRLTPTIFQDGLLEFFEHERIVVPVV
FT                   RVCWPNSLILESRDVVSDPPPTQAERDTTQALSDALRLWRRFDADPELPHPFDLGAQAP
FT                   GAALITTDVASQEFVDWADFRTNIRGAGQDPLYVSDGVDTYYHDWQVLLVADALKMGVH
FT                   VIFDTRKPELLKQAVSGRLSDIPAKMTRSNVSFEGPRGLAKGLEWAHWFDAAAKVEAVR
FT                   SRKLTAVSMGHNGHTFTLEGVELADFNAVQKRSAERALAAIAGTRDHARSFLIYLCERW
FT                   DEWSRRGGNDVAGEYKRQIGLALRMVMLAFDTDFKAIAIEVGRASGHFANTLDVIFPDW
FT                   KHDARDKAELSLKHSVVAKAPTADATLTLDDAAITDLLDWLERTDQWRVHLSIEAILKH
FT                   QFGASSVDHSALAKEVESLSTTFEHLANALLDEAGVSSPATLMKKVQAFWNTSTEVHGI
FT                   LTTRYSLVGTKTATRADRLAAIAALTPSGPNIDVARTILAAVLYRNDGLHNGMASWVEA
FT                   ELHEAARIFLTAMMFCRKNLFVSPPSP"
FT   gene            complement(749823..751553)
FT                   /locus_tag="Arad_7843"
FT   CDS_pept        complement(749823..751553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7843"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7843"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29258"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNX7"
FT                   /protein_id="ACM29258.1"
FT                   /translation="MTHHIFFSWQSDTPNAVGRSMIEACLERAIGLLQADAEVDLADRE
FT                   LAIDKDTLHVPGSPAIAETIYDKIDRAAVFLSDLTYVALRPNGGGIPNPNVLIEHGWAL
FT                   KSLSSRRVISVMNTALGDPEQHELPFDLRHVRRPILYACSPDAKQEDKKKAREVLTSHL
FT                   VAALKAIFNDNVVRKRLRPPAPEVPHPRDVQLLERVHRQLPLTLRQFLHQHNFGSPFRL
FT                   AHLDPIHEMNETWVGAAYEFHDPEVQRPFDDLRRLGGEFGGLVLERIYAMDRNPTMGWP
FT                   KTDQDVAQGIQPGTRQAIEAMNAKATAFCAAIDDFDRIARDRIPVATGIHDTRDDAAES
FT                   NKKEQDALNALQELALDMHRGGLPEIVTQPRLTLRLVPFEATQGRRLDPRRVGELQRQF
FT                   PPSPNERIKVDSDGRQWWSCAVPRRRADGLNPETSWRMRLVRPGYLEYQVTIGQRIDDD
FT                   PQIMVDGRHLEALIVRNLERMAAIANDLELAGPALVSISLDGVDDIELFAARPGGRRVR
FT                   RPEIILPVVKLVEMNGELAAMIQEQLDILWQTAGWIDGSPSFASGIWAGYSDKQNYEIN
FT                   "
FT   gene            complement(751679..752257)
FT                   /locus_tag="Arad_7845"
FT   CDS_pept        complement(751679..752257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7845"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7845"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29259"
FT                   /db_xref="InterPro:IPR008585"
FT                   /db_xref="InterPro:IPR038128"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNX8"
FT                   /protein_id="ACM29259.1"
FT                   /translation="MKDKYINFAALADAEPDAFSTTALDRGSDVCVIAPHGGKIEFGTS
FT                   ELARAVASDIWSLYLFEGCKNSANRDLHITSTNFDEPRGDGLVRKSEVAIAFHGCSGEG
FT                   ETIFLGGRHQQLIEKMGKNLLDAGFAVARHNDPDLQGTNLANIYNRGHSGMGVQFEMTI
FT                   ALRDRLKNPERDSERPNLSDFVDAIRRAI"
FT   gene            752365..752946
FT                   /locus_tag="Arad_7846"
FT   CDS_pept        752365..752946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7846"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7846"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29260"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNX9"
FT                   /protein_id="ACM29260.1"
FT                   /translation="MSDGPHKSLPLRPKYKRLAEWAYKPAFPVEQVCEAAEAAILHDAR
FT                   TELAPIVARIIRIADGEDLLTRLPGFVQEQLRALRDDASLSPLGASVIECTVMAFQQGL
FT                   QGREAVQEGVDTALRERLAANARTTEEHYFVEAGRRASLNIRERMNETMNAMDANGSFS
FT                   RIARSVIGDKTAAVSRAPVVRDSLEEGVPF"
FT   gene            752943..754316
FT                   /locus_tag="Arad_7847"
FT   CDS_pept        752943..754316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7847"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7847"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29261"
FT                   /db_xref="GOA:B9JNY0"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNY0"
FT                   /protein_id="ACM29261.1"
FT                   /translation="MKVLQGECPRIRVAVVEPGAGSMPSWQTIEIDSTIVFKMEDLDDY
FT                   RTKNWDNRIYDVMVLIAAVEFCDKSCKRPAWGWMRRIELHLPVHDVDHWETPLLGSALM
FT                   SALKFLTGDEWQITFYKRRSPMEDIGRQSRLEFGDQSKVVTPFSDGLDSRAVTAMMTAG
FT                   GRSDRLIRVRVGAKTDDRPRTEHRKAPFLTIPFKVKSGDRPFAESTVRSRGFKFTLLSG
FT                   IAAYLLGTHDIVMPESGQGALGPSLVQTSHGYEDYRNHPLFFGRMERLVAAIFNYQVSY
FT                   RLPRLWKTKGQTLGEFAALPVNPNEWVKTRSCWQQNRNSSVDGKRRQCGICAACMLRRL
FT                   SFHAAGLEEPKENYIWEDLRAGEFAKGAAPGFNKITGAMEHYAIAGTLHLDHLADLRSS
FT                   PVNRKRVARHAWFLSQELGMTPAEAEDSLLGLLQQHEVEWKAFMKDLGPKSFVAQWLA"
FT   gene            754322..755506
FT                   /locus_tag="Arad_7848"
FT   CDS_pept        754322..755506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7848"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7848"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29262"
FT                   /db_xref="GOA:B9JNY1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNY1"
FT                   /protein_id="ACM29262.1"
FT                   /translation="MSEVNDQLTQEELGERLRLARESTGKTQADAAEAIGVARTTLVAM
FT                   EKGQRRVKIGEMQQLARLYGTTANALMRKESVHIELVPKFRKLAENEERPVAEAAELMA
FT                   QLVRAEVELENLLGIEHTRNLPPERRILSGDVREQAEQHALELRHWLGLGLAPVADIVS
FT                   LLEMQMGVRVYTRKLAAKISGLFAFDEKVGACILLNANHPLDRRTQTAAHELGHLVATR
FT                   TDAEVSELDELENSREEKYANAFARGFLTPAQAVRLKFAEVTAGSTSLTRRHVIVLAHI
FT                   FHVSREAIVRRLEELKLTKKGTWDWFLANGNITDDQARQVLGDAGKSDRLKDEAALPVS
FT                   LKTSLMAYQAAKRGILSEGQISRLLHLDRIQVRDILSDIDAEESGANAATSILR"
FT   gene            755481..756095
FT                   /locus_tag="Arad_7849"
FT   CDS_pept        755481..756095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7849"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7849"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29263"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNY2"
FT                   /protein_id="ACM29263.1"
FT                   /translation="MRQPQSSARSHAAIVVDTSVIINLNATAHATEIIRAYGVTLCASD
FT                   VVRDELILDRINGRNDGELAQRLVQEGLLEFLAFDEEAEQLFESLVGGPAEMTLDDGEA
FT                   ATLAVAVSLNRTAVIDERKAIKISSERFPGLELMATADILRSDEVFAALGSEGIADALF
FT                   RGLKGARMAVPERLHDWVVELLGERIVECRSLPAALRQVRK"
FT   gene            complement(756133..756549)
FT                   /pseudo
FT                   /gene="dinB"
FT                   /locus_tag="Arad_7851"
FT                   /note="DNA-directed DNA polymerase protein; Incomplete gene
FT                   (pseudogene)"
FT   gene            756582..757679
FT                   /locus_tag="Arad_7852"
FT   CDS_pept        756582..757679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7852"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7852"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29264"
FT                   /db_xref="InterPro:IPR024442"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNY3"
FT                   /protein_id="ACM29264.1"
FT                   /translation="MSETMLAVLSNIRTIDDMVAAFREEEHCRRLLESMVWRDGRVCPA
FT                   CGYKRSIAIAGRDMGKRRARPGLYQCSSGDCRFQFTVTTHTPLHATKLPLRTWLKAMWL
FT                   LLQSDKGLSSVRLAETLGVSQPTAWRIGHALRLMVAREHMLDGTVEVDHFYLGGRPGKH
FT                   PDDPPPGRGRKGQAKTQKTPVMAIVQRPADVTPGSPAGDARAAVVTGLSLRAAVGVIAP
FT                   QVELHAHLMSDEANAFVAIGESFAVHETVNHSSREYVRNTVHVNSAEGFNARVRRTIAG
FT                   VFHHISPELADLYFHEIGFRWSQRVVIGQAVRRNRSGKESGKILWSRVPPALQLLQVFR
FT                   AATGRQMRRSHQGGITIKSTVAVFG"
FT   gene            757739..757885
FT                   /pseudo
FT                   /gene="dnaEf"
FT                   /locus_tag="Arad_7853"
FT                   /note="Fragment of DNA polymerase III alpha subunit
FT                   protein; Incomplete gene (pseudogene)"
FT   gene            complement(758100..758780)
FT                   /gene="phoB"
FT                   /locus_tag="Arad_10054"
FT   CDS_pept        complement(758100..758780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoB"
FT                   /locus_tag="Arad_10054"
FT                   /product="phosphate regulon transcriptional regulatory
FT                   protein PhoB"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_10054"
FT                   /db_xref="EnsemblGenomes-Tr:ACM28589"
FT                   /db_xref="GOA:B9JNY4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNY4"
FT                   /protein_id="ACM28589.1"
FT                   /translation="MVLRIGIVEDDEAFCESLNQAFTNEGYTVDAWRDGRLAQVSLTAR
FT                   LPDLLVLNWTMTSTFGIDLLKGMRSAPRSAAIPVIMLATDATENDKLLALSLGADDYLV
FT                   KPFSMLEIVLRVRNLLRRMKINESQLVLKVSDIVLDRNSYTVLRSNKEIKLGPTEYKIL
FT                   EFLMRNPGTVHTRTDVLTNVWGPHATVDPRVVDVHIGRLRKCISNSENDDIIRTIRGAG
FT                   YALG"
FT   gene            759160..760017
FT                   /gene="phnC"
FT                   /locus_tag="Arad_7854"
FT   CDS_pept        759160..760017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnC"
FT                   /locus_tag="Arad_7854"
FT                   /product="phosphonate ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7854"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29265"
FT                   /db_xref="GOA:B9JNY5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012693"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNY5"
FT                   /protein_id="ACM29265.1"
FT                   /translation="MAFELKNVSRRFGNKLAVDSVTLDIPQGQMVGVIGRSGAGKSTLL
FT                   RMINRLADPTSGSIHFAGTEVSKLSGRALRNWQRDCAMIFQQFNLVPRLDVLTNVMLGR
FT                   LNQRSTVMSLLSVFTREERIEAIAALERLGIEQTALQMAGTLSGGQQQRVAICRALMQQ
FT                   PKMMLADEPIASLDPLNAKIVMDALRDINEREGITVITNLHTLDTARNYCERIVGMAAG
FT                   RVVFDGKPSDLTAAAVKEIYGTDKDGAGVDETMTSTAINIPDQAAQAAAHASAGLQPLA
FT                   LAGP"
FT   gene            760113..761018
FT                   /locus_tag="Arad_7855"
FT   CDS_pept        760113..761018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7855"
FT                   /product="phosphonate ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7855"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29266"
FT                   /db_xref="GOA:B9JNY6"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="InterPro:IPR017797"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNY6"
FT                   /protein_id="ACM29266.1"
FT                   /translation="MLKKTLLAATALLALAGGAAAQDLKEFRIGIMGGENEADRLRNYA
FT                   CLTDHLKKEFGFEKVSLFPAADYDGVIQGLLGGTLDFAELGASGYAATYIKDPKAVTPI
FT                   LTTQQTDGSTGYYSVLVARKDSGFKALAELKGKKLGYADPDSTSGYLVPKVTLPKDLGM
FT                   PVDKFFASTQFNGGHENNVLAVLDKKVDASVTWASGVGDFKDGYSSGNLRKMVDKGTLN
FT                   MNDIVQLWQSPLIPNGPLVVSNKLSDEWKGKLTDLFMSLPKKDKNCFEAIEGGDYAGYI
FT                   KVTPEFYNAVIETRRATIGG"
FT   gene            761087..762067
FT                   /gene="phnE"
FT                   /locus_tag="Arad_7856"
FT   CDS_pept        761087..762067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnE"
FT                   /locus_tag="Arad_7856"
FT                   /product="phosphonate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7856"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29267"
FT                   /db_xref="GOA:B9J6Q1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005769"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9J6Q1"
FT                   /protein_id="ACM29267.1"
FT                   /translation="MTIADAQPQMQSAPHSAKEIGDAWSRMVARRRLYTGLGLAILIIA
FT                   FVSSVRFADESNAGHFFDRLPHLFDFLSWLIPKDWADVYRALFDLASPNGANGVGGEEF
FT                   NFPLGRVYVWGNFYIPEYFELMIITINVALVSTIIGFIVALPLSFFAARNMSPSNPVRL
FT                   VTKRVMEFLRAFPEIVIAGLFSAILSIGPIAAIIAVGLHTIGALGKLFYEVVENIDMKP
FT                   DEGMKAVGASWTERVRFGALPQVMPNFMSYALLRLEINVRASTIIGAVGGGGIGEELKL
FT                   SISRGFGAKTVALVLLLFITIIAVDQFSAWLRRRLVGEHAFLLQH"
FT   gene            762076..763422
FT                   /gene="phnE"
FT                   /locus_tag="Arad_7857"
FT   CDS_pept        762076..763422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnE"
FT                   /locus_tag="Arad_7857"
FT                   /product="phosphonate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7857"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29268"
FT                   /db_xref="GOA:B9JNY8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005769"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNY8"
FT                   /protein_id="ACM29268.1"
FT                   /translation="MSVIDASRMQDIEARYPEILHRSFRQRFGALMVFIGVILYGFYAV
FT                   WFFDLPKVITEAHWERVGIYLSEWVSYDVQPEFRISGDTISIKYPRFSPLGDNPHPDWV
FT                   TNNPDGSLTVSVSGTSRTVTITKTQAILTAHGVTIPIDITGDVPKVIGSEPVPAWMTVY
FT                   DDNILVDMGFAGNVSISTDRVKIRKRFIGWANFVFDTHSPFFDKPAGEVISLIVSGPRL
FT                   NPDESNLSLAFDNVWNNAAWQHGDVWSKLFQTIVMAFLGTLLGSVVGFPLAFLAARNIT
FT                   PNRLLNQVLKRFFDFLRSVDMLIWALFLTRAFGPGPLAGSGAIFLTETGTLGKLYSEGL
FT                   ENIDNKPREGVKSTGSSTILVHRYGIMPQIVPVIVSQTLYQWESNVRNATIIGAVGAGG
FT                   IGLKLWEAMRTNANWENVAYMVLLILIVVFLFDAASSALRTRLMGTRVK"
FT   gene            763704..763841
FT                   /locus_tag="Arad_7858"
FT   CDS_pept        763704..763841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7858"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7858"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29269"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNY9"
FT                   /protein_id="ACM29269.1"
FT                   /translation="MHWVGRDTAETRVRPEAWNRSIHRMRGRIEIFGTWKRRSTLRRMR
FT                   "
FT   gene            complement(763886..764812)
FT                   /locus_tag="Arad_7859"
FT   CDS_pept        complement(763886..764812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7859"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7859"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29270"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNZ0"
FT                   /protein_id="ACM29270.1"
FT                   /translation="MSSVDAIIEEVLNTRPNQVHNSSYKALRSSNSANEYSQEAELANH
FT                   ERLWFNDLYGFVDHYRQGESERGRLIQKVRLERDPDFGNLLLESSFDAYLLGETVQFPY
FT                   SIYFNMARNVRSRLLLNQVKDDTTAIIELGAGTGMALIDLWHSGIDRQIPLICMEPTHF
FT                   GRLCFDFLTRLEPKILGRSIYFNFQDPVFPEINDLNTQSLLLFTSGAIEYIEELPEQLL
FT                   LDIICRFDKVCGVHLEPLGWQIPDLKITTSSPQSLVRSGERGQNKNLWQLLVKLQNSGL
FT                   IRISSEKEFGVYGSLKYPITYLRWDKL"
FT   gene            complement(764866..765702)
FT                   /locus_tag="Arad_7861"
FT   CDS_pept        complement(764866..765702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7861"
FT                   /product="Sugar phosphate isomerase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7861"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29271"
FT                   /db_xref="GOA:B9JNZ1"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNZ1"
FT                   /protein_id="ACM29271.1"
FT                   /translation="MSNHNAPLAPVLGAALLIDDFEELHRWIFDADRDLELEDFANGKT
FT                   LDGDWQSLVERYKKLLVSHGGRLGIHGPFWDNNILAVSDPQIRPIVQRRFVQGVDVCEA
FT                   LGATHMVVHSPFTMTDGNNMHASKAWRDYLMTLGRENLMPAVKRAEEVGCVLMIENVED
FT                   TNPFDRVAFAQSFESQAVRVSVDTGHAHLAHRMAGAPPVDCFIGSAGRLLQHIHIQDVD
FT                   GYADRHWAPGDGEIHWRSVFEAISLQSSHPRLILEIKDKRDLIRGANYLRDLGLAS"
FT   gene            complement(765886..766707)
FT                   /locus_tag="Arad_7863"
FT   CDS_pept        complement(765886..766707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7863"
FT                   /product="Amidohydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7863"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29272"
FT                   /db_xref="GOA:B9JNZ2"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNZ2"
FT                   /protein_id="ACM29272.1"
FT                   /translation="MTMIEHHENQGRFGFPIIDVHTHTEFDGKLDKHGGRHATRDLFVA
FT                   DCRRYNIRGIVTDSYFPAEDLDTLPCALLKCAVIGRKEFDVAEIEDNIASGRFGAIKIN
FT                   LGFVPIFASDPSLQPIYAIAERHGIPILFHTGHTGYAKSHLKYSDPLTIDEVAVSHANV
FT                   NFLLVHGGNPWFDTAAVLADKNPNVYVELSSIIDSDPRISTPDRIRRQIEDPVARMFSY
FT                   VADPTKILFGSGWPMVDLGSYIEACMRAVPPQHRRAFFHDNACRLFNFSRG"
FT   gene            complement(766704..767618)
FT                   /locus_tag="Arad_7864"
FT   CDS_pept        complement(766704..767618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_7864"
FT                   /product="phosphoenolpyruvate phosphomutase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_7864"
FT                   /db_xref="EnsemblGenomes-Tr:ACM29273"
FT                   /db_xref="GOA:B9JNZ3"
FT                   /db_xref="InterPro:IPR012698"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B9JNZ3"
FT                   /protein_id="ACM29273.1"
FT                   /translation="MELKSITPDVRRGALRALLEKRTFLRFLDIHNALSALIVEHTIVE
FT                   TENGSQSFDGMW