(data stored in ACNUC7421 zone)

EMBL: CP000631

ID   CP000631; SV 1; circular; genomic DNA; STD; PRO; 388169 BP.
XX
AC   CP000631;
XX
PR   Project:PRJNA13402;
XX
DT   30-JAN-2009 (Rel. 99, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Agrobacterium radiobacter K84 plasmid pAtK84c, complete sequence.
XX
KW   .
XX
OS   Agrobacterium radiobacter K84
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Rhizobiaceae;
OC   Rhizobium/Agrobacterium group; Agrobacterium;
OC   Agrobacterium tumefaciens complex.
OG   Plasmid pAtK84c
XX
RN   [1]
RP   1-388169
RX   DOI; 10.1128/JB.01779-08.
RX   PUBMED; 19251847.
RA   Slater S.C., Goldman B.S., Goodner B., Setubal J.C., Farrand S.K.,
RA   Nester E.W., Burr T.J., Banta L., Dickerman A.W., Paulsen I., Otten L.,
RA   Suen G., Welch R., Almeida N.F., Arnold F., Burton O.T., Du Z., Ewing A.,
RA   Godsy E., Heisel S., Houmiel K.L., Jhaveri J., Lu J., Miller N.M.,
RA   Norton S., Chen Q., Phoolcharoen W., Ohlin V., Ondrusek D., Pride N.,
RA   Stricklin S.L., Sun J., Wheeler C., Wilson L., Zhu H., Wood D.W.;
RT   "Genome sequences of three agrobacterium biovars help elucidate the
RT   evolution of multichromosome genomes in bacteria";
RL   J. Bacteriol. 191(8):2501-2511(2009).
XX
RN   [2]
RP   1-388169
RG   Agrobacterium Consortium
RA   Setubal J., Wood D., Slater S., Nester E., Farrand S., Goldman B., Burr T.,
RA   Goodner B., Otten L., Dickerman A., Almeida N., Sun J., Jhaveri J.,
RA   Banta L., Houmiel K.;
RT   ;
RL   Submitted (14-MAR-2007) to the INSDC.
RL   Virginia Bioinformatics Institute, Virginia Tech, Washington Street, Box
RL   0477, Blacksburg, VA 24061, USA
XX
DR   MD5; 0b70a608c3b970785001b3e231df3e19.
DR   BioSample; SAMN02602977.
DR   EnsemblGenomes-Gn; EBG00001276673.
DR   EnsemblGenomes-Gn; EBG00001276674.
DR   EnsemblGenomes-Tr; EBT00001808785.
DR   EnsemblGenomes-Tr; EBT00001808786.
DR   RFAM; RF00489; ctRNA_p42d.
DR   RFAM; RF00490; S-element.
DR   StrainInfo; 114617; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..388169
FT                   /organism="Agrobacterium radiobacter K84"
FT                   /plasmid="pAtK84c"
FT                   /strain="K84"
FT                   /isolate="ATCC BAA-868"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:311403"
FT                   /culture_collection="ATCC:BAA-868"
FT   gene            100..666
FT                   /locus_tag="Arad_12000"
FT                   /note="tiorf35"
FT   CDS_pept        100..666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12000"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31089"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPM0"
FT                   /protein_id="ACM31089.1"
FT                   /translation="MGDRTVTDRMKRQRELRAAEGWQKVTVWVPTVADAEDVKKLAAER
FT                   RARAEALAGLSEEVPKVNVETAERIARAIAEHGSNAYITPSGAVLELMKQLAREDDLVS
FT                   FASAFVIIARAKPANAKFITARVPAMISEFLIRHRGIDGGAMGKWGISNPGWADETKAA
FT                   VRDPERFPQVVEALAQAIKRSQTVQ"
FT   gene            839..1981
FT                   /locus_tag="Arad_12001"
FT   CDS_pept        839..1981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12001"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12001"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31090"
FT                   /db_xref="InterPro:IPR011664"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPM1"
FT                   /protein_id="ACM31090.1"
FT                   /translation="MSKAHGKPVGPVRLLWGGYLRNMAESQVPFPYLPAQLQAIRASIS
FT                   EPRFASYLAKGGNHEEYAMALYLYNARVAKAFLYPLNVAEVTLRNAVDGILVAKFGASW
FT                   HQDATFRDQTLTGNGLVTLDKAIQRAGANAARDQIVATLTFDFWSNLFRPEYGALWRTT
FT                   VNIAFPHLQHGESRQEIQNLVKPINVFRNRVAHHEPVLDLNVTDIHAKIVKLIELRCAE
FT                   TATWMKHHSTLSTVVRTRPRRDGTNANTLAAKLDPAFVPVKPETGLGELAELLDEKHQA
FT                   IICLDDDGHPIAALTVVDAIRFITECAKRLGGMIDLNDHTVSDLIKAANLADRWTQMDD
FT                   ATPLALAVKELQKPRIQILVGIEAASGKATGAILRAHRRY"
FT   gene            1991..3211
FT                   /locus_tag="Arad_12002"
FT   CDS_pept        1991..3211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12002"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12002"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31091"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPM2"
FT                   /protein_id="ACM31091.1"
FT                   /translation="MPLSFKLVDSGWSDELDAGMRERPETVLIVCPFIKKQTIERLIFA
FT                   HHPRDLRVITRFDLNAFNAGVSDMDALSLLLQSGAKIRGVVGVHSKMYIFGGNRAIVTS
FT                   ANLTEAAMFQNKEFGFAADDPFIAGQCQSYFDRLWAGTKHDLSQADIEQWRQILAPYRV
FT                   GTRNSVSLPDFGETVNSASPLVLEPPTDAPTQSFVKFFGRADNRASLSMAIDEEVIRSG
FT                   SHWACTYPRGKRPRQVRDGAIMFMARMVQARSDYIIYGRAIGREHRPILDDATPADVSL
FT                   RAWKENWPHYVRVHDPVFINGPLSAGVSMVDMMTELGPDSFAPTQRNLNAGGGGNLNPR
FT                   RAIMRKPHMELTPQAYKWIFDRLDKSMMRFGALDLTDPRFDLPAAQDNSPDALANTPQL
FT                   SRQSPEE"
FT   gene            3215..3607
FT                   /locus_tag="Arad_12003"
FT   CDS_pept        3215..3607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12003"
FT                   /product="Tiorf32 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12003"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31092"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPM3"
FT                   /protein_id="ACM31092.1"
FT                   /translation="MDVPHVSRQPPEIGSRVKIYFDRKSGDLIIETREGQRSRDFMGVC
FT                   IGDAVFETEPTVRSSTRCIVTGTFLAIPGSRESRDIESDIRTQGRSHLEFYWWRDKTWP
FT                   LRKARLAFIAKPHGGFPTSMVVDGEV"
FT   gene            complement(3777..4856)
FT                   /locus_tag="Arad_12005"
FT   CDS_pept        complement(3777..4856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12005"
FT                   /product="transcriptional regulator, HTH_3 family"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12005"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31093"
FT                   /db_xref="GOA:B9JPM4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPM4"
FT                   /protein_id="ACM31093.1"
FT                   /translation="MFNKSRLTVARQRAGLTMKELASKVGIEPRAVTGYEAGEYLPSEE
FT                   TARKLSRILQFPLSFFMLDDVDIPRPEGVSFRSMSKMTARQRDGAVAAGAIAFMLSDWL
FT                   DIEFDLPVASVPDMREDTPQSAAAGLRDFWALGNRPIKNMVHLLELKGVRVFSLGEDGK
FT                   EVDAFSVWRDDRPYIFLNSQKSAERSRFDAAHELGHLVLHKHAAPNGLEAEKQANEFAA
FT                   AFLMPEAPLRAVGRITGLPKVVELKSAWSVSVAAMTYRLHELGLASKWTYQQLFMEISR
FT                   RGWRTDEPKPIRREQSQVWKKVLDDLRQNGGGVERLSETLSIPESEIVKLLFGLVTVAV
FT                   PSSPNASITPKRGNLRLVK"
FT   gene            complement(4856..5509)
FT                   /locus_tag="Arad_12006"
FT   CDS_pept        complement(4856..5509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12006"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12006"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31094"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPM5"
FT                   /protein_id="ACM31094.1"
FT                   /translation="MAMSASVVHQNPFDARRRLAELNVSVEAVVRAVLAGHTARLNCTD
FT                   NDPPFIPGTEAWRFVVRTLRDELLPLGWRKDDPSNYSLVINDSSQVNIVVASSDALTCV
FT                   AHGSPRTKSLKGLYTEAAVLKNNLESDMFPETVEAELRKAATILSYPTWMLLIHIEDDV
FT                   CRAELSLPSAFDDRNVTGWEERIFIPLPDADGGLPVEDPIDDTDIDVPVTRKVA"
FT   gene            complement(5672..6811)
FT                   /locus_tag="Arad_12007"
FT   CDS_pept        complement(5672..6811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12007"
FT                   /product="Y4cF Protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12007"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31095"
FT                   /db_xref="InterPro:IPR011670"
FT                   /db_xref="InterPro:IPR021068"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPM6"
FT                   /protein_id="ACM31095.1"
FT                   /translation="MISMAYDLAKISMSALMRPAFDAGIALTRLDERIARSTVGSGWIE
FT                   RSHFADACASLWIDGELVHLEDLVLHDHTRDIRTPTHELTIARDVLRTRRRIAAQSPDW
FT                   ALSAEGIRNLRQTSDSNPVGAEAVEPGGVIRPAVAIDPEGEGEDGDALENLSGVDYAAI
FT                   DALLARSEAAIEQAKWPGRADARERDTLVYDLDWDEDARLEEWRGVLRQANDLPAVLQA
FT                   IVALDAWNELSVLQHAPWLGRLLAASILRQAGITTGAHLAAVNLGLKTIPVDRRRHPDR
FT                   ETRLLAIAHGFLAAGEIGLKEHNRLALARTMFERKLNGRRTSSKLPELVELVMAKPLVS
FT                   AKMVAKTLDVTPQAARRIVLELGLREMTGRGRFRAWGVI"
FT   gene            6920..8149
FT                   /locus_tag="Arad_12008"
FT   CDS_pept        6920..8149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12008"
FT                   /product="integrase IntA"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12008"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31096"
FT                   /db_xref="GOA:B9JPM7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPM7"
FT                   /protein_id="ACM31096.1"
FT                   /translation="MISRRKSARIGANHGPGGRQNRPFGAPVAHPKKSLTAVERRAEEL
FT                   DTIAAVLPMERRDELAELLTDHDVETLRHLVNQGMGDNTLRALTSDLAYLEAWGMAATG
FT                   RSLPWPAPEALLLKFVAHHLWDPKRREADPDHGMPKNVDDSLRRQGFLKTVGPHAPGTV
FT                   RRRLANWSTLSKWRGFDGGFASPALKSAIRLAVRAVPRTRRRKSAKAVTGDILAKLLAT
FT                   CATDNLRDLRDRAILMVAFASGGRRRSEIAGLRVEQLSTEPPIPVEDGPPLPSVAIHLG
FT                   RTKTSSGEEEEIVYLTGRPVEALNAWMVAAKIEGGSVFRGIGRWGTLSRRALDPQSINA
FT                   ILKQRAEMAGLDSGEFSAHGLRSGYLTEAANRGIPLPEAMEQSRHRSVQQASSYYNSAT
FT                   RRSGRAARLL"
FT   gene            8489..9064
FT                   /locus_tag="Arad_12011"
FT   CDS_pept        8489..9064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12011"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31097"
FT                   /db_xref="GOA:B9JPM8"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPM8"
FT                   /protein_id="ACM31097.1"
FT                   /translation="MQANFKNKLFPAADVKCFTQCSQAWRSIQDSIGIEIYVASGADSL
FT                   QELRRPPRQTVKMLVNLFLMVAVAVWNIRDGLLGSSTALIIGSFFALWAVVVAFNLICC
FT                   RIHVSLDETSLVINRMVRSPVQILWKQIETAKLPEGRAPAIISWRASPGANLQYIGVSQ
FT                   RRLGEEGAKVLRNAILTARPDLDTLVAT"
FT   gene            complement(9219..9857)
FT                   /locus_tag="Arad_12012"
FT   CDS_pept        complement(9219..9857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12012"
FT                   /product="Glutathione S-Transferase Protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12012"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31098"
FT                   /db_xref="GOA:B9JPM9"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPM9"
FT                   /protein_id="ACM31098.1"
FT                   /translation="MTAQPRLFGADYSVYVRIARLCLIEKGIEHELVPLDIFADGGPPA
FT                   DYLAKHPFGRIPAFEHEEFSLYETSAITRYIDEAFEGPQLQPLESVHRARCNQLISIAD
FT                   NYAYPQLVWGVYVERISKPGRGVPTDEEKLAAALPKARNCLAAMSHLMGDAPWFVGQHL
FT                   TLADLYAAPMFDYFLMTPEGAELIRQHANLQEWWGRMASRPSMAVTKPS"
FT   gene            complement(9989..10342)
FT                   /locus_tag="Arad_12013"
FT   CDS_pept        complement(9989..10342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12013"
FT                   /product="integration host factor alpha-subunit protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12013"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31099"
FT                   /db_xref="GOA:B9JPN0"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005684"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPN0"
FT                   /protein_id="ACM31099.1"
FT                   /translation="MTIKTLTRADITHSIIRQIGLSRTESAELVDTILEEICSALIRGE
FT                   NVGLSSFAAFNVREKSRRPGRNPKTGEDYQIAARRVISFTASDAVKTQIQKAHVGRKMK
FT                   AKARPIDPTSGPT"
FT   gene            complement(10410..10847)
FT                   /locus_tag="Arad_12014"
FT   CDS_pept        complement(10410..10847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12014"
FT                   /product="phage prohead protease"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12014"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31100"
FT                   /db_xref="GOA:B9JPN1"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPN1"
FT                   /protein_id="ACM31100.1"
FT                   /translation="MFVSKPLLNHDEFLVWAKSEGFADTVASDKLHVTIATSHGMVNWE
FT                   QILPCVSDLTVRVGGRRSVRNFGGVIVLIFGCQRLTQRHAEFRRLGMSWDFPSYTPHIS
FT                   FAFDEGVDLAKIQPFLGQLHFGPECFQVDTMHSLGFSPFMD"
FT   gene            10912..12087
FT                   /locus_tag="Arad_12015"
FT   CDS_pept        10912..12087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12015"
FT                   /product="Phosphoribosylamine-glycine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12015"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31101"
FT                   /db_xref="GOA:B9JPN2"
FT                   /db_xref="InterPro:IPR026325"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPN2"
FT                   /protein_id="ACM31101.1"
FT                   /translation="MLGLIDVDEDHAIRPLKRHHVAGAGEIFPLSGERRLCPLSPARTK
FT                   SRFPILRPEGLQDLAEHVRPAADAVGDTPRFFSLPPTPPLLRANSGSRSRRSRFAGSKR
FT                   RDEMTIYTETARFDTARTMTETEMWKVAPSIFATTAHESRSDRFKPIPTIEVLRGLMAE
FT                   GFVPVGAKQSASRTEGKADFTKHLIRLRRVDDGKTYRVGDTVCEILLKNANDGTSAYEL
FT                   LAGLFRIRCMNSLVTQTGTIDAIKVRHSGDVSAKVIEGTYRVLNEAERTLVAPQDWATH
FT                   KLNRDEQQIMAEAAHVLRFGDNDGETKTPIKPEQLLLPRRHDDRADDLWTVWNVTQENV
FT                   IRGGLRGIGREDLGRPRRVKSRAVNGIDQDIKLNKALWLIGEKMAELKAAR"
FT   gene            12170..12292
FT                   /locus_tag="Arad_12016"
FT   CDS_pept        12170..12292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12016"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31102"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPN3"
FT                   /protein_id="ACM31102.1"
FT                   /translation="MAIVALSGEGNPELGTIVKVADALGFRLSLVAKSDARPAA"
FT   gene            13002..13358
FT                   /locus_tag="Arad_12017"
FT   CDS_pept        13002..13358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12017"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12017"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31103"
FT                   /db_xref="InterPro:IPR007948"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPN4"
FT                   /protein_id="ACM31103.1"
FT                   /translation="MTIGNANKGDTAVTDLVNFIRFNDNGMLSGNIASIAYDLDISGEE
FT                   FESTNAKAPAYRLFAKSPRGKRVEIGGIWKKQNQNGGDYFTVTVNIGYGRLNANLGRYP
FT                   GQDDDDLMAVIPWD"
FT   gene            complement(14045..14206)
FT                   /locus_tag="Arad_12018"
FT   CDS_pept        complement(14045..14206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12018"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12018"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31104"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPN5"
FT                   /protein_id="ACM31104.1"
FT                   /translation="MRNALKLRSYSMPRFVTNLQTLNQTANSSSFPGVAPEYQVLAMAE
FT                   YGVNLRWR"
FT   gene            14236..15429
FT                   /gene="repA"
FT                   /locus_tag="Arad_12019"
FT   CDS_pept        14236..15429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repA"
FT                   /locus_tag="Arad_12019"
FT                   /product="replication protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12019"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31105"
FT                   /db_xref="InterPro:IPR017818"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPN6"
FT                   /protein_id="ACM31105.1"
FT                   /translation="MQPSLVLQDDQEHLPSLLATDAQELSYQLQQHQAKIFPPHSQKTM
FT                   RAFSPAEAASFIGIGEGYLRQVAADGHGPDPLPNGRRLYSADDMDRIRRVLDERNGTPK
FT                   YVPARRGSEKLQIVSVMNFKGGSGKTTTAAHLAQYLALRGHRVLAVDLDPQASLSALFG
FT                   HQPELDVGEGETLYGAIRYDEPRPIAEIVRATYTPNLHLIPGNLELMEFEHETPRAMVA
FT                   GTAETMFFARIGEALTEIESLYDVVVIDCPPQLGFLTMSALCAATSILITVHPQMLDVM
FT                   SMSQFLTMTSELMSVVEKAGGRTSYDWMRYLVTRFEPNDGPQSQMTGFMRAIFGNRMLH
FT                   NAMLKSTAVADAGVTKQTLYEVERAQFTRGTYDRALESLNLVNAEIEAHIRSTWGRK"
FT   gene            15434..16435
FT                   /gene="repB"
FT                   /locus_tag="Arad_12020"
FT   CDS_pept        15434..16435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repB"
FT                   /locus_tag="Arad_12020"
FT                   /product="replication protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12020"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31106"
FT                   /db_xref="GOA:B9JPN7"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR011111"
FT                   /db_xref="InterPro:IPR017819"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR037972"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPN7"
FT                   /protein_id="ACM31106.1"
FT                   /translation="MARKNLIEVSMPSTTRSDAESPRDTRPIAGFVPQTRSAIPVGGIT
FT                   KTLGNITEKMERANDLERQLAEGQAIIDVDPDLIDGSFVTDRLEIDPVKLAQLVDQIRE
FT                   HGQQVPILVRPHPTSKGRYQVAYGHRRLAAARELGFKVRAVVRDLTDDQLVVSQGQENS
FT                   ARTDLSYIEKALFALRLEERSFRRDIIMAALGVDKAALSKMLIITRQVPLDLISTIGAA
FT                   PEIGRRRWLELGERLESVAPEPIIVELSADHSRKLSSDERFQRALVLATKKSQVPESSV
FT                   ARSEISGVPVKFKKTASSATFVFDSKAAPGFDQFVQERLQDLFAEFQQGKGA"
FT   gene            16592..17905
FT                   /gene="repC"
FT                   /locus_tag="Arad_12022"
FT   CDS_pept        16592..17905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repC"
FT                   /locus_tag="Arad_12022"
FT                   /product="replication protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12022"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31107"
FT                   /db_xref="InterPro:IPR005090"
FT                   /db_xref="InterPro:IPR021760"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPN8"
FT                   /protein_id="ACM31107.1"
FT                   /translation="METGYVTTPFGRRPMTLGMLASQKLTREIDPATSVDKWKIYRALC
FT                   EAKPLLGVTDRALAVLNALLSFYPKNELSEDNGLVVFPSNAQLSLRSHGMAEQTIRRHL
FT                   AALVDAGLLIRKDSPNGKRYARRGREGEVSEAFGFSLAPLLSRAEEIEHLAATVVAERL
FT                   HIQQLRERISLCRRDIAKLIETALAEQIRGDWQGIHTGFRSLIEGLPRFPTTAALENLL
FT                   DELVVLRDDIVIQLEMQLKTQNQSGNPYQNERHIQNSNPESTTEFEPSFETKQGAPAED
FT                   KPDPLTVPTAEKADVSVSPRQVGRRKSAGAVGGTNAENHGDLKSFPLGLVLQACPQIVD
FT                   YGPSGVIGSWRDLLSAAVVVRTMLKVSPSAYQDACLAMGPENAATVMACILERGGHINS
FT                   AGGYLRDLTRRTEQGQFAIGPMLMSLVRANAPTGRRTG"
FT   gene            complement(17883..18383)
FT                   /locus_tag="Arad_12023"
FT   CDS_pept        complement(17883..18383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12023"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31108"
FT                   /db_xref="InterPro:IPR016103"
FT                   /db_xref="InterPro:IPR036442"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPN9"
FT                   /protein_id="ACM31108.1"
FT                   /translation="MTKPWTESQGVIPAASSDLNKAEAISVLLIRPIDLLPKSAGDPIR
FT                   PFAIGIWNDIRALLKPDTAVTALRRAVSAYTHSKRYFLACAQPDAFRHDIDGNAIAPIT
FT                   EENRMAAQLAFTKVAKRSSDAPAPPLEPTPEPPEVSRAAQIRAGLLSRSKPKAAQPTPS
FT                   SVQ"
FT   gene            complement(19019..19471)
FT                   /locus_tag="Arad_12024"
FT   CDS_pept        complement(19019..19471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12024"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12024"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31109"
FT                   /db_xref="GOA:B9JPP0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPP0"
FT                   /protein_id="ACM31109.1"
FT                   /translation="MSKQRTTFTKIRRHKATPQAETLSRIHPVDFYVGQQIRIQRVRAN
FT                   LSQTELGKGVGISYQQVQKYEVGTNRVSASMLWEIGNFLNVLPAMFFDGLPESGAGDLT
FT                   QISPQANESLAFIATTEGRELVERLTDMTPVARRRLLLLLNALAQA"
FT   gene            20058..21428
FT                   /locus_tag="Arad_12026"
FT   CDS_pept        20058..21428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12026"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31110"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPP1"
FT                   /protein_id="ACM31110.1"
FT                   /translation="MKTISALISFAGIVLVSTSLAFAQADPITAGIVVQGLTQAIGDMR
FT                   SALNEATNDAKSVGNSYQANAQNVLTDIDKMFGKNLNLAFDKMTDQQRQLVQNGERLVA
FT                   LTKEATDELTKKNFDRARSLMIEGDIVAYDTSYSLPCRTTKPRVMQVEPVEISADDEAP
FT                   VIHVRGNFLLQGKGLKVSFAKTEAQVLQRTDTEISFAVPQSVLDDAKGKQIAISATLDG
FT                   LTTITRKIRFVLGCSEKSRSLETAPSVQFLINPPITFHVQGTLTTSHLVDTVLPDLKGQ
FT                   FSNTGNGHCDDSYSVDQNYCLIDKNGGFDHVDISNPSANCGSSIGPINPSGDHCVFVGG
FT                   HVQGCGAIRGPFNVWAGCKGRGWVKYDYQLYRKDRVMTEAGHSDIEKEGIPGETLFSFP
FT                   FPTAAGKKEEMQFTFNVIVQKMRGDKVLEQGTLSQAQATHGTWQANVKDGQFSLTLQ"
FT   gene            complement(21435..21689)
FT                   /locus_tag="Arad_12028"
FT   CDS_pept        complement(21435..21689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12028"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31111"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPP2"
FT                   /protein_id="ACM31111.1"
FT                   /translation="MAHAFPVALNLTISIRRISNYLSDQTETVAFLRLNTKGHPCRLTA
FT                   VEPGRCAGMFSNNWLGAITTPKGGVVISQMRPVICRPKN"
FT   gene            complement(21949..22089)
FT                   /locus_tag="Arad_12029"
FT   CDS_pept        complement(21949..22089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12029"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31112"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPP3"
FT                   /protein_id="ACM31112.1"
FT                   /translation="MKRFTHHLWIKFFDFCQMEITRGHLFAFKGKLQSKNQAKIVQCAI
FT                   P"
FT   gene            22520..23800
FT                   /locus_tag="Arad_12031"
FT   CDS_pept        22520..23800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12031"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12031"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31113"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPP4"
FT                   /protein_id="ACM31113.1"
FT                   /translation="MTSEVALDEVYVWIWLPGKTEPVVAGLLSRAGSTLVFNYGRSYLE
FT                   RPDAISIYDPELPLKAGVLPLPAGLSMPSSLRDAAPDAWGRRVIVNRRFGQKGAAIDIG
FT                   QLDELTYLIESGSDRIGALDFQRSATAYEPRQAHTASLEELLTAAERVEAGVPITPELD
FT                   QALFHGSSLGGARPKAIIEEPDTKYIAKFSSRTDVYNVVKAEFVAMRLAALAGLEVARV
FT                   RLVGAAGKDVLLIQRFDRLWLLGGWRRKAIVSALTLFELDEFMARYASYQDLTEIIRHR
FT                   FAAPRATLHELFGRLVFNILCGNTDDHARNHAAFWDGTSLALTPAYDVCPQGRTGNEAT
FT                   QAMLIAGDNRQSRLSVCIEAAAQFQLGVEEAIGIIERQIITVRDRWSEVCDEGGLTEID
FT                   RNLLWRRQFLNPFAFEGAPVQLLGLIE"
FT   gene            complement(23876..24127)
FT                   /locus_tag="Arad_12032"
FT   CDS_pept        complement(23876..24127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12032"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31114"
FT                   /db_xref="GOA:B9JPP5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPP5"
FT                   /protein_id="ACM31114.1"
FT                   /translation="MGDDVTKTLGTKRHQALIALLIENREAKGLTQTDLAARLGEYQSF
FT                   VARLESGQRRVDVIEFLELAEILGFDAAQALSAVAKAN"
FT   gene            24305..24664
FT                   /locus_tag="Arad_12034"
FT   CDS_pept        24305..24664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12034"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31115"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPP6"
FT                   /protein_id="ACM31115.1"
FT                   /translation="MKVIPDETVDLLEALLFTIRKIVESGAQGKQRIANAYHDACSLAM
FT                   AIDRDGGSAGPRIEACLKHFNIHKDAGDVASAGWMLAAIQERVSERNLYGWRKLEEIVN
FT                   AAVHELLLSVQASPN"
FT   gene            complement(24759..25085)
FT                   /locus_tag="Arad_12035"
FT   CDS_pept        complement(24759..25085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12035"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12035"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31116"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPP7"
FT                   /protein_id="ACM31116.1"
FT                   /translation="MMSNAIYRSGDARMPRDMAGQLEYMADRIGDASRADLQVLLRRAA
FT                   LLIRNAAPIGLEAETEDALLSIAGELGMTRNDMIRHIVKEWLETNAYLPVRELDEDGEV
FT                   SGNA"
FT   gene            25101..25394
FT                   /locus_tag="Arad_12036"
FT   CDS_pept        25101..25394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12036"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31117"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPP8"
FT                   /protein_id="ACM31117.1"
FT                   /translation="MVKARLPTARHAFAHHGGGKRKLMSKVLNPMHEIGDGCPGVPIMG
FT                   GNDRIDRIDFRFFYYCCGFDTHWTHVSIPPDGAALLVKLFENSGRCAARVCS"
FT   gene            complement(25528..25890)
FT                   /locus_tag="Arad_12037"
FT   CDS_pept        complement(25528..25890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12037"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31118"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPP9"
FT                   /protein_id="ACM31118.1"
FT                   /translation="MKRSEDDMTDIPPLPKSRRNLTDLDSLIADSIGRLGSYEGTHGTP
FT                   AGSEIAVDPPVKEERSQPAAPLNPGSVDDKPERFQIALSGAVIIAAKLEALKQKTTASD
FT                   ITERALRSYLGMPPKA"
FT   gene            complement(25887..26561)
FT                   /locus_tag="Arad_12038"
FT   CDS_pept        complement(25887..26561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12038"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12038"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31119"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPQ0"
FT                   /protein_id="ACM31119.1"
FT                   /translation="MTIIAVANSKGGVGKSTLCLLIASELAQNGAKVLIIDADQKQQSC
FT                   LQWVNRCQRAGTLPPSLMVAPANTPQDLKVALTTSNAEIILVDVQGSMNDLLIAAIVSS
FT                   DITLVPAKANVMEMVETVKLFDWAQNNLKRAPLRLILNRVEGIDTNTTAFQDAVQMIRD
FT                   HRLPALPTFVRARKVYEQFSKEAGSLAHIGKDPGKSEQVAKARGNIISVITDITKIVSE
FT                   AA"
FT   gene            complement(26787..27041)
FT                   /locus_tag="Arad_12039"
FT   CDS_pept        complement(26787..27041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12039"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31120"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPQ1"
FT                   /protein_id="ACM31120.1"
FT                   /translation="MPSRSGRPYGDCRTSQSAVRPPIGHRQFSYTENCYPANHIIHFYH
FT                   YISTTYITYESDHTAIISDSISSDDRSRTPKTEHSGKSA"
FT   gene            27040..27447
FT                   /locus_tag="Arad_12040"
FT   CDS_pept        27040..27447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12040"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31121"
FT                   /db_xref="InterPro:IPR008687"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPQ2"
FT                   /protein_id="ACM31121.1"
FT                   /translation="MSEIEIGQRRARRNKSVRVRLSAAEFCALTAFATDAALPTSEVLR
FT                   RLAREASGLGPTFEGDMSKKIQLIIVQLRKIGVNLNQIARVLNSGSTPGYEPLLGGIER
FT                   LARLVAQHERDLDELRARGRARALRLVRTDV"
FT   gene            27539..30991
FT                   /locus_tag="Arad_12044"
FT   CDS_pept        27539..30991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12044"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12044"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31122"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="InterPro:IPR040677"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPQ3"
FT                   /protein_id="ACM31122.1"
FT                   /translation="MRAVRKARQKPGPKSKRHGPVGLPYTGSKPRTGAAPMDLLLEDEW
FT                   RKRRRGGAGGSSSPVRSLGQPDKTKLQPGPNTDSGTVGAKAETRIRVAGPQERLAIAGG
FT                   SQPAVVKLVSYAAGSSRVGKLLTYQSRDGELAVERETGAKMAGGQWIQALADEWAEEDG
FT                   RQPSKDVLRLSLSVQSGSDDAVGAALKEALPGHRIAWASRPIEAGEGRIVEVVMSAAAR
FT                   AHPKQHKVQRIYDNRKSLAGLAVRLEDAFGSGTEIEVHGFAHGVDGVGRYLAQVRKRTR
FT                   HATWSARMDKGGSFVGDVLVGTGASSLAEAKDWKRDLRSQERRDVAHIIFSAKPGTPRE
FT                   GFVDAVRETLAREFAGHRYAFVLHEDRQHLHVHAAMKMLSETGQRLHPRIQDFKRWRQT
FT                   LAEEARDRDIPMDAVSRFERANPPGYKLKDIRRVQRGIATDNVRRRVEAVKNGAVHIPA
FT                   REEGKRRAAAAAHGWDEAAAITAQTIPEIAPEAGVLRLYRAERPGSRSSAPIFTRDRAQ
FT                   AAELAHRYGGALSFIDVRPTEMHQIRPVRSQSGMGSGDDRFVVARELADTMRLVLPAEV
FT                   ITATIMRFRRRSEIAGEYQSPGYQAGRAIKETDEMANLDIMKTSFAEMDEQMEVIRKNL
FT                   PADRQPQIDELHGKLKQTQQDMLKAQETIEKRRGAVEGETFVQPVKHEFSQFTAEERGE
FT                   LIRYVARKANGSIGAVAFTDHGDKVEIARWKDRETVLAAMQVASQKWDSLTINGTDGYK
FT                   TIAVELAAEHGFKVTNPELQDKLVAASERIARNRVGRAGITPGVLPEDAKPETQIETPT
FT                   SATELALPERSSEPEIDGDKVRPADRDRQSMLAAMREAAKKWDTITVNGSERDKVLAVE
FT                   LAAEHGFKISNPELQDKLIAAKEKVDQRRQRELAREEKLTGFVDGSQALRDVELKPPVE
FT                   EDREAGSVTATMRDGRLVGHGAAPYEHNPENDRSYYVTLARANGDQQTNWGVGLEREMR
FT                   THRPEIGEHITVSYTGSEPVVVDGELRNRHNWQIGRAGPSDKLTDNTIGRSDAEIAIAL
FT                   ETVRDRTDAEAQREVRQAERSTATNERQIDGGGEDHAYRTQAEANAAVRAERSVDQNPS
FT                   KPIPADVNQSPEIERQRQIQQELLAEKQANRQAESQKQTQKPR"
FT   gene            complement(31008..31757)
FT                   /locus_tag="Arad_12045"
FT   CDS_pept        complement(31008..31757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12045"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12045"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31123"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPQ4"
FT                   /protein_id="ACM31123.1"
FT                   /translation="MQSRDQPGDTHSIWHIPIQNSSFFLTPMPLIDILSADRFSTYLLW
FT                   ANNDVALAERLYSYNVQLSADFYSSLHMLEIALRNRCDAVLTTAHGAAWFDSPTVLKES
FT                   YQRQCIKEARALLLREGKSASHGQMIAELNFGFWSSLFGRSSNHLWGILRPIFNTGGLQ
FT                   RATIAQKLRDLRRLRNRIAHYEPILAQPLTALHADVLNLTSWMSVEAAAWITTHSNVAY
FT                   SATMLIIPDPVNGQSVFDMALIGHVPI"
FT   gene            complement(32511..33503)
FT                   /locus_tag="Arad_12046"
FT   CDS_pept        complement(32511..33503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12046"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31124"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPQ5"
FT                   /protein_id="ACM31124.1"
FT                   /translation="MLQNTTRNQHFLSQVEQRLNALNPQAKAANLRIYSFRLADRDDYK
FT                   LVLENPNGSPISRNLSLFDLFSFDVANDSDLRRNFEALFQKYEGNIEDLTKSLLAKLKA
FT                   GNHDIKTEIIDLFAAKLLNFVRNPFSIAKVLNTFPGLASYDPTNPVLLAEYRRIVSGRK
FT                   PQQAHLCAQLGISDAQYVEWLRMLFMLLTPMADGQPNFFEQIIKTLFEDGKKYVLVAIC
FT                   DYESDRCLLSDRGFSQAATDAGPHLSFSFNLCGTAFVDYIFTDLPAFAQGRAGPEVFAQ
FT                   TIASMERREQPVNVRFLRNDLDMLKRYNRRAVDQCYERVFCSAKDGLVF"
FT   gene            complement(33545..36400)
FT                   /locus_tag="Arad_12049"
FT   CDS_pept        complement(33545..36400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12049"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12049"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31125"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPQ6"
FT                   /protein_id="ACM31125.1"
FT                   /translation="MTPDQFIAKWKHSTLKERSASQSHFNDLCDVLGVDKPTDVDQKGD
FT                   WYCFERGASKTAGGEGWADVWKRGHFGWEYKGKRRDLTAAYAQLQQYAVALENPPLLVV
FT                   SDMDRFIVHTNWTNTVSAVHTIQLDDLRDAGKRDLLRWVFTDPERLKPAKTIDALTREA
FT                   ADKFAGLAIRLHQKGQDPHEVAHFVNRLVFCMFAEDINLLPRHLFSQILDKAFHKPDIA
FT                   KGLMEQLFAAMKSGGLFGVDEIEWFNGGLFDNATALPLTRDDLKIIGEAAALDWSDIDP
FT                   SIFGTLFERGLDPTKRSQLGAHYTDPEKIMMIVRPVILEPLWQEWETVKATIEKPRTSE
FT                   KRRRDLLGGFLERLRQFRVLDPACGSGNFLYLALLGLKDLEHRVNLEAEAMGFGRQFPT
FT                   VGPQGVGGIELNPYAAELARVTVWIGEIQWMRKNGFDVERKPILRPLDNIQCRDALLNK
FT                   DGTEAVWPEAHVTIGNPPFIGDKKMISLLGEPYVEQLRRTFAGRVPGSADFVMYWFEKA
FT                   RARILAKAQERAGFVATQSIRRGASSDILKRIVETGSIFDAWDDEEWTVDGAAVRVSLI
FT                   CFDGMKGGGAKRDGVEVPIIHSDLSVDAADTTMAVQLAQNRRLSFQGPVKVGAFDIEGD
FT                   LARKWLSRPLNPNGRPNADVLRPWANGNDITRRPSGKWIIDFGELDETAASLFEDPFAH
FT                   IITYVKPDRDKNRRDRRRIKYWQHGETVPGLRKTVDHLERFIITPRVAKHRLFVWMHKS
FT                   VLPDSRLVAIARDDDATFGILHSRYHEQWTLRLGGWHGVGNDPQYTPSMGFETFPFPEG
FT                   LTPDIPAAKFAGDSRALAIAAAAKRLNDLRENWLNPADLVRREAEVMTGFPDRILPVDE
FT                   KAAQELKSRTLTLLYNARPAWLNDAHKVLDTAVAQAYGWPDGLSDEEVLARLLALNQQR
FT                   GITPVAKPKSKTLEKTKAAAE"
FT   gene            complement(36606..36824)
FT                   /locus_tag="Arad_12050"
FT   CDS_pept        complement(36606..36824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12050"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31126"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPQ7"
FT                   /protein_id="ACM31126.1"
FT                   /translation="MYDLGYPRLAGDLAVGAEASILVLIVVDLLKPVVEHLKAAVPSFP
FT                   TVIKVNQKGQGYSARIANTSRRASLGK"
FT   gene            complement(37011..37181)
FT                   /locus_tag="Arad_12051"
FT   CDS_pept        complement(37011..37181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12051"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12051"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31127"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPQ8"
FT                   /protein_id="ACM31127.1"
FT                   /translation="MFALEHPRLEAAIPLPARPSRRRKGGLFGLQLQKKTGDNPTIAAF
FT                   IFGYQASDFNH"
FT   gene            complement(37250..39145)
FT                   /locus_tag="Arad_12052"
FT   CDS_pept        complement(37250..39145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12052"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31128"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPQ9"
FT                   /protein_id="ACM31128.1"
FT                   /translation="MRRTILVLISLCVFFSISLKAFACTNKCVPYTSWCACTDDPPNIF
FT                   DPKKAVEDAVNNLVNSFTKAKITDAIKLSFPLSGAINEVAKASGDQTLVAAVNSFEAIG
FT                   AKLDTESQTAITNALTNPSKGVRDAAQNLIKSANDGVQAIQAAARYGERTLTNYQEVFS
FT                   EAERRAREGKVVDAVWHLGMDPMTRQSANMAQLMKESDVARDAFKTLVTTQAGPAGAAA
FT                   FAAWYEYYSSNGDIQKALSTGIYTYAVASGHASVDSMPSGTIEETVKKSAAAAALRGVA
FT                   VAASGGSQQDILNAAAQSGGAVIVQSGQAYATKEYIDPAKAKTDQFCIDAVNETCEDAV
FT                   QWIDDTKKQLKDYNDQLAQNESLADSLPTSVVTADGQWAISWNQKALLDPKSKTPGAVL
FT                   TYVGPTSFYRKQMIDLAALGRGDGLFPHGGPSINDSPDRFSAEFPDGKWRISNEGQRIF
FT                   AYDTDLLGFKTTANYYINESSRSIESLYFWLQASSGWQRHGDDDETYSGVSEEKVYNTC
FT                   SSVTLEKIEVFLFENIGAIDGKPIKSDEDISRSNSFSGICSSSTTIRSSDICERTGRRI
FT                   NTVVHFKSKKQITLTATSQNIFVAQMENHGAERRIFSYGRDSCNISIAIEKPFAK"
FT   gene            complement(39162..39602)
FT                   /locus_tag="Arad_12053"
FT   CDS_pept        complement(39162..39602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12053"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12053"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31129"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPR0"
FT                   /protein_id="ACM31129.1"
FT                   /translation="MKMGKDQIPNFVEAVLATGCDICAVGQNGYVLGEIDLQPEIRKSV
FT                   SEALRRIEQWFDERDHLLRDIADYLRSIGSVFERNPSSRALRSSQICITAYFFRRRQQY
FT                   ETLGDVMRREMDKAHITLALSHARRYSTRHAKTLTMSWRTAL"
FT   gene            complement(39747..40214)
FT                   /locus_tag="Arad_12054"
FT   CDS_pept        complement(39747..40214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12054"
FT                   /product="Staphylococcus nuclease (SNase-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12054"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31130"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPR1"
FT                   /protein_id="ACM31130.1"
FT                   /translation="MGRAFSYLAVATIAALILIAIAAPVDAGARSAVIRTSVHATYCEN
FT                   SACEPVTLRIEGGDSFVIYRWGNHHEPVRIANIDAPYGRARCERERERALMAAGRLGQF
FT                   LNGSTFTMARVGTDRRGNSIAFVSINRRDLGHHLVREQLVWPREPKHRFWC"
FT   gene            complement(40220..40555)
FT                   /locus_tag="Arad_12055"
FT   CDS_pept        complement(40220..40555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12055"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12055"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31131"
FT                   /db_xref="InterPro:IPR007948"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPR2"
FT                   /protein_id="ACM31131.1"
FT                   /translation="MTANTKELTNYVEFSEDRKSLRGNIASISYDIDIAGETYISDNPK
FT                   APAYRLFAESPLGRRIEIGGIWKKQNQSGGEYFTLSINTGYGKLNANLGRYPGQGGEDV
FT                   LAVIPWD"
FT   gene            complement(40613..41191)
FT                   /gene="exoI"
FT                   /locus_tag="Arad_12056"
FT   CDS_pept        complement(40613..41191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exoI"
FT                   /locus_tag="Arad_12056"
FT                   /product="succinoglycan biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12056"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31132"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPR3"
FT                   /protein_id="ACM31132.1"
FT                   /translation="MRPANLGVVSLVFALSILAAMASYTSTNAQSAQPSSNVFAVPQSD
FT                   LTFLTGDSWQQAGQIIRLYGVQACIRGTTYTDKSGQKQDCGAVSLAMLAAIVKDTRPTC
FT                   APVAQLTAPAAGKPATILVICSAHIGNNALDVGTLLITQGFAFAAMANTGKPVYLPYSL
FT                   EESIAQQSRVGLWAYPDMPHPNRVLVSRQ"
FT   gene            complement(41188..41856)
FT                   /locus_tag="Arad_12057"
FT   CDS_pept        complement(41188..41856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12057"
FT                   /product="acyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12057"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31133"
FT                   /db_xref="GOA:B9JPR4"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPR4"
FT                   /protein_id="ACM31133.1"
FT                   /translation="MTSVALSASPSLWLPNRRDVFANFGLAFGLVASLAFAGESAVSLL
FT                   NAGMPAECAEYASNVSQSEGNFSSVSPVVNGTRCYGAFQFCDSGTLQAYWDGSREDFLN
FT                   NPSAQVTAWQRYQRGQWYAAQKNGMTSLIGQQVCYQGTCATISQSSILKACQFGCGVGG
FT                   KLYNLAKSGLDCNAAGTRDGAGTSVCSYLISGAGYNVGCITNSNDGVDCTPVAAKEVQQ
FT                   "
FT   gene            complement(41853..42329)
FT                   /locus_tag="Arad_12058"
FT   CDS_pept        complement(41853..42329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12058"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31134"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPR5"
FT                   /protein_id="ACM31134.1"
FT                   /translation="MKPILTVLATTLVLGLASTDPAAAQDGYKLALKLTTKDATHDPDG
FT                   VWADDDLAGIRQALGTAKIYTARIATPSGTWLLSQTNGDCNLQGMCTALLVLIRPGTPP
FT                   VRPLRAARLVQMANPQLPLGGTAILSPDAKTLTTSEIAEDGKAFTGSYEVEPIQ"
FT   gene            complement(42348..42797)
FT                   /locus_tag="Arad_12059"
FT   CDS_pept        complement(42348..42797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12059"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31135"
FT                   /db_xref="GOA:B9JPR6"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPR6"
FT                   /protein_id="ACM31135.1"
FT                   /translation="MVRFEEIAGGHPLAETQVQRNMLMRKEIWFFHRLGLLEIVIAAIA
FT                   ISGITTIGGIWVTTAAKSAYAHPMDNLPYTVLVLALFLLFNGLLIGLCCAAAICILKFL
FT                   YVALSAFYRLLRTLLAQPIHLARLITAGFAALIDKARAIRRRLPR"
FT   gene            43339..44043
FT                   /locus_tag="Arad_12060"
FT   CDS_pept        43339..44043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12060"
FT                   /product="transglycosylase SLT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12060"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31136"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPR7"
FT                   /protein_id="ACM31136.1"
FT                   /translation="MSIASVRAAALAATLVFPSLVLANGVSPISIAATVPASSDCPDGA
FT                   ADAETIRQLITNETARQGVDARLALAIADQESGFGAHVNSPAGARGPMQLMPATAARYK
FT                   VADICDAAQNIRGGVSYLKDLSAMFGGNIMLVVAAYNAGEGRVVAARGVPAIAETVSYT
FT                   ALVTNAYFGFDSILKGGKRPSQAVKPDTRAAEAGVDLLAETPSPDKPIPINQTRTEAGD
FT                   RDWIGGSVLYVQ"
FT   gene            44061..44414
FT                   /locus_tag="Arad_12061"
FT   CDS_pept        44061..44414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12061"
FT                   /product="type IV secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12061"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31137"
FT                   /db_xref="GOA:B9JPR8"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPR8"
FT                   /protein_id="ACM31137.1"
FT                   /translation="MKANLYNPARSAMSSRPISGNSLVLVAIAGAMAIGNADMAYAAGD
FT                   IFQPINSVFTTLLNFMTGTFATTAATIACAAVGYMALTSRIPWSWCFSIIVGIAFIFGG
FT                   AQLVSSMSSGLGG"
FT   gene            44414..44710
FT                   /locus_tag="Arad_12063"
FT   CDS_pept        44414..44710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12063"
FT                   /product="type IV secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12063"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31138"
FT                   /db_xref="GOA:B9JPR9"
FT                   /db_xref="InterPro:IPR007792"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPR9"
FT                   /protein_id="ACM31138.1"
FT                   /translation="MSEAQAKAEVAPLVLGLTRPRMFWGVPIGLFVGELMIVVMTFLNT
FT                   KNLAMFLLFLPLHAAAYVITVRDPHLPNVVRVRIAKCPWTKNRHFWGGNSYEP"
FT   gene            44736..47180
FT                   /gene="avhB4a"
FT                   /locus_tag="Arad_12064"
FT   CDS_pept        44736..47180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="avhB4a"
FT                   /locus_tag="Arad_12064"
FT                   /product="type IV secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12064"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31139"
FT                   /db_xref="GOA:B9JPS0"
FT                   /db_xref="InterPro:IPR004346"
FT                   /db_xref="InterPro:IPR018145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPS0"
FT                   /protein_id="ACM31139.1"
FT                   /translation="MQKAVRKDLRFGAEIAREKPISAHVPYLRHVDEETLRTKDGMLLT
FT                   IIKVGGFCHQTADQQIIDVEATARNTLVRALADSRFAVYSHIVRRRIPPDIGGAFDIPF
FT                   CKNLDERYMASLADSRMYTNELYLTIIRRGFQGRVGLADALMSHFRKAAGMSEQALDRE
FT                   ALQELRQHVANIVKGMEHYGVRILKAVLREYSVASEPLEFLAMLLNGGQQVNMALPRMP
FT                   LDQYLPTRRITFGRRMFEMRGGSDDDTRFGAMLSIREYPPYTAAGMIDGLLKAPGEFVV
FT                   SQSFALQDRAPILSEMDRIERQISVSDERGTSLESAISIAKDELVNGRSVMGYHHLTVM
FT                   ALGNTIKETESSAQAITKELQNAGMVVVREDLNAEPAFYAQLPGNFAYIARRALISSRN
FT                   FCGLASYHNFALGKPAGNHWGPAVSLLQTTSMTPYFFNFHKGEVGNFIVTGPTGSGKTV
FT                   ALLFLLSQAMRARPQPRCAFFDKDRGGEIFIRACGGQYEVLQPGMASGFNPLQLEDSPD
FT                   NRAFVHDLLSYLVRPKNEAEKLSAEQEKILARAVDHIFNVPIRERLFSDVIHLLRGGEA
FT                   AGRDDLASRFEAWCDTRGWLFNNPVDLWNSDRGVFGFDLTAVLDDPEIRTAALGYIFFR
FT                   IGQMLDGERPMMLFVDEGWKLLGDDKAGAFINDQLKTIRKKNGIVGIGTQSARDITTSR
FT                   IAHTLLEQSPTNIFFPNPKADRESYVTGFGLSEVEFEWVKSTSSTSRQFLVKHDHDSVI
FT                   ARLDLSGLPDFIKVLSGRAETVAECERLRHRHGDAPEHWLPYFCGWRQEPSNLSGSQAE
FT                   AQ"
FT   gene            47312..47824
FT                   /locus_tag="Arad_12065"
FT   CDS_pept        47312..47824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12065"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12065"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31140"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPS1"
FT                   /protein_id="ACM31140.1"
FT                   /translation="MQRARTFKQSSVTPSRGLTTSVTSKGDLAGIQQVNGADISGSPFS
FT                   GTSIANSDLSILLAVGQSVQALKTKNTGQVVSALAAVAAAISANTSTLKNQATAIGTAN
FT                   SLQGAFDQNTAARLSGAQIWNQTIQAVTTTTQMRNQRLVDQAAAESAATKVMTYDPGSV
FT                   SFVGGNE"
FT   gene            47838..48572
FT                   /locus_tag="Arad_12066"
FT   CDS_pept        47838..48572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12066"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12066"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31141"
FT                   /db_xref="InterPro:IPR014158"
FT                   /db_xref="InterPro:IPR023220"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPS2"
FT                   /protein_id="ACM31141.1"
FT                   /translation="MKIFKTLPAALVVAIAVAPCGGVFAQVPVIDDATLSQATKTASNT
FT                   AQIMSSNSDILQTVNRTLAAVTGNRSTSEIAGTALGSGFSIGSAPDFSSLLSGQMSWGN
FT                   LGSFGNTAATILNGLNLVKTLSGQTGSANLTRGDKAYQGLVNTATALTASIAGTQNSAQ
FT                   QRSTAFQAVQGQIGAATDIKGSIDQNSQVQTQTAQTVNELVGAVNAGNAALNAEQVRQL
FT                   AAEAATAAFMTYDAGQVSFVGH"
FT   gene            48569..48781
FT                   /locus_tag="Arad_12067"
FT   CDS_pept        48569..48781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12067"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31142"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPS3"
FT                   /protein_id="ACM31142.1"
FT                   /translation="MKGLMMQMLKVPFLALAVAAFAALPGCASHKELKAPCSAGISSVF
FT                   SSQAYASGIGDRCGPMVRQEAVTIF"
FT   gene            48858..49820
FT                   /gene="avhB6a"
FT                   /locus_tag="Arad_12068"
FT   CDS_pept        48858..49820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="avhB6a"
FT                   /locus_tag="Arad_12068"
FT                   /product="type IV secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12068"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31143"
FT                   /db_xref="GOA:B9JPS4"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPS4"
FT                   /protein_id="ACM31143.1"
FT                   /translation="MYTTLASYLGPLFLAALTVYVVWWGYEMLFGRAQMTAGTFVWRFG
FT                   RAFICYTLIVSWATYQPLIVKPLLEAPDGMATIVCQSTGGSNCGGDGSSGSSVTQGLTD
FT                   IWNSGLAVVKAMADAGGITAVGMYILAIVVLAVVCILCAIAVTLLMIGKMTMFILLAIG
FT                   PIVLCCALFNLTSRVVDGWITSLAGYALLPIIVYVILGFMLTLLKGRVDALTADASAAN
FT                   MTTLAPFMLMSIVTAFLLTHSISIALAIAGGGPRIDALGAAAGLMTARLAWRAAAGSGR
FT                   GVAQAGGYLFNQRPDGPATIGDGDPAAAQVRAAAANARK"
FT   gene            49854..50600
FT                   /gene="avhB8a"
FT                   /locus_tag="Arad_12070"
FT   CDS_pept        49854..50600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="avhB8a"
FT                   /locus_tag="Arad_12070"
FT                   /product="type IV secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12070"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31144"
FT                   /db_xref="GOA:B9JPS5"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR026264"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPS5"
FT                   /protein_id="ACM31144.1"
FT                   /translation="MVKTDNAAAEFGTPARVTNSGVIDSRYYSEGERWERSVYRSVAMS
FT                   RGVWRTVAVLLSIALAAAIGLLWMLLPLKSFDVVVLEVDKTTGYVEASRPLQERGDLTQ
FT                   NEAVTRANIVRFIRARETYDPKGLRDNFDLASLYSTGKAAADLANAYSGANLSNPVKVY
FT                   GANTTVSVFVKSVIFLNDNTAAVRFSTTRSGTSGPTVTDHWVANVRFKYTSEPMRNDWR
FT                   FDNPLGFQVTEYRRDQETVTSGEDAQ"
FT   gene            50642..51403
FT                   /gene="avhB9a"
FT                   /locus_tag="Arad_12071"
FT   CDS_pept        50642..51403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="avhB9a"
FT                   /locus_tag="Arad_12071"
FT                   /product="type IV secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12071"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31145"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR033645"
FT                   /db_xref="InterPro:IPR038161"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPS6"
FT                   /protein_id="ACM31145.1"
FT                   /translation="MLARPPIVLAEVQPQSVRADARIRTVPFQKDNVVYLAGMMGVSTM
FT                   IVFNEDEQIATVAMGDSLAWQAVPDQSKRFLFIKPLQPDAQTNMNVVTSKRVYTFFLNG
FT                   AKPGNTKTAVIKLRFSYPEDSLDANLLAAARQNAAMPNVRAALANPGRINYDYGYKGAV
FT                   DARPTSMFDDGTKTFFQFSGEVPAFFAVKSDGSESLVNYRREGDYIVVDKVARQWTLRS
FT                   GNVVTCVFNMKPPIGALKPANGKPQEISHGH"
FT   gene            51393..52676
FT                   /gene="avhB10a"
FT                   /locus_tag="Arad_12072"
FT   CDS_pept        51393..52676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="avhB10a"
FT                   /locus_tag="Arad_12072"
FT                   /product="type IV secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12072"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31146"
FT                   /db_xref="GOA:B9JPS7"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="InterPro:IPR042217"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPS7"
FT                   /protein_id="ACM31146.1"
FT                   /translation="MAIDFEEEARIVETVAKPADGRRGRLMPVLLASVALVVLAYAGYV
FT                   SFIKPQAARKTDANEEFKTASHAAHLNFDPENPSPPPSDNKLVLVPPTPTPTVVPPPQI
FT                   TAPVVMPPVIDEEAARRAAEEAERARKEEELRQARLRSNMLVVDQSVRGESAASVVGAA
FT                   SAQNAGSGGSANASADEDPDRRFVQSVGSQDVETVTASRNDRIDALIPQGVLIRGVLET
FT                   AIQSDLPGMVRAVISTDVYSFDGRRVLLSKGTMLTGEYKSGMARGQTRILIVWTRALRS
FT                   DGTSVALGSYGTDDLGRSGLAGFVDKHYLERFGAAAVLSMVGGISSFVAGLNSDGSSSS
FT                   GSSSSTSSDAQTQAQQTLSQTMAEMANIALKDSINIPPTIYVDQGTQIMVFVRKDLDFS
FT                   SLYPDPVKEAVNELRRARIRNAPSTSGQ"
FT   gene            52651..53763
FT                   /gene="avhB11a"
FT                   /locus_tag="Arad_12073"
FT   CDS_pept        52651..53763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="avhB11a"
FT                   /locus_tag="Arad_12073"
FT                   /product="type IV secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12073"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31147"
FT                   /db_xref="GOA:B9JPS8"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR014155"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPS8"
FT                   /protein_id="ACM31147.1"
FT                   /translation="MRPAPPANDVTKSDVLRSEEPKSEDPKSLWDSLPIYVRQTAQPIR
FT                   KWLEDPAVIEIMCNRPGEIWIESLNSHHMSRYDVPALDERAITALAQMIAGTTQQSVNE
FT                   ETPLLSAAMPHGERFQAVLSPVAVLGGAFAIRKQVIRDMTLDDYVELGGLDDVQVTGAG
FT                   MAAGEELSDLEHGLITRLQDSSPKARREWLRFAVENRITMLISGGTSSGKTTFFNGLLK
FT                   DVPAWERLVSIEDTRELKPSQPNYLALVTSKGGQGRARTTMQECLEAALRLRPDRIFMG
FT                   EIRGAEAFSFLQAVNTGHPGSLSTLHADNPRGAYERLAMATMQAGLGLTKAELMEFVRF
FT                   VVPVVIQVARDPATMKRGVREIYFSKWSSR"
FT   gene            53760..56123
FT                   /locus_tag="Arad_12074"
FT   CDS_pept        53760..56123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12074"
FT                   /product="TRAG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12074"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31148"
FT                   /db_xref="GOA:B9JPS9"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041533"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPS9"
FT                   /protein_id="ACM31148.1"
FT                   /translation="MNRFEKVVALVAGPIVGAGAAFYTWSASYAAGSYLMLKSSTMWKS
FT                   FAGGDVLMPAKQAWVYLGNPIVTKLISVATISTLALSAVVAVAITLAIKRPWQVRPPAD
FT                   GSRFATLKDLESAGLLGGAPGKSVLLGTFGKGRNAVDVRYSGDSHFFVNGPSRSGKGRG
FT                   FVMPNLLEYEGSVIVLDVKLENYTLTGPARMAMGQRCYVFAPGSAHSHRWNPLDFVRDW
FT                   PERSTDLINLAATLLPIGEKEEAYWKQTARGLLAGALGYVLESASMEGRRNLRSVLRLL
FT                   STGRPFSAVLQEIIDNEPELDQFILGSFRQHLGRDEEQRPSFEGHVTTALAAFNNLLIA
FT                   EACSGSDFDIRSLRRKPFSLFIAAPVSDFGTVEPIIRLLIQQIHDVMLRSLPGADEPHK
FT                   ILMMLDEFYQFERLPEIIKRAPLVAGYGLTIALVAQNIPQLDERYGQQTRNALLGNMDV
FT                   KLSIAVGDDATAKIVSDNLGRKYVEREGWGRQTGLLFGKQASSGRFELVPLIDPGSVQR
FT                   LDDSNTVLQVRGGYGAILNKLNFYGDIRFIARRREVEGWKSELVIPEIRIQTEWPLFAP
FT                   QPPELAVELPAVQDEQRQSSDIDHEMIVLEHAGAVFVEPARLMHVYRSAISAVDDQPTA
FT                   DLLFRLRTAPGTIGDIKGEKSRFVRQDRRAREQALASVWPLRKAISEARWAVIGARLSD
FT                   RAEREELFFSRGINSIVADDLDAHEDETNHLHLGFSSAQAVIDQVTDVAEAAIGNEQNS
FT                   DPNALAAALGNLKAALEYSMTEFEEENRLPVSTW"
FT   gene            56251..56943
FT                   /locus_tag="Arad_12076"
FT   CDS_pept        56251..56943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12076"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31149"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPT0"
FT                   /protein_id="ACM31149.1"
FT                   /translation="MSISLGPFPSTCFPGFTFTMTSRDKYNAYRRAWWAKSLGDHLTES
FT                   RVFLPREAHDWVVRFAAEVEERLPFVLGKLVVAQIKGVEEKAETEPVVPAQPQDEAVEK
FT                   PNSVEPISADNLHKLFYVVLASRFPNDTGSTRLRQVGFLGAVAAEIAAGRKPTASSIAN
FT                   CTDNHVSQITGLAKIMKDRGVIDVRSAPSVRKGKAAKIFSIRPDALKAIHAAHLEVTGQ
FT                   VIDDITPP"
FT   gene            57333..58628
FT                   /gene="repC"
FT                   /locus_tag="Arad_12077"
FT   CDS_pept        57333..58628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repC"
FT                   /locus_tag="Arad_12077"
FT                   /product="replication protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12077"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31150"
FT                   /db_xref="InterPro:IPR005090"
FT                   /db_xref="InterPro:IPR021760"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPT1"
FT                   /protein_id="ACM31150.1"
FT                   /translation="MTSMPNSHRAYANRRVTAASLETDRIVADFQFDHRSGSSMSRPSR
FT                   TQALQVAKRFASAIGLKAAKIALIDQLFAFSKTLDWSDTETVPVVWPSNELLARRLGIK
FT                   VSTLKYHLAGLAEAGLICYSDHPTYQRRGRRSEDGRIVEAYGINLSPIAAQYSELLDLA
FT                   DAADFEARKCKGLSNRRTLLRRGIAAIIEAARLELGSLNDEWNSLLARLDRLRERRGRG
FT                   SVDLADVVDALVTLRAEAADLLEALYDSRDSDTAVAKIRPLQTTAETPDSESCNDERNC
FT                   ADAQYIDQSGATGATAYENKPAETSVPGKRKAPAADDDIVNVSLPLLRSAFVHLSQMVP
FT                   EVFDHWAAFRSSGGLLCRLCYVNPQVYQEAVEVLGQDLAIVALALTAERNAKGSVSNAG
FT                   GYLRELVNRSHQGTLRLSRSLFGMAASSRKAH"
FT   gene            58628..58804
FT                   /locus_tag="Arad_12079"
FT   CDS_pept        58628..58804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12079"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31151"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPT2"
FT                   /protein_id="ACM31151.1"
FT                   /translation="MIVRMCSYGKMTDDAGEVGISLRAFLRKSCVSYRFFADGERPHIQ
FT                   KFLGAILLVRPHP"
FT   gene            59167..60762
FT                   /locus_tag="Arad_12080"
FT   CDS_pept        59167..60762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12080"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31152"
FT                   /db_xref="GOA:B9JPT3"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPT3"
FT                   /protein_id="ACM31152.1"
FT                   /translation="MLKNRKLFIPPPNDGSDFKELFKRLAAAGAGRPLGSDGFPAGPWT
FT                   PELLALAISQIDSNRVGVDLRTVQLWFQENEKGISTANIRWLARIFGCDDPVATSEWQM
FT                   ELSEAQSRFTAKRRESKNARSSANVAPEVLEVAWTASGDDVTGTPVELARDTDIKRPDR
FT                   RPGLALRSEALFSHGSPLNLPASVFAGATALGFLSYITGIHSATYIRADGVVKQVGFLW
FT                   APNWTFLFMVLLPLFFSLVTELLVFWKGEGRLKLLAQGGKMESDHDWGRNVEASSYSYW
FT                   AVFLICVLFAGLFQWIGVCLTPLMKGGADYATSWGSLAVVRPEIISVPMSIVFTALAYL
FT                   YMCLCFYLFFVGLILLHTMVHDLWRLEEASKSRSEVEYRRELNELGLRLMRGIFRCTVL
FT                   GVLVAICMKAQSAYLTSNREDIVAWFVGDISSALHHHADVSNKFSYRMPTHYSSLLVAV
FT                   SACVVFLYGSIRLGGGSRFQLPLWKMSAVVALLFVSYLLVDAFAGFSILLGIGVLLGIY
FT                   GLCDPGFGHRERVG"
FT   gene            60772..61767
FT                   /locus_tag="Arad_12081"
FT   CDS_pept        60772..61767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12081"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12081"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31153"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPT4"
FT                   /protein_id="ACM31153.1"
FT                   /translation="MYHSWLDRWDERRARRGEEGKKTSDFLLDAERAFPGAKKTASLEE
FT                   FCVLADQAVADPAFFDEPSGSDQGFQKQDGWLKFPSDMSTDVEENNVVWAKITESGSFD
FT                   QALVIFHHWNASARNQQIASFFSKRGITVVEIAMPYHFERRRPGSTHADYMLSPNLGRT
FT                   IQSVRQAVWDGRKLIRWLKSEGYREISVLGMSLGSWVAGLIAAHDASVSKASLFLTAGS
FT                   LADMVWTGRATRSIRESLEPEIKLTDLRRAWAPLNMENYAQNLGRPDLDLHVVLAKRDK
FT                   VVLPEISQRFMQRLKDAGAQPNILELNCGHYSLGMPPYILLAGLSLKRFL"
FT   gene            62488..62748
FT                   /locus_tag="Arad_12083"
FT   CDS_pept        62488..62748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12083"
FT                   /product="SyrB2 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12083"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31154"
FT                   /db_xref="GOA:B9JPT5"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPT5"
FT                   /protein_id="ACM31154.1"
FT                   /translation="MIEMRVAEGTATLKDVIKSAGISEQTYYNWKRAVRPVDHENKRPI
FT                   PGSDEFADLVQLERENQRLRQILAEKLRAENAELRKRLGLE"
FT   gene            62990..63604
FT                   /locus_tag="Arad_12084"
FT   CDS_pept        62990..63604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12084"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12084"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31155"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPT6"
FT                   /protein_id="ACM31155.1"
FT                   /translation="MKTTQRSFVVAFKSGRRQLKMGTKSIWGDTDLKALACEVEDKASH
FT                   LFGSNEASSTPDIDRDMLPDRIDAASASEDAVDLDVARAAVPSAKDVEADVTAQDQANR
FT                   SADEGVAQVQDIGPASQPNATTIGGIRNRTKRASGRRIPHTSMTALGDQGGQSETAVNP
FT                   ISVDEVAVLDAENKRLKKLLVEQLRGQNLQLEKMLERFAGT"
FT   gene            63647..63790
FT                   /locus_tag="Arad_12085"
FT   CDS_pept        63647..63790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12085"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31156"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPT7"
FT                   /protein_id="ACM31156.1"
FT                   /translation="MASGAGGTVQRLASETPSRGERDPSPPMAVKKKGIAKEYYYFSII
FT                   YR"
FT   gene            complement(63921..64163)
FT                   /pseudo
FT                   /locus_tag="Arad_12087"
FT                   /note="DNA polymerase III, alpha chain gene fragment;
FT                   Incomplete gene (pseudogene)"
FT   gene            64358..65350
FT                   /locus_tag="Arad_12088"
FT   CDS_pept        64358..65350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12088"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31157"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPT8"
FT                   /protein_id="ACM31157.1"
FT                   /translation="MSAPTEEMISVQKLVERLNAEYAFEVDYIGADLGGFSSQNNQLTL
FT                   KDKRRMVLKRCDQSQWDPRNVDIATILAHHSSLIYAPLATVGGSSTFKFDGWVYAVFPY
FT                   VDGEKLHQHSLDAETLKSAARALYAFHHIAHFAGSHAAQRPNVSDFEREVTSVLEPTLS
FT                   LSTDHADIIIRSIEAKRHILHSFSSDLSSINVGASSVIHGDFHNENILYRSDHVVAILD
FT                   FEMLHWGNVEDDIISFIALGCCNNGFSEENLRMANIFVKEYLSLHGENLDLHTALLRFI
FT                   HLKSSSLFLQKMLIYTGNMLYAQIIERDNKLFPSIMKKHREISKTLSSL"
FT   gene            65985..67325
FT                   /locus_tag="Arad_12091"
FT   CDS_pept        65985..67325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12091"
FT                   /product="Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12091"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31158"
FT                   /db_xref="GOA:B9JPT9"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPT9"
FT                   /protein_id="ACM31158.1"
FT                   /translation="MSNGFLLPLLAIAVPAALQNFVFSAQQVLDTIMVARLNDEYVAAL
FT                   AFCGAAFLVITSSLFGIALATSALVAQHWGAIDYARMRSYLFLGIALSMLVAVPAVVLF
FT                   VGFPELLMSLGPDSIQVRNAGVEYLQIAGWSILLWPISVGLSMALNMIGQARLSLLISV
FT                   AFAVITIVSNYVLIFGWGPIPKLEIRGAAFGTLGTSVLFAGVYLLFVLRPNNALRFSSR
FT                   ELSSTITLPLIRKLIAQSTPLFINGTLWAGGLFTYNVIFSQLGTAGMTVIALLAPIITV
FT                   SLVIFNGLATGANSVIGNALGRKDFDYAWNCAKSAISLTLVTGACTSLCMLLLQGVLPT
FT                   LYSGVSQGVFTEFESVYTIAAAFIWVRGLNIFLVNGLLRTGADNDYILKLDTISSWGIS
FT                   IPLTCAAVYAFDLSLIFVYLASLTGDFVKMIFYVARVRKRLWLRSLV"
FT   gene            67363..68721
FT                   /locus_tag="Arad_12092"
FT   CDS_pept        67363..68721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12092"
FT                   /product="NikO protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12092"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31159"
FT                   /db_xref="GOA:B9JPU0"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPU0"
FT                   /protein_id="ACM31159.1"
FT                   /translation="MSFIDKDHILAFGAGRLHDGHLNISGYKHAMVQAIACCIAQNQSA
FT                   ALNNVPHLTETSIITKILQNSGCTVDYSGDTLRLDPTKMDNSSIDPLLSQEIHGSLYLV
FT                   PAYVARFGEAVFHGAGGCPIGENGGRPVQHVLDVMEKFGIKSSITNGAVKCERTQTIRA
FT                   VDVDAQNYSDDPSTLSGPAVSGATKTALICAAMADETRIRNPYLKSDVFVHLDVLQQMG
FT                   YRVDIDLGMITIRKPLSPNRSPGIDYTLNSCVSEIVTYAIAAAIHDIDLVMKIKKGERV
FT                   AQALAPELTILSRMGLPVEITEDAVSVGRANTILGQAIIVDNSVTSIQSDHHPFLVLLM
FT                   AIRGCRGSVADTVWRKRVHYAEVLSAMGASIRIEGNTVHVDGAPNWVVTRNVVSGGDVR
FT                   SSAVIALLGTLLNSKVYIEGAHHLSRGYVDFVGKLISLGANIDTYANARLLAS"
FT   gene            68718..69917
FT                   /locus_tag="Arad_12094"
FT   CDS_pept        68718..69917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12094"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31160"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPU1"
FT                   /protein_id="ACM31160.1"
FT                   /translation="MRVLSIANVSNIDNPECDSGIIFQRLIADELVNYGIQYDVLVPKT
FT                   FSTAREYCGAANAVEFPLGTTRYESRFSFDWNEFKRVITLLKPDVIFNSQVELTSAIRA
FT                   LLVTEGKTIPIVSYCHYPALWAGDGQKPEKDASLDHAALWYPIVQDILSALNTADRFII
FT                   QSDFAGKLVAAAASFYNVPKHREIGVVAPPVDPAMLSDEPTEARLARRRNRKVIYNHRL
FT                   YASYGTQDFIDHISECLDLNCRFFISDPMGNRSMHRAFLSGSPADYRQRLSAMPCVDVS
FT                   PLGYSRAAYRGEILSSRVGIAAFRPACVWSMSALDCMGLGTPVIAPNYASYPEFIPPEL
FT                   LFNSVAEFRCLLVRLLEDDIFWCNASDQSRTMALRFSVQDSAARFFKMFSTLGDSACAV
FT                   "
FT   gene            69905..71683
FT                   /gene="asnB"
FT                   /locus_tag="Arad_12096"
FT   CDS_pept        69905..71683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnB"
FT                   /locus_tag="Arad_12096"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12096"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31161"
FT                   /db_xref="GOA:B9JPU2"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPU2"
FT                   /protein_id="ACM31161.1"
FT                   /translation="MCGIAGVASRQAHTLLRPEVVRMALHRLGHRGPDGTETYHCAQGV
FT                   FGAVRLAMNGLESAAVALKENGGKLSLFYNGEIYNQRELRAELAEHGVRFSTTNDGEII
FT                   LHLYKLAGLAMLDRLDGMFSFALVDEDKGETIIARDRFGIKPLYYHYDDSHGQLFFGSE
FT                   LKVIRCLTERAPEIDRVSVASYLHLRFIPAPFSIYQNIRKLEPGCYLRLNREGLRREKY
FT                   VLASRDRVDARRTQQSLSGELDDRLRDAVAEMLHCETEIGSFLSGGIDSTLVVQHATRL
FT                   NAGHKAFSVGYKQATIADETEQAKKSALALGTDHRVTLMSSDDCLTQQLKQSSWYLDEP
FT                   VLSTVSLPTFELSRFSRQFVKGVLAGDGSDEIFMGYNYLYDLRHELGEHQLLERYIAKI
FT                   GWLRPAIGSQVAKEYFAFDPFDTVLLPSDDPWEAIRSFEVNYRLPDYHLHRVDRLSMAH
FT                   SLEVRIPYLHKSIYDFAFSFSARDLIEKFPRKAILRGISAGGAIDHLLQKKKMPFTSPY
FT                   ADWLHGPLKEYAEYLFFQSTVGESLGIDLTQLGRVVNLSELSNHLNSTEIWGFFSLFNW
FT                   AQVTDESTPSFGLRHG"
FT   gene            71676..72485
FT                   /locus_tag="Arad_12097"
FT   CDS_pept        71676..72485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12097"
FT                   /product="hydrolase Cof"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12097"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31162"
FT                   /db_xref="GOA:B9JPU3"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPU3"
FT                   /protein_id="ACM31162.1"
FT                   /translation="MGKLIVSDLDGTLLNKKRRLSPRTEDVLRTIFATEFSFIVATGCN
FT                   RNDASSALNRMQFPMICNNGAAIWRPEDSKFSDVKYISSGAVQQILDVTNSINSAPCLL
FT                   MIDDRSKLEYYCNARAKTDLKMCSQLDGMGVPQSDGRFDRSGVVNMRFVSESPFSLELI
FT                   QEIREISGLNVVYERSIYESAVYFVEIYAEHVSKGDAISSFLRSNPHEEVICIGDGLND
FT                   LSMRSVCSTFCAPADAHKDILEIADIVIGESDRDGVAEFLEKILLDD"
FT   gene            72533..74146
FT                   /locus_tag="Arad_12098"
FT   CDS_pept        72533..74146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12098"
FT                   /product="ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12098"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31163"
FT                   /db_xref="GOA:B9JPU4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPU4"
FT                   /protein_id="ACM31163.1"
FT                   /translation="MLSSVIMSNVTWSATDEALLKDINLTFGAERTGLVGRNGVGKSSL
FT                   LKLICGELLPHSGTVLVNGSVGFLRQIVQIESQLTVADLFGVASALATLNRIERGDAND
FT                   DDFALADWTLESRIASSLADLKLDVAMNTPLVSLSGGQRTRAALAALIFDKPSFVLLDE
FT                   PTNNLDGEGRNAVIDFLSHWRSGAIVVSHDRDLLDTMDAVVELTSLGSTRYGGNWSYYQ
FT                   ERKAVELSASKRELNEAERRLIDVDRASQAAAERKTRKDNAGKSKRAKGDAPNAALNSM
FT                   RDRSEKTGAENARLAERRRNQAQADVVAARERIEVLQPFAVALASTQLPANKTVLALEL
FT                   VSAGYDPLCPVVQDLSLKIVGPERIAIIGPNGSGKSTILSVIGGGLKPSSGIVKVFTPF
FT                   AMLDQRMSLLDPSATIRDNFRRINVDADENVCRAALARFKFRADAALLLVSSLSGGQMI
FT                   RAGLACVLGGKHPPPLLILDEPTNHLDVESVETVERGLCAYDGALLVVSHDARFLDAIG
FT                   VNRTIAMGARPRGSLPRHRV"
FT   gene            complement(74203..74550)
FT                   /locus_tag="Arad_12099"
FT   CDS_pept        complement(74203..74550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12099"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31164"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPU5"
FT                   /protein_id="ACM31164.1"
FT                   /translation="MECAVTEQSISWEQDGIDSGWFFAKNVGSVRSSSSYRPGGWWFLP
FT                   KWLPDTEENDVGPFKTKTAALAEAERLAAISSQNRRQLLSAVAAEQRLPSIYLGDKSIV
FT                   VTTSHESGSAK"
FT   gene            complement(74553..76085)
FT                   /locus_tag="Arad_12100"
FT   CDS_pept        complement(74553..76085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12100"
FT                   /product="transposase number 3 for insertion sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12100"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31165"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPU6"
FT                   /protein_id="ACM31165.1"
FT                   /translation="MTIRADELPDDLNALKAMVLSREAENARLRQIIKELQRHRFGRRA
FT                   ETLPEDQLLLGLEEAEQVEAHGLEAKEQASADLRQTRVAKRRTNRGSLPAHLPRIEMVV
FT                   DIDDHACPGCHHDLHRIGEDISEKLDIIPAQFRVLVVRRPKYGCRACEDVVVQAPAPAR
FT                   LIEGGIPTEATVAHVLVSKYADHLPLYRQAQIYKRQGIDLDRSTLADWVGRAAWHLRPV
FT                   HQRLLDVLKSSSKLFADETTAPVLDPGRGKTKTGQLWAYARDDRPWQGNDPPGVVYVYA
FT                   PDRKAERPMTHLEGFVGILQVDGYSGYRPLAAKNTVSLAFCWSHVRRRFYELAAAGPAP
FT                   IATEALRRIAELYKNEDEIRGRTQDDRRVIRQEKSRPITDSLAPWLTEQLGLISQKTKL
FT                   AEAIRYTLSRWDGLTRFIGDGRIEIDSNTVERSIRPIALNRKNALFAGSDAGAEHWATI
FT                   ASLIETAKLNDVEPLGYIADALTRIVNGHPNSQIDELLPWSYRTDKIPPMKE"
FT   gene            76794..77273
FT                   /locus_tag="Arad_12103"
FT   CDS_pept        76794..77273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12103"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12103"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31166"
FT                   /db_xref="GOA:B9JPU7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPU7"
FT                   /protein_id="ACM31166.1"
FT                   /translation="MSLEPLMSAKYDSKRTKTDVLIEEGTFNPTPEKVRDPKFRGSEFF
FT                   DPHDAVQVKYEMLRRVSIDKVSVTEASDEYGVSRPTYYQAKVNFDMAGIAGLVPTKPGP
FT                   RGPHKIDDRVLAFLQAQLAPGEPVRARELAKLLRQELDIELHPRSIERVLKKSGT"
FT   gene            77566..79683
FT                   /locus_tag="Arad_12107"
FT   CDS_pept        77566..79683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12107"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12107"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31167"
FT                   /db_xref="GOA:B9JPU8"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPU8"
FT                   /protein_id="ACM31167.1"
FT                   /translation="MNVHLKVQPHHLERGAYLYIRQSSMRQVVENVESARRQYALRGRA
FT                   VALGWRDEQIIVIDNDQGESGASAAWREGFQRLVSDVGMGHAGIVMGLEVSRLARNNAD
FT                   WQRLLEICALADTLILDEDGVYDPASFNDRLLLGLKGTMSEAELHVIKARLRGGILNKV
FT                   RRGEFRCLLPTGLVYDHFGNVTLDPDMQVRETIIHFFEMFSRLGSASQTVKVFRNEGLL
FT                   FPSRLHNGDTLFRPLTASTAMRVLNNPRYAGAYTYGRRQFRRTIDGKKTLRARDIDDWP
FT                   ACIPDAHPGYISWERHQENLKILKANGRGFEAARASIPREGPALLQGRAVCGQCGSHLR
FT                   VRYAARRGRQEAWYICNRARIYRGEPMCQSIAGPPVDEAIGMLIAEQMTPAAVELALEV
FT                   RKEIQARHEEADRLRCRAIERAQTEAELAQRRFMLVDPSNRLVADTLEGEWNEKLRTLA
FT                   SAREERERGREHDQFILDKAVHERLVAMTADFNQLWKDPDTPSRERKRLLAHIIEDVTL
FT                   LKLPAEGTTKLHVRFKGGKIQTLTTMNPKSSPQQIKTKPSIIELVDRLLDDYIYPEIAE
FT                   ILNEQGHRPGGTARRGCQDARFTPLKVAYLIHEYKLRSRYDRLRQRGMLTRQEAAAHLN
FT                   ISEQTVARWAKFGLITRHAYNGHYSLYEIADGDLPQKQCSRWNPLEDRAAAYRQMQTEP
FT                   RTSTGEERGVV"
FT   gene            complement(79654..79899)
FT                   /locus_tag="Arad_12108"
FT   CDS_pept        complement(79654..79899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12108"
FT                   /product="transposase number 2 for insertion sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12108"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31168"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPU9"
FT                   /protein_id="ACM31168.1"
FT                   /translation="MIGPSGAVKVMIATKPVDFRKGAEGLAALVKAEMGTDPFSGTIYV
FT                   FRAKRTDRIKLIFWDGSGVCLVANDRRSYYTSFLAS"
FT   gene            complement(79896..80339)
FT                   /locus_tag="Arad_12109"
FT   CDS_pept        complement(79896..80339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12109"
FT                   /product="transposase number 1 for insertion sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12109"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31169"
FT                   /db_xref="GOA:B9JPV0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPV0"
FT                   /protein_id="ACM31169.1"
FT                   /translation="MSISELTLKTKDDEPVRRFEVFTGSGRRREWSDELKAQIVAESHE
FT                   PGVTVSSVARRHGLTSQQLFTWRRLARKPLDVLPDGAPMFAPAVVVAQDMPMPRKVRRA
FT                   RSPRKAHGDAVIELEIGGATIRIASGADATTIAAVIAAMKASS"
FT   gene            complement(80450..82078)
FT                   /locus_tag="Arad_12110"
FT   CDS_pept        complement(80450..82078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12110"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31170"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPV1"
FT                   /protein_id="ACM31170.1"
FT                   /translation="MVDQKSNRNVLFSAVKNEAPFIVEWIAYHKVIGFDRIIVFSNDCS
FT                   DGTDAILDALNEAREILHIRHTPPAGVSAQQSAARMANEMGLLEQSDWVIWLDADEFLN
FT                   IGVGSGQVSDLVSAISPCAGILISWRLFGDGGNHSFPGKFISPNFTSAASETFTRNREI
FT                   KTFFRFEYPVVGFSEIGTHRPLLRKAHEAPSTTFLSGNGRPIESSSEVNRRWLEGEDFW
FT                   RTSSVEQQEHGYKFAQINHYCVRTPEYFLLKKSRGRGFLSDQSGSRNRRHTPMFYMRMN
FT                   RNGSFDDGILRFSDQVDMVIKQLVGIENVQCAISSAQQKVQIAIDAIPRDDIEQLCKSS
FT                   MTELEAAAPMNGLDLPLSEKERDLLVEHFQNATNVLVYGGGHPSIEALANGCSRVISVE
FT                   CDKQFSQTLQSMLADTYEESRFHIHYEDIGVTGDWGFPDDSSHSDAYYRYPTSIWDSRE
FT                   FEHPDVVVINGRFKAACFLTTISLCQKETRILFSRYARSEAIHWIERYFRPIRYCDEIA
FT                   EFVVSPTMFSTAEITRIVSAYSDPR"
FT   gene            complement(82373..83014)
FT                   /pseudo
FT                   /locus_tag="Arad_12113"
FT                   /note="transposase fragment; Incomplete gene (pseudogene)"
FT   gene            complement(83210..83341)
FT                   /locus_tag="Arad_12114"
FT   CDS_pept        complement(83210..83341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12114"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31171"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPV2"
FT                   /protein_id="ACM31171.1"
FT                   /translation="MLVEFRRDLPHFWFGIDPAKRGQAYEMLHYLPIAGDRKMANAG"
FT   gene            complement(83351..84700)
FT                   /locus_tag="Arad_12115"
FT   CDS_pept        complement(83351..84700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12115"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12115"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31172"
FT                   /db_xref="GOA:B9JPV3"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPV3"
FT                   /protein_id="ACM31172.1"
FT                   /translation="MIFVDECGSLTLKLANRISALRYEHLPHAVVDKAISLIVDTVVVA
FT                   AAGTSAAGVKNVADLVIGEGGRAEAKLWSTGQSLPATSAAFVNSLHAVALDYDSLNGTV
FT                   HADAVVLPAAAAIAERQRSTGQEFLTAYVIGTEVMARLANSVSGPSPGWSHTAIFGGFG
FT                   AAGAAAYLLKLDPQQTAHALGLALGQAAGTQQANVEQVLQKRLQPALACRAGVFSALLA
FT                   KVGITGPTFAVEGKFGFGRLYRELDEFHVLGGFGEEFFLMRTGLKKYPICACSHAAVEA
FT                   LHDIISAHGLTAADIMHIEARISPFMARLVGGEARAASDLEVFAQFNLRYALASMALRK
FT                   RIGLNELSNQSVTETAVIEFMKRITIAIDPQSSGELAPASVTLTCTNAKVLRAASFFMP
FT                   GTPEAPLTEETLRQKHQECLTNAMRSTTLATLTRSIERNRAHGVVFRGLP"
FT   gene            complement(84697..86061)
FT                   /locus_tag="Arad_12116"
FT   CDS_pept        complement(84697..86061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12116"
FT                   /product="Coenzyme F420-dependent N5,N10-methylene
FT                   tetrahydromethanopterin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12116"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31173"
FT                   /db_xref="GOA:B9JPV4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPV4"
FT                   /protein_id="ACM31173.1"
FT                   /translation="MSTVTRKMRLGAFLQETGHHIAGWRLAEADASAAFSLEHQVELAR
FT                   TAERGLFDLVFIADSLAVRGAANIEALRRTSRAVGWEPITLLSALAASTSKIGLVGTVT
FT                   TTYSEPFSLARQFASLDHLSGGRAGWNLVTSNNEAEAQNYGRSAHAEHGDRYNRAEEFI
FT                   DVVRGLWDSWEDDAFTLDKEKGLFFDPEKLHVLDHTGANFKVRGPLNIARSPQGYPVLV
FT                   QAGSSEAGRRLAARTAELVFTAQQTLAGAQEFYADVKNLSKAFGRNPDLIKIMPGFFPV
FT                   VGRTTEEARAKFDALQDLVDPVVGLATLATTMGEVDLSNYDLDGPLPDIPETNGPKGRR
FT                   QLLIDLAHRENLSIRQLYLRVVAARGHHVVIGSPEEIADEMERWFKQGAADGFNIMPAS
FT                   FPGGLTDFVDLVIPALQRRDLFRRDYEGNTLRDHLGLGRPAGRFEKPLAMARALP"
FT   gene            complement(86066..87232)
FT                   /locus_tag="Arad_12118"
FT   CDS_pept        complement(86066..87232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12118"
FT                   /product="Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA
FT                   dehydrogenase, central region:Acyl-CoA dehydrogenase,
FT                   N-terminal:Acyl-CoA dehydrogenase, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12118"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31174"
FT                   /db_xref="GOA:B9JPV5"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPV5"
FT                   /protein_id="ACM31174.1"
FT                   /translation="MPQVQIKPLHDEAINQLRELTNTLFREEGVIADRDGVIPFKSLRA
FT                   IYDLGLWHASASKSLGGRGGSLTGEEPGLFLELLRTVCSGDSPTGHCYQLHNHALWQLE
FT                   TVGTPAQIERFLKPNLEKFSLFAAVGSEPGRVNMYEMKTRARKVDGGFIVNGVKNFVTN
FT                   GGAADIIITSVALDDASSYFDNLQMMLIEPGMDGVTFDDDWYRPHGMRSARSPIMRLED
FT                   VFVPDIHALGEPGAFARQRWQGRFHLGFAANYLGSAEGLFDWFLQYTRTRNRSQDPIIQ
FT                   LRTGEMKLQLDAASALFEEAVRSWSTKSTVEAELRSMSAKSFAARAAFDVVRSILYTAG
FT                   ATAQFEEHPLGRSVRNLETHVVHAGHDRTAQIIGQAQLGVTFDSTLQR"
FT   gene            complement(87270..88250)
FT                   /locus_tag="Arad_12119"
FT   CDS_pept        complement(87270..88250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12119"
FT                   /product="ABC-type taurine transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12119"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31175"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPV6"
FT                   /protein_id="ACM31175.1"
FT                   /translation="MTDERPSLTIALASFDRHIPFFMNWLPQHPNFSLKALDVGINPPG
FT                   RDGGDRHGRMLRDREFDIAEVSLASYIMARAQGAAFTAVPVFPRRLFSQNHIFVHVTSG
FT                   IKTPRDLIGKRVAIRSFQVTLSVLAKGDLASLYGVPWRSIHWVVQDAEEIAWQGEDLSI
FT                   ERMAAGTKGVDLLRRGLVDAYIDPRPPVLLLTDDAVRPLFPDRQAEAAAYFRARGAFPI
FT                   MHLLIIRQETADKFAGLPGYLIEAWEDAKAKVCRSYEDPAYTLMPFGSAAYQAAVAEFG
FT                   PDPWPSGLAANADNVRWFQDYMVDQTLLHQPLPLASLFHSSVLDT"
FT   gene            complement(88247..88984)
FT                   /locus_tag="Arad_12120"
FT   CDS_pept        complement(88247..88984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12120"
FT                   /product="Ribulose-5-phosphate 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12120"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31176"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPV7"
FT                   /protein_id="ACM31176.1"
FT                   /translation="MVIKADIVRDLVVANRILAHEAVVDSYGHVSVRDPERNDRFLLSR
FT                   SVSPEQVQTDDVLTFDTRGEPVEATKTALYSERVIHAAIYRDRPDVHAVVHGHAQEVLP
FT                   FTVTDVRLRPVLHVAAIIGADIPVWDMRDAFGDTDLLVTTMDHANDLSARLAQNRVVLM
FT                   RGHGFTATGISLEHVVRTSYYLKVNARLQREASALGTITFLTQGEVDAAIARMGSMRAT
FT                   PRVWRNWAIRCGAGNLFSDEVAP"
FT   gene            complement(88989..90095)
FT                   /locus_tag="Arad_12121"
FT   CDS_pept        complement(88989..90095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12121"
FT                   /product="ABC-type Fe3+ transport system periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12121"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31177"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPV8"
FT                   /protein_id="ACM31177.1"
FT                   /translation="MKQRLISRRHFSMTALALPALAAFAGIGRAANAWNDIVSAAETEG
FT                   TLTVLGPPIQPYRLSILEFQKAYPKIKLEYTAGSSPDFEARLRSERRVKQYLWDIMVAG
FT                   FSGSAFSEQIPAGWFDPVRSLITQPDILDDTHWLGGFEGGFLDRDKKYFYAFQAGKQNN
FT                   LNIDRAKIPKASLSRLEDLLDPQWKGKIAILDPRTRGSGHLVTLLLTVLGEDKARAFLT
FT                   EQQPTLASSNRQLSDWIAAGAYPITSGLSPSEIAQLQANGLAKEVTALSTPPNQTAWTP
FT                   GWGAVALLHNAPHPNAAKVFVNWLLSQGAQADWAGRGFVNSRRTDVKPGLEVSALSDAS
FT                   FREGLTFNNEVNAEKALKAFALAKEVLG"
FT   gene            complement(90107..91189)
FT                   /locus_tag="Arad_12123"
FT   CDS_pept        complement(90107..91189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12123"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12123"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31178"
FT                   /db_xref="GOA:B9JPV9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPV9"
FT                   /protein_id="ACM31178.1"
FT                   /translation="MLTIQSLKKSFDGRTVLDGVDVSIEDGKIFTVLGDSGCGKTTLLR
FT                   ILAGLETADGGRIEFNGATWVDTAARHLLPPQNRGIGLVFQSYAIWPHMTVGQNVAYPL
FT                   RRAGLKRQDIAERVSQTLAIVGLAGFEQRSATRLSGGQQQRVAMARALAPEPKLLLLDE
FT                   PFSNLDVSLRSQLRRELKDIQQRLGLTIVLVTHDQLDAFTLSDQVAVMRAGRVEQIGTA
FT                   QEIYERPASDYIRSFVGRSSSLSAKVIQENGSELKVRLKGGKLTSVRDEEANAISVGTS
FT                   ISLWARPEDIVLCLASPEAQADDLAGRVREVTFIGDRFETVVDLYGGEPLLAYQSRSAV
FT                   LGPGTEVIVRFLSSPTIIRS"
FT   gene            complement(91199..92872)
FT                   /locus_tag="Arad_12124"
FT   CDS_pept        complement(91199..92872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12124"
FT                   /product="ABC-type Fe3+ transport system permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12124"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31179"
FT                   /db_xref="GOA:B9JPW0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPW0"
FT                   /protein_id="ACM31179.1"
FT                   /translation="MPSSVSFWLWTMLFAMAMIAPVAAILRGSFEIAIPGSDDTRFGLD
FT                   AWRQVFAEPMFLSAVVNTVGLTLATQLLALPIGIFIAWLIGRTDLPGRRHLEFCFWISF
FT                   FLPALAVLQGWILAFDPHYGVANSAIQRFFGPSAPVFDIYSWTGIVFAHLVTTTISAKV
FT                   MMLTPTFQNMDSRLEEAARVAGDGHFATLLRITIPVLAPAIAVAAIIGIMRSLESFEIE
FT                   LVLGMPRRIEVYSTLIYHLTRNDPINFAGASALGISITSVLAWLAVLSVRIGSGGRAVT
FT                   VSGHSKPARITLGPWKIPAFIFVATFAALLTVMPVAFLIASSVMTMFGFFSLESVWTTS
FT                   HWTGVVADPVFLSSFANTLVLAIGCTFACVIVSIAIGYTVVRSSRAARIILDVTSWVPF
FT                   TVPGILLSLAMLWLILESGSTYLYGSTVSLIVTVTLSTLTLGVQLIKGSLSQIHRELEE
FT                   ASWVGGTSTFETLWRIVLPLTARSIAVVAVMSFIAAARNISHVALLVSSDNRPLSILQL
FT                   EYMIDGHQEEAAVVGVVIVAVAVLAALLARRLGSRIAPHA"
FT   gene            93118..93912
FT                   /locus_tag="Arad_12125"
FT   CDS_pept        93118..93912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12125"
FT                   /product="regulatory protein, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12125"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31180"
FT                   /db_xref="GOA:B9JPW1"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPW1"
FT                   /protein_id="ACM31180.1"
FT                   /translation="MMTEDESTFVRSIARGLKVIEAMSAVQDGLSLSEVAMRVDLDRAT
FT                   ARRILLTLQSLGYVRQAEKRFSLSPKVLGLGYAYLSGTPLWSVSAPYLMTAATAISGSC
FT                   SIAVLQGSEAIYVARQTSGKRSLAQSVEIGTRFPLYCTSAGKVLLTRFSDDEFQEYTAT
FT                   TELNAFTTRTITSAPKLRTEVEHVRKQGWAISDQEYEDGVRSVAVPILDATGKTVAAMV
FT                   ASSQASRLVDDDWRAIADDHRRILIDALEPLAPLWWAQTPVR"
FT   gene            complement(93922..94650)
FT                   /locus_tag="Arad_12126"
FT   CDS_pept        complement(93922..94650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12126"
FT                   /product="dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12126"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31181"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPW2"
FT                   /protein_id="ACM31181.1"
FT                   /translation="MIMASEFVGKVIWVTGGSGTIGAAVVRQLALKGATVVASSRQRDV
FT                   LSETHNVVWMQADVTNNLDVRTTATAIVENFGRIDGVVTASTVPIFGDFLALTDDDWSS
FT                   VVNAKLFGSVRPVRAALPYMIARGSGSIVLISGRGGLRASPQHLPGSSVNAALILLAQG
FT                   LATRFGPDGIRVNALSPGPIVSERLEVMQKAGMPQASTALGAAGTADDVADAILFLLSD
FT                   DARHITGTNLVVDGGGPRTT"
FT   gene            complement(95314..95568)
FT                   /pseudo
FT                   /locus_tag="Arad_12128"
FT                   /note="hypothetical protein; Incomplete gene (pseudogene)"
FT   gene            95685..96302
FT                   /locus_tag="Arad_12130"
FT   CDS_pept        95685..96302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12130"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12130"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31182"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPW3"
FT                   /protein_id="ACM31182.1"
FT                   /translation="MHIKVFVLAALALSSAVATNAADMTADQSAPQPEQQAYSAYNWSG
FT                   FYLGAQGGYSWNKAKYLGADQSLNTGSAGAHVGYNFQTGNIIYGIENDFNYNFDKGNKA
FT                   DLQWDASGRARVGYALDRTLLFATAGLAAAGGKVDAPAIGKKDDILIGWTAGAGVERAL
FT                   TDNILIRGEYRYSDFGKKDFGSDIGDFSATQQKIILGASYKF"
FT   gene            complement(96609..97079)
FT                   /locus_tag="Arad_12131"
FT   CDS_pept        complement(96609..97079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12131"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12131"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31183"
FT                   /db_xref="GOA:B9JPW4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPW4"
FT                   /protein_id="ACM31183.1"
FT                   /translation="MTGGEASDFSAVPDLLAIPVGKPRLFLADKGYDGNFLREELLIHG
FT                   IRPVIPPKANRKNPPACDFRPYKDRNRIERDDTLSAGRRAYLRQFFIARKSRGAGLGRA
FT                   AIELLLAERFKEPMVVRLEVLDSNPRGFGFWTAVGFQGYSRNLERTSGPGTA"
FT   gene            complement(97076..97507)
FT                   /locus_tag="Arad_12132"
FT   CDS_pept        complement(97076..97507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12132"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12132"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31184"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPW5"
FT                   /protein_id="ACM31184.1"
FT                   /translation="MARGDLMNMEWRIIEGLLPAERGRKSRPAHDNRRYLNGMLHVLRV
FT                   GCPWRDMYERYGKWNSVYVRFRRWAEQGVWDALLETLVELGLTDDWQHMIDSTTVRGHS
FT                   QSAGAKGGFIRRVLVDHAAALRRKSTPAQTVRDVLSASS"
FT   gene            complement(97631..97738)
FT                   /locus_tag="Arad_12133"
FT   CDS_pept        complement(97631..97738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12133"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12133"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31185"
FT                   /db_xref="GOA:B9JPW6"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPW6"
FT                   /protein_id="ACM31185.1"
FT                   /translation="MMDWFPIVFITFKVLVLGTGMFFAIKWHHDQGKKK"
FT   gene            complement(97980..99026)
FT                   /locus_tag="Arad_12135"
FT   CDS_pept        complement(97980..99026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12135"
FT                   /product="xylitol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12135"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31186"
FT                   /db_xref="GOA:B9JPW7"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPW7"
FT                   /protein_id="ACM31186.1"
FT                   /translation="MTTQRALVLERQHELKLRDIDLPQEVGPGEVKIKIHTVGVCGSDV
FT                   HYYTHGRIGPFVVNAPMVLGHEAAGTVAEVGAGVSHLKVGDRVCMEPGIPDANSKASRL
FT                   GMYNVDPAVTFWATPPIHGVLTPFVVHPANYTFKLPDNVSFAEGAMVEPFAVGMQAAAK
FT                   AKITPGDTAVVLGAGPIGTMVAIAALAGGCARAIVADLAQPKLDIAAQYQGVIPVNIRE
FT                   KNLIEEVRRLTDGWGADVVFECSGSPKAWETVMELPRPGGVIVAVGLPVAPVGFDVSTA
FT                   STKEVRIETVFRYAHQYERSIALIASGRVDLKPLISETFTFEQSIEAFDRAVEARPSDV
FT                   KLQITFEG"
FT   gene            complement(99083..99808)
FT                   /locus_tag="Arad_12136"
FT   CDS_pept        complement(99083..99808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12136"
FT                   /product="short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12136"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31187"
FT                   /db_xref="GOA:B9JPW8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPW8"
FT                   /protein_id="ACM31187.1"
FT                   /translation="MDFSGKSVLVTGAGKGIGRTVAQMLASRGAQVVALSRSEADLRSL
FT                   EAEIGSRSIAVDLADAVATRAAAAAAMPVDYLVNCAGTTTLEAFVDVTTEAFDHLIAVN
FT                   TRAPLIVSQEYARSRIALGAGGAIVNVSSASATTGFADHAAYCASKGALDAMSRVMANE
FT                   LGRHGIRVNCVNPTITLTDMAKKAWSDPEKAGPMLARMPLGRFVETNEVAEVVLFLLSD
FT                   RAAMVNGVSMPIDSGFAIN"
FT   gene            complement(99822..100796)
FT                   /locus_tag="Arad_12137"
FT   CDS_pept        complement(99822..100796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12137"
FT                   /product="sugar uptake ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12137"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31188"
FT                   /db_xref="GOA:B9JPW9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPW9"
FT                   /protein_id="ACM31188.1"
FT                   /translation="MLNLLKPKSSGDLARLGVLFALAALILFGALRYDNFLSSFNILSF
FT                   LRYNSMFTLVALGMAFVIITGGIDLSVGGVAACSSVVAAMLSTHSWWAGLAGGVGTGIL
FT                   AGLVNGLVVTKMRIQPFIATLAMMLASYGTALLLADNQSVSVSYDTGFTMIGQDDFLGF
FT                   PIPAWIALAAYIVGWLVLERFPAGRHVLAIGDGEGIAALIGLKVERTLTIVYLASGALA
FT                   GLAGVILAAQFGAGQPTEGVGWELFAIASVVVGGTLLTGGAGSVGATLAGALLLGLVFN
FT                   ILNFENGLGWISLSAYWQSVIRGGFLLVVVILQAKLDSKREMS"
FT   gene            complement(100806..101810)
FT                   /locus_tag="Arad_12138"
FT   CDS_pept        complement(100806..101810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12138"
FT                   /product="sugar uptake ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12138"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31189"
FT                   /db_xref="GOA:B9JPX0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPX0"
FT                   /protein_id="ACM31189.1"
FT                   /translation="MTVSDTSSLKHTRRAKASPLVMLSRYGTFAAFIALLIFNMMVTPH
FT                   FLSWQTFNVNLTQVATIVIVATGMTLVISTGGIDLSVGSLMAISGALAPMIFMGDVFQI
FT                   DNMALAVGLAFVIPVVVAALLGVFNGLLVTRFSIQPIVATLVLFIAGRGVAQVMTNGNL
FT                   QVFKNPCFQFIAMGNFFGIPAQVVLMLVIAALAYALIRYTVIGRQILAVGGNEKAARLT
FT                   GIPVRRIKIVAYMISGALAGIAGLVVVARNSASDANLVGMGMELDAIAAVAVGGSLLTG
FT                   GRANIIGTLMGALVIQLVRYTLLANGVPDAAALIVKAGLIVIAVFIQQRADRI"
FT   gene            complement(101812..103305)
FT                   /locus_tag="Arad_12139"
FT   CDS_pept        complement(101812..103305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12139"
FT                   /product="sugar uptake ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12139"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31190"
FT                   /db_xref="GOA:B9JPX1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPX1"
FT                   /protein_id="ACM31190.1"
FT                   /translation="MLLSMQGIMKSFAGVSALQGVTLEIGEGEIMALVGQNGAGKSTLI
FT                   KILTGAYQRDGGTIHFDGKAVSFSSPAESQAGGIATIYQEINLAPQRSVAENIYLCREP
FT                   RKMGFLDRRAMRDGARKVLQQFKLDIDVEMPVSRFSAATRQMVAIARAVMQDAKLLIMD
FT                   EPTSSLDEREVAVLFETIRTLQKNGLAVCFIGHRLDELYALCERVTIMRDGKTVAAGPL
FT                   ANMSKMDLVQNMLGRELAAFEAIGRDIDVRNDKPIRLQLNNGGHGIRVREVVLSLREGE
FT                   ITGLAGLLGSGRTETARILFGVDKLERGSLQFEGQPRRYSEPAAAIADGIGLVSEDRKV
FT                   DGIIPDMSIRDNMTLALLPKLKKNGVVDRVRQDEIVARFIKSLGIKCASPEQAIKELSG
FT                   GNQQKVLLARWLCTNPRVLIIDEPTRGIDIGAKTEILKLLRGLADEGLSVLMISSEIEE
FT                   LLAVADRVIVLSDGMSVAELPRQNLSEASLLAAMAHQVN"
FT   gene            complement(103423..104397)
FT                   /locus_tag="Arad_12140"
FT   CDS_pept        complement(103423..104397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12140"
FT                   /product="sugar uptake ABC transporter periplasmic
FT                   solute-binding protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12140"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31191"
FT                   /db_xref="GOA:B9JPX2"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR033893"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPX2"
FT                   /protein_id="ACM31191.1"
FT                   /translation="MITRRSLLTTSVAASAVALVSTIAFAAPPLAKKDIYKVGFAQTES
FT                   NNPWRIAETKSMQDEAKKLGYQLVYTDAASSAAKQVADVNSMIAQGVDIIFLAPREEKP
FT                   LIPAIMAAKKAGIPVILLDRNVDPSLAKPGKDYVTFIGSDFVDEGKRIAEWLAKNANGK
FT                   KKIIELEGTTGSSPANDRKKGFDEAIKAAGGFEIVASQSGDFARDKGRQVAEALLQAHP
FT                   DVDIIYAHNDEMAIGAISAIEAAGKVPGKDILVLSIDGGKEAVGLVAEGKIGAVVECNP
FT                   RFGPKAFETMARYGKGEVIEPWVKNIDKFYDGTNAKNELAGAY"
FT   gene            104680..105696
FT                   /locus_tag="Arad_12141"
FT   CDS_pept        104680..105696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12141"
FT                   /product="transcriptional regulator, LacI (ribose operon
FT                   repressor) family"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12141"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31192"
FT                   /db_xref="GOA:B9JPX3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPX3"
FT                   /protein_id="ACM31192.1"
FT                   /translation="MTDVALEAGVSQTTVSFVLGQTAGSKLPQATRERVIEAARRLGYS
FT                   LPDHSPSRLSVAPTVSGTIGFMVDQLATTHDAVVAIEGARQASLNGGNILLVAQMPGDP
FT                   ETEARTIEALTKADISALIYMAIFTRELVAPAYLYELKIPVVLLNCHTSDYRFPSVVPS
FT                   EIAGGQNATLHLIQHGHRRIATITGEPWQEATQDRLRGYRRALATADIPFDPHLVVEGD
FT                   WSTSGGYEATKKLLRLKELPTAIFCQNDRMAIGCYEALKEFGLDIPQEMSVVGYDDEEV
FT                   ARHLHPPLTTSVLPHRAMGEWAIERLGMPFTPQGNRFPIIKLECPLVLRGSVAAPAR"
FT   gene            105773..106123
FT                   /locus_tag="Arad_12143"
FT   CDS_pept        105773..106123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12143"
FT                   /product="serine protease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12143"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31193"
FT                   /db_xref="GOA:B9JPX4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPX4"
FT                   /protein_id="ACM31193.1"
FT                   /translation="MMAGGGNLLRLIQLFLAKACCSCCATSTAASSTKYGTLRSVGPIW
FT                   RLCAENGISPGGLILRTRLQGATDSFALDINKRRSVTEIALSWGFNDISYFNRAFRTTY
FT                   GMTPRQMRHSHQ"
FT   gene            complement(106197..107003)
FT                   /gene="proC"
FT                   /locus_tag="Arad_12144"
FT   CDS_pept        complement(106197..107003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="Arad_12144"
FT                   /product="pyrroline-5-carboxylate reductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12144"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31194"
FT                   /db_xref="GOA:B9JPX5"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPX5"
FT                   /protein_id="ACM31194.1"
FT                   /translation="MAHVVLIGAGNMGFAMLRKWSKLGQHHLTIVEPNAALRARAAETD
FT                   ARTYASADDLPVAFQADVAVIATKPQVVGDVVERYSALLADGGFFISVAAGIGIRKMAL
FT                   RAKRPAAIIRCMPNTPAAIAEGMIVCCPSAETTFVQRALAEELLSSIGRVAFVDDEALM
FT                   DTVTAVSGSGPAYVFHFIEALCQAGIQAGLDEELALLLAKQTVFGSAKLAIEATEPPAT
FT                   LREQVTSPNGTTAAALDVLMEDGKGLRHLIEAAVQAARRRSVELGS"
FT   gene            complement(107005..108027)
FT                   /locus_tag="Arad_12145"
FT   CDS_pept        complement(107005..108027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12145"
FT                   /product="Malate/L-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12145"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31195"
FT                   /db_xref="GOA:B9JPX6"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPX6"
FT                   /protein_id="ACM31195.1"
FT                   /translation="MYRQPYETVVETLELILTKHGYSARSAGILALNCATAQQDGSESH
FT                   GLFRIKDYLAIIKSGYVNGDPNPKVVDVAPGFIRVDADNGFAQIALADAKERLVQKAAE
FT                   NGIAIVAIRNSHHLGALYLDVEDLADRGFVSLAVVNSIAVVAPPGGRAGVYGTNPMAFA
FT                   APRAEGPPLVFDQASSTMSHGDVQVAAREGRLLPEASGIDKRGIPTNSPHAILNGGALS
FT                   TFGGHKGASIALMVEILCAALVGADFSYEVDWSETPGARSARTGETIILIDPRTGADGL
FT                   PPLAERVGTLIEALSVAGQKRIPGDRRIKARSEANGSVPVDEKQWLALLELANTSDRRK
FT                   "
FT   gene            complement(108034..108963)
FT                   /locus_tag="Arad_12146"
FT   CDS_pept        complement(108034..108963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12146"
FT                   /product="EtfA2 electron-transport flavoprotein,
FT                   alpha-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12146"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31196"
FT                   /db_xref="GOA:B9JPX7"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPX7"
FT                   /protein_id="ACM31196.1"
FT                   /translation="MTILLLADHDKAVLSDQTAKVLTAATGIGADIHVLVAGLDTGTVA
FT                   KAASTLAGVGKVLQAEDASYARQLSEPLADLIVSLAGSYDVIIGAATSAAKSVLPRVAA
FT                   LLDVMQISEIVEVVAEDTFKRPIYAGNAIQTVQSSDAKKVITVRTAAFAAAPASGAAPI
FT                   EIVSAIGDKGLSRFVSEEIAASERPDLMSAKIIISGGRALGSAEKFREVILPVADKLGA
FT                   AVGASRAAVDAGYAPNDWQVGQTGKVVAPQLYIACGISGAIQHLAGMKDSKVIVAINKD
FT                   EEAPIFQIADYGLVADLFEALPELQKAL"
FT   gene            complement(108995..109816)
FT                   /locus_tag="Arad_12147"
FT   CDS_pept        complement(108995..109816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12147"
FT                   /product="electron transfer flavoprotein beta-subunit
FT                   beta-etf flavoprotein small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12147"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31197"
FT                   /db_xref="GOA:B9JPX8"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPX8"
FT                   /protein_id="ACM31197.1"
FT                   /translation="MPPITRLPDRPAFTKTRKDRGRCSMKILVPVKRVVDYNVKIRVKP
FT                   DGTGVDLANVKMSMNPFDEIAVEGALRLKEAGKASEVVAVSVGPSKAEDTLRTALAMGV
FT                   DRGLLVETDETVEPLTVAKLLKAVAQQEAFDLIILGKQAIDDDSNQTGQMLSALLGWSQ
FT                   ATFASKIVIGDGSITVTREVDGGLQTIDVILPAVITTDLRLNEPRYASLPNIMKAKKKP
FT                   LDKKTPAELGVEVVQRVRVLKTEEPAGRKAGVKVTSVAELVDKLKMEAGAL"
FT   gene            complement(109791..111416)
FT                   /gene="betA"
FT                   /locus_tag="Arad_12148"
FT   CDS_pept        complement(109791..111416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betA"
FT                   /locus_tag="Arad_12148"
FT                   /product="choline dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12148"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31198"
FT                   /db_xref="GOA:B9JPX9"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPX9"
FT                   /protein_id="ACM31198.1"
FT                   /translation="MAYDYIIVGAGSAGCILAARLSEDPAIQVLLVEAGGSDRGPVIAM
FT                   PAALPFAYQSKKLGWGYQSGPEPHLGGRTMDEKRGKVIGGSSSINAMIYNRGNPMDFDG
FT                   WAEQGLVEWDFAHCLPYFRRMETFADGADEWRGGDGPMRISRCKAQHKLYDAFLRGGEQ
FT                   AGYPVTPDHNGYRQEGLHIAQSFIHGGRRWSSARGYLHPAAKRDNLHIMSKTLVSRVVV
FT                   ENGAAIGIEILENGTLRLIDCEREVILCAGAFNTPQLLMLSGVGDPDELRRHGIALKGE
FT                   ARQVGRNLENHPGVNLQYATNYEDSLVSELNLFGRARLGVEWLLTRKGLGASNFFETGA
FT                   FLRTREDVSFPNMQFEFLPLTRYVKNGKLVAIPGFQFWMDLSRPESRGSVTLRSADPAE
FT                   APYIVFNHLQSPQDLKDLVDGVRLARDLIRQPAWDKYRGQELSPGSDAQSDAELEKFVR
FT                   ANLGTSYHPSGTCRMGIDDEAVVDSEARVKAVRRMRVVDASIMPRVVTANLSAAIMMIA
FT                   EKLADRICGKEPLPPSNASYYKAA"
FT   gene            complement(111622..112092)
FT                   /locus_tag="Arad_12149"
FT   CDS_pept        complement(111622..112092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12149"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12149"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31199"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPY0"
FT                   /protein_id="ACM31199.1"
FT                   /translation="MVKIEPNRGAIVASLSLVDVLEMLDIRIALECHALRLAIPEMAEE
FT                   DFSHAESILEGYNREPNPESWGTMNWQFHWSIYAPCHRPRLLSMIEANYGHVNRFVRMQ
FT                   VSLAAGKERPRKEHELLLALCREGDIEQATALLETHIEQTKKSVQASRRHRS"
FT   gene            complement(112347..113243)
FT                   /locus_tag="Arad_12151"
FT   CDS_pept        complement(112347..113243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12151"
FT                   /product="transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12151"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31200"
FT                   /db_xref="GOA:B9JPY1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPY1"
FT                   /protein_id="ACM31200.1"
FT                   /translation="MSCATKKVSTNEDDCCQLRRSSLGIPRHRRRADLFGARRGVGEEP
FT                   FCHCRPRRRDRPAPRVFGSSAHGDRPALAEGTSTIPATRDYRLWCLPRLDEHPDLSGVR
FT                   ASSSRRRRSRRGDRSAACRPCSFRRPLDFLWLATAVGGLLFLLPFRTENDLDPVGLLFA
FT                   VGAAACWACYILFGKKISPLGPVRAVSLGMAVAATFGVPFGVYNAGASLLGWQILAVGL
FT                   LVALLSSAIPYMLEMFAFRRLPPSALGILLSAAPAISALMGTLLLNERLSNQQMLSIVL
FT                   IMVGSAGCAIFSRKAVA"
FT   gene            complement(113295..114023)
FT                   /locus_tag="Arad_12152"
FT   CDS_pept        complement(113295..114023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12152"
FT                   /product="glutamine transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12152"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31201"
FT                   /db_xref="GOA:B9JPY2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPY2"
FT                   /protein_id="ACM31201.1"
FT                   /translation="MSIVEFRKVVKSYGTLDVLKSIDLSIDQGEIVFLIGPSGSGKSTL
FT                   LRCINVLETIQSGDLIVDGLSAKGTRAGIRQIRLEAGMVFQQFNLFPHMTALENVMFGP
FT                   LKVRRSGKAEAETIAKDLLAKVGLSERAGHYPSQLSGGQQQRVAIARSLAVRPKLMLFD
FT                   EPTSALDPELRHEVLQVMRQLADEGMTMVVVTHEIGFARDVGSRLLFIDKGHILHDGGP
FT                   KELLANPPSERLASFLQHIR"
FT   gene            complement(114020..114676)
FT                   /locus_tag="Arad_12153"
FT   CDS_pept        complement(114020..114676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12153"
FT                   /product="Amino acid ABC transporter, permease protein,
FT                   3-TM region, His/Glu/Gln/Arg/opine"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12153"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31202"
FT                   /db_xref="GOA:B9JPY3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPY3"
FT                   /protein_id="ACM31202.1"
FT                   /translation="MTFEWSAIIDALPALLRGAAVTVMVAAASLLAGMILGTIIGVIRT
FT                   YAPKYISLIAQIYIGLIRGTPMVVQIMFIYFALPSLLDIKLTALTAGMIALTVNSSAYL
FT                   AEIVRGGFMAVPHGLREAGLAMGLPLHRVLLYIIGPVAFRRMVPALGNQFIIGLKDTSL
FT                   LIVIGVAELTRTGQEIMTENYRAVEIWAAVGVIYLVIISIMAIIFRVIEKRIQMT"
FT   gene            complement(114723..115469)
FT                   /locus_tag="Arad_12155"
FT   CDS_pept        complement(114723..115469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12155"
FT                   /product="ABC-type amino acid transport system periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12155"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31203"
FT                   /db_xref="GOA:B9JPY4"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPY4"
FT                   /protein_id="ACM31203.1"
FT                   /translation="MNRRIFFGALVATVAFTQAVFAQDKTIVVGTSVDSKPFDFMQDGK
FT                   YVGFDQDLLVEIAKEAGFKYNVTPMDFGALIPALQTANIDLAISSIFMTDARKKVVDFS
FT                   DVYYTSALGVLIVANDATIKSGNDLAGKKVASVTGAASTTWLKEHAPTAQVTLFPQVTN
FT                   MFMELQSSRAEAVVYDYPFLAYYAATEGKGKVKILEAPVGDGIPVGIAFPKGSDLVVKT
FT                   NDALKKIKADGRYDAIYKKWFGKLPG"
FT   gene            complement(115733..117175)
FT                   /locus_tag="Arad_12156"
FT   CDS_pept        complement(115733..117175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12156"
FT                   /product="Succinate-semialdehyde dehydrogenase (NAD(P)+)"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12156"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31204"
FT                   /db_xref="GOA:B9JPY5"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPY5"
FT                   /protein_id="ACM31204.1"
FT                   /translation="MTMYAEKLEMLIDGTWVQGSSGATAPLVNPADGAEIATVPHATKD
FT                   DLDCALDASARAFRVWKTTTAAYRWQILSRAADLIETRKGDIARTLTLENGKALAEAVG
FT                   EVQFCADATRWYAEEAKRAYGRIIPARAAGVRQMVFKEPVGPALGFAAWNFPAGNVTLK
FT                   MAAALAAGCSIIVKPSDETPGTAVAIGRCFQDAGVPAGALNIVFGPPAPISEHLIASPI
FT                   PKKVSLTGSTPVGKLLQRLASDTLKRCTMELGGHAPVIVFDDADIEKALDVLIAAKFRN
FT                   AGQVCTSPTRFYIQENVYERFVTGFVERSCKIVVGNGLDEATQMGPLITERRLDMMDTF
FT                   IRDAVEKGASVALGGERLDRRGYFYAPTVLKDVTDDARVMIEEPFGPLAQLTPFKSVDE
FT                   VIARANSLPFGLAAYLFTANGSTASAVSEALEAGVVGVNHTSVHEPETPFGGVNESGYG
FT                   AESGIEGLEAYLRTKMISEKRL"
FT   gene            117301..118680
FT                   /locus_tag="Arad_12157"
FT   CDS_pept        117301..118680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12157"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12157"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31205"
FT                   /db_xref="GOA:B9JPY6"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPY6"
FT                   /protein_id="ACM31205.1"
FT                   /translation="MTTKNEAVDVAVIGAGSVGIAVAYYLVRKYGIKDIAIIDPRDPMS
FT                   LTSAQSGENYRNWWPHPIMAAFTNDSIRLMEEIASASDNRINMTRRGYCLVTRRSDPSD
FT                   LIEDLYRGYGEDAEGLIRVHKGGGPHDSYRPPVSADWRQAPDGVDVLCEQNLIRSTFPA
FT                   YADDISAILHVRRAGSISGQQLGQFMLEYIKDQGGRLLRGEVVSIASASPFLLSVKTSD
FT                   GVASLRADRIVNAAGPFLKDVAALLGEELAVSCVYQQKIAFEDREGVVPRNLPFTIDLD
FT                   DQKLAWSEEERALLAEDHDTAKLTELMPGGIHCRPDGAENGKWIKLGWAFNDAPSDPHG
FT                   PEPINDQFPDIVLRGASRLQPGLAAYIGRLPRGAHHYGGYYTTTEENWPLIGPMHTPGA
FT                   FVAGALSGFGTMAACISGSICADWVMGKTSAPYARMLSAARYDDPAIMAELAALDNRGH
FT                   L"
FT   gene            118735..119931
FT                   /locus_tag="Arad_12158"
FT   CDS_pept        118735..119931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12158"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12158"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31206"
FT                   /db_xref="GOA:B9JPY7"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPY7"
FT                   /protein_id="ACM31206.1"
FT                   /translation="MEPEQTGKEIRLKTDIVIIGGGAIGAAVAYFLKRTDASISVTVIE
FT                   RDPTYNLASTPRASGGVRRLFSLPENIALSNYSIPFFDDFAETMAVDGVPADIGLKKNG
FT                   YLFIVPPSSRDMLKQNFEIETSMGCNVVWLEPDEIKHKFPSMNVSDLGSAVYSPDDGWL
FT                   DPHSVLMGFRKKARSLGADFIAEEVMGFERTATHVAKVKLKSGAEIKADHFVNAAGAWA
FT                   KDICTMLGFKVPIEPLRRFEHYFETEEPIEPLPYLKDPERLAFRPEGKGYSGGVPTLAE
FT                   PRGYNFEVDHDYFENVVWPALAHRFPQFEKTKCKNTLPGLYDQNDFDGNVIIGPGADGL
FT                   ANFHMLAGFSGHGLMHAPGCGLAMTELLLKGRYETIDLSRLGWQRLLDDKPLPERGII"
FT   gene            complement(119976..120629)
FT                   /locus_tag="Arad_12160"
FT   CDS_pept        complement(119976..120629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12160"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12160"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31207"
FT                   /db_xref="GOA:B9JPY8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPY8"
FT                   /protein_id="ACM31207.1"
FT                   /translation="MAVKGNEVRKSAPELVRDGLREAILTGAYEEGQQLRQDELAEQFG
FT                   TSRIPVREALRQLEGEGLVELHANKGAVVKGLSVEDVLEMLDIRIALECRALKLAIPNM
FT                   AVEDLEAAEQILADYEETSDPAAWGEMNWRFHWTLYCPCNREKLLAMIEANYGHVSRFT
FT                   RRQVSLATGKAKPQQDHAELLRLCREGEADAAVALLEKHIEQTQKSLRAAMRRR"
FT   gene            complement(120798..121697)
FT                   /locus_tag="Arad_12162"
FT   CDS_pept        complement(120798..121697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12162"
FT                   /product="LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12162"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31208"
FT                   /db_xref="GOA:B9JPY9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPY9"
FT                   /protein_id="ACM31208.1"
FT                   /translation="MMVDDLSRQRPLLDNDVLRTFVAIAETLSFSAAARSVSRTPSAVS
FT                   MQIKKLEEQLGSALFIRAARTIKLTRQGETLLTYARTMLMLSNEAVSRLVDPQLTGVVR
FT                   LGAPVDISARIFPKILKDLSDAYPGIVVDVVVDASDRLVQRIDEQRLDLTLTCIVGNPS
FT                   ALRGEVIGTEKLVWAGAGLGSAFRQDPLPIATHEDGCIWRAAALEQLERKGRPYRLAYL
FT                   SPRTTVQCAAVVSDLAVAPLPCSYVTDDMRVLGAEDGFEELGSFDIRLVSKSSATELVR
FT                   IVADGIRRLLKEATEGSA"
FT   gene            121910..122104
FT                   /locus_tag="Arad_12163"
FT   CDS_pept        121910..122104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12163"
FT                   /product="4-oxalocrotonate tautomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12163"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31209"
FT                   /db_xref="GOA:B9JPZ0"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPZ0"
FT                   /protein_id="ACM31209.1"
FT                   /translation="MPWIRVDLSTGRTVEQKQKAAEAITDALVKFCNCSPESVSIVFND
FT                   VTADNWAFAGKLLSQTAKP"
FT   gene            complement(122386..122847)
FT                   /locus_tag="Arad_12166"
FT   CDS_pept        complement(122386..122847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12166"
FT                   /product="Transposase, IS4"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12166"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31210"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPZ1"
FT                   /protein_id="ACM31210.1"
FT                   /translation="MKFKVTNWAEYEAGLRRRGNLTLWMIAEALSQWHAPKRTTRGGQP
FT                   RYSDPAIETTLTLGVVFGLQLRQTEALLASVLGLLEFDLAIPDHTTLSRRARMGRSSER
FT                   RQGRSISAEEGPVHVLIDSTGLEIYVAHAVSFLFLPVISRQARYSLQRG"
FT   gene            123222..123866
FT                   /locus_tag="Arad_12169"
FT   CDS_pept        123222..123866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12169"
FT                   /product="plasmid pRiA4b ORF-3-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12169"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31211"
FT                   /db_xref="InterPro:IPR012912"
FT                   /db_xref="InterPro:IPR024047"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPZ2"
FT                   /protein_id="ACM31211.1"
FT                   /translation="MILQFRIFLKDVSPMVWRRVHVPSTMTLREFHGVLQVVMGWESIH
FT                   LYEFVIHTVRYGSWETAANSPKIALDDLKLRKGSRFLYEYDLNIPWQHEIRLEERVSVN
FT                   AKTRYPNCSGGDGNCPQEDCGGPEGWMWRQDNAFGYEMVDDLATTVALFQEISETKSFA
FT                   VLEDPGRLEEFRETLERIEQCASWNGQPFERRKVNERLRQGDHLVLMHQQM"
FT   gene            124152..125579
FT                   /locus_tag="Arad_12171"
FT   CDS_pept        124152..125579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12171"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12171"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31212"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPZ3"
FT                   /protein_id="ACM31212.1"
FT                   /translation="MENASRKNDMRARLVLEIVGDNGETIATETVADLVKVTKGAEDLG
FT                   LSLSEAKTLLAKLQQKMVETQVDVWLRQYHEGDGRALRHKGYYPVTFHTLFGDVRLKSP
FT                   RYCLPRRDRSNGPVTVSPLRQLIPDHVAPERLYLETRWASLVPYAAAAELLADMLPIDC
FT                   GSNATTVRQHALRTASRIEQELTEERVSFMQNSCLRDWMDLPIPDGRIVIGLDGGYVRD
FT                   RDDRKRNFELIVGRSLPEDGDPRYIGFVHGYDRKPQRRILDHLKKQGVQANQDITFITD
FT                   GGEEVRSLAKMIAPASEHVLDWFHITMRITVLRQFAQGLENHDEQAGLNMLDALERIKW
FT                   YLWHGNGYRVRGEISDLYCDAVAIETAYPNIRKFLMAIGEFRSYIAANDASLINYGERY
FT                   RSGERISSALVEATVNAVISKRFAKKQQMQWSRTGAHLLLQTRTQTLDGSLRLTFKKWY
FT                   PGMANDNHEPGNNSAAA"
FT   gene            125858..127219
FT                   /locus_tag="Arad_12172"
FT   CDS_pept        125858..127219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12172"
FT                   /product="sorbitol-binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12172"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31213"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPZ4"
FT                   /protein_id="ACM31213.1"
FT                   /translation="MVGISGLGLSWEDLVRHYLAGALSAFISVAISSAALAETLTIATV
FT                   NNGDMVRMQKLTDDFKAKNPGIDLQWVTLEENVLRQKVTTDIATKGGQYDVLTIGTYEV
FT                   PIWSKLGWLAPLDKLSADKTYDVDDLLPAIRSGLTTDGKLYAAPFYGESSMVMYRKDLF
FT                   DKAGLKMPDAPTWTFIADAARKITDKSHEVYGICLRGKAGWGENMAFLTATANSFGARW
FT                   FDEKWKPQFDQPEWKSTLDFYVKLMKDAGPPGASSNGFNENLSLFQTGKCGMWIDATVA
FT                   ASFVSDPKESKVADKVGFALAPDNGLGKRGNWLWAWSLAIPASSKKTESAEKFIAWATG
FT                   KDYTNLVAQKEGWLNAPPGTRASLYANADYQKAAPFAKMTLDSINSADPTKPAVKPVPY
FT                   TGIQFVAIPEFQGIGTAVGQQFSAALAGQITVDAALKAAQQLTTREMTKAGYPK"
FT   gene            127350..128222
FT                   /locus_tag="Arad_12173"
FT   CDS_pept        127350..128222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12173"
FT                   /product="sorbitol/mannitol transport inner membrane
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12173"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31214"
FT                   /db_xref="GOA:B9JPZ5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPZ5"
FT                   /protein_id="ACM31214.1"
FT                   /translation="MATLHTRSAARVMMTPSVLLLFAWMIVPLVMTIYFSTLNYNLLSP
FT                   GAHDFIGLLNYEYFVTDPAFLNSLIVTLLLVGGALIITVVGGIALALLLDQPIFGQGIV
FT                   RMLVLAPFFVMPTVAALIWKHMFMNPVNGLLAHLFKFFGLDPLTWLETVPLFSIVIIVA
FT                   WQWLPFATLILLTALQSLDEEQKEAAEMDGAGAVSKFIYITLPHLARAITVVILIETIF
FT                   LLSAFAEILVTTNGGPGTATTNLTYLVYSQIVLSQDVGGASAGGIIAVILANIVAIFVM
FT                   RAVGKNLEA"
FT   gene            128224..129066
FT                   /locus_tag="Arad_12175"
FT   CDS_pept        128224..129066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12175"
FT                   /product="sorbitol/mannitol transport inner membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12175"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31215"
FT                   /db_xref="GOA:B9JAY9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JAY9"
FT                   /protein_id="ACM31215.1"
FT                   /translation="MARNVSTRRKVVVSLAAWAVALLIFFPILWTILTSFKTEGDAIAS
FT                   PPQFLFFHWTLENYFEVQSRSNYFLHFANSVIIAFGSTILGLIVAVPAAWAMAFSPTKR
FT                   TKDILMWMLSTKMMPPVGAFIPIYLLFQGFGLLNNQFASRLGMVVVLMLINLPIIVWML
FT                   YTYFKEIPGEILEAARMDGASLAKEIIYVLTPMAIPGLASTMLLNIILAWNEAFWTLNL
FT                   SSVDAAPLSTFIASYSSPEGLFYAKLSAASTMAIAPILILGWFSQKQLVRGLTFGAVK"
FT   gene            129078..130079
FT                   /locus_tag="Arad_12178"
FT   CDS_pept        129078..130079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12178"
FT                   /product="ABC transporter, nucleotide binding/ATPase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12178"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31216"
FT                   /db_xref="GOA:B9JPZ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPZ7"
FT                   /protein_id="ACM31216.1"
FT                   /translation="MGSIVLKKVSKVFGEAKVIPSIDLEINEGEFVVFVGPSGCGKSTL
FT                   LRLIAGLEDVSGGQILIDGKDGTNLAPAQRGLAMVFQSYALYPHMSVRKNIAFPLKMAN
FT                   MPQAEIDKKVADAARVLNLTDYLERKPRQLSGGQRQRVAIGRAIVRQPKAFLFDEPLSN
FT                   LDAALRVNMRLEISDLHHQLKTTMVYVTHDQVEAMTMADKIVVLNRGNIEQVGSPLELY
FT                   KSPRNLFVAGFIGSPKMNFVKGAYAQNLGADTIGVRPEHVLLSTESGDWKGRVNHAEHL
FT                   GSDTFLHIEADGIGAITARGTGDFPARAGDTVYLTPDKSRIHKFNEKGMATQ"
FT   gene            130076..130849
FT                   /locus_tag="Arad_12179"
FT   CDS_pept        130076..130849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12179"
FT                   /product="sorbitol dehydrogenase (l-iditol 2-dehydrogenase)
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12179"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31217"
FT                   /db_xref="GOA:B9JPZ8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPZ8"
FT                   /protein_id="ACM31217.1"
FT                   /translation="MKRLEGKSALITGSARGIGRAFAEAYLREGATVAIADIDVDRAKK
FT                   TAEELGPKAYFVQMDVTDQASIDAAIATVDEKTGGIDILINNAALFDLAPIVQITQKSF
FT                   DTLFAINVSGTLFTLQAAAKSMIARGKGGKIINMASQAGRRGEALVAVYCATKAAVISL
FT                   TQSAGLDLIKHGINVNAIAPGVVDGEHWDGVDLKFANYENRPLGEKKRLVGKAVPFGRM
FT                   GTAEDLTGMAIFLASKEANYIVAQTYNVDGGNWMS"
FT   gene            130907..131845
FT                   /locus_tag="Arad_12180"
FT   CDS_pept        130907..131845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12180"
FT                   /product="transcriptional regulator (AraC/XylS family)"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12180"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31218"
FT                   /db_xref="GOA:B9JPZ9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPZ9"
FT                   /protein_id="ACM31218.1"
FT                   /translation="MSSPIRSVQPRAPRKVAPQLAPKFEQILTTEHDTFLWRIDDYPWV
FT                   RSLWNFHPEFEIHLIRKSSGTAYVGDYIGDFGPGDLTVIGSNLPHDWVSHIGKDDKIPG
FT                   RDLVVQFDPDKLRQASQHLPEIKRLNSLLTTAQRGLRFSGATAQRAAHLLETIGKFDGL
FT                   ERLIRFLRVLELLADSKECDVLSSPEFAPNVDAITLNTMQRAILHINSHFTEKIQLPDV
FT                   AAVANMSTNRFSRFFIKNTGRSFTDYVVSLRIGRACRLLSESDKPVIDICYEVGYTNLS
FT                   NFNRSFLRHVGKSPSAYRRAAHGKRVSTDSQ"
FT   gene            complement(131860..133740)
FT                   /locus_tag="Arad_12181"
FT   CDS_pept        complement(131860..133740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12181"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12181"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31219"
FT                   /db_xref="GOA:B9JQ00"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ00"
FT                   /protein_id="ACM31219.1"
FT                   /translation="MKLKRLKQPSIRTSLIAIFSALAIIVVTFAYTSVNGLTDLHEGSV
FT                   EITRSSLPSILAAKDIKSDMQAIQAAYFTYITASKPDIMQAAEESVKKLQGVAKDEVLR
FT                   AQQLGPNAREIELLAIIDKSLTEFSQKGEGVFTLAKMSQYDEATGVLTSMMEASEPAFA
FT                   AMDELVAIATQNAEAAVVSADNTYGKTRFTAFAVIGLVLSLVLGSSIYALISIAKPIKA
FT                   ITASMTKLAVGDTESVIPYADRTDEIGQMAGAVEVFRQAAIANRRLELEAERNREIAEV
FT                   DRKRLTQEADAAADKRLRDATSALADGLTRLAAGDLNFQLLEPMSPDFEALRRDLNSAV
FT                   LQLRDTLTSVSIAAGAMNDGSREISVSTDNLSRRTEQQAASLEQTAAALDEITVNVANS
FT                   SKRAEEARSIVSEATASATRSAKIVADAVEAMRRIESSSSQIVSIIGVIDEIAFQTNLL
FT                   ALNAGVEAARAGEAGKGFAVVAQEVRELAQRSAKAAKEIKDLIRKSGQEVENGVLLVRA
FT                   TGDALNAIEGHVTEINHRVLSIATSASEQAMGLGEVNAAVNQMDQVTQQNAGMVEETSA
FT                   ASAILASEATHLHQLVSQFNLGDAETADDQRSGRPVAVMQGIKSKGRLVA"
FT   gene            complement(134270..134965)
FT                   /locus_tag="Arad_12185"
FT   CDS_pept        complement(134270..134965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12185"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12185"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31220"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ01"
FT                   /protein_id="ACM31220.1"
FT                   /translation="MSNKPAIILVHGFWGGAAHWGKVVLELARKGHQSIHAVELPLTSL
FT                   AEDAERTRKMVAQQKGPVLLVGHSYGGAVITEIGDQPNVAGLVYIAAFAPDAGESPGGI
FT                   TQQHPPAAMANIEPDSDGYLWLKADRLHESFCQDMTPEEGFVMAATQKAPLASTFGDAV
FT                   TAPAWKKKPSWYQISSEDRMIAPENQVAMSARLNARKVITLKASHASLISKFVEVAGLI
FT                   DEAATELAQ"
FT   gene            complement(135029..135973)
FT                   /locus_tag="Arad_12186"
FT   CDS_pept        complement(135029..135973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12186"
FT                   /product="amidohydrolase/nitrilase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12186"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31221"
FT                   /db_xref="GOA:B9JQ02"
FT                   /db_xref="InterPro:IPR000132"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ02"
FT                   /protein_id="ACM31221.1"
FT                   /translation="MQAAPEFLDIEKGVDKAIGLIEQAASQGASLIAFPEVWLPGYPWW
FT                   IWLDSPAWGMQFVGKYFANAMEIGDVHYERLRAAAARNSIHVVMGFTERAGGSLYLAQA
FT                   LFSDSGEVIANRRKLKPTHAERTVFGEGDGSHIAVHSTKLGRLGALCCAEHIQPLSKYA
FT                   MYSQNEQIHVASWPSFSVYRGAAFQLSAEANLAASQVYALEGQCYVLAPCALVSKPMIE
FT                   MLVDTPAKQNLLLEGGGFTMIFGPDGSPLADAIPETEEGIMYADIDLGFIGVAKAAYDP
FT                   TGHYSRPDVLRLLFNKREQPRVQSFDPDLNEIE"
FT   gene            136179..137087
FT                   /locus_tag="Arad_12187"
FT   CDS_pept        136179..137087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12187"
FT                   /product="AraC-type DNA-binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12187"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31222"
FT                   /db_xref="GOA:B9JQ03"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ03"
FT                   /protein_id="ACM31222.1"
FT                   /translation="MSARSDTLSLWKEQLWSTYVRLESKAETDGFYGAVQEFLPHSHSL
FT                   SLVDSTAQLTERTRRHIRADQQEVVLVAFQLSGCGLVVQDERQARTAPGEFVLYESMRP
FT                   YSLGFDGPFKQLVLRVDRERMISTMPCIGNMTARTFDAKQGAGAVALDFLQSLAARGSQ
FT                   IDEGSLSPMERTAFDLVATGVLSSTGDLSPRRVLFERLRDRLIEKVRDPSFNQTDMAVL
FT                   AGMSPRSLRRLCAENGISPGGLILRTRLQGATDSFALDINKRRSVTEIALSWGFNDISY
FT                   FNRAFRTTYGMTPRQMRHSHQ"
FT   gene            complement(137161..137889)
FT                   /gene="proC"
FT                   /locus_tag="Arad_12188"
FT   CDS_pept        complement(137161..137889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="Arad_12188"
FT                   /product="pyrroline-5-carboxylate reductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12188"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31223"
FT                   /db_xref="GOA:B9JQ04"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ04"
FT                   /protein_id="ACM31223.1"
FT                   /translation="MATIVEPNAALRARAAETDARTYASADDLPVAFQADVAVIATKPQ
FT                   VVGDVVERYSALLADGGFFISVAAGIGIRKMALRAKRPAAIIRCMPNTPAAIAEGMIVC
FT                   CPSAETTFVQRALAEELLSSIGRVAFVDDEALMDTVTAVSGSGPAYVFHFIEALCQAGI
FT                   QAGLDEELALLLAKQTVFGSAKLAIEATEPPATLREQVTSPNGTTAAALDVLMEDGKGL
FT                   RHLIEAAVQAARRRSVELGS"
FT   gene            137950..138255
FT                   /locus_tag="Arad_12190"
FT   CDS_pept        137950..138255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12190"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12190"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31224"
FT                   /db_xref="GOA:B9JQ05"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ05"
FT                   /protein_id="ACM31224.1"
FT                   /translation="MEPEQTGKEIRLKTDIVIIGGGAIGAAVAYFLKRTDASISVTVIE
FT                   RDPTYNLASTPRASGGVRRLFSLPENIALSNYSIPFFDDFAETMAVDGVPAQTAKP"
FT   gene            complement(139226..140683)
FT                   /locus_tag="Arad_12193"
FT   CDS_pept        complement(139226..140683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12193"
FT                   /product="Cytochrome c, mono-and diheme variant"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12193"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31225"
FT                   /db_xref="GOA:B9JQ06"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014353"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ06"
FT                   /protein_id="ACM31225.1"
FT                   /translation="MRKIFKQNSPAKRGAVILLALSAAILVVGKAGAQISDPQALVEKG
FT                   RGIATAADCMACHTVPHSNRPFAGGYPIVSPLGTIYSTNITPSKTAGIGNYTEDDFDRA
FT                   VRKGIRKDGGHLYPAMPYTAYAEITDADMHALYAYFMNGVEPVDDKAANQTDLPFPFNI
FT                   RFSMMFWNLLYSTKVPFQPDPSKTEEINRGAYLAGALGHCSSCHSPRGLLMGESAGSYL
FT                   AGGAVGPWYAPNITSDPVSGIGGWSTDELVQYFRDGHADGKNQAAGGMAEAVQNSLQYL
FT                   PDADLHALASYLKSVPAIRDPGDTRAAHEYGAAVSSESSIRGAYSQTEHNSLRNGAQLY
FT                   SGYCASCHRIDGAGSENHAYPSLFHNSATGASQPANLVATILYGVDRETAGKQVLMPGF
FT                   GAQSYVTPLTDQQIVDVSNYVLMNFGNPATKVTLADVAIARTGGPVPFLARVQPYILTV
FT                   ILSLVAIVLLVAAFWVLRKRRAVSVAA"
FT   gene            complement(140687..142333)
FT                   /locus_tag="Arad_12195"
FT   CDS_pept        complement(140687..142333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12195"
FT                   /product="Choline dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12195"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31226"
FT                   /db_xref="GOA:B9JQ07"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ07"
FT                   /protein_id="ACM31226.1"
FT                   /translation="MKSPVFTNGDAKADVAIVGSGVVGALIAEQLAGEGYAVLLLDAGL
FT                   RIERGQAVENWRNMPFKNRAGSDFQGLYPQSKMAPAPLYWPENNYVELSGPDGKGFKQG
FT                   YLKTVGGTTWHWAASSWRHLPVDLKMRTAYGVGRDWPISYDELEPYYCRAEEAMGVAGP
FT                   NDPMLQSPSERSKPYPMDMVPWSYGDKRFAEIVNAHGYRSVPIPQARSTRPWNGRPTCC
FT                   GNNNCQPICPIGAMYNAIHSVQAAEAKGASVLAEAVVYKIDTDENNRVTAVHWYDGQHQ
FT                   SHKVTADTFVIACNALESPRLLLAAANDRNPAGIANSSDQVGRNMMDHSGFHCFFQAPE
FT                   PLWIGRGPAQSSCIVGPRDGAFRSEYSANKMILNNITQVTTATSVALKKGLVGPALDAE
FT                   IRRLTTHGVDLSISLEPLPDPKNRVTLSKSRLDPHGIPCPDVYYDVGDYVHKGYDAAVK
FT                   QLEDIGKLFNASDFHVTTALNANNHIMGGCIMGSDPKDSVVDGNCRAHDHANLWIPGGG
FT                   AIPSASVVNSTLTMAALGIKAADDISKSLRA"
FT   gene            complement(142336..142923)
FT                   /locus_tag="Arad_12196"
FT   CDS_pept        complement(142336..142923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12196"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12196"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31227"
FT                   /db_xref="InterPro:IPR024651"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ08"
FT                   /protein_id="ACM31227.1"
FT                   /translation="MTMTVKSQDGPLLAGRGNSIKISTVPPITRRALLAGAAFSFAGFA
FT                   WQPASAQSAAPTRGLSGFLDVSHAITGKSDLSPMTADRIYAALQADDAGFEGRLAQIVP
FT                   LVRQTGSPDALKAAASAIGLGDTLTAIITAWYTGTVETAKGPVVVSYAEALMYRPVADG
FT                   LTVPTYCNKGPLWWTGLPPEITTMPNNYPKVL"
FT   gene            143182..144213
FT                   /locus_tag="Arad_12197"
FT   CDS_pept        143182..144213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12197"
FT                   /product="LacI-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12197"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31228"
FT                   /db_xref="GOA:B9JQ09"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ09"
FT                   /protein_id="ACM31228.1"
FT                   /translation="MASDDKRKQRVTLIDVAREAGVSRATASLVIRNSPLAAVKTRERV
FT                   EAAIARLGYVRNLTAARLRASQTRMVGLIVPNLTNPFFAELLSGVEEIIDAAGLIVILA
FT                   NSHDSACRQSALMHRMREHGVDGIILCPASDTTGDFLDDQREWQLSVVQVLRHITRSVD
FT                   YVGVDYAGGMNSAVDYLVSLGHQRIAFAIQGGLHSAFEERSVAFDRAMSRNNLNAGLIV
FT                   RVPETLAEIAQTAVPLLFAGMTLPTATICFNDIVAMGLSSGLYDHNIRVGHDHSIIGFD
FT                   HVRNGEAMRPRLTSVSTYSDVVGRRAAQRLMARLENPDGEVEWDVIRTDLYVGDSCGPA
FT                   LNS"
FT   gene            complement(144538..146352)
FT                   /locus_tag="Arad_12198"
FT   CDS_pept        complement(144538..146352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12198"
FT                   /product="Feruloyl esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12198"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31229"
FT                   /db_xref="InterPro:IPR011118"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ10"
FT                   /protein_id="ACM31229.1"
FT                   /translation="MRKLKAVVVLAFLALSMLPMVANIRPAHAAGSLRCDDTLKSKFKA
FT                   DDTRVLLVKYFSREEKVGLSGSPEPSPEAPVDMCLVKLLVGPGKAGTAGLKSTSDGIGI
FT                   EVWLPSPDAWNRIIRVTGSGGFAGGYQSKTDRIGNAGRADPITLAAVAKGYVVSSSDHG
FT                   HLGQTTSDGSFALDEDGGINTVLWHDFAERSLHELAVKTKDLAAAYYGKPQLYAYWDGF
FT                   STGGRQGLKLAQKYPDDFDGILAGAPAINWTRFITAELYPQLVMQKMFAGPIDIAKLNA
FT                   TSAAATAQCGGKELGFLLDPTQCRYDPSHDINVLCSSEILNETPGKGDPATCITLTQAE
FT                   AVNRIWFGQSSDGSYIDPKMDNGMSAMLSGNHLWWGLTRGTSLARLAGEKPFPIASTMV
FT                   ALELQDARYAQAGLLPDTPSGKGMDRWKMLDYGSLADAYALGLLLQGPFSNINTDDPDL
FT                   RAFRNSKAKLITYHGWNDDLIMPQGSLNYFNRASASMGGTTRLKEFYRLFMIPGLAHDG
FT                   TFARAGSVDPVTGQPTDVAKVPLPQPATGRDELFIALRRWVEEGKAPSRIDVRSANGNV
FT                   TMPLCDYPREPVWNHTGSIGSRESYSCE"
FT   gene            complement(146536..147354)
FT                   /gene="pcaD"
FT                   /locus_tag="Arad_12199"
FT   CDS_pept        complement(146536..147354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaD"
FT                   /locus_tag="Arad_12199"
FT                   /product="3-oxoadipate enol-lactonase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12199"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31230"
FT                   /db_xref="GOA:B9JQ11"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR026968"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ11"
FT                   /protein_id="ACM31230.1"
FT                   /translation="MPFITVNSVQLHYRLSGRRNGPRIAFANSLGSDLRIWGEVEQRLG
FT                   QDFEMLFFDQRGHGLSEVTDQPYTISQLAADLLGLLDIIGWTQVSLCGVSVGGMIAMEA
FT                   AAQCPDYVARLVLLDTATKIGTAAGWSDRISAIETSGIPIVSEQILTRWFPLGYRMREP
FT                   RAWEAWRRMLESTADRGYINTCLALRDADLTAAAGRLAVPTLVMAGSNDQSTPPELVAA
FT                   TAGQIAGSRFENIPGAGHLPCIDAPDVLTGAIEAFCQIRESIRSPAIAHS"
FT   gene            complement(147356..148069)
FT                   /locus_tag="Arad_12201"
FT   CDS_pept        complement(147356..148069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12201"
FT                   /product="ABC-transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12201"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31231"
FT                   /db_xref="GOA:B9JQ12"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ12"
FT                   /protein_id="ACM31231.1"
FT                   /translation="MSLLLNVQGLQSFYGVSQILHGIDLQVRPGEQIALLGRNGMGKTT
FT                   FLRSLMGMMPRTLGDIDLHGISVRGELPETIARAGVALVPEGRGVFGSLTVIENLIMAA
FT                   RPGRSGKQGWTLDRVLSVFPRLAQRRNNGGQQLSGGEQQMLTIGRALMTNPDLILIDEA
FT                   TEGLAPLIAQEIWKTLDIIRSEGIATIVVDKDIRSLSRVADRVVIMSKGRLVFEGSPGE
FT                   LAASGDLLERHLGVQ"
FT   gene            complement(148066..148824)
FT                   /locus_tag="Arad_12202"
FT   CDS_pept        complement(148066..148824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12202"
FT                   /product="ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12202"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31232"
FT                   /db_xref="GOA:B9JQ13"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ13"
FT                   /protein_id="ACM31232.1"
FT                   /translation="MTKELLVVEGLTKRFGGLVAVADVSLSVREGEIHAIIGPNGAGKS
FT                   SLINLLAGDLAPTSGSIELDGKDMASYTPHARCRAGLGRSYQKTTIFQDRTVFENVKLA
FT                   AQGARPGVLSMWRLRSREEENEREALNALTDTGLLDRAETKARMMSHGEQRQLEVAMVL
FT                   ATGPRVVLLDEPLAGMGHGEAKRMSEVIRSLKKGRGVLLVEHDMDIVFAIADRLTVMAD
FT                   GHIIATGSVEDVRRDPKVRGAYLGEMEEVA"
FT   gene            complement(148821..149822)
FT                   /locus_tag="Arad_12203"
FT   CDS_pept        complement(148821..149822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12203"
FT                   /product="ABC-transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12203"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31233"
FT                   /db_xref="GOA:B9JQ14"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ14"
FT                   /protein_id="ACM31233.1"
FT                   /translation="MTPLFSRAQIPMLAMFGAAVLLPWLVSGYYVQFAAKVLMLGTLAM
FT                   ALNLSVGFGGMVSLCHAAFFGLAGYTLILVTPEYEVPSLLLTLAAAIAVVAVSALVIGL
FT                   LSLRTRGIYFIMVTLAFGEMLFFLFHDTGIGGGSDGIFLYVKPVLAAGSIVLLDLENPI
FT                   VFYLVALSTCVACWCLITHLLATPFGDALTAARDNERRALSLGIPVFRVRLVAFVVSAV
FT                   MAGIAGYLSAAQFGFVAPQMLGWHLSATALVMVVLGGTRRVAGPLFGAILLVGLEDLLK
FT                   IYVEEWKLYYGLIIIMLVLFVPGGLQDLLRLSGTEAFFRRKLPQPVAVGGKL"
FT   gene            complement(149826..150698)
FT                   /locus_tag="Arad_12204"
FT   CDS_pept        complement(149826..150698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12204"
FT                   /product="ABC-transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12204"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31234"
FT                   /db_xref="GOA:B9JQ15"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ15"
FT                   /protein_id="ACM31234.1"
FT                   /translation="MDIGTFAIQLLNAVQYGLVLFLVASGLTLVFGILGVINLAHGAFY
FT                   MLGAYLAWWFTMASGSLVVGILGASAVSFVVGLLLEAFFIRRLYGRDHLSQVLLSFGLI
FT                   LVIDEVRQMLFGRDVQSVPVPDWLSGSINLTDMQSYPLYRLALIVFCLILAMSIFLVIN
FT                   KTRIGMIVRAGAENRDMTRALGIPFDRVNRLVFAVGIALAALAGAVIAPVSTVFPGMGD
FT                   SMLILSFVVVVLGGVGSVPGAAIGALMIGLIDTFGKVFLPEFSGMLIYVLMAAVLLWRP
FT                   TGILGKREI"
FT   gene            complement(150749..151960)
FT                   /locus_tag="Arad_12205"
FT   CDS_pept        complement(150749..151960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12205"
FT                   /product="ABC transporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12205"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31235"
FT                   /db_xref="GOA:B9JQ16"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ16"
FT                   /protein_id="ACM31235.1"
FT                   /translation="MSNNKGIFETTVTRRSFLGTTTIGAAGLAFGLASPAIAQGAPLKV
FT                   GIMLPFSGTYAKLGQFIENGFHLYVEQKSGLLGGRRVEFVRLDDESKPETATDNMNRLV
FT                   GRDKVDFVVGTVHSGVAMAMVKVARDTGCPLIIPNAGADEATGPLCAPNIFRTSFSNWQ
FT                   AAHPMGKVMRDEGFGKVATITWRYGAGQQMTKAFKEGFEAAGGTVVEELTVPFPEVEFQ
FT                   ALITRIAELKPDAVFAFFAGGGAVKFVVDYAAAGLKGKIPLYGTGFLTDGTLKAQGASA
FT                   EGIRTTLHYADDLDNPANKSFLEGFKAKTGDTGDIYAVQGFDAAALLDVGLAATGGDSQ
FT                   ARDALFAAMQAAKLDSPRGPLSFSAAHNPIQNIYLREVREGRNMLVSIAGDAVNDPARG
FT                   CRMS"
FT   gene            complement(152038..152820)
FT                   /locus_tag="Arad_12206"
FT   CDS_pept        complement(152038..152820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12206"
FT                   /product="short-chain alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12206"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31236"
FT                   /db_xref="GOA:B9JQ17"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ17"
FT                   /protein_id="ACM31236.1"
FT                   /translation="MKLDRFTNKAMVITGSAQGIGREVAIRAAAEGARLALIDRSDVVR
FT                   EVAAEIEAAGGKATAILADLEAWEGAVEAIRQARAHIGGPDILVNNVGGAIWMRPFEHF
FT                   DERQIEAEIRRSLFPTLWCCRAVLPLMIEAGGGVIVNVSSIATRGINRVPYSAAKGAVN
FT                   ALTVALAMENAERGIRVNAVAPGGTEAPQRRIPRNSEDQSEDDRRWMSEVVSQTKQSSF
FT                   MKRYGTLEEQAGAILFMASNEASYLTGTILPVGGGDSG"
FT   gene            complement(152820..153833)
FT                   /locus_tag="Arad_12207"
FT   CDS_pept        complement(152820..153833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12207"
FT                   /product="toluate 1,2-dioxygenase electron transfer
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12207"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31237"
FT                   /db_xref="GOA:B9JQ18"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ18"
FT                   /protein_id="ACM31237.1"
FT                   /translation="MPKIALNFEDGVTRFVECGPNEVLVDAAYRARLNIPMDCRDGVCG
FT                   TCKCRVESGFYEMDAYIEDALTDEEASQGYVLTCQMRPKSDCVLSIPATSKMCKSGPME
FT                   FGASLAEVRQLSDTTIGFTLEIDQPDNLAFLPGQYVQVSVPQTEDSRAYSFSSRLNGGR
FT                   VDFLVRNIPGGLMSGYLSGRAMPGDRLTIRGPSGAFYLRELSRPTLFLAGGTGLAPFLS
FT                   MLDYLSARGGSTPPIRLLYGVTRDADGVEVCKLEAFADAISNFTFEVCVSDPDSNAPRK
FT                   GFVTDHFGADDLNGGDSDVYLCGPPPMVEAVRRHFDLIGVKPASFYFEKFNAAEAA"
FT   gene            complement(153853..154344)
FT                   /locus_tag="Arad_12208"
FT   CDS_pept        complement(153853..154344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12208"
FT                   /product="benzoate dioxygenase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12208"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31238"
FT                   /db_xref="GOA:B9JQ19"
FT                   /db_xref="InterPro:IPR000391"
FT                   /db_xref="InterPro:IPR017641"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ19"
FT                   /protein_id="ACM31238.1"
FT                   /translation="MTISRQQVEEFLYRETRYLDERDWDNWLALYAPHVEFWMPAWDDD
FT                   DRLTEDPQSEISLMYYATKQGLEDRIFRIRTDRSSATSLPEPRTLHHISNVEILEQTAE
FT                   KAEVRFNWMTQNFRYKTTDTHYGTSFYTLEINEGGMRIARKKIVLVNDYIHHVIDVYHV
FT                   "
FT   gene            complement(154431..155801)
FT                   /locus_tag="Arad_12209"
FT   CDS_pept        complement(154431..155801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12209"
FT                   /product="Phenylpropionate dioxygenase, large terminal
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12209"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31239"
FT                   /db_xref="GOA:B9JQ20"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017639"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ20"
FT                   /protein_id="ACM31239.1"
FT                   /translation="MLDIPTDRRIEEKLEGSVIEDAETGSYRCRRDIFTDSELFELEME
FT                   HIWEGNWIYLAHESQIPNPNDYITGYIGRQPIVISRDKAGNLNCFLNACSHRGAMICRH
FT                   KRGNKSTYTCPFHGWSFSNTGKLLKAKDANGAGYPEQFNTNGSHDLTKVARFESYRGFL
FT                   FGSLNPDVLSLEEHLGEARKIIDMIVDQSPDGLEVLRGSSSYVYDGNWKLQTENGADGY
FT                   HVSSVHWNYAATTQHRKEAVAAAAGEDVTRAMDAGSWAKQGGGFYSFEHGHLLLWTRWG
FT                   NPEDRPLAEKRGELTEQFGQAWADWMIDRSRNLCLYPNVYLMDQFSSQIRVYRPIAVDK
FT                   TEVTIYCIAPKGESVAARARRIRQYEDFFNASGMATPDDLEEFRSCQIGYQARQAAWND
FT                   LSRGATHWIEGADEGAEAIGLKPLLSGAKTEDEGLFVIQHSYWKKALGAAIGRDPTR"
FT   gene            complement(155862..156791)
FT                   /gene="catA"
FT                   /locus_tag="Arad_12211"
FT   CDS_pept        complement(155862..156791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="catA"
FT                   /locus_tag="Arad_12211"
FT                   /product="catechol 1,2-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12211"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31240"
FT                   /db_xref="GOA:B9JQ21"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR007535"
FT                   /db_xref="InterPro:IPR012801"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ21"
FT                   /protein_id="ACM31240.1"
FT                   /translation="MASGIIEKSVIQDLARRASGLDTDGGDRRIKEIMNRVLGDLFQAI
FT                   DDLDISMNEVWSAVAYLGAAGRNNELGLIAPGIGLEHFLDLRLDEEERRAGLAGGTSRT
FT                   IEGPLYIAGAPECQGFARLDDGSDQGEVLFMQGQVRDQNGKPVGGAVVDVWHANTLGNY
FT                   SHFDPQQAPYNLRRRIVTDTEGRYRFRTIMPSGYSTPPGGSTEELLFAVGRHGHRPAHI
FT                   HFFVEAPAHRHLTTQINIEGDPYLFEDFAFGTRNDLIPPVIRINDPKLMAENQVQQPYA
FT                   FIEFDFVLMPAVEGVADTIVERERAKAA"
FT   gene            complement(156888..157178)
FT                   /locus_tag="Arad_12212"
FT   CDS_pept        complement(156888..157178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12212"
FT                   /product="Muconolactone delta-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12212"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31241"
FT                   /db_xref="GOA:B9JQ22"
FT                   /db_xref="InterPro:IPR003464"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR026029"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ22"
FT                   /protein_id="ACM31241.1"
FT                   /translation="MLFYVEMTVELPYELPHQLAVDLKATEKERAHELQRSGKWRHLWR
FT                   VAGQYANISIFDVSGPGELHEILSTLPLFPFMRIKVAPLCRHPSALREDDS"
FT   gene            complement(157183..158334)
FT                   /locus_tag="Arad_12213"
FT   CDS_pept        complement(157183..158334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12213"
FT                   /product="Mandelate racemase/muconate lactonizing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12213"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31242"
FT                   /db_xref="GOA:B9JQ23"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR013370"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ23"
FT                   /protein_id="ACM31242.1"
FT                   /translation="MSGIIRITAIETIILDLPTIRPHKLSMVTMSQQSMTIVRIRCSDD
FT                   FEGTGEGTTIGGLAYGPESPEGMKLTIDQYVAPLLIGRDATRVQAAMDIVSKAIKGNHF
FT                   AKCAVETALLDCHARRLGLPLSELLGGRRRDSLPIAWTLASGDTARDVDEAQQMLDLRR
FT                   HKDFKLKIGSKPIAEDVRHVADIRKALPDTASIRVDVNMAWREREAKGAIDALADAGCV
FT                   LVEQPVAGIAPLARLTRASSIAIMADEALVGPESALEAATARAADVFSIKIEQAGGLFA
FT                   AAKVIAIAETAGISIYGGTMLEGPVGTIAASQLLVGVTDLPWGTEFFGPLLLTEELLIE
FT                   PLVFRDFELQIPTGPGLGITLDESAVDRFRRGAKPAGGLRIAG"
FT   gene            158432..159364
FT                   /locus_tag="Arad_12214"
FT   CDS_pept        158432..159364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12214"
FT                   /product="regulatory protein, LysR:LysR, substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12214"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31243"
FT                   /db_xref="GOA:B9JQ24"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ24"
FT                   /protein_id="ACM31243.1"
FT                   /translation="MELRQLRYFVAVARERNFSRAAEILHIAQPPLSRQIQQLEEELGV
FT                   DLLDRSKRPLSLTEAGRFLYEQAAKTLVNLEHIREQTRRIGRSQRERFIIGCVGSTLYG
FT                   GIPDLVRRMRIQWPELDIEIREMMSTEQVTALKEGRIDVGFGRVRFNDREVERLTLREE
FT                   RLVVAFPKGHVKSFEKEPIALAELQGEPLIVYPSVPRPSFADEILNLLGELSVTPGSVE
FT                   EVREIQAALGMVAAGVGLCIIPAASQRQRPDDVCYRMIGDEKATSPIIMSFRRSDADGK
FT                   INQIKQLIREMYADNPPWLQLSNVRLGEG"
FT   gene            159533..161053
FT                   /locus_tag="Arad_12216"
FT   CDS_pept        159533..161053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12216"
FT                   /product="aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12216"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31244"
FT                   /db_xref="GOA:B9JQ25"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ25"
FT                   /protein_id="ACM31244.1"
FT                   /translation="MNLLRTSENSQPTTAQTGAQPRTPVLLFINGTWRPAASTHTFADI
FT                   NPTTRLSYATVADGNVSDIESAIAAAKAAQPAWEALPPAARSGFFYKAAEIFQSSQEKF
FT                   VNALVEETGSGLGKAMFECSLIPLALREAAALTTRATGEILPSNIPGKVNTISRTAAGV
FT                   VGVISPWNFPLYLSLRGFVYALALGNTAVLKPSEDSPISGGTILAELFEAAGLPSGVFN
FT                   VVTCSRDKVKAVAAAMINDPRVARISFTGSTAVGREVATTSAAQFKRVVLELGGKNPVV
FT                   VLDDADVDYAVNVAFFSAFLHQGQICMSADKIIVARNLYDSFVEKLIAKVSMFEPLEPS
FT                   NPMAVIAPIINDRQLDRIDRLVKSARDAGATIHLGGEKLGPFYRPTVMTGVTRDMDIYR
FT                   EEIFGPVAFVMPADSEEEAIALANDTVYGLSSSIITGNATRGQILATQIEAGMVHVNDT
FT                   CVHDEPHCPFGGMKASGWVGKWGASGAIEAFTEQRWISVQTVPRAFPF"
FT   gene            161050..162837
FT                   /locus_tag="Arad_12217"
FT   CDS_pept        161050..162837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12217"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12217"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31245"
FT                   /db_xref="GOA:B9JQ26"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ26"
FT                   /protein_id="ACM31245.1"
FT                   /translation="MRTAARARLPHYPASRIEQMTPPVFSRFARGDRLNTLEAALYHGK
FT                   VGRRQFMQLAMAAGASLTAARTMAQDGGDAAITQLYNAHNLKKAYDYIVVGSGSGGAVV
FT                   AGRLATETDAEVLLLEAGSTDQLNAVLNPGLWPTNIRSERDWGYTADPADSVNGRALIL
FT                   PMGKVVGGGSSVNAMVWARGHRNDFDFWASETGDDSWSYASVLEIYKRIEDWQGKPDTK
FT                   RRGDGGRLWIEPARDPNPIAPAFLSAAESVGIPTFEDMNGEMMEGAGGAAIANLRIRDG
FT                   RRINLAHDYLYAALKRPNLTLLTGAEVLSLTVIGSRVTGLTFSRNGVTHAVEAKTRMLL
FT                   SAGAINTPKLLMLSGIGDDTELSKHGIKTAVKLPGVGRNFQDHVLVAGCLWEYKVPLPS
FT                   ANNVAEATLFWKSDGSLDTPDLQPFQIEVPFASEVTSPQYNPPAGSWTIAPGLVRPKSR
FT                   GRVYLSSADPRAMARIDARFMSDPADLKAILRGIELCREIGNSEAMKPFVKREIMPGAL
FT                   DKTAMANFARDAAGTYFHESCTCKMGRDELSVVDGRLSVRGVEGLSIADASVMPRVSTG
FT                   NTMASTVIIGERMADILLG"
FT   gene            complement(162886..163785)
FT                   /locus_tag="Arad_12218"
FT   CDS_pept        complement(162886..163785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12218"
FT                   /product="Helix-turn-helix, AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12218"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31246"
FT                   /db_xref="GOA:B9JQ27"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ27"
FT                   /protein_id="ACM31246.1"
FT                   /translation="MVNVTEKLIEYRMVRHSAASEASSYLTNHIAEVSLCFPNPIVCQM
FT                   MRGHKIMRVNGSKPFDFLPGEAMLVAPGMPLEILFPEASPEDPTECICIEIDRSQVDEI
FT                   VERVNQGQKRLGLDGRFSLDWTRFAVFRKDLAILGQMNRLMTLYRDEKSPFRDVLVDLG
FT                   HEELVLRILQAQSRELLVEQRTFSPTTGLDVAAEMLRDNPRERYAIEDLAQIACMSEAT
FT                   FFRRFKARFGVTPAKFANDCRIHRARALLATTPVTEVAFDLGFASVEHFSRLFRRVTGE
FT                   TPGGIRKRLRPDVRAYIQ"
FT   gene            complement(163963..165039)
FT                   /locus_tag="Arad_12220"
FT   CDS_pept        complement(163963..165039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12220"
FT                   /product="mandelate racemase/muconate lactonizing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12220"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31247"
FT                   /db_xref="GOA:B9JQ28"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ28"
FT                   /protein_id="ACM31247.1"
FT                   /translation="MMKITAIRSRPVLVPLEFPIRTASGTVSASPLVLIDLFTDAGIIG
FT                   HAYIFGYAPLTLQPLVALLDNLAGTIIGQSVAPRALEERLRRSFRLLGYTGLMRMALAG
FT                   IEMAAWDAFAKEQRMPLVRLIGGEPRPIQAYDSHSMDGEALAVERAVRSAKAGFRGIKT
FT                   KIGYASFAEELTVIRAIRSAVGPQFEIMVDYNQALSVPEAITRGRALAEEGITWIEEPT
FT                   LQHDYDGHGQITRALTTSVQMGENWFGPEEMMLSVKAGASNLAMVDVMKIGGVCGWMKA
FT                   SAIAEQHGLPLSSHLFQEISVHLLAASPTAHRLEHMDIAGPVLLQGMTIQDGFALASEE
FT                   PGTGVAWQEDAVAQFLIA"
FT   gene            complement(165036..166190)
FT                   /locus_tag="Arad_12221"
FT   CDS_pept        complement(165036..166190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12221"
FT                   /product="FMN-dependent alpha-hydroxy acid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12221"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31248"
FT                   /db_xref="GOA:B9JQ29"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ29"
FT                   /protein_id="ACM31248.1"
FT                   /translation="MGKSIKVEDYRHLARRRLPKMVFDYLDGGAEDEYGLRHNRDVFLD
FT                   WHFKPSRLIDVSRRDLTVELFGQRYPLPFMIGPTGLNGIFRPNGDLLLAQAAARLGIPF
FT                   VLSTASNLTIEEVASNCDGELWFQLYVVHRDLANSLTDRALAAGYKTLVLTTDVTVNGY
FT                   RERDMRSGFGLPLRYTPKVILDGLRHPAWSLDLMRTGVPQLANFRGAAAATPQAQAALM
FT                   SRQMDASFSWEDLARLRDRWPHRLLVKGILRSEDAQKCVELGADGVILSNHGGRQVDSC
FT                   LSPMEVLSQTARLVTKPILIDSGFRRGGEIVKALALGAKIVLLGRATLYGLAARGEPGI
FT                   DDVLSILRTEIDRTLALIGCNSVAQLSSDFLVPTFGRHNEEKRS"
FT   gene            complement(166195..167778)
FT                   /locus_tag="Arad_12222"
FT   CDS_pept        complement(166195..167778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12222"
FT                   /product="benzoylformate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12222"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31249"
FT                   /db_xref="GOA:B9JQ30"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ30"
FT                   /protein_id="ACM31249.1"
FT                   /translation="MKTVREATYELLRSVGLTTVFGNPGSNELPFLNGFPADFRYILGL
FT                   HEGVVVGMADGYAQATGNASLVNLHSAAGTGNGMGALANAWNSHTPIIVTAGQQTRAMI
FT                   GAEPLLANVDAAMLPRPLVKWSYEPASASEVPHAFSRAYHIAELPAKGPVYLSIPYNDW
FT                   EQPAGPFSDAVNMRKVEAAGMPDEHRLAALLDRIASARNPVIVLGPDVDAARANSYAVT
FT                   LAEKIAAPVWVAPSAPRCPFPTTHQNFRGLLPAGIASISRLLSGHDLILVFGAPVFRYH
FT                   QYDPGAWLPEGASLISVTCDALEAARAPMGDAIVGDVGGVLKRLCERVVAGARADLEAL
FT                   PRPERAPASSGALLPEAVFDILDDLAPENAIYLNESTSTTAALWERLRMRQPGSYYFAA
FT                   AGGLGFAMPASVGVQLAEPERRVIAIIGDGSANYGIQALWTAAQYKIPTIFIIMKNGTY
FT                   GALRWFAGVLKVENVPGLDVPDIDFQALATGYGVKAHRARNAEEFKHALTEALSSDTPI
FT                   LIEVLTKHGG"
FT   gene            167898..168788
FT                   /locus_tag="Arad_12223"
FT   CDS_pept        167898..168788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12223"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12223"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31250"
FT                   /db_xref="GOA:B9JQ31"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ31"
FT                   /protein_id="ACM31250.1"
FT                   /translation="MTDLNLIRAFIAIYETESVSGAAVKLNLTQPSVSHALSRLRDMLD
FT                   DTLFTRTRDGMKPTFVAERMYGIFRSALSEIETAIASRWSFDPKSSNQVFKLAFSDLGE
FT                   MTFLPHILPRLSQEAPKVGIEVVELEVEKLDDWFATGKIDAAIFNSTSAKVQSRSEPIF
FT                   QERYVCLVSARHPRIRDQVSLEQYLSEGHIVVSSHSGHRQVEDQIRAIGAARQVSLRLP
FT                   HFTGLHDIVAKTELLATLPSRTAHMFASSGMVKYCTIPLPIPEFEVRLHWRETDGEIEA
FT                   QAWLREILKSCLQGL"
FT   gene            complement(168952..170046)
FT                   /locus_tag="Arad_12224"
FT   CDS_pept        complement(168952..170046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12224"
FT                   /product="nitrilase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12224"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31251"
FT                   /db_xref="GOA:B9JQ32"
FT                   /db_xref="InterPro:IPR000132"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ32"
FT                   /protein_id="ACM31251.1"
FT                   /translation="MDISRRQMLGASAAALYLTRLAQDVHAADAAQSASGHALPGSRLT
FT                   EEFKVAAVQAEAVYLDLKGGVDKTIRLIGEAASAGAKLVAFPELWLPGYPFGHESEQWK
FT                   KAHLKQYVANSLQIGSEEWRLLLEAAAREKIFVSLGYSELEGDYLYMGQALIGADGSPV
FT                   QIRRKLRPSGGERTVWSDGDASGLRVYETEIGRVGSLSCWEHMHPQMTYILQSQMEHIH
FT                   IGAWPILPEANGFNWAGPAVNLAAARYYATITGAVTIVPCSIVGDEAYSRFQEIPASRW
FT                   VPKGGGHARIYGGNGAEIGNLIPHEEEGLVMATVDPRAFSPKTEDSNGEFSYGVLQFIL
FT                   ENYPGPRVPDKEHGSRNLVAIGSL"
FT   gene            complement(170119..171093)
FT                   /locus_tag="Arad_12225"
FT   CDS_pept        complement(170119..171093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12225"
FT                   /product="amidohydrolase/nitrilase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12225"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31252"
FT                   /db_xref="GOA:B9JQ33"
FT                   /db_xref="InterPro:IPR000132"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ33"
FT                   /protein_id="ACM31252.1"
FT                   /translation="MVKIAYKVAAVQAAPEFLDIAKGVDKAISLIEEAARNGASLIAFP
FT                   EVWLPGYPWWIWLDSPAWGMQFVGRYFANAMEVGDAHYERLREAATVNSIHVVMGFTER
FT                   AGGSLYIAQAIFSDKGEIIANRRKLKPTHAERTVFGEGDGSHIAVHTTELGRMGALCCA
FT                   EHIQPLSKYAMFSQNEQIHIASWPSFSVYRGAAFQLSAEANLAASQVYALEGQCYVLAP
FT                   CALVSKSMIEMLVNTPSKQNLLLEGGGFTMIFGPDGAPLAKAIPENEEGVMYAEVDLGF
FT                   IGVAKAAYDPVGHYSRPDVLRLLFNRNGQQRVHPFETDYTEIE"
FT   gene            171272..172177
FT                   /locus_tag="Arad_12226"
FT   CDS_pept        171272..172177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12226"
FT                   /product="Helix-turn-helix, AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12226"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31253"
FT                   /db_xref="GOA:B9JQ34"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ34"
FT                   /protein_id="ACM31253.1"
FT                   /translation="MIQDANTLSAWREQLWSTYVRLESKSDARDFYGRVVEFIPGTHSL
FT                   SLVDSTSQLTERTRHHVRTDHQEVVLVAFQLAGQGFVTQDDRESKTIPGQFAFYESGRP
FT                   YSLSFEGPFKQLVLRVNRDKFLSRLPGLGNLTARTFEARHGCGAVALDFLRSLAARGPG
FT                   ICDAQLALMERVASDLVAGSILSLTTAVSPRRAVLERLRTRIIEEVRDPSFDPLDMATI
FT                   AGMSSRSLRRLCAENGTSPGQLILQTRLQGVKDDLSTGTNAKRTVSDIALSWGFNDMSH
FT                   FNHSFKAAYGIPPSRMRISN"
FT   gene            complement(172327..172995)
FT                   /locus_tag="Arad_12227"
FT   CDS_pept        complement(172327..172995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12227"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12227"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31254"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ35"
FT                   /protein_id="ACM31254.1"
FT                   /translation="MHGFWGGAAHWGKVVLELARKGHQSIHAVELPLTSLAEDAERTRK
FT                   MVAQQKGPVLLVGHSYGGAVITEIGDQPNVAGLVYIAAFAPDAGESPGGITQQHPPAAM
FT                   ANIEPDSDGYLWLKADRLHESFCQDMTPEEGFVMAATQKAPLASTFGDAVTAPAWKKKP
FT                   SWYQISSEDRMIAPENQVAMSARLNARKVITLKASHASLISKSVEVAGLIDEAATELAQ
FT                   "
FT   gene            complement(173019..173378)
FT                   /locus_tag="Arad_12228"
FT   CDS_pept        complement(173019..173378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12228"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12228"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31255"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ36"
FT                   /protein_id="ACM31255.1"
FT                   /translation="MLYGINKENVSILNAVNNDIDDNIIRPAIGNTADRRRRQQQAGRL
FT                   IRKPQPSFIFCGIREMRPKCQEFRIPSDVTGYFVLAAVNVSIRWGRDLVISILAICGSS
FT                   FTDRIALFQDNRREF"
FT   gene            173671..175098
FT                   /locus_tag="Arad_12230"
FT   CDS_pept        173671..175098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12230"
FT                   /product="cytochrome bd-type quinol oxidase subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12230"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31256"
FT                   /db_xref="GOA:B9JQ37"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ37"
FT                   /protein_id="ACM31256.1"
FT                   /translation="MFGLTALELARIQFGFTISFHIIFPAITIGLASYLAVLEGLWLWK
FT                   KDAVYRDLYHFWSQIFAVNFAMGVVSGLVMAYQFGTNWSYFSAFAGSITGPLLTYEVLT
FT                   AFFLEAGFLGVMLFGWNKVGPGLHFLATIMVAIGTLISTTWILASNSWMQTPQGFEIVD
FT                   GRVIPVDWLKVIFNPSFPYRLAHMTVAAYLATALFVAASGAWHVLNGRATAATRTMLSM
FT                   ALWMVLIVAPLQIAIGDAHGLNTLEHQPAKIAAMEGHWENKPGESVPLILFGWPDMQAE
FT                   MTRYAVEIPYLGSLILTHDLNGRIPGLKEFAPEDRPNSTIVFWSFRIMVGLGMLMLLLG
FT                   VSGLWIRWRKRLFDTPWFLRFAILMGPTGLIAILAGWFTTEIGRQPWIVYGVMRTKDAV
FT                   SNHSALTLSTTLVVFIVMYVAVFGTGISYMLKLVAKGPQPHHDDGHGPDEDGQSRRPAR
FT                   PLSAAPDDIDPTIAPRS"
FT   gene            175119..176126
FT                   /gene="cydB"
FT                   /locus_tag="Arad_12231"
FT   CDS_pept        175119..176126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydB"
FT                   /locus_tag="Arad_12231"
FT                   /product="cytochrome d ubiquinol oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12231"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31257"
FT                   /db_xref="GOA:B9JQ38"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ38"
FT                   /protein_id="ACM31257.1"
FT                   /translation="MGIDLPLLWAIIIGFGLMMYVIMDGFDLGIGILFPFVRDRDDRDT
FT                   MVNTVAPVWDGNETWLVLGGAALMAAFPLAYAVILSALYLPLFLMLAGLIWRGVAFEFR
FT                   FKADDAHKPFWDKAFAWGSFIAAFSQGVALGAFITGFPVENNAFTGGALDFLTPFSLFT
FT                   GAGVVIAYALLGSTWLIMKTEGDLQKRMVKLVRPVTIILLGVIGIVSLWTPLAYPAVAL
FT                   RWFSMPNLLFFSPVPLLVLITTAAILSVLRRDPHAAPFILALLLLFLGYSGLAISVWPN
FT                   IIPPGISIWTAAAPPESMGFTLVGALFVIPFILAYTAWSYYVFRGKVKTGEGYH"
FT   gene            176126..176272
FT                   /locus_tag="Arad_12232"
FT   CDS_pept        176126..176272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12232"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31258"
FT                   /db_xref="GOA:B9JQ39"
FT                   /db_xref="InterPro:IPR018895"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ39"
FT                   /protein_id="ACM31258.1"
FT                   /translation="MTDRATRANTSWLRRIGWLVLIWAFSVMSLAVAAAFFRLLMGFAG
FT                   LTL"
FT   gene            176890..177150
FT                   /locus_tag="Arad_12234"
FT   CDS_pept        176890..177150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12234"
FT                   /product="pyruvate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12234"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31259"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ40"
FT                   /protein_id="ACM31259.1"
FT                   /translation="MWSSEPRRQTRRSSVEESGGLKGTLREVSAHPCPVLVGVVTAKQE
FT                   LIMPLKIKLEQAKGFSLYMLKAVINGRGDEVVELAKTNLRL"
FT   gene            177147..177689
FT                   /locus_tag="Arad_12235"
FT   CDS_pept        177147..177689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12235"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12235"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31260"
FT                   /db_xref="GOA:B9JQ41"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ41"
FT                   /protein_id="ACM31260.1"
FT                   /translation="MIGERLVTGMDFARHVAFVLRCSAAATFSYMLASAIGLPHPVWAA
FT                   MTGIIVSQEKLTETRSATAWRLGGTVIGIVAAVAIGSLAAPLGADVAIQIALAVGLCAI
FT                   VARRYPALRVCMWTGPIVFLTASPDMPILTTGLYRGGEVLLGGLLGAALHTIAEAVIGR
FT                   MFGQIEPNSIDPPAKQP"
FT   gene            178261..179301
FT                   /locus_tag="Arad_12237"
FT   CDS_pept        178261..179301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12237"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12237"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31261"
FT                   /db_xref="GOA:B9JQ42"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ42"
FT                   /protein_id="ACM31261.1"
FT                   /translation="MLSFRMPIDQHVGSCKQEWSSVVAKATINPPRRRFRQKDLHLDRL
FT                   ECDRMFIAVIDTGSFAAAATRLGTSAGQASKLVSRLEANLGVQLIMRTTRALSLSEAGR
FT                   AYYERIKTLLEEFDDLDASVRNASGVPSGRLRITAPLTFGTTQLASVLIQFATAFPDIQ
FT                   LDVSFSDRIVNLVDEGFDAAIRIGRAEDSSLIARKLCAIRVVLVAAPSYLDGRGMPAEP
FT                   AHLAHHDCIIDTNFRDPLTWRFKHHADPQPILADVHGRIQFSNAEACVAAAEAGLGIAR
FT                   APSFVAGARLRAGAVRPVLSDFEDEPRGLYAVYPPGRHLALKVRVLVDFLANAFRGQPT
FT                   WDKNWP"
FT   gene            179411..179818
FT                   /locus_tag="Arad_12238"
FT   CDS_pept        179411..179818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12238"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12238"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31262"
FT                   /db_xref="GOA:B9JQ43"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ43"
FT                   /protein_id="ACM31262.1"
FT                   /translation="MIDNRTAPYAVLILRLALGLLFLAHAGLKIFVFTPAGTAGFFVSL
FT                   GLPGWLAYVTIVWELAGAVALILGIWPRLAAIAVIPILLGAISSVHLAAGFFFTNPNGG
FT                   WEFPGFWIVALIVLALSGDGALALRPTPTRK"
FT   gene            179853..180713
FT                   /locus_tag="Arad_12239"
FT   CDS_pept        179853..180713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12239"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12239"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31263"
FT                   /db_xref="GOA:B9JQ44"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ44"
FT                   /protein_id="ACM31263.1"
FT                   /translation="MSTIKNPAVGIGKVSLTVQDLDRVSSFYQQAVGLHLLRGDASTVE
FT                   LGVEGNTLLELRRDSSARRRSPREAGLFHTAFLLPSRADLGRWMKQAMETRPPIVGASD
FT                   HSVSEALYLSDPEGNGVEIYADRPLLSWQWKDGLVHMPSDQLDIDSVLAAAGSGRWTGF
FT                   PEGSKVGHVHLQVGAIPDAEAFYSEILGFAITSRYPGGTFYGAGGYHHYLATNIWNSRG
FT                   AVVRNYPSTGLADIEILADPDSTASIGDRSAARNIPANSTPQGLALRDPWGTEITIVTP
FT                   TAQTI"
FT   gene            180724..181683
FT                   /locus_tag="Arad_12240"
FT   CDS_pept        180724..181683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12240"
FT                   /product="glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12240"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31264"
FT                   /db_xref="GOA:B9JQ45"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR016639"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ45"
FT                   /protein_id="ACM31264.1"
FT                   /translation="MLVDGKWTADWHPVQATDAKGGFVRQISGFRNWITPDGSAGPAGE
FT                   GGFKAEAGRYHLYVGLICPWASRTLIGRALKKLGETISVSVVEPALSEQGWQFGDYPGA
FT                   ERDLQNGATYLHEIYTTADPHYTGRATVPVLWDKERRTIVNNESADILRMLNSGFGPLA
FT                   DDTVDLYPEDLRVDIDALNDRIYPRLNNGVYRTGFATTQLAYEEAFAEVFAMLDELETR
FT                   LDDRGPFLFGERLTEADVRLFVTLIRFDAAYHGLFKCNLRRLADYAHLSHYLDRILCVP
FT                   GIRETVNIDHIKRGYYSIKALNPTGIVPVGPQLPFAIS"
FT   gene            181695..182312
FT                   /locus_tag="Arad_12241"
FT   CDS_pept        181695..182312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12241"
FT                   /product="Phospholipase/Carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12241"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31265"
FT                   /db_xref="GOA:B9JQ46"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ46"
FT                   /protein_id="ACM31265.1"
FT                   /translation="MSALAANMLVIMLHGVGSSGSDLAPLANTWKDSLPGAVFASPNAP
FT                   SRSSFGSGYQWFSVAGVTEDNRSTRIIEARTAFDTTISAIIEENGFSDRLNRVVFVGFS
FT                   QGTIMALDAIASGRWPVGAVVGFSGRLASPLPLQAAVSTPVLLVHGSADAVIPAAETTK
FT                   AAALLQSQGVNVETMMIPALGHTISANGAARGATFLASAMAK"
FT   gene            182329..182991
FT                   /locus_tag="Arad_12242"
FT   CDS_pept        182329..182991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12242"
FT                   /product="monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12242"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31266"
FT                   /db_xref="GOA:B9JQ47"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ47"
FT                   /protein_id="ACM31266.1"
FT                   /translation="MEIGLYTFGDLPLGSRGPAASSRRLSEIIEAAKLADQAGLSVFGI
FT                   GEHHRLDYTISVPVAVMGAIAAVTKNIRITTAVTILSSSDPVSIFEELATIDLLSAGRG
FT                   ELTLGRGAFIESFPLFGYDLSDYDALYEEKLALLLKIAASDEVTRRGRFRARQVRDRST
FT                   PLCRPSSDLGRRLRDTRQRRTGGQGGRAAQPCQYRWGTGALPSVHRSLPPQLPPCRS"
FT   gene            183614..184915
FT                   /locus_tag="Arad_12246"
FT   CDS_pept        183614..184915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12246"
FT                   /product="Major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12246"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31267"
FT                   /db_xref="GOA:B9JQ48"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ48"
FT                   /protein_id="ACM31267.1"
FT                   /translation="MNQSNSIRHLPGETAPERNIRLTGQHVGALFVARYIAALVGIYIA
FT                   LITPASVTLAIRIGQIDPEGKASSLAFVASIGAAAALFSNPIFGMLSDRSTSRLGQRRP
FT                   FIFWGFVIGVLAIFAIGVAPSIPLIALGWAIAQIAFNASIAATIAVLPERVPATLRGRV
FT                   SGFMGMTGQLAVVTGVFLIQLAGTRGAGMFIWPAVLGGVLVLPFLLTLREVQRLPGEVP
FT                   NVTVRSVLGALWINPFQHRDFGLVWAGRFLAWTALYLLTTYKTYFLIDHLGYSTETVAP
FT                   ILTTAMFVLAVAVAVSSIGGGLLSDYFGRRKPLVVLASVFFVVAMLVVAFAHNVEMFLI
FT                   GIVIAGLGNGLYFGVDYALVSEVIPDRENSAGKSMGVFNLSSTIPQTIAPIIAPALLRI
FT                   NAEGSDGNYTSLYLCAAAFALISAVFIQFIKGAK"
FT   gene            184912..187215
FT                   /locus_tag="Arad_12248"
FT   CDS_pept        184912..187215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12248"
FT                   /product="Glycoside hydrolase, family 3,
FT                   N-terminal:Glycoside hydrolase, family 3, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12248"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31268"
FT                   /db_xref="GOA:B9JQ49"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ49"
FT                   /protein_id="ACM31268.1"
FT                   /translation="MTDLATETLRLDDKDNEALSLTTGADYWTTTNAPSYGIRSMRLAD
FT                   GPHGLRVQDDENPDHLGLERSAQATCFPPAVTLASSWDIDLIEAVGNALGREARAAGVN
FT                   VVLGPGLNIKRSPLCGRNFEYYSEDPLLAGVLAGAAARGLQAQGVAACLKHFAVNNQET
FT                   DRLRVSANIDERPLREIYLRAFQIALEESAAWSVMSSYNRINGVFASQNHWLLTDLLRN
FT                   EWGFDGVMISDWGAVRDPVDAFKAGLDLRMPGRPDDNRIRQAWARGEIDAVLLDQTVGR
FT                   MRLLCDRTSIAAPAVDVDRNDHHKLVQKAAAESAVLLSNDGVLPLALKPGIRIAVVGEL
FT                   ARQPRYQGAGSSRVNAIKVVSSLDALSARVHKAGAELEFASGYTLSGSSDHALIDEAIE
FT                   LAQRSDVVILFMGLPGEFEAEGRDRTTIQLPANQTALISALQGTKSKVVVALSNGSVVT
FT                   TSSWRNGVNAIVEFWLTGQAHGDTVADVLLGVVNPSGKLAETVPIRLEDTPAFLSFPGE
FT                   HQNVDYGEGIYVGYRYYDARSIDVDYPFGHGLSYTTFEYSGLEILVRPLSDVVAFDAKI
FT                   RIHNTGERFGHEVVQLYVQDLQTEITTPPRELRGWKKIGLAPGEEATVEIAVTREQLSH
FT                   WHTPNKCWVYPGSDLIVCVGGSSRDLPLKKTVTIPGEAISLKLDEWATFGEWLDDPKLG
FT                   LKLRELIEARGGLKGRMADLLADEGGGRDAVRAVPLATIVEFPGVPVALDDLRILSSSL
FT                   TGANDGSRSPGTRL"
FT   gene            187302..188024
FT                   /locus_tag="Arad_12249"
FT   CDS_pept        187302..188024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12249"
FT                   /product="TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12249"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31269"
FT                   /db_xref="GOA:B9JQ50"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ50"
FT                   /protein_id="ACM31269.1"
FT                   /translation="MCLGERREVNNVAFRLRSLCLCLTRWPKVVVQGVKPMPRALKNAE
FT                   QGERTRAAILASAIELFGEKGYRATSVSQIAKRAGVVQSALHHHFGAKEQLLDAALKLH
FT                   YPSSVARPDMQAVATGRTEFVDEMMEAARRNISDRHLVRFFSVMTGESLTREHPAHQFF
FT                   VNRYDIARDGFTDAIAQAKSITNDTGRAQVSLLVSILFATSDGLQMQWLRNPSIDFVAG
FT                   LERVAKMVGEGIQALRQG"
FT   gene            complement(188591..189334)
FT                   /locus_tag="Arad_12251"
FT   CDS_pept        complement(188591..189334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12251"
FT                   /product="transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12251"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31270"
FT                   /db_xref="GOA:B9JQ51"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ51"
FT                   /protein_id="ACM31270.1"
FT                   /translation="METYIRDVTSEELRLFGDIVARLSRLDNDVEARTAVFEDIVKLVR
FT                   ADFAASYIWNDRLRRFEKGLIHNMDPENIRNYERYYQFRDPHTFKLREKRKATLIEEVN
FT                   PYNELIRTEFYNDFLKRDGLHHGINVFLFEGDRDLGDFRLWRSAKSPDFSEREKMLLDT
FT                   ISPFLKKAMANGMERFENLTPRERQIAFLVARGCRDREICDMLNIGFSTVRTHLNKAME
FT                   KKGCSNRAELAALIMRENGALPGTA"
FT   gene            189489..190451
FT                   /locus_tag="Arad_12252"
FT   CDS_pept        189489..190451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12252"
FT                   /product="arginase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12252"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31271"
FT                   /db_xref="GOA:B9JQ52"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ52"
FT                   /protein_id="ACM31271.1"
FT                   /translation="MNTDKFPVSLIGLPYLMGSRGPNLGYQMAQGPRILLAPEKAPAAM
FT                   QEFFSDVETVMIEDADEPNIAFTGGDYRLLPVGDQMSRVLVQNIRLAQEVKGARERGRI
FT                   PIACVGACSAALGMVGGVGETEGEIGMIWLDAHGDAQTPDTSENGFIEGMPVTTIAGKC
FT                   WPRYRRKIPGFREIDESRIITIGLSEMFTPTARRSAKDALGTLVHKLVIEELGFEEALT
FT                   RALDNLASKCGKVFIHFDTDVLDPTVLRANTHAANGGLTDEQCKTAFRLIGERFEILAV
FT                   SFASYDPVVDERGPQVLVPLLVAAARAAAEGRARQGSSS"
FT   gene            190520..191410
FT                   /locus_tag="Arad_12253"
FT   CDS_pept        190520..191410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12253"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12253"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31272"
FT                   /db_xref="GOA:B9JQ53"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ53"
FT                   /protein_id="ACM31272.1"
FT                   /translation="MALGPKELLSHQTLLSALSEGGCDLAVELIEDVDDPAPDETAGYF
FT                   DANVAGLFAGDQMSRLQVQTARLARAVRYAVSADRMPLVANGGCTCALGMVAGLAAIGE
FT                   IGMVWFDAHDDAETPETSTSGLVEGMPVSMITGRCWQAFCHQIPGFEPIPADRILTIGL
FT                   HEKYEHKPDRGLKSPGSVVTPAIVKSKGYDGAIIEALADLRTRCSKVYVHVDVDVLDPS
FT                   VLKSSNHAAEGGLSAEQLAYALDAIADSFEIVGLDFSSFDPTIDPHGVHTLVPLLVHAA
FT                   SASTRSRIHRNHCPG"
FT   gene            complement(191447..193009)
FT                   /locus_tag="Arad_12254"
FT   CDS_pept        complement(191447..193009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12254"
FT                   /product="ABC-type dipeptide transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12254"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31273"
FT                   /db_xref="GOA:B9JQ54"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ54"
FT                   /protein_id="ACM31273.1"
FT                   /translation="MSNDTKFTSMLSVSRRQLLRTSVAIGAAGVLASSLISTAAIAQSE
FT                   ARKTGGIMRVAVPGGSADSLDPHRTQGQISDIVRFCNLFDGLCEFKPDASVGFVLAESF
FT                   TPNGDATEWTLNLRSGVKTHAGKDFTADDVIYSVKRILDKEHPSKGAALISFIDPTKVE
FT                   KIDDLTVRFMLAAPNGLFSEVWANRYLKMVPRDFDPAAPVGTGPFEYVSFTPGQESVFD
FT                   RFDGYFREPAWVDQLVISVINDNTAAINALRGGQVEITYTMPFAQARVISADPSLKLLN
FT                   NPSAMSIPIYMRTDIAPFDDPKVRMAMKLIANREQMVKIALAGYGTIGNDMAGRTIAPC
FT                   GESTLPQRKQDIAKAKELLKEAGKSDLTIEMVTVNGTAGMIECAQVFAEQAKAAGVTIN
FT                   VKVVEVGAYLAKYGQWSFGVDFLSDTYLAVATRSLLPTGTFNTSHWNDAEFIDLHKQAM
FT                   ATADITKRCDIIAKMRQIEYERGGNIVWGFANTLNGYRANVKGLVPYTVDSALYSLRTV
FT                   WLA"
FT   gene            complement(193132..194895)
FT                   /locus_tag="Arad_12258"
FT   CDS_pept        complement(193132..194895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12258"
FT                   /product="peptide ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12258"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31274"
FT                   /db_xref="GOA:B9JQ55"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ55"
FT                   /protein_id="ACM31274.1"
FT                   /translation="MTVIRIRNLRVDATATGLPIVKDVNFEIAAGEVLGLVGESGSGKT
FT                   TISLSLLGFSKPGTAIQTESRIFVDGTDLMTMSPRARNEVRGKLITYVPQDPSASLNPA
FT                   IKIGEQLVEGLMRGRDALSPHVAKARMAELMSEVGLAATPEFLSRYPAQLSGGQLQRVA
FT                   IAMAVAPRPRLVIMDEPTTGLDVSTQADVLAMMTRLCQAHGIATLYVSHDLAVVAHIAD
FT                   KVMVLYAGRIVEAGSKGDVFARPAHPYTRSLLDAVPSMREARKLRAIDGMAPPLRDREH
FT                   GCVFRARCPHATAVCAVAPPLSSKSAANHEVACHWADEIDGQAKTAPLFVVNRILENDK
FT                   VLEVLSLSARYGDRTVLRDVSMTLSRGECLAVVGESGSGKTTFSRCMIGLHSDWKGEIV
FT                   LEGRRLSQSAAHRSPDDRRKLQYVFQNPYGSLNPRKTIGGNLAVPIGHFQTSDDQNRDR
FT                   QIKAALERVELRSAHIDRFPNELSGGEKQRVAIARALLASPDVMICDEITSALDVSVQA
FT                   AIVELLRSLMSDGLSLVFVTHNLGVVRSLADSVAVLDKGEIVEIGSSESVLSRPSAAYT
FT                   KSLLANTLELA"
FT   gene            complement(194892..195767)
FT                   /locus_tag="Arad_12259"
FT   CDS_pept        complement(194892..195767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12259"
FT                   /product="dipeptide transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12259"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31275"
FT                   /db_xref="GOA:B9JQ56"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ56"
FT                   /protein_id="ACM31275.1"
FT                   /translation="MSKEITVVDVESKPRRIAVQRVFRSARTSVGLGLMILVAAVAVFG
FT                   PFLAPYGATELVGMPFDVPQYGSPFGMDFLGRDVYSRFLNGGSSLVWMSLSASALGLVL
FT                   GALIGLSCAFYKGWTDILLMRLVDVKLAFPSVIFVLLIVTVVGPGKALLVILVGVSQAP
FT                   SVSRVIRGAALSVVNLEYVQYCRAIGLSGPRIIATQILPNVATPLLVEAGLRLMWSISL
FT                   LAGLSFLGYGIQPPAADWGVMINENRNALSIQPWAVIAPIAAIAVFTIGGNIFAEAVLR
FT                   SLGRTDSGKD"
FT   gene            complement(195769..196734)
FT                   /locus_tag="Arad_12260"
FT   CDS_pept        complement(195769..196734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12260"
FT                   /product="peptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12260"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31276"
FT                   /db_xref="GOA:B9JQ57"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ57"
FT                   /protein_id="ACM31276.1"
FT                   /translation="MSIASKQAGLICRRIGLSLITLVLVSILIFMATQGLPGDVARTIL
FT                   GKDAGAEQVEALRVQLGLNLPPAEQYLHWVTSLLHGDLGVSAASNRAVADLVGPRVANS
FT                   FVLVVMSMALTLPFSVLLGVVTANRKDKWFDRAAMAASLGVNALPEFVLGLLLVVVFST
FT                   NIFHIVPAVSLLSPTKPFYDQLGAYVLPVTTLFLLQTTYLYRLVRGAMIDVLASDYVQF
FT                   ARLKGISSNRILFRHALPNAAVPAIQAAANVFALSVGGIVVVEYVFGYPGMGTALTDAV
FT                   GNRDIPVVQFIVLVIASTFLLSNMIADLAAALLTPPSRGA"
FT   gene            complement(196849..196959)
FT                   /locus_tag="Arad_12261"
FT   CDS_pept        complement(196849..196959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12261"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31277"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ58"
FT                   /protein_id="ACM31277.1"
FT                   /translation="MCQLQRSAQGIHRSDAVFTSGPTVPVVVSFQLYLQL"
FT   gene            complement(196963..197661)
FT                   /locus_tag="Arad_12262"
FT   CDS_pept        complement(196963..197661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12262"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12262"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31278"
FT                   /db_xref="GOA:B9JQ59"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ59"
FT                   /protein_id="ACM31278.1"
FT                   /translation="MNCLEILTVNKLSGGYGSGIVLRDFSAGFRAGEVHCVVGRNGVGK
FT                   STLLKLLAGAIRPASGEIVFQGRDFYSISMSERVKMGLSYAPQDKVVFDELTVAENLTL
FT                   MRDSRSLKHFELYLETFPRLKERLSQKAGTLSGGEKKLLSLSRTLAEERALVLLDEPTE
FT                   GVQYENVVRIAQLINTRKAAGAAVVLVEQSLGLVESIGDQISVLDHGEAVLQQSVGKMT
FT                   RAEIQGWLTI"
FT   gene            complement(197658..199382)
FT                   /locus_tag="Arad_12263"
FT   CDS_pept        complement(197658..199382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12263"
FT                   /product="ABC transporter ATP-binding/permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12263"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31279"
FT                   /db_xref="GOA:B9JQ60"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ60"
FT                   /protein_id="ACM31279.1"
FT                   /translation="MVSSAVRNLAVLATAMILLPLLAGDLWAYEVSLYLTYGIVATGLG
FT                   LAWGLSGTLSLGHGLYMAISAYLAANVFIVLDGSGLAWPAAFLCALIPMVIAFIIAFGV
FT                   FKGQTGNATSFSMVTLALALAGGQIAIGWSSVTGGFNGLLGVPPLPGISGIIEQYALVG
FT                   AATLVVCAGYVWLISAPLGTVWKAVAADERRMQFLGFDTALLKALAFAVSGFCAGLGGV
FT                   IYAQQQGIVTPDLSGFAFCGSLLVYVAVGGRMSVFGPLVGALVVGLLSSELRDRVDWWE
FT                   LVLALVFIVVVLRFPKGLAGIIPTSASVTNLPMSVEAPCLKGERSALSCQLQGISVKMG
FT                   SVQILNGLNFFAEQGKTTCIIGPNGAGKSSSFNALTGLLPLSGGALSLDGKPIRKATPA
FT                   ALTLAGVSRKFQAPTVFPTLTIRENLSLGLWSKRASTVDLLNRRLWQWNSPLLAELKRR
FT                   FEFLAQDAKLASDLSHGQRQILELSMVLLTEPRLLLLDEPCAGLSQDETFAVIDLAKWI
FT                   RAKTGMTIVVVEHDMALVEALADTVNVFHQGRFLAKGTIEEVRANDDVRNVYVGGQR"
FT   gene            complement(199360..200202)
FT                   /locus_tag="Arad_12264"
FT   CDS_pept        complement(199360..200202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12264"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12264"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31280"
FT                   /db_xref="GOA:B9JQ61"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ61"
FT                   /protein_id="ACM31280.1"
FT                   /translation="MMTLSLNLGYDVLVLAILTLGLAVSMGLLGVLNIAHGEMVMVGAY
FT                   CGLSVQHLELSYFLAVPLAFVVCGALGFLAERLIIRPLKYDGFATLLGTWGLGMAIREI
FT                   VKLLWGNGYQSVDLPIAGTVNLFGSTFPGWRLFVMSCAFLVLVFVAIWYLRTSTALRIR
FT                   AMVSNPVLAQAVGINSSRLSTQTFVFSSAAAGIAGVLIAPTVPVEPSMGILLVVNSFFS
FT                   LVVGGYGTIAGLLSGAVAIGGSQSILATQLSPSMAYLVVLAIAIIFLWRRPRGLFSRA"
FT   gene            complement(200219..201385)
FT                   /locus_tag="Arad_12265"
FT   CDS_pept        complement(200219..201385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12265"
FT                   /product="nitrile hydratase regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12265"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31281"
FT                   /db_xref="GOA:B9JQ62"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ62"
FT                   /protein_id="ACM31281.1"
FT                   /translation="MTQTISRRQILKLSAAIATSAAAGRVAFAADPIRIAVFITLSGGA
FT                   SLFGASSRAAADYAAAQINASGGIMGRPLELTIADGGAAPAEVAKTATRMVIGKSVDII
FT                   VGSHDSAVRQAIEAAIRGKVPYIYTPVFEGGDCAPFTYFLGETPEQQVGASIESLVKRA
FT                   GGKSFYLIGNDYVWPRATNDAVKAAVKRLGGTIVGEEYYPVGAANKFESSIEKIRAASP
FT                   AIVLQTLVGGDNVNFNRTFANFGLSANILRMSCLLEENTLLGIGKEASDNLYSCMGYFA
FT                   KLDLPENKAFIAGIAKTSSGTPAIQNTIAKSVYDGLAMAKAVVEKAKSVSAKDFDAAAE
FT                   HTSFNTPSGMMTVKNRHTAKIMYLAKCSGTDFEVIETFKDIQTGQSCN"
FT   gene            complement(201404..202819)
FT                   /locus_tag="Arad_12266"
FT   CDS_pept        complement(201404..202819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12266"
FT                   /product="indole acetamide hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12266"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31282"
FT                   /db_xref="GOA:B9JQ63"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ63"
FT                   /protein_id="ACM31282.1"
FT                   /translation="MQKMALWKLTLTEANALLEKGNITSVELVSSLLDRADALRELNAF
FT                   AHLDREQILSTARDCDARRKDADGPLPILHGLPISLKDNIACVGMPMRANTPALQNFEP
FT                   AQDATVAAKLKAAGAIPFGKNTMHELAFGGTSNNTFGGPVRNPFDTTRVPAGSSGGTGA
FT                   AVGGRLVPAGIGSDTGGSVRVPASFNGVFGYRPTTGRWSGHGVLPLSHTRDTLGPLARA
FT                   VSDLDLIDRALHEREPAVMAEIRTLRLGKPSGFYWDNLAEDVRTVCEHALSRLAGAGAT
FT                   IVEIDLVPLTNLVREIAFPIVFYEAVPELTGFLEKWKTELTVETLLSSVASPDVAAVAK
FT                   ILMDPAQAVPSSAYNRAIEEMIPEIAAGHAKILAEHLLDGIVYPTSPITAPKIGDDETT
FT                   DLNGEQVPTFLTVIRNMDIGSLIALPTISLPVGVDRNGLPIGLALEGAHAGDEKLFAVA
FT                   LSLEASLPAIPQP"
FT   gene            203076..203360
FT                   /locus_tag="Arad_12268"
FT   CDS_pept        203076..203360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12268"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31283"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ64"
FT                   /protein_id="ACM31283.1"
FT                   /translation="MPIVSVFYPLGHLRSQPDDERCDRKILFWPGLNQKGGVAKLARKK
FT                   LVAALAPSYSVILLPQPSRCSCYSRNVEINSLSLNKKSGILDWLCATPI"
FT   gene            complement(203518..204312)
FT                   /locus_tag="Arad_12269"
FT   CDS_pept        complement(203518..204312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12269"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12269"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31284"
FT                   /db_xref="GOA:B9JQ65"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ65"
FT                   /protein_id="ACM31284.1"
FT                   /translation="MNPLNQAAASTFQDVRFVLTDMDETLTYRGRLAACTYEALERLQD
FT                   AGVIVVPVTAAPAGWCDQMARMWPVDGVIGENGGFFFEREAGGHGIRRSFWHRGEERAI
FT                   VAGRLAQIGDRVRKTVTSAIFAEDQSFRQTSIAFARSGDAQTEADIVAELRKEGVDVTV
FT                   NNLWILGWLGGYDKLAMARRVLFERYGLDIDSERNAVLYVGDSTNDAPMFAFFHHTVGV
FT                   STVTEYLHEIPVPPRWISEGPGGIGFVEVASAVIVAKRICPA"
FT   gene            204311..204439
FT                   /locus_tag="Arad_12270"
FT   CDS_pept        204311..204439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12270"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31285"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ66"
FT                   /protein_id="ACM31285.1"
FT                   /translation="MLFSVSALGAAGSRRQFLLLAVDQIIPENAPDHAGTMRKLPF"
FT   gene            204734..205021
FT                   /locus_tag="Arad_12272"
FT   CDS_pept        204734..205021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12272"
FT                   /product="heat shock protein groES"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12272"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31286"
FT                   /db_xref="GOA:B9JQ67"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ67"
FT                   /protein_id="ACM31286.1"
FT                   /translation="MAFRPLHDRVVIRRLESEEKTRGGIIIPDTAKEKPQEGAVVAVGP
FT                   GLRDESGKLAPLDVKAGDRVLFGKWSGTEIKIDGEDLLIVKEADILGVVA"
FT   gene            205049..206677
FT                   /gene="groL"
FT                   /locus_tag="Arad_12273"
FT   CDS_pept        205049..206677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groL"
FT                   /locus_tag="Arad_12273"
FT                   /product="chaperonin GroL"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12273"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31287"
FT                   /db_xref="GOA:B9JQ68"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ68"
FT                   /protein_id="ACM31287.1"
FT                   /translation="MAAKEVKFSTDARQRLLRGVDILADAVKVTLGPKGRNVVIEKSFG
FT                   APRITKDGVSVAKEIELEDKFENLGAQLLREVASKTNDLAGDGTTTATVLAQAIVREGA
FT                   KAVAAGLNPQDLKRGIDLAATEAIRSIKERSRKVASSEEVAQVGTISANGESEIGKLIA
FT                   EAVQRVGNEGVITVEEAKSFETELDVVEGLQFDRGYLSPYFVTNAEKLIVEFEDAYILL
FT                   HEKKLATLQPLLPLLEAVVQTGRPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGF
FT                   GDRRKALLEDIAIVTGGQVVSEDIGIKLENVTLDQLGRAKKIRIDKETTTVVDGAGEKA
FT                   EIAARVQQIKTQIEDTSSDYDREKLQERVAKLAGGVAVIRVGGSTEIEVKEKKDRVDDA
FT                   LNATRAAIEEGIVPGGGVALLRAKTAVNALKNDNPDIQAGIHILQKALEAPIRQIAENA
FT                   GVEGSIVVGKVLESNSPTFGFNAQTEKYVDLLQEGIVDPTKVVRTALQDAASVAGLLVT
FT                   TEALIAEVPKEKTPTPAAPGGGFDY"
FT   gene            206661..207050
FT                   /pseudo
FT                   /locus_tag="Arad_12275"
FT                   /note="conserved hypothetical protein fragment; Incomplete
FT                   gene (pseudogene)"
FT   gene            complement(207109..207717)
FT                   /locus_tag="Arad_12276"
FT   CDS_pept        complement(207109..207717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12276"
FT                   /product="GCN5-family N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12276"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31288"
FT                   /db_xref="GOA:B9JQ69"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ69"
FT                   /protein_id="ACM31288.1"
FT                   /translation="MALRRIKLSCQSFQRFGALFEMPKSPPIEFSTDRLLLRAARAEHA
FT                   AGVFMEYTGNSKASRFLTRGPHPAQSRTEAVINAWGESNWTNSDRFVWSIIDRSSHRPI
FT                   GLFLMFMEGDSAEIHYGLGPAFWGKGLATEAGLAVMRWVSEQSHLSSVHTTCAVAHDAS
FT                   RRVLEKIGLLRDQFVPEALLMKATDAKLDGWSYVWRRTD"
FT   gene            208064..209490
FT                   /pseudo
FT                   /locus_tag="Arad_12277"
FT                   /note="conserved hypothetical protein; Frameshift
FT                   (pseudogene)"
FT   gene            209615..209968
FT                   /locus_tag="Arad_12279"
FT   CDS_pept        209615..209968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12279"
FT                   /product="uridine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12279"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31289"
FT                   /db_xref="GOA:B9JQ70"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ70"
FT                   /protein_id="ACM31289.1"
FT                   /translation="MNHRRDFFIELASRIVALEGRLIVAIDGVDGSGKTTFADELAPVL
FT                   TQKGRPVVQASVDGFHNTKAIRYRLGRNDPEGFFLDSHNYQSLHRFLLGPFRAGANTVD
FT                   TARYDHAADHEIS"
FT   gene            209999..210289
FT                   /locus_tag="Arad_12280"
FT   CDS_pept        209999..210289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12280"
FT                   /product="Panthothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12280"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31290"
FT                   /db_xref="GOA:B9JQ71"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ71"
FT                   /protein_id="ACM31290.1"
FT                   /translation="MIDGIFLHRDELSNLWDFSVFLSVPFSVSYARMAVRDGSNPDPMA
FT                   QENRRYYEGQKIYLRNCKPEARATVIVDNSPNEKPKLVQAPAGHVARKGPQ"
FT   gene            complement(211109..212038)
FT                   /locus_tag="Arad_12281"
FT   CDS_pept        complement(211109..212038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12281"
FT                   /product="electron transfer flavoprotein alpha-subunit
FT                   alpha-etf flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12281"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31291"
FT                   /db_xref="GOA:B9JBQ2"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:B9JBQ2"
FT                   /protein_id="ACM31291.1"
FT                   /translation="MAILLLADHDNQSLSDQTAKTLTAAAKIGGDVHILVAGKGAKAAA
FT                   DAAAKLAGVSKVLLAESDELANNLAEPLADLIVSLAASYDTIITAATSVGKNVLPRVAA
FT                   LLDVAQISEITEVVSADTFKRPIYAGNAIQTVQSSDAKKVITVRTASFASAPEGGSAAV
FT                   EAIAAVANPGLSSFVSDALSSSDRPELTSAKIIISGGRALGSAEKFREVILPVADKLGA
FT                   AVGASRAAVDAGYAPNDWQVGQTGKVVAPQLYIACGISGAIQHLAGMKDSKVIVAINKD
FT                   EEAPIFQIADYGLVADLFEALPELEKAL"
FT   gene            complement(212063..212812)
FT                   /locus_tag="Arad_12282"
FT   CDS_pept        complement(212063..212812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12282"
FT                   /product="electron transfer flavoprotein beta-subunit
FT                   beta-etf flavoprotein small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12282"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31292"
FT                   /db_xref="GOA:B9JBQ1"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:B9JBQ1"
FT                   /protein_id="ACM31292.1"
FT                   /translation="MKILVPVKRVVDYNVKIRVKPDGTGVELANVKMSMNPFDEISVEE
FT                   ALRLKEAGKAEEVVVVSIGPAKAEETLRTALAMGADRAILVETDDAVEPLAVAKILKGV
FT                   ADAEQPGLIIVGKQAIDDDSNQTGQMLAALLGSAQATFASKIEIGDGKATVTREVDGGL
FT                   QTIEIKLPAVVTTDLRLNEPRYASLPNIMKAKKKPLDKKSPADFGVSTEPRLKVLKTEE
FT                   PSGRKAGIKVGSVAELVEKLKTEAGVL"
FT   gene            complement(212851..214284)
FT                   /locus_tag="Arad_12284"
FT   CDS_pept        complement(212851..214284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12284"
FT                   /product="NAD(P) transhydrogenase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12284"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31293"
FT                   /db_xref="GOA:B9JQ74"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ74"
FT                   /protein_id="ACM31293.1"
FT                   /translation="MTIGIVSAAYIAAAVLFILSLGGLSGQESAKRAVWYGIVGMALAV
FT                   IATVFGSSVGNWFIILLMIGGGAVLGTYVASRVQMTEMPQLVAALHSFVGLAAVFIGFN
FT                   ADIAAGRVAGLDEAARAALDGFAGILAHKTPAELSILKVEVFLGVFIGAITFTGSVVAF
FT                   GKLAGKLDGKAKKLPGGHFLNAASATASLILLLMHVNGDGAWTLILMMVLAFFIGYHLI
FT                   MGIGGADMPVVVSMLNSYSGWAAAAIGFSLGNDLLIVTGALVGSSGAILSYIMCKAMNR
FT                   SFVSVILGGFGATTGPQMEIIGEQIAIDTDGVAAALNDADSVIIVPGYGMAVAQAQQAV
FT                   SELTRKLRAAGKTVRFAIHPVAGRLPGHMNVLLAEAKVPYDIVLEMDEINDDFHETDVV
FT                   IVIGSNDIVNPAAQEDPNSPISGMPVLEVWKAKQVFVSKRGQGTGYSGIENPLFYKENT
FT                   RMFYGDANQSINSLLQFVK"
FT   gene            complement(214305..215879)
FT                   /gene="pntA"
FT                   /locus_tag="Arad_12286"
FT   CDS_pept        complement(214305..215879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntA"
FT                   /locus_tag="Arad_12286"
FT                   /product="NAD(P) transhydrogenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12286"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31294"
FT                   /db_xref="GOA:B9JQ75"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="InterPro:IPR026255"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ75"
FT                   /protein_id="ACM31294.1"
FT                   /translation="MKIGSPKEIHAGEARVAMTPDSAIQLHRMGYECVIEAGAGTAAGF
FT                   PDETYREAGIEVIDSKELLYASADVIVKVRPPEMTEVDWLSSGKILISFFYPAQNKELL
FT                   EQANATGASVIAMDMVPRISRAQKMDALSSMANIAGYRAVIEAGTNFGRFFTGQVTAAG
FT                   KVPPAKVLVIGAGVAGLAAIGTATSLGAITYAFDVRPEVAEQIESIGAEFVYLDFDDQA
FT                   EEGAATGGYAAPSSPEFREKQLARFRELAPEIDIVITTALIPGRDAPKLWLADMVAAMK
FT                   PGSVIVDLAAERGGNCDLTVADQRVVSDNGVIVIGYTDFPSRMAAQSSTLYATNIRHML
FT                   TDLTPGKDGKLVHNMEDDVIRGATVAYQGEITYPPPPPKIRAIAAQKPKEKVKEPTPEE
FT                   RRAKEAVAFKAQTKNQAFLLAGGTALLLLIGAYAPANFTSHFVVFMLACFVGFQVIWNV
FT                   SHSLHTPLMAVTNAISGIVILGALLQIGSDHWLVVVLAALSILIATINIAGGFLVTRRM
FT                   LAMFQKS"
FT   gene            215976..216212
FT                   /locus_tag="Arad_12287"
FT   CDS_pept        215976..216212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12287"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12287"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31295"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ76"
FT                   /protein_id="ACM31295.1"
FT                   /translation="MPLRHIRIRNYSASTSTLWQQKLFVVPRKVIDGDWQDAAVDHDGT
FT                   RVGRLQNGGMISRRLTAASAGRDTNSLRNLKRA"
FT   gene            complement(216397..216630)
FT                   /locus_tag="Arad_12288"
FT   CDS_pept        complement(216397..216630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12288"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31296"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ77"
FT                   /protein_id="ACM31296.1"
FT                   /translation="MKSLRWIHRRVPKRSNQNIAWREPSASGIGAAKISKEARLKAQET
FT                   FEAATDAKWLRSLGATIGDLPLSLIGRRTQPF"
FT   gene            217260..218570
FT                   /locus_tag="Arad_12289"
FT   CDS_pept        217260..218570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12289"
FT                   /product="Carbohydrate-selective porin, OprB family
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12289"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31297"
FT                   /db_xref="GOA:B9JQ78"
FT                   /db_xref="InterPro:IPR007049"
FT                   /db_xref="InterPro:IPR038673"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ78"
FT                   /protein_id="ACM31297.1"
FT                   /translation="MEIQSSRVRLRKWKLLNVGVVVIMAPLALAGQSWAQSPGPDKAPW
FT                   LKSLSDIGIDVRGLYAVGGFATVTGGAEEGKLGIGSLMITHVDFDLGKIIGWSGTKIKT
FT                   EFTMYPINYPKDGEYFSQYAGSFLGGEQYPTHDADFQPWLSQLTLEHDFGNGLKLEFGK
FT                   TTMQRYFFPNVCGMDILCPDPIIKWDSQLPPPDAGTLGFVASYEARDDLTFRFGAQQLR
FT                   DIDALFADHGWNAFSTTGHTGIFYIGGVRYQNNVNPVDLELAGWYADTPLVDAYTGEAH
FT                   TGTAGLQLKWSKTIWSEEDGGRPEGLAVFGALGDSFDETRPIDWSATLGLRWENPYESP
FT                   SGEWGISQISAKAIYARIGESTLLAQREQRVASGGQRVLGNPNQWRLSLDMITTVGKHV
FT                   FVQSSLQYVINPDSSQSRTSELPKDGIIAGTMINYVF"
FT   gene            complement(218831..219394)
FT                   /locus_tag="Arad_12290"
FT   CDS_pept        complement(218831..219394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12290"
FT                   /product="reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12290"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31298"
FT                   /db_xref="GOA:B9JQ79"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ79"
FT                   /protein_id="ACM31298.1"
FT                   /translation="MHHLLIVACSTRPTRIGYPLTAWAAERAELDGRFSVEIADLRELA
FT                   LPNFDEPHHPRNRKYEHEHTRQWSRIVERADAIVFVTPEYNHSFPGALKNALDFLHEEW
FT                   KFKPAGFISYGGIAAGTRAVQMLKPVLDCLRMIPVYEGVNIAYAQEILAGGRFAAKAIH
FT                   EDAAAQMLDSLILWTTRNSSLYIR"
FT   gene            complement(219839..220072)
FT                   /locus_tag="Arad_12294"
FT   CDS_pept        complement(219839..220072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12294"
FT                   /product="ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12294"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31299"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ80"
FT                   /protein_id="ACM31299.1"
FT                   /translation="MKFRDVVATEAEERALNAVGVAGFAGHFPRQLFGGTRQWASLARA
FT                   LSLDTPIILMDELFTAIDEQTRMILGKIFSNY"
FT   gene            220738..221469
FT                   /locus_tag="Arad_12297"
FT   CDS_pept        220738..221469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12297"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12297"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31300"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ81"
FT                   /protein_id="ACM31300.1"
FT                   /translation="MTTGASGFRTTHHASAIATIEDHAMPTTTDGTELVAALRQQLSVN
FT                   DPFLGKASPAEFEAGSILWPGDRWSSIERVFVTEANGRRLEEYRYTPAAGDRGVLPVAF
FT                   MFDLTGEKQVIVYSDHHLVDDRVPILPKVTDNHPWRSEDDVLFTYFSALNRNRLEEVLD
FT                   QFETDGYFRHSNDETCRGRDELRIDFTKMMGSTGIRIDYCRFTDDGTTCAAEAYMPSGR
FT                   PAVAVYERGRHGKLKAIRIYL"
FT   gene            221477..222355
FT                   /locus_tag="Arad_12298"
FT   CDS_pept        221477..222355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12298"
FT                   /product="2, 3-dihydroxybiphenyl 1, 2-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12298"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31301"
FT                   /db_xref="GOA:B9JQ82"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ82"
FT                   /protein_id="ACM31301.1"
FT                   /translation="MAQLVSLIGVPHDPTLPIAARLRPDGKAPPGAIPALDCFEELRRE
FT                   LEKARPDALVIVGSDHLNQWFFNNMAPFTIGKPERLKGPFPSEIRSWGLESCDLPVHGG
FT                   LARHMLKHGYEEGIDFAFSDEFIADHSFTIPVNFLRPEQDLPVVPAFVNLLAPPVPPGR
FT                   RFVDVGRAMRSGIESFAGGERVALIVTGHMSNSVGGPGMLNNMTEPETDWDRAMWARIE
FT                   ANDVDAILQHSTWDRLYAAGNGTPGFLAYLLAFGAASRAPPTYRRLIATTAQPACAFLA
FT                   WDEAALDGGRA"
FT   gene            222352..222639
FT                   /locus_tag="Arad_12299"
FT   CDS_pept        222352..222639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12299"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12299"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31302"
FT                   /db_xref="InterPro:IPR011986"
FT                   /db_xref="InterPro:IPR036622"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ83"
FT                   /protein_id="ACM31302.1"
FT                   /translation="MSRYELNKALWNYAREPDFKSRFDADAASAVATRSLSDAERSALT
FT                   DRDIRAIFELGAHPFLLYSFAIASNGGWCMEMMKEYVSRLQGLTPGDIET"
FT   gene            complement(222657..222914)
FT                   /locus_tag="Arad_12300"
FT   CDS_pept        complement(222657..222914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12300"
FT                   /product="Phosphoenolpyruvate carboxykinase (ATP)"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12300"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31303"
FT                   /db_xref="GOA:B9JQ84"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ84"
FT                   /protein_id="ACM31303.1"
FT                   /translation="MNETVKKPASIRIVDSAKKELMNVSAIDRDGNFLLVKGKIFGTMP
FT                   MTAKLSPEEARNALKMLTPRLVWFLLTFLFRRSTEDVRTK"
FT   gene            complement(222928..224511)
FT                   /locus_tag="Arad_12302"
FT   CDS_pept        complement(222928..224511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12302"
FT                   /product="Phytoene dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12302"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31304"
FT                   /db_xref="GOA:B9JQ85"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ85"
FT                   /protein_id="ACM31304.1"
FT                   /translation="MATYDIVVMGAGHNGLTTAAYLAKAGKKVLILERQDFVGGGVVTR
FT                   EINTPGYRHDLHSSCHIMIQGNPLITDDELGLIGKHGLTYNYSDVPYASIFPGNETLIT
FT                   YKDLDRACAEIARFSEKDADTYRMFAERSMAMMPMFMSGLYSPPLPYGPFMAMLDSSDE
FT                   GRDILDAMSRSSLDIIDHAFEDDRVKIHLLKLVTENLQLPDELGTGMGIYLMPGIIHTF
FT                   GVSQPIGGSGGLTDALVRSIEANGGEIRTNAEVAQILISGGRATGVKMIDGEEFLARDG
FT                   VIGAIHPHRLETFVKGLDPTIYRRANRVNTSTQSLFVSHYDLKERTKYYAGEEITKATM
FT                   LEYFTFDRLSELLDDFDHLRRKRIPPRPLLGGGDETHADPSRAPAGAGIFHAITMAPYA
FT                   IEGKGAAYWDEIKEQEADKNLSWYRKFISNLTDDNIIARTSWSPLDMERSSPNSFVNGD
FT                   MHGCAPFMYQTVGHRPTPDLGQYTVPGAERLYLVGPFMHPGGGVYGAGRATAIKMFDEL
FT                   GIDFDKAIKR"
FT   gene            complement(224652..225806)
FT                   /locus_tag="Arad_12303"
FT   CDS_pept        complement(224652..225806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12303"
FT                   /product="hydrolases or acyltransferases (alpha/beta
FT                   hydrolase superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12303"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31305"
FT                   /db_xref="GOA:B9JQ86"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ86"
FT                   /protein_id="ACM31305.1"
FT                   /translation="MFEPFPGNYVWNLSTNLALMCGGNIGEIDEACRPIREAAARGEDT
FT                   GTALFFDSWVNVAHQVIDNGMADEEKGRKLSAGIKYQRAAGYLLAAERMQSRDYAPRWE
FT                   AYRKGLEMFRRGVELQGLGVEFIDIPYQGSSFPALFVPAKPIDGRPAPVLVSCNGLDSM
FT                   KEQIFSAGNPAAFAARGVSTLVIDQPGTGAALRLNGLVGRHDAEAWASPAVDYLLTRKD
FT                   VDPKRIGMFGLSLGGYFAPRAAAFEKRFALCAVMGANHNWGEMQKRRQAREGDRPVPHY
FT                   WDHVMWVFGKKTIEDFMVWAPAMDLNGVVEKIEAPFLITHGGGDRQIPVEYAHQSYDQA
FT                   VNSAKRELHITTKADFELEHCGADNGTILRDYIADWIGETFTEM"
FT   gene            226018..226998
FT                   /locus_tag="Arad_12304"
FT   CDS_pept        226018..226998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12304"
FT                   /product="Nucleoside-diphosphate-sugar epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12304"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31306"
FT                   /db_xref="GOA:B9JQ87"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ87"
FT                   /protein_id="ACM31306.1"
FT                   /translation="MAMRIGVTGAGGFVGSALVSVLAKGGLKDAGLGVELVAIDAQLPT
FT                   SLPEATERAEGDLTDIGFLEQTFSRPFDVFYHLAAIPGGAAARDYDLGWRVNVEASVAV
FT                   LNRLALQEKPARFVFASSIGVFGIPLPTDKVNDQTLPLPTMSYGAQKLIVEALVADFWR
FT                   RGLIDGLAVRLPGIIARPRVRGGHLSAYMSDILHALRAGEPFLCPVASDATSWFMSRAR
FT                   CVENLIHAGSLPAERVGTRRAFNLPALTLSMRALVDGAAGHFGPQVQSLVTYEPNEALQ
FT                   AQFGSYPALLTPIADELGFTHDGDAKMLVARALDLSDQTSQRGAA"
FT   gene            227139..227594
FT                   /locus_tag="Arad_12306"
FT   CDS_pept        227139..227594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12306"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12306"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31307"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ88"
FT                   /protein_id="ACM31307.1"
FT                   /translation="MPQQIAADFDEPTLLHSSTAPPKRGTVIRVVDLPPEGPDGPVFDK
FT                   EQSRELFSAVGLAENAERHKPGRHPLMHRTESIDYGIVLFGEIVLLLDDSEVHLKHGDV
FT                   VVQRGTVHAWTNRSDHICRMAFILTDGEFEEELTRALDEHDARIAAE"
FT   gene            227591..228367
FT                   /locus_tag="Arad_12307"
FT   CDS_pept        227591..228367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12307"
FT                   /product="short-chain alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12307"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31308"
FT                   /db_xref="GOA:B9JQ89"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ89"
FT                   /protein_id="ACM31308.1"
FT                   /translation="MMLAGSLPTTPGFRLDTRHALVTGAGRGLGLAAAVALAEAGAMVT
FT                   LVARTTGEIEDATAALRERGLRARARAVDVTDTQAVEALLAGEVPFDILVNNAGTNKPG
FT                   PFVDVSEEKYDLVMGLNVRSAFFTSQAFARRLIAEQRPGVIINMTSQMGHVGAARRTIY
FT                   CASKHALEGLTKALAIELAEHGIRVNSVAPTFIETPMTKPFFEDEEFRRQTLSKIKLGR
FT                   IGTVEDIMGAIVYLASDAAALVTGTSLLVDGGWTAE"
FT   gene            228399..229676
FT                   /locus_tag="Arad_12308"
FT   CDS_pept        228399..229676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12308"
FT                   /product="Histidinol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12308"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31309"
FT                   /db_xref="GOA:B9JQ90"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ90"
FT                   /protein_id="ACM31309.1"
FT                   /translation="MIRYLKKGGNAAESAEADRKVRQTVEAILEDVTTRGDAAVRDLSV
FT                   KFDKWTPESFRLTKEEIDALVANVPVQVISDIRFAQAQIRRFAEAQLASMKEIEVETLP
FT                   GIRLGHRHVPMESVGCYIPGGRYPMVASAHMSVLTAKVAGVKRVIACTPPLNGAPPAAT
FT                   IAAMALAGADEIYVLGGIQAVAAMGIGTEMIKPVDMLVGPGNAFVAEAKRQLYGKVGID
FT                   LFAGPTETLVIADDTVDAEICATDLLGQAEHGPTSPAVLLTTSKRIADQIEDEIQRQLS
FT                   RLPTADIASVSWRDYGEVILCDTDEELLAEADRIASEHVQVMTANPRWFLENMHNYGAL
FT                   FLGPRTNVAYGDKVIGTNHTLPTKRAARYTGGLWVGKFLKTCTYQEVTTDAASALIGEY
FT                   CSRLCTIENFAGHKEQADIRVRRYGG"
FT   gene            229803..230795
FT                   /locus_tag="Arad_12310"
FT   CDS_pept        229803..230795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12310"
FT                   /product="fumarylacetoacetate hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12310"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31310"
FT                   /db_xref="GOA:B9JQ91"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="InterPro:IPR041072"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ91"
FT                   /protein_id="ACM31310.1"
FT                   /translation="MKLATIPNGTRDGELVVVSSDLSRAVSARVIAPNLLTAFEDWSAA
FT                   EPKLRTLAEDLAAGRAGETFAFDQSIVLSPLPRSFQWIDGSCFKNHLYLMARATGRDPE
FT                   IEMNSPFPLMYQGMSDDFYRPHGDIPLPREEDNIDFEAEVGIVLDEVPMGTTAAEAPKY
FT                   VKLVLLINDVSCRAYVKREITVGFGWMNAKPSTAFSPVAITPDELGAAWTGKVELPIRI
FT                   EWNGERFGEPNGREMSFSFYDLIEHAARTRKLAAGTIFGSGTVSNSDFKNVGSACIAER
FT                   RSIEMLEHGEHRTSFMKFGDRVRIEMIDAGGKSIFGAIDQTVVEYRKVF"
FT   gene            230797..231276
FT                   /locus_tag="Arad_12311"
FT   CDS_pept        230797..231276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12311"
FT                   /product="Lactoylglutathione lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12311"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31311"
FT                   /db_xref="GOA:B9JQ92"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ92"
FT                   /protein_id="ACM31311.1"
FT                   /translation="MGAGLFPDLKPHHVGISVCNLDEAIAFWSEIFGFELDFTAELKPI
FT                   RTTIAFLKRDGFRIELFEKYGASAVPEERLKPNTDLLVQGTKHIAFSVENVQDAAEKLH
FT                   ARGVRIVGIMRGHGTPMQHEDAPHLDGTKQPAMALFFLDDSNVLVEIIRRSDFAD"
FT   gene            231444..231890
FT                   /locus_tag="Arad_12313"
FT   CDS_pept        231444..231890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12313"
FT                   /product="transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12313"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31312"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ93"
FT                   /protein_id="ACM31312.1"
FT                   /translation="MKVPADELASLPAGAILSGLVHRMDSHDHDREAPVREVMARLGDR
FT                   WSHLILLILSAGTFRHATLRRLIAAISSEKAISQRMLTLRLRALERDGMVVRAITPTVP
FT                   PRVDYSLTPLGAEFVNLTNGLLRWIEQHDAEIQENRRRFEADGG"
FT   gene            complement(231916..232914)
FT                   /locus_tag="Arad_12314"
FT   CDS_pept        complement(231916..232914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12314"
FT                   /product="Catechol 2,3-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12314"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31313"
FT                   /db_xref="GOA:B9JQ94"
FT                   /db_xref="InterPro:IPR000486"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ94"
FT                   /protein_id="ACM31313.1"
FT                   /translation="MYERYISQLAHVKVTTPKIEASLSFYKNVLGMEESGRAGGSVFLR
FT                   GWGEGFYHSLELVEGKEPGLSHIGWRAQGPEQLELAAKRIEAAGAGLGWTEGNAGHGKT
FT                   FRYRGPGGHEHHLFWDVTRFQPSVAQAPIFPNRPQRFQPRGVAVRSIDHVTIATANPEK
FT                   DANWYRETLGHRYMEATVADPEANFGEFVVFGMTTVCERSHDMGLVADFSGALGRVNHI
FT                   AYWVDQREELRRAADVLLDADIAIEFGPGRHGMGEQDYLYCREPGGMRIELNSGGYHNY
FT                   EPDFETVRWTPAQGSNVYYKNLKMPHSMHESFPPVDMSHAAENMAKTTLFV"
FT   gene            233032..233673
FT                   /locus_tag="Arad_12315"
FT   CDS_pept        233032..233673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12315"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12315"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31314"
FT                   /db_xref="GOA:B9JQ95"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ95"
FT                   /protein_id="ACM31314.1"
FT                   /translation="MDYPTRAPRQKRSRNSLEKLMTAGVDLLEEKGFEGLSIAELSIRS
FT                   GVSIGSIYQRFEGKDALFASLQEEILKRIDAEQSDLFRRIDSSLPDDRLVVEAVGRLAI
FT                   FFQQNEGLLKIMILRGAVDEDTRRRGSRSSIQLALAFESFLLSSIRRFGHAQPEVAADV
FT                   CFRIVYATFTRRIMSGSTFESETVLSWETLGDEVAHVCASYLLSPPLGSV"
FT   gene            233750..234565
FT                   /locus_tag="Arad_12316"
FT   CDS_pept        233750..234565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12316"
FT                   /product="short-chain alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12316"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31315"
FT                   /db_xref="GOA:B9JQ96"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ96"
FT                   /protein_id="ACM31315.1"
FT                   /translation="MERVLKGMTAIVTGGAGGIGTATSRVLADRGARVVVADIDGDRAR
FT                   ATADAINADGGTALGIHVDIGDEASVKEMFGATLAAFGRLDILDNNAALLTSDYAQRDL
FT                   DIARMETEVWDRTFQVNTRGTMICCREALQIMEDQGSGVIINTASNLALQGNLIQAAYS
FT                   ASKAAVIQLTRSIATSHGKRGIRCNAVLPGLTASKAALDNLPSRLREIVEEETLTPYLG
FT                   DPMDIAYTVAFLVSREARYITGQTIVADGGTSVHIPGYARFNELFSGAE"
FT   gene            234562..235356
FT                   /locus_tag="Arad_12317"
FT   CDS_pept        234562..235356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12317"
FT                   /product="short-chain alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12317"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31316"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ97"
FT                   /protein_id="ACM31316.1"
FT                   /translation="MMNSIKNRGKLSDRLKDKVAIVTGAGSGIGQGCALMFARHGARVV
FT                   AVDIDEDAVETTRAQIDAEGLDLTPRQADLTKPSDVAALVDGVATEFGGVDILLNAAAV
FT                   ADFVWIEDMDYERHWRRTLTGELDTVFLMCKAVWPHLSARSGGAIINFGSANAYVALKN
FT                   SPALAHTAGKGGVLAMTRQLAMEGAPHGIRANSISPGMIVTAATRPVLDRPELLAAVQE
FT                   KLMVGRLGQPDDIAWAAVYLASDEAAYVTGADFRIDGGALAW"
FT   gene            complement(235375..236148)
FT                   /locus_tag="Arad_12318"
FT   CDS_pept        complement(235375..236148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12318"
FT                   /product="short-chain alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12318"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31317"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ98"
FT                   /protein_id="ACM31317.1"
FT                   /translation="MASSLFDLSGKVALITGAHRGIGLAIAEEMAQAGAAVAICSNDAE
FT                   GIALAAGRLSGSGLNALGIPCDVGVDGELDRLVAKTERQLGPINILVCNAGINPHFGPM
FT                   AAASDDEYDAIMRINLRSVVQLTNRVTPGMAARRDGVVILTSSLSGLRGNARIGVYSLS
FT                   KAALAQHARNLAVELGEYNVRANAISPGLIRTDFATPILSNEEGLQRRLEKTPLRRVGE
FT                   AREIAGAAVFLAARAGAFVTGHNLVVDGGTLISDA"
FT   gene            complement(236189..236926)
FT                   /locus_tag="Arad_12319"
FT   CDS_pept        complement(236189..236926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12319"
FT                   /product="transcliptional regulator TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12319"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31318"
FT                   /db_xref="GOA:B9JQ99"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041586"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQ99"
FT                   /protein_id="ACM31318.1"
FT                   /translation="MATTNILAEEAGPPKRRQRKSATSPDNTRDKILDAAEALIGERTF
FT                   DTASLREITQEAQVTLALASYHFGTKDKLFADIVARRANVLGEMRRERLAKLEASAKLT
FT                   TETILDAFMRPLFEKMIEGGRGWPAYLQILAQLGQTNRWLDLLHENFDSTAELFLEKLA
FT                   TTLPDVTRPLLMRGFSLALVAMLQTLSKNRRIDSLSGGKVSADDLGEAYNVLLKFSVCG
FT                   LEGLSALKKAKGRSRLKDLTAIV"
FT   gene            237058..238182
FT                   /locus_tag="Arad_12321"
FT   CDS_pept        237058..238182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12321"
FT                   /product="monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12321"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31319"
FT                   /db_xref="GOA:B9JQA0"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQA0"
FT                   /protein_id="ACM31319.1"
FT                   /translation="MATIEKVLIVGGGISGLCLAIALRERNIEVDIAEIKTEWTVYGVG
FT                   IIQQSNVVRAMADLGIVDKYLAAAFPFEQPCIYAPDGSLAAKLPALRLAGPNYPANLGV
FT                   SRLALHQVLTQEAQERNARVHLGLTLKGLDQDEQEVSVTFSDGSVERYDLVVGADGVYS
FT                   RVRMLLFGDRYTPRYTGQAVWRHNFPRPKEMDHLCAFPTPNGNAGLCPLSDDLMYMFVT
FT                   SSEPGNPYHREEDLPGLMRDRLKGYGGIIGELRETIHDPKEIVYRPMEVLFVEEPWHKG
FT                   RVVLIGDAAHATTPHLAQGAGLAIEDAVVLADELNTKPTIEVALQRFHERRYDRCKTIC
FT                   EGSIQVGEWELNHSPEADHKGMLLKMITLAAQPI"
FT   gene            238199..238810
FT                   /locus_tag="Arad_12322"
FT   CDS_pept        238199..238810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12322"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12322"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31320"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQA1"
FT                   /protein_id="ACM31320.1"
FT                   /translation="MKVALVGATGNAGSRILNELLDRGHKVTAIVRRSDRVPIHPSIVA
FT                   IGTDGSENALAAAIKGNNAVVSSVRFVDLAPEVLIAAVKKSGVKRYVVVGGAGSLLHPD
FT                   GIEEARRPEFPEAFRPNSLRGGDLLTLLRQTPELEWTFISPPRIFRPGERTGKFRYGKD
FT                   HMLMTDDGMPTSISFEDFALGLANELENPQHVRERFTIGY"
FT   gene            complement(239278..239778)
FT                   /locus_tag="Arad_12323"
FT   CDS_pept        complement(239278..239778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12323"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12323"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31321"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQA2"
FT                   /protein_id="ACM31321.1"
FT                   /translation="MPRAYNADRVLGEVEKILNLGRGGATRNDRVSNIRSYVTGMADTG
FT                   CQPDDPVREFASLAADQWSSMILLVLRDGPFRYSILHRLVGAIGVTDGISQRILTLKLK
FT                   KLHHNGLIIRTIENEAPIRISYSLSPLGRSFIDEIEHLAQWIIGKLPEIHAARASNFDE
FT                   TEK"
FT   gene            240230..241042
FT                   /locus_tag="Arad_12325"
FT   CDS_pept        240230..241042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12325"
FT                   /product="ferredoxin--NADP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12325"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31322"
FT                   /db_xref="GOA:B9JQA3"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQA3"
FT                   /protein_id="ACM31322.1"
FT                   /translation="MLQASVVTDQPKTHTAFYKETVTSVKHWTENLFSFRTTRDPGLRF
FT                   VTGQFVMLGLTVNGKPLLRAYSIASPSHASELEFYSIKVPDGPLTSRLRKIREGDEVLV
FT                   GRKPTGTLVLDGLNPGRNLFLVSTGTGLAPFIGLAQDSETYDRFDKVVISHTVRQVADL
FT                   NYRELLCEALQSDEYLGELVTAKLTYYPSVTREPFRNQGRITDLIQSGKIFSDLKLPVF
FT                   DPACDRVMLCGGPSVLGDLKTILQARGFKEGSVSNPGEFVLERAFVEA"
FT   gene            242382..242705
FT                   /locus_tag="Arad_12331"
FT   CDS_pept        242382..242705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12331"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12331"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31323"
FT                   /db_xref="GOA:B9JQA4"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR022569"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQA4"
FT                   /protein_id="ACM31323.1"
FT                   /translation="MTFVVTENCIKCKFQDCVEACPVNCFHEGPNFLVINPSECIDCGV
FT                   CEPVCPAEAIYPLEELPVEQAAFAALNSELAAEWPVITIKGPPPADASIWDGKRGKLSL
FT                   LER"
FT   gene            242785..244041
FT                   /locus_tag="Arad_12332"
FT   CDS_pept        242785..244041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12332"
FT                   /product="transporter transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12332"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31324"
FT                   /db_xref="GOA:B9JQA5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQA5"
FT                   /protein_id="ACM31324.1"
FT                   /translation="MIESTSQDGFRWRVLLAIAVSSVCAGMVIMSFAPLIGDVAKDLNV
FT                   DLGTASFGLIGVTMFVSAVGIGLLGFWINKIGIFRVIIAGQLLILLSNAAIPMIGGQLA
FT                   SLVLIRVLQGLGSAALTVAISPALALWFPREEMGRAMGLQSVGMAVGIILGLNAGPVLS
FT                   QMLGGWQLGVGLLSFVPLLALLITVPIAIASHSHSRAAVAEARDHETTPTSDFLRVPAF
FT                   WVGLIALCLCYWVGLAFNGLSPGYLAVDPPTGAGYGSQGAGRLMLLFTLAGVAGPPLGG
FT                   FLIDKLFEGRSSPLVAIGWVLGAVCYTAILFSPVHSNSVVLGAVLLGAGLANPFINVTL
FT                   MSYAAKVFPPHVVGKVCGLWLSLSFLAGAGGVMACSITLSATGSYTSPILIIGIGSLIG
FT                   LATVPFFKQPSPHERVAAL"
FT   gene            244019..245497
FT                   /locus_tag="Arad_12333"
FT   CDS_pept        244019..245497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12333"
FT                   /product="flavoprotein subunit of a reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12333"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31325"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQA6"
FT                   /protein_id="ACM31325.1"
FT                   /translation="MSGLLHCDPLLITINWNQKMQTIEADVVIIGGGGTGLPAALTTIE
FT                   GGIKRVILVEKRRALGGNASMAGGFLFAAESKRQKEVNGEMDRDAVFKETMAFHHFDRI
FT                   KPRLLRVFIDKSAETIEWLEDRGAAFKFGHVESMAVHILEGMKAPVGGFSRVIRLLGDK
FT                   FQKEGGQLLLNTAAERIVCSEDGKIQKVIAKNKNAETVEISTNCVILGSGGFTGNRELL
FT                   KRYFPDHYDDVYWTDSVPNMGEGIQMATDAGAGLDDRCTLVRETTYSFETKKSMPNRAG
FT                   MEPRSIWVNNRGERFADESIYMDNMATNALVAQPGMLGFALFDNDLIDYMVKNPSPVLG
FT                   PDPVSIRDIFELEAQTGEWCAVANTFDQLASWMGADREVLKATIEEYNGFCESGRDALF
FT                   AKDKRHLFPLLKAPFYALKFRPLMVETVGPVQINEKMQVLDKLGSIVPGFFAGGAITGG
FT                   WQGNDYHLFGSALGWAINSGRIAGENAIRFLQEK"
FT   gene            245665..246462
FT                   /locus_tag="Arad_12335"
FT   CDS_pept        245665..246462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12335"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31326"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQA7"
FT                   /protein_id="ACM31326.1"
FT                   /translation="MQTTQSRLIIPAGERALAMWEVQNLMSRHEYYHAAGMNLEEVDAL
FT                   WVARHGPNATTATFASPVWVMNGIETIRRAYGEENQRNREKALKALAGIDLKIKDVPEN
FT                   YGAGHEWAMHTSTTPVIEVAGDGETAKGVWYSPGLGLETKFKGGKIGLNASMFWEKYAG
FT                   DFINEDGVWKIWHLQMAYDLVPGLPQEMVDPIMLALGDMADTGPVEAAREAGERMSGAL
FT                   PPGFSQPVYSYPVYSPQRPGIMYPRLPEPYYTFSETFSYCNSR"
FT   gene            246749..247765
FT                   /locus_tag="Arad_12337"
FT   CDS_pept        246749..247765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12337"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12337"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31327"
FT                   /db_xref="GOA:B9JQA8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037416"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQA8"
FT                   /protein_id="ACM31327.1"
FT                   /translation="MRFQRLDLNLLVVLNALLSERSVSLAAERICLSQSATSSALGRLR
FT                   EYFGDDLLIVKGRQMILTTRAVSLVEPVRAVLEQIRMTISVTPPFDPAVSDRAISIMAS
FT                   DYITEVLLASAINQMAVEAPNMRFDIRPLDCHLVETLERGLTDLLVTIDYAISPDHPSD
FT                   ILFEDDYVVVGWSGNRAMKGPMTKDLYFALGHVTARFGQGRVSAFEDWFVRRNKLQRRV
FT                   EVVTPTFLSLPGLVVGSSRIATMHRRLATRMADHMPLTIREVPFDIPRIREAVQWHVSN
FT                   NNDKAIRWVVARLKAMALAEPGTSVPYTQITHGVDRTSHDEIIAEFQTHAAQGGKVN"
FT   gene            247838..248206
FT                   /locus_tag="Arad_12339"
FT   CDS_pept        247838..248206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12339"
FT                   /product="IS5 family element, transposase orfA"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12339"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31328"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQA9"
FT                   /protein_id="ACM31328.1"
FT                   /translation="MSDLILLSKAQMRRIEPYFPLSHGVPRVDDQLILSGIIFVLRNGL
FT                   RWRDAPREYGPHKTIYNRFIRWSRLGVFNRILAELTAKRGRPEQLMIDATHLKAHRTAA
FT                   SLLKKGMFPDVSDAPMVA"
FT   gene            248302..248505
FT                   /locus_tag="Arad_12340"
FT   CDS_pept        248302..248505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12340"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12340"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31329"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQB0"
FT                   /protein_id="ACM31329.1"
FT                   /translation="MIEAFPKAKTLLADKGYDADWFRDALAERKITACIPSRANRKVAI
FT                   PHDSALYKKRHKIENMFGRLKD"
FT   gene            complement(248700..249659)
FT                   /locus_tag="Arad_12341"
FT   CDS_pept        complement(248700..249659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12341"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12341"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31330"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQB1"
FT                   /protein_id="ACM31330.1"
FT                   /translation="MFQRSLCRSASIALFILLSVLVALEGSPAGAQEKTIRLLRAPVGA
FT                   FQPLYVALERGYFKERGLVVEIAIGGGPDQNIAQAMAGQVEIVMTGAVPLVAAAANGVP
FT                   VVAVLGAEAHDDPATTGLMVKVDSPIRTLADLKGKRIGLPGIASPQGLATLLALDGAGL
FT                   TQKDVALVNLPFDAVVESAERGQVDATFPVGFFYTLAKARGFRELPDVIRPLEGTPAVL
FT                   YATARQWAEENPNTLKAFNEAMLRAYADANSNQTLVRQVDRLQTRLPSNFIDTRPIVPF
FT                   VGTFNRNVWYKMNVALARFGLIPRVPASNEYIWDGAPR"
FT   gene            complement(249727..250686)
FT                   /locus_tag="Arad_12342"
FT   CDS_pept        complement(249727..250686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12342"
FT                   /product="extracellular solute-binding protein, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12342"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31331"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQB2"
FT                   /protein_id="ACM31331.1"
FT                   /translation="MTAILMNRRRIVALMLTGASITALPASSAIAEENVVRVLRSPVGT
FT                   FQGLYIADQQGYFKEKGLKVEVMVGGAPSQNIAQLQAGQADIIMSGSFDLVAAAAQGLP
FT                   VYAVLNTQDQGEVATTGLMTPPGSSIKTLADLKGKRIGMPGIQSTQGLMIYRALEKVGM
FT                   TKKDVALVSLPFDAMIESAEKGNVDAIAPIGLFFSLAQSKGFGELKEVYQEIQGTPAVI
FT                   FASSRDWVGKNKETLTAFNEAMQKAYDYGNKHPEAVRAVDSAQTKMPPDYINTRYIAPF
FT                   VAGFQRDKWEAAVKDMTKFGFIPRTPTMSELVWEGAPK"
FT   gene            complement(250725..251537)
FT                   /locus_tag="Arad_12343"
FT   CDS_pept        complement(250725..251537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12343"
FT                   /product="ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12343"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31332"
FT                   /db_xref="GOA:B9JQB3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQB3"
FT                   /protein_id="ACM31332.1"
FT                   /translation="MNYMSKVGSAASPAVKPLVVAGLTKVYGQGENALKVLENLSLQVD
FT                   PGEFICIVGPSGAGKTTLLRCLSGLTSPTAGEVRVGAEKVTSPLAEIGLVFQDYRGSLM
FT                   PWMRSGENVAFPLQGKGVPRAERLRRAEECLAAVGLPSVMQRYPWELSGGMQQRVAIAR
FT                   ALAYDAHILLMDEPFGSLDAQTRFELEDLVLDLRRRLGISVIVVTHDIDEAVYLADRVI
FT                   VLSGHPATVIDTVDIRLGVERDQISTKAQPLFSEYRSRILKQIRKRPK"
FT   gene            complement(251561..252358)
FT                   /locus_tag="Arad_12344"
FT   CDS_pept        complement(251561..252358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12344"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12344"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31333"
FT                   /db_xref="GOA:B9JQB4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQB4"
FT                   /protein_id="ACM31333.1"
FT                   /translation="METILLSILDWVLSLLSQLWLPVLLICGWWWISEGSQSYYFPPLS
FT                   EILSALWTDLIAGPLLGYVCISLSNLAAGLAIATMLGISFGLLIGEFDTMRQITQPTLN
FT                   FFRAVPPASIVPIVIIALGVGATPKIFIIALGCFWPILLNTIDGVRGTSLAVRDTARAY
FT                   RIPTHLVVFRVALPAAMPQIMAGIRVALAVALVLMVISEFFGADAGVGFYITEASTRFA
FT                   TRQAWAGTILVGIIGYLLSGVFLQVERRVLGWYFRDTNRSAPK"
FT   gene            complement(252362..253129)
FT                   /locus_tag="Arad_12346"
FT   CDS_pept        complement(252362..253129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12346"
FT                   /product="ABC transporter component C"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12346"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31334"
FT                   /db_xref="GOA:B9JQB5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQB5"
FT                   /protein_id="ACM31334.1"
FT                   /translation="MTRIARLRSMQILVGIGILALWAGANALNLVESVLPPVIDVGRQF
FT                   FAVLARPEFLVGFGATVYDAVRGLLIAALLAIPIGILIGMFPKLEVATRMLVDFGRSFP
FT                   VIALLPVFVLLFGATQTMKVVAIGIACFFPILLQTIYGARNLDPTIVDTVRSFRIPPHL
FT                   RFFKVLLPAAGPFIATGLRIATTVSILVAVGVEIVSVTPGIGREIALSRSYNETPTTYA
FT                   YIIYAGLLGVVITLLWDLAEARLLHWHIRSKVE"
FT   gene            complement(253126..254163)
FT                   /locus_tag="Arad_12347"
FT   CDS_pept        complement(253126..254163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12347"
FT                   /product="Gluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12347"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31335"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQB6"
FT                   /protein_id="ACM31335.1"
FT                   /translation="MAFNSLKEWQVDRGSIRYIGEGLQRPECILAEPNGTLWSADGRGG
FT                   IMRIDPDGSQRLVLQSTTARNESSSFEDRYVNTIGSLPNGLAFDKEGNFLIANFGNDSL
FT                   ELMTRDGRTRTLVDNIDGEPVGKANFVTRDTHGRLWLTVTTRMVPWTRHVETMSHDGYI
FT                   AVIDERGARIVADGLCGTNELRFDLAEDYLYVAETTKRRISRFRVLPDGELGPRATHGP
FT                   ENVGGFCDGIAFDTCGNLWSTLIMADRLIAVTPEGEVLVILDDGNPKATAALDAAWHDG
FT                   QVTPELMAAATGTIAPWMASLTFGGPDLRTVYLGSLRGHRIPYFRSPIPGLPLIYWGER
FT                   QRGAA"
FT   gene            254488..255231
FT                   /locus_tag="Arad_12348"
FT   CDS_pept        254488..255231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12348"
FT                   /product="IstB-like ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12348"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31336"
FT                   /db_xref="GOA:B9JQB7"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQB7"
FT                   /protein_id="ACM31336.1"
FT                   /translation="MIFAAVFLRRRQAECLHALRRCDLRLGFRLPGSLVHDRADDCGQT
FT                   RPTFWLQAGCAWLAILLEREATMRQQKRFEARARVAILRHDPQIENADFRAARGLDRNL
FT                   FMMLAGCGWIRKSQSAHHRAGRGRQELASAIKHAAKISPSPTTGFARYSQHLPLHEAMG
FT                   DMAGSSNRWPSPICLSLMIGDRKSSTMISGAIFSRSSKTATSVDRDRHQSGAPGSLVGN
FT                   NSKPYARRCHPGSPRSQCLSHRSHR"
FT   gene            complement(255695..256240)
FT                   /locus_tag="Arad_12351"
FT   CDS_pept        complement(255695..256240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12351"
FT                   /product="regulatory protein, TetR"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12351"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31337"
FT                   /db_xref="GOA:B9JQB8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQB8"
FT                   /protein_id="ACM31337.1"
FT                   /translation="MEKSLREKIIETADRLFYQHGIHAVGINRLIEESGVSKDSFYRNF
FT                   RSKESLIEAYVRARHEAAMRNFFKVVTVHDAPRDQILAIFKDLADRVQRHGFRGCAFIM
FT                   MLAEYSNVPSLATLARDHKEKLRTEIEAICSRFSGRSPHTARTLCVLYEGFLSRSAVTR
FT                   TPDDREALLEMVESIIRD"
FT   gene            256571..258148
FT                   /locus_tag="Arad_12352"
FT   CDS_pept        256571..258148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12352"
FT                   /product="oligopeptide ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12352"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31338"
FT                   /db_xref="GOA:B9JQB9"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQB9"
FT                   /protein_id="ACM31338.1"
FT                   /translation="MFTVREHKREGLVMQSTRRSFVKLLSSGVFLPATTTVGFLRVPNA
FT                   FAAEQNVLSIAQGNDILSLDPADHGNNSTESALVNIYDYLVTKDFSGETLVFTPNLAKS
FT                   WSTSDQVRWVLNLRDDVRWHDGSKFTANDVKFTVERTQGDPKLKSANKFSSVKAVKVID
FT                   DYTLQIETKYPNPLLLHSFVGNGAGLLPKLAFEAAGDKDVFFRNPVGTGPYRFKEWRKA
FT                   DRLFLEKNADWWGGQPKWDSVVVRAIPETATRVSEFITGGVDIAVNIPPEDIERIKANK
FT                   GTRVISFDIARNLALHVRTGEKWVTHDPRVREAIDLAIDRNTIAQQVVNGYGSPTRGFF
FT                   PKKIPGSNPELSANLPYDPEKARTLLREAGKEGAAIKLSTPSGRYVKDREISETVVGYL
FT                   EDAGFRPQLEVLDWTIYNSRLTADGFGELYLWGMGSYTDGSSLFQDDFKRHYDWTNAEF
FT                   NSLREKARNPGSEDARLAILRRAQEIVADQRVRIGLIYPQSIYGVNDRIKFDGRFDEMI
FT                   FAEDVVPV"
FT   gene            258145..259062
FT                   /locus_tag="Arad_12353"
FT   CDS_pept        258145..259062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12353"
FT                   /product="oligopeptide ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12353"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31339"
FT                   /db_xref="GOA:B9JQC0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQC0"
FT                   /protein_id="ACM31339.1"
FT                   /translation="MSSRYLLRSLVQVVPILYIVSLIVFILVYLTGDPSALLVPEDATE
FT                   ADRLALVAAWGLDQPWYVQYLAYMRNILSGNFGVSYRYGTEALPIVLERIPATLLLTAG
FT                   ALVVAIAIAVPSGIVAALKHGTPADVIVSGISVLGKAMPTFWVGIMLVLIFGVWLRVLP
FT                   VSGGGSFAHLILPAVTLGTGFAADLTKLIRSSMLEVLGRDYIRTARAKGIPNRVIVFKH
FT                   VLRNALIPALTMTSLHVIALLGGALVTETVFAWPGLGLLVVNAIYTKDMAVIQIAVFVI
FT                   TLMTLFVNFATDLLYRAIDPRIKL"
FT   gene            259073..259963
FT                   /locus_tag="Arad_12354"
FT   CDS_pept        259073..259963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12354"
FT                   /product="oligopeptide ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12354"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31340"
FT                   /db_xref="GOA:B9JQC1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQC1"
FT                   /protein_id="ACM31340.1"
FT                   /translation="MTLQDTAGLETTPGRIVAGLRSLLTSRSGCVGVLILGIIVLAALF
FT                   ADYLPLPSPRQRNLNLKFAPPIWAAGGLSGYWLGTDGQGRDVLARVIYGARTSLIVGLA
FT                   AVAFSGIVGLVLGLVAGYRGGLLDAVLMRVIDAMLAIPTMLFMLVVALVAGSGMLPLVS
FT                   VIAVTNWVVYARLVRAEVLHIKELEFVSAARIGGVCQVRILLRHILPNTISAFIVIATL
FT                   NIGSVILAESSLSFLGFGIQPPEVSWGQMLSDGRQSLATSWWVATFPGVALTLTVFSII
FT                   LIGDWLRDYLDPRMP"
FT   gene            259960..261657
FT                   /locus_tag="Arad_12355"
FT   CDS_pept        259960..261657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12355"
FT                   /product="ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12355"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31341"
FT                   /db_xref="GOA:B9JQC2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQC2"
FT                   /protein_id="ACM31341.1"
FT                   /translation="MTGSDFPIPILRYRNAGISLAKRNGEHSLVRGVDLDVFPNEIVAL
FT                   VGESGSGKTLTALSVLGLLPKGASFRADIAMVNGKDITRLNNRGWRDLRGSEVGIVFQE
FT                   PLSSLNPVLTIGDQIGEVLLYKKGLARKVREDRAAELLDLMGIPTSRSVLGEYPHQLSG
FT                   GMRQRVMLAIAMAGEPRLLIADEPTTALDNAIQHQVLELLVETAARTRIGLLFITHDLS
FT                   VVAQIADRVAVMKDGSLVESAPVGAVFAQPQHAYTRRLVSLAPRVPAVVKHGPPLAAHL
FT                   ERVEQNRPTKDVPLLEVRDLVKRYMPTGGRLTRASGSVALDGVSARIWPGKTLGLVGQS
FT                   GSGKSSLARVITGLIAPDAGSVRFEGEDIFSNAGREATRRGRDVQMIFQDPFSSLNPRM
FT                   KIADVVTEPMVAHRLLAGKSVEDAAVELLQTVGLPAGFARRYPHELSGGQRQRVGIARS
FT                   LGVRPKLLVCDEPVSALDVSVQAEILALFKTLQPLFGLTYLFIAHGLDSIYSVSHHVAV
FT                   MQSGKIVEYGLRDEVFGDPQHPYTRSLLAAMLDSDPKSSRFRSHRRAV"
FT   gene            261697..263061
FT                   /locus_tag="Arad_12356"
FT   CDS_pept        261697..263061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12356"
FT                   /product="monooxygenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12356"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31342"
FT                   /db_xref="GOA:B9JQC3"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQC3"
FT                   /protein_id="ACM31342.1"
FT                   /translation="MSSRSQNLPTRRIRLGYFHQPVGRHPSAWRRPDAEGHPEDVAWAI
FT                   RVAKKVEAGLFDVFFLADGLVGPNPHEQGKAGGLEPLTLLAALAASTINIGLVGTISTT
FT                   FSEPFNVARMLASLDHISGGRSGWNVVTSQSDRAAQNFGKERLLDHAERYARSAEFVDV
FT                   VKKLWDSWDDGALVLDKGRGAFIEPARIREINHKGRFFSVRGPLNVSRPPQGHPVIFQA
FT                   GSSGDGITLAATKADIAFTAQDTIEDALSYRDALRAAATVAVPGSPGPLVFPGVMPVVG
FT                   RTHSEAVEKFAALQENTDITAGIRQLSGRWGYDLSGYDLDGPVPEPRANIHGQSRVQLL
FT                   LKKAHTEGYRLRDLAALAIASHGHRIIVGSFEEVADDLQHWFNSGAADGFNIIPASMPD
FT                   GVDDFVELVIPELQRRGLYRTAYEAKTLRGLLGLPSPRQPGGDQSAQNTTSATAA"
FT   gene            263119..264081
FT                   /locus_tag="Arad_12357"
FT   CDS_pept        263119..264081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12357"
FT                   /product="cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12357"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31343"
FT                   /db_xref="GOA:B9JQC4"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQC4"
FT                   /protein_id="ACM31343.1"
FT                   /translation="MARIYNDLSELIGNTPLLDLQRIRKITNVQSRILAKIEYLNPAGS
FT                   IKDRTAWSIIKEAEKSGRLKPGDLLVDITSGNTGIGLAAVAASRGYRTKFYLRDIISPD
FT                   KINILRQFGAEVVLVDNNEFLVPDGIYAVLDRVRRENPEAFFTDQRTNPANPLIHAETT
FT                   GPEIWQDTGGAIDILVGTVGTGGTISGSGRFLKERKPELQVVVCEPTPDSVPTKDNPHA
FT                   EAIEGVHKVTGVNETHLPETYDSTVVDEVIAVTTAQARETALLVAREEGLLVGTSSGAA
FT                   VSAALVLAARSQNAGKNIVVIIPDSGERYLSSARVAAEG"
FT   gene            264208..265845
FT                   /locus_tag="Arad_12358"
FT   CDS_pept        264208..265845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12358"
FT                   /product="transporter peptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12358"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31344"
FT                   /db_xref="GOA:B9JQC5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQC5"
FT                   /protein_id="ACM31344.1"
FT                   /translation="MLLSRRTFTKLLYSGIFAAYGFIGLSGIEDASADETKRTSGGEIT
FT                   FLLGSLDSGWGLNEKVDIYTGQVWGQIADKLVHVDEAGKPTPWIAESWEANADQSQFVL
FT                   HLKKGVTFSDGARLDAAAVAANIEIWAKGDPSRGIGRLGLFPSSTYIGTDVVDDHTVRV
FT                   KFSTPTLSFLPTLGYHKTLLRAPTSLNLPANELGDLSKQIGSGPFVVESWHENDNVVLR
FT                   KRPDYNWGPVAIDHSGPASLDRITFKVVKEAALRGAALEAGQADVALNIPPQELAGLRK
FT                   KGFTVIAPTSLGFVSGFRVNTKAPYFAEAAVRQAIQSGINRQEILDTVFTPDWKPAKSF
FT                   IEANVPEVADFRDILAYDPAKSRRLLDEAGWTVGDDGVRARNGEKLRFNIYASPWVSTS
FT                   KPVDEVIVQQLREIGIAATLNVVDVPTFNARVRDNDTVPLVEVSRSFLDAGVVGRVLTD
FT                   LQDGDNWFNYGQTNETLNNFTKAIDESVDYGKRANVLREVQKHVLEQGLFIPTTQLIQR
FT                   LFVQSPKLHGDVYSGAAYPLYYGAWLDN"
FT   gene            265910..266899
FT                   /locus_tag="Arad_12359"
FT   CDS_pept        265910..266899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12359"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12359"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31345"
FT                   /db_xref="GOA:B9JQC6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQC6"
FT                   /protein_id="ACM31345.1"
FT                   /translation="MSTSNYLGYALQRLAQALVVVALAYILTFLIINVLPGDPISNMLL
FT                   DPENGFSRQDVAPIIAYYGLDKPISAQLWIALSRFVTGDLGISLRSSLPVSGLVLDALP
FT                   STLILAASALSVALVLAFLIALASQNLPRKYGQGLVRLLPAASLSIPSFIIGIFLIQVF
FT                   AFQFGLFRITNPDTFAATAFAALALGVPVSAQIAEVLVTNLDHEARQEYFSVARSRSLS
FT                   RIELFTYHQLRPSSLPLITMIALAVGELLGGSLVTEAIFGRSGIGSLVQGAVSMQDYPV
FT                   IQAVVSLAATVFVAVNLLADLAYPLLDPRLRADRRGQTSLNEAEVAPE"
FT   gene            266896..267726
FT                   /locus_tag="Arad_12361"
FT   CDS_pept        266896..267726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12361"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12361"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31346"
FT                   /db_xref="GOA:B9JQC7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQC7"
FT                   /protein_id="ACM31346.1"
FT                   /translation="MTFYQFESRSSSRSDALPVSVIVSFALLATIIAWSLAPGLFTSQD
FT                   PYIGDTSQKLLSPGLRHWFGTDHLGRDVFARVVFGSWSSVTSAGIAVVIGLVFGGLLGL
FT                   VSGFVGGYADVIVARLVDVLLAIPNFLLAVVIVSSFGFQTVNVAIATGASSVAVFARLM
FT                   RAEALKTRTSIFVEASGLLGGSKWHILLRHVLPNAYRSVLALAVLQFGASILVIASLAF
FT                   LGYGDPPPAADWGVLVSNGKDYPSSPWLVFAPASVIVVTVLSINRLSRWLRQSY"
FT   gene            267749..269377
FT                   /locus_tag="Arad_12362"
FT   CDS_pept        267749..269377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12362"
FT                   /product="ATPase component of various ABC-type transport
FT                   systems, contain duplicated ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12362"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31347"
FT                   /db_xref="GOA:B9JQC8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQC8"
FT                   /protein_id="ACM31347.1"
FT                   /translation="MLHLSEKSHLLTVENLSVTYGHDAVVDQASFTLRRSRALALIGES
FT                   GSGKSTIAKAVLGLLPETAKTSGKIGFKGSDLLRLNDYTWRPLRGRAIGFVPQDPQNAL
FT                   NPVRTIGAQAHEAARLLNLPDRAAERAAIHEIFELVGLGEPERIYRSYPHQLSGGMLQR
FT                   VLIGLAVLPKPDLIVADEPTSALDVTIQKRILDLLSTLRASLDLSLLLITHDLAIAAER
FT                   AEDVVVLKNGKVQEAGLSRHVFLTPASDYARRLQADVPSLNPFRFRTEERRARSGKGAE
FT                   TQIQVQSVSRAFDVDGNQVHALKGVSFSVDSGSTHALVGESGSGKTTLARLLLGLDTPD
FT                   SGAITVAGQKVHGRSAGALRDLRRDLQLVYQNPFTSLDPTWRVKNIVREPLDRYGIGTP
FT                   ADRDRRVFETIRAVGLGEDFLERRPAALSGGQRQRVAIARALVVQPKVLVLDEPTSALD
FT                   VSVQAGIVEALFELQQRFGLTYIFVSHDLSLIRQVADTVSVLQHGRLVEDGPVDRVFEA
FT                   PSGPYTRALLASIPAPPSPTSHRPW"
FT   gene            269400..270716
FT                   /locus_tag="Arad_12363"
FT   CDS_pept        269400..270716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12363"
FT                   /product="arylsulphonate monoxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12363"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31348"
FT                   /db_xref="GOA:B9JQC9"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQC9"
FT                   /protein_id="ACM31348.1"
FT                   /translation="MPTARDRIVLVAFSDPNAFHQGNPARQRDPDRFTIDQFIAHAKLA
FT                   ERAGFDAIFKPDFLGLDPLKGDVRPRAGFEPLTLLAALSQHTKRMGLIVTESTSYTEPY
FT                   NVARYFTSLDNLSGGRAAWNVVTSYYGEENFGDGTLLPLSERYRKADEYLRVAYRLWNG
FT                   WKEGSTAYTSEGHRFNGDLIEQTDFEGDYFKVRQPLDIPPGPQRRPVIVQAGASDEGLD
FT                   FAARHAEIVFTATPDIEAGKAFYEDLKRRAVSHARDADHVKILPGLNIFIAPTTEQAQE
FT                   IYSSQFTDRNLLKYRDKITREAPLFRLGDLNLDQPIPESAIPSEEELNQVERRRSRGLL
FT                   LRRYLAQPGATLRQVLSGIYEFGHLTLIGTPQSVAEEIALWFEQGACDGFVFKGGNSFA
FT                   SVAEEVIPILRTKGVFKDPVSTGLTFRQTLFGIANGRTT"
FT   gene            complement(270741..271808)
FT                   /locus_tag="Arad_12364"
FT   CDS_pept        complement(270741..271808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12364"
FT                   /product="sugar transport system ATP-binding ABC
FT                   transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12364"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31349"
FT                   /db_xref="GOA:B9JQD0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQD0"
FT                   /protein_id="ACM31349.1"
FT                   /translation="MASITINKVRKSYGHHTVLHEIDLKIADGEFIVLVGPSGCGKSTL
FT                   LRMIAGLEDISAGGIQIGDTLVNELPPKDRNIAMVFQSYALYPHMSVADNMSYSLRLRK
FT                   TPKERIATAISGAAKTLGLDALLQRRPKALSGGQRQRVAMGRAIVRSPQAFLFDEPLSN
FT                   LDARLREQMRSEIKRLHKQLTATSVYVTHDQIEAMTLADRIVAMNDGKVQQVGSPLDLY
FT                   RTPANLFVASFIGSPGMNFLDATYVSEIDSYAVTLPDGTQVSLERPLPLSSGAKLTVGI
FT                   RPEHVVLSDSDGMEANVDLVEPTGLGFILHLRMHDLPFKIFTQNEIAVVGRTRAKITLP
FT                   CKDLHFFDDAGRRIQ"
FT   gene            complement(271820..272650)
FT                   /locus_tag="Arad_12365"
FT   CDS_pept        complement(271820..272650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12365"
FT                   /product="ABC transporter, membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12365"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31350"
FT                   /db_xref="GOA:B9JQD1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQD1"
FT                   /protein_id="ACM31350.1"
FT                   /translation="MKSKRFGALLHRLALLPYLFFSLFPVFWLVKVSVTPTDLLYTEGV
FT                   RMWPSRTTLEHYLFVLINSEFPTFFLNSLIVSLGTAVCVTVLAALAGYAMSRFAFAGKT
FT                   VIVVLMLLTQMFPLSMLVAPIFKMFSSMGLTNSLFGLVILYSAFNLPFATFLMQSFFDG
FT                   IPKDLEEAAMLDGATRFVAFRQIIVPLTLPGIAATLGFVFTAAWSELLLALMLISQNQM
FT                   STFPVGLLTFVSKFSVDFGQMMAAAVMALVPVGVFFLVIQRYLVQGLTAGAVKG"
FT   gene            complement(272654..273553)
FT                   /locus_tag="Arad_12366"
FT   CDS_pept        complement(272654..273553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12366"
FT                   /product="sugar transport system permease ABC transporter
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12366"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31351"
FT                   /db_xref="GOA:B9JQD2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQD2"
FT                   /protein_id="ACM31351.1"
FT                   /translation="MTAISKIKPFRRLEPYLYTAPAVFLILALILVPLVLGVSYAFQDV
FT                   QLLNPFSGGYIGLDHFREIYGDKTFYGALFNTVWWTMASVIFQFSFGLLLALLLDKRFM
FT                   GLGLVQALIFLPWAVPSFLMGLTWAWLFNPVVGPLPHWMAALGILSSPENILSDPTIAM
FT                   WGPIVANVWGGIPFFAITLLAALQSIPRDLYEAASIDGASPLQRFWSITVPFLAPTIAI
FT                   TVLLRTIWIANFADLIVVMTNGGPADHTQILASYIFTIAFKRLDFGYASAVAVVLILLL
FT                   SIYAALIIALRRTLMKEH"
FT   gene            complement(273759..275018)
FT                   /locus_tag="Arad_12367"
FT   CDS_pept        complement(273759..275018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12367"
FT                   /product="ABC transporter, substrate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12367"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31352"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQD3"
FT                   /protein_id="ACM31352.1"
FT                   /translation="MKRIITAAVMLGLMAGSALADTKLRLVEVLTSPERTVTLKSIVAK
FT                   FEAANPGTTVEIISLPWSEAFQKFATMVSAGDVPDIVEMPDNWLSLYANNGQLESLEPY
FT                   LAKWQYTSDLTDRALELGRDVKNTAYMLPYGLYLRALFYNKRLFEQAGIANPPKTMEEF
FT                   VANSDKITKTTGKSGYCLRGGPGGLNGWMMFGASMAGSSDFFDKDGTSTLNNEGWKKGL
FT                   SWVVNLYKNGDAPKDSVNWGFNEVVAGFYSGTCAMLDQDPDALIAIADRMKAEDFGVTS
FT                   MPKGPDGKAFPTIGYVGWSIMAASKQKDLAWKLMATLEGPEGNMEWNKRVGTLPILKSA
FT                   QKDPFYASDKFKGWFAELADPNITPMKMPTYLEEFAYFKDVLALKSSQQALLGEITPSQ
FT                   LADTWADYMTKSQQKFLSKK"
FT   gene            275230..277215
FT                   /locus_tag="Arad_12368"
FT   CDS_pept        275230..277215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12368"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12368"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31353"
FT                   /db_xref="GOA:B9JQD4"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR041036"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQD4"
FT                   /protein_id="ACM31353.1"
FT                   /translation="MQIPPLKVRGASFRDTLGREALLRGVNLGGDCKLPYPYGGTNFPT
FT                   DFSDHRAVSFVGRPFPLDEADEHLSRLRHWGFNALRLLTTWEAIEHAGAGQYDEDYLDY
FT                   FEQVCRKAGEYGLYVFVDLHEDAWSRMTGGSGAPGWTFEAAGLDFTRFHSAGLSHVMQL
FT                   KYDYVEGGRQDNYPQMTWGSNHRLSPGGIMWTLFFTGKIFTPEFTIEGVNVQDYLQSHY
FT                   VGALNAVAKRIADMPNVLGFDTLNEPVPGWIGRPLSYRHLRPTTMNPANPRIGLAMSPL
FT                   DNLLAAQGIPVSVPKILRDPKTGAFSVGSEEIVNPDGVSIWLPGHTCPFEAAGAYRLNG
FT                   TKAEVLDETFFCVSRGRVLSAANDAYGPLFQAVSETTHVINPRWSIFAELEPYSAFVGG
FT                   PFPDNMPEGAVNASHWYDSSTLYTKTFSSESAFDFTAGKMLYGRDAIKASYVKQLRDVA
FT                   TLSNTFGPTGAPTLIGEFGIPFDLDGGAAFETWRTGDRSQTPWQPHIDALTLMYEAFDE
FT                   LLLHVTLWNYTASNRNDLAIGDGWNQEDLSIFSRDQQEHPDDPDSGGRALLGFCRPFVR
FT                   LAQGNLIRMAFDASACRFTAEIEVDAVVPAETEIYLPQLHFGKHPIIEVSGVDSDLRFD
FT                   LERQCAFIQSRENGSLAITVQHTPAP"
FT   gene            277394..278134
FT                   /locus_tag="Arad_12370"
FT   CDS_pept        277394..278134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12370"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12370"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31354"
FT                   /db_xref="GOA:B9JQD5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQD5"
FT                   /protein_id="ACM31354.1"
FT                   /translation="MDRISISPVVKMPVEAQATDALRDAIVNGAIPAGERITEIQLSDQ
FT                   LNLSRATVRSALHQLAKEGLLTLVPYTGWSVISMTSADVWELYTLRSAVERLAAQLLAG
FT                   AIDTAASAKIEEAFEALARACKKGDRPGIAVADFSLHKTIIDLTNHSRLIAQYGLIEQQ
FT                   IRMYIRSSDALVPSSDAIIRQHRPIVDAIIRGDADEAGTLSEQHNLTEGKKLSDHLKDL
FT                   EVAQESAAKAVSVGGKKRKAPLSR"
FT   gene            complement(278191..279513)
FT                   /locus_tag="Arad_12371"
FT   CDS_pept        complement(278191..279513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12371"
FT                   /product="4-aminobutyrate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12371"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31355"
FT                   /db_xref="GOA:B9JQD6"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQD6"
FT                   /protein_id="ACM31355.1"
FT                   /translation="MVNGFDPANLGKLDAKTRDIVERRAKFLGPAYRLMYAHPVEIARG
FT                   SGSKLYDSAGNDYLDAYNNVPSVGHSHPKVVEAIHRQLETLCTHTRYLQDGILEYAASI
FT                   LPTFEDNIEHIMFTCTGSEANDLALRLACHHTGRNGVIITSEAYHGNSFMTAGFSPSLG
FT                   PKSPLGTWVRRIPTPDSYRIAPQEMGAWLAGEVQKQIDDLEGHGDGLAAFYADSLFSSD
FT                   GIYADPVGLLAPIAEVVRRAGGLFIADEVQAGFGRSGDRFWGYQRHGVTPDIVTMGKPM
FT                   GNGYPVAAIALAPRFVEKFGSDMRYFNTFGGNTVAIAAAQATLDVMREEKLQSNAKEVG
FT                   AIVRDGLRDLATRYEAIGDIRGAGLYIGVEFVKDRTTKIPDSATALAVTNGLRERRVLI
FT                   SATGFHANTLKIRPPLVFSRADAARLLTELEATLAEVCGHR"
FT   gene            complement(279599..281050)
FT                   /locus_tag="Arad_12372"
FT   CDS_pept        complement(279599..281050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12372"
FT                   /product="glycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12372"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31356"
FT                   /db_xref="GOA:B9JQD7"
FT                   /db_xref="InterPro:IPR007835"
FT                   /db_xref="InterPro:IPR025286"
FT                   /db_xref="InterPro:IPR037035"
FT                   /db_xref="InterPro:IPR038614"
FT                   /db_xref="InterPro:IPR039760"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQD7"
FT                   /protein_id="ACM31356.1"
FT                   /translation="MEPANAATNGTSMSLTQGASLGLTPAKYIRNRGILLQSGDAVLRR
FT                   YALDIAEAGIAAADPGTAARRAVNFFGNALHIADREYRLSPEQRIFVIGAGKATYPIAQ
FT                   VLDDVLGSRIHKGLIVCKRGQLGSLNHIDMLLADHPVPTAASWDAAERTVSLLREVQAG
FT                   DIVIACFTGGSSSLFVSPAEGISLEDKAETNRVLLGCGANIIEVNAVRKHISKVKGGRL
FT                   VRDLPAGTQLVNLTVSDVIGERLEYITCPSVHDTSSFEDACATLDKYDLWNRVPFSVVR
FT                   HLRKQSAAERSTTSADLAHIVRQDELIVTTDAACAGAADAARNAGFHPIILSTLFEGES
FT                   SSLGKTFAAIAREILATGRPLPMPCVLIGGGETTVTISSKAGLGGPNQEFAVAAALELD
FT                   GYENVVALGIDTDGTDGPTPHAGGLVDGSTAGTMRLQGFDLHIALRDHDVTNLLERTGH
FT                   IITTGNTGTNVNDLKMVLVGRPPQD"
FT   gene            complement(281145..281342)
FT                   /locus_tag="Arad_12373"
FT   CDS_pept        complement(281145..281342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12373"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31357"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQD8"
FT                   /protein_id="ACM31357.1"
FT                   /translation="MRGSQSHVGVRTPEICPLLRRHSIANNIEDRNQSTPRSMHQGLSH
FT                   AFLPWTLAQSPARVFPYLNI"
FT   gene            complement(281360..282259)
FT                   /locus_tag="Arad_12374"
FT   CDS_pept        complement(281360..282259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12374"
FT                   /product="ISSpo9, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12374"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31358"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQD9"
FT                   /protein_id="ACM31358.1"
FT                   /translation="MPFKHNAARRHRIGKMKFKVTNWREYEARLRRRGSLTLWVAGEAL
FT                   SSWQAPKRVTRGGQPCYSDLAIETALTLGLVFGLRLRQTEGLLASVLQLMELDLAVPDH
FT                   TTLSRRASMWRSADRRQGRSISAEGPVHVLIDSTGLEVYGAGQWSEEKHGARSRRSWRK
FT                   LHLALDADSGEIIAHALTDRETGDASQVEVLLDQIDTSISQFTADGAYDGKPTYAAVNK
FT                   HSAGAVVIIPPRANAVERADTEPPSQRERHIAAVNNDGRMNWQAATGYGKRSLVETAIG
FT                   RYKSIIGRRLRARSFAAQ"
FT   gene            complement(282587..283612)
FT                   /locus_tag="Arad_12376"
FT   CDS_pept        complement(282587..283612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12376"
FT                   /product="Transposase, IS111A/IS1328/IS1533:Transposase
FT                   IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12376"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31359"
FT                   /db_xref="GOA:B9JQE0"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQE0"
FT                   /protein_id="ACM31359.1"
FT                   /translation="MSEVRTIGLDLAKTVFQIHGADASGAVVFRKQLRRRQVLEFFARQ
FT                   PHCLVTMEACGSSHFWAREIGRLGHEVRMIPPAYVKPFVKRQKNDMADAEAICEAAQRP
FT                   TMHFVAVKSEEAQGVAVVLRTRDLLIRQRTQTINALRGHLAEFGEVAPEGSTYAAKLIA
FT                   IVEDPQTALPQTARASLRFLTAMLSQLNDQIQALDAEIVRRAREDETARRLMTIPGVGP
FT                   LIASALVASAPPPETFQRGRDFAAWLGLVPRQHSTGGKHRLGSTTKMRERSLRRLLIMG
FT                   ANSVVVWRARKGAAPGSWLAKMLAHKPPMLVRVALANKMARIVWALMAKGEVYRAPVTT
FT                   A"
FT   gene            complement(283687..284373)
FT                   /locus_tag="Arad_12378"
FT   CDS_pept        complement(283687..284373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12378"
FT                   /product="ISSpo9, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12378"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31360"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQE1"
FT                   /protein_id="ACM31360.1"
FT                   /translation="MPHKFNCARRHKIASQKHRVTNWAAYNENLRRRGDLTVWVNEEVQ
FT                   CLWSGSRHISRGGQQKYSDLAITLCLTLRVVYGLPLRQTQCLMRSVAALMDLDVLVPDF
FT                   STLSRRSKGLTLPPTKPRLGDQGPVHLVVDGTGLKIVGAGEWLETKHDAKASRKRWRKL
FT                   RLGLDLISGEIVCCELTTDEIGDPTALPKLLDLIDSPVARFVADGAYDGEQTRDLLAAY
FT                   FGDHGR"
FT   gene            complement(284544..285548)
FT                   /locus_tag="Arad_12379"
FT   CDS_pept        complement(284544..285548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12379"
FT                   /product="d-ribose-binding periplasmic protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12379"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31361"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQE2"
FT                   /protein_id="ACM31361.1"
FT                   /translation="MNITRRTTLAIIGGAGLLPIAGKVGFAADKPVKVGAAVYGLKNEY
FT                   AQIWAAEIKKHPAFANGIAELTVFDGNYDHATQASQFDLMATQHYDVAIYIPIDSYAAK
FT                   GVIHKAALKNLPVVGSNGPAKSDELVSFIGSDDVAAGQYEAETLFKAIGDKGNIVVLIG
FT                   PEGNLGQELRTEGNKKALDANKDITVLERKTANWSRSEAMVLMQNWLTSHKGKINGVLA
FT                   QNDEMGLGAIAAMKAAGIDPKTIPVVGIDGVTDAVRAVQSGDMILSIRQDAQTQAQGAV
FT                   DIALRRVIGDSYQPLAECWKKYPQMAWGNGTDKLYSVPWTYVTKENAAEFLQK"
FT   gene            complement(285636..286643)
FT                   /locus_tag="Arad_12380"
FT   CDS_pept        complement(285636..286643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12380"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12380"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31362"
FT                   /db_xref="GOA:B9JQE3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQE3"
FT                   /protein_id="ACM31362.1"
FT                   /translation="MKRSCISHPKNGKFNMPQVSHTIVVNLVSRFGIAFGFAILCVFLA
FT                   FASPYFATWDNIGNILAQVSINGIMAVGLTFVILAAGIDLSVGSVLALAGIVAASVVTN
FT                   SGMDLGVTAAVIVGLAVGGLAGATNGAIISASSRIPPFIVTLGMLSAARGITQVYNHGS
FT                   QISDLSDDFMLLGNGQIGGIQISVYLFALVALIGYIALKYTRFGRYVYAVGGNERGART
FT                   AGVNVGLIKFSVYLISGICAGLSGIIFTSRATSASLQAGLGYELDAIAAVVIGGTSLAG
FT                   GRGGIGGTILGALLIGVINNGLDLLSVDSGNKQIIKGLVIVFAVFLDTVRARTR"
FT   gene            complement(286615..288132)
FT                   /locus_tag="Arad_12383"
FT   CDS_pept        complement(286615..288132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12383"
FT                   /product="ribose ABC transport system, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12383"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31363"
FT                   /db_xref="GOA:B9JQE4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQE4"
FT                   /protein_id="ACM31363.1"
FT                   /translation="MNQPLETIAANNDAGGDYLLLARNIGKTYGSVTALKHGALKLRAG
FT                   SVHALCGGNGAGKTTFLSILMGMTKPDHGEILLDGVAVDFHNPRDALAAGIAIITQELS
FT                   PLLEATVAENIFLGREPTRSGIVDYARMFREAQALLDRLKFAIDARAVVGSLSLSKMQL
FT                   VEIAKAISQESRILIMDEPTSAIGEAETDILFDAIRSLTQQGVGIIYVSHRLSELFRIA
FT                   EEYTVFRDGEFVEAGKLADIDREELVRLIVGKTVRREKGDHREPGSPIIEVENYGREGV
FT                   FENISLQLREREIVGLFGLMGAGRSEFLDALFGVTKHETGSLKIEGQSVTIHSPSDAIA
FT                   KRLAFATEDRKDTGLILCRPIRENISLSSLKENSIGGFVRRGREKRIVAKMASAFSLKM
FT                   GSAEDDVETLSGGNQQKVVLSRCLVTDPRILLCDEPTRGIDEGSKQAIYTFLRNFVSEG
FT                   RTALVVSSELDEILQVADRIIVFRRGRIAGELAGTDASHEALLHLAS"
FT   gene            288190..288381
FT                   /locus_tag="Arad_12384"
FT   CDS_pept        288190..288381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12384"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31364"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQE5"
FT                   /protein_id="ACM31364.1"
FT                   /translation="MVRKQFVGSRRKLVLSPALQHLMMPNKRTFFCKNCPNSSLFGYLQ
FT                   VKIIAALHKIYLLPFQTN"
FT   gene            288427..289311
FT                   /locus_tag="Arad_12385"
FT   CDS_pept        288427..289311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12385"
FT                   /product="xylose isomerase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12385"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31365"
FT                   /db_xref="GOA:B9JQE6"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQE6"
FT                   /protein_id="ACM31365.1"
FT                   /translation="MRRLGIHSFVWTGGQTQEGLEMALNKTAEHGYRTIEFAYLRPEKF
FT                   NLDKLAKLAQSLDVEIGVTMGLSHATDVSSEDEAAVSAGKKVLSDAIRAVRDIGGNKLG
FT                   GILYSAHTKYGRAPTKKGWDNSVAAIAASGEIAKGSNVDLVLEIVNRFETNLLNTAAQG
FT                   LKFIEETGSDHVRLHLDTFHMNIEEANPAAAIRLAGDKIGYFHIGESNRGYLGDGTINF
FT                   DLIFDALLDIDYKRDVVFESFSTAIVDEGLSLACAIWRDTWTDNDPLAAHAKRYIELRY
FT                   EEAKRRRATNARP"
FT   gene            289377..290591
FT                   /locus_tag="Arad_12386"
FT   CDS_pept        289377..290591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12386"
FT                   /product="transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12386"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31366"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQE7"
FT                   /protein_id="ACM31366.1"
FT                   /translation="MNETVTAGSSPRKIRQNNIVAALQTLYVHRCLSRAELARKLGMNR
FT                   SSSGEIVSDLTSGGYIREADDVSRAGGLQSRAGRPGIMLEIIPDAAYFVGVELGVEHIS
FT                   TAVIDLTGDVRACRKIAFDTPSSSPEEAMKRGVDLALDAMPKDMVARCRGLGISTPAHI
FT                   RSDGVVSLAPIIGWRDIPLADLGRSVFPANVPIVIENDANAFAIGDSYRHGTSGVTLFL
FT                   LMETGVGGGIMIDGKLFRGGHGLAGEIGHTLVPGSGGQKFEQLIGRELILRQYREATGR
FT                   ADAELQELIDEVRDRVPDAVNIAEKWSRHLAYALLQACRLIDPDRIVLGGSVASLYPMV
FT                   AARVASHMAEGQVIAFPSPDIVVDDDADFGSAFGAACILHQRFLSLENEEFGGDDSIPS
FT                   PSSYP"
FT   gene            290603..291586
FT                   /locus_tag="Arad_12387"
FT   CDS_pept        290603..291586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12387"
FT                   /product="fructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12387"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31367"
FT                   /db_xref="GOA:B9JQE8"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQE8"
FT                   /protein_id="ACM31367.1"
FT                   /translation="MTATPALAPDRLGPTVCVGEILVEIVATTPGDGFLDAQPLVGPFP
FT                   SGAPAIFISQCGRFGGSAAMVGAVGDDDFGRVNTERLSRDGVDVSCIEVDSDYPTGTAF
FT                   VRYRRDGARDFVFNIAKSAAARFEWTQQVEELFKRSGHLHVMGSALSVPNASTVIERAI
FT                   ELVKARGGSVSVDPNVRKELKLDEETSRRFERVVAAADLLLPSGEELERAAGVEGEDNA
FT                   IRRLLEIGVKEIVLKRGSEGATYFGRDGVRVDVPAFVVEEIDPTGAGDCFGGAYLTARR
FT                   LGLEPAEALVYGNAAGARNVTVRGPMEGAGTRAELDAFIDSTERRA"
FT   gene            291583..292878
FT                   /locus_tag="Arad_12388"
FT   CDS_pept        291583..292878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12388"
FT                   /product="D-tagatose-bisphosphate aldolase, class II,
FT                   non-catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12388"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31368"
FT                   /db_xref="GOA:B9JQE9"
FT                   /db_xref="InterPro:IPR012062"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQE9"
FT                   /protein_id="ACM31368.1"
FT                   /translation="MMSVNLSELARNRTAGGPAIGVTSVCSAHPLVLRAALRYGRDKSS
FT                   TVLIEATCNQVNHLGGYTGMTPSDFAALVFEIADDEQCPRELIVLGGDHLGPNPWRDLP
FT                   AEAALAEAMKMVSAYVEAGFRKIHLDASMGCKGEPAALDDETTAHRAARLASAAEEAAS
FT                   RVGGGKPIYIIGTEVPPPGGADHALSAIEPTAASAARKTIDVHRKVFADAGLGDAFTRA
FT                   IGLVVQPGVEFGNHNVIVYNRSRIDDLRAVLDAEPQFVFEAHSTDYQGGKPLRELVEDG
FT                   FPILKVGPELTFVLREALYALDLIASDLLPAYGQRPLYSAMEALLIAQPSNWSRHYHGT
FT                   DAEKRWLRHYSLSDRIRYYWATPEARDAVGFLFESLEGVTIPMPLMWQHMPAAMSFADA
FT                   PLTPEELVMWRITKSLADYDYGCTGSVHDVAD"
FT   gene            292912..293637
FT                   /locus_tag="Arad_12389"
FT   CDS_pept        292912..293637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12389"
FT                   /product="ribitol 2-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12389"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31369"
FT                   /db_xref="GOA:B9JQF0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQF0"
FT                   /protein_id="ACM31369.1"
FT                   /translation="MQHLTGKVAAVTGAASGIGLASTEALIAEGATVVLVDRDEKALGA
FT                   VCARLGERAVPLTLDLLNPEKCAGLLDGILSKAGKLDIFHANAGTYIGGDLVDANLDAI
FT                   DRMLNLNVNVVMKNVRSVIPHMIERGSGDIIITSSVAGHTAVPWEPVYSASKWAMTSFT
FT                   QTMRRQLLKSGIRVGSISPGPVVSALLADWPEENLRKAKEAGALIEPKEVADAVVFMLT
FT                   RPRNVTIRDIVILPSSFDI"
FT   gene            293696..294420
FT                   /pseudo
FT                   /locus_tag="Arad_12390"
FT                   /note="oxidoreductase protein; Frameshift (pseudogene)"
FT   gene            294493..294723
FT                   /locus_tag="Arad_12392"
FT   CDS_pept        294493..294723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12392"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12392"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31370"
FT                   /db_xref="GOA:B9JQF1"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQF1"
FT                   /protein_id="ACM31370.1"
FT                   /translation="MPLSLRGNTRRIKRTISVIRLHTFAIVAMAACGYAFTVQDTAASN
FT                   AESQTRFLQGLVAGIGFIGGGVIILCGVIIL"
FT   gene            complement(294926..295576)
FT                   /locus_tag="Arad_12394"
FT   CDS_pept        complement(294926..295576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12394"
FT                   /product="phosphatase/phosphohexomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12394"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31371"
FT                   /db_xref="GOA:B9JQF2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQF2"
FT                   /protein_id="ACM31371.1"
FT                   /translation="MSLYDPIESKSFDAFLFDMDGTLLDSSAASERVWGRWAEENGIPT
FT                   PPYHGHRVEDTMADLRSFGIDREKAAAEITERELADLDGVVPIPGAIEFLQALPSGKWA
FT                   VVTSAPMELALRRIAAAGLPRPEAIIAAEDVTKGKPKPDPFLAGTKLLSVDPARCLVFE
FT                   DADTGIHAAEAAGASVVVITHTNSATLPGRQAVQDYQRLIASSFSGGLLVHQI"
FT   gene            complement(295666..296928)
FT                   /locus_tag="Arad_12395"
FT   CDS_pept        complement(295666..296928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12395"
FT                   /product="transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12395"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31372"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQF3"
FT                   /protein_id="ACM31372.1"
FT                   /translation="MSTRSWLATKLTQEDAFRSVLLLEGQMNKPQTIRIRNEIDALNVL
FT                   FAKGGMSRADLARNVGLNRSSIGNIVASLMSQGLVDEGAESIRPADEGRTGRPGILVKL
FT                   SEEGAFFLGIEIGIDRLSAVLIDLSANVVSRKSVQFDCASLGPSAVMARAAELAAEIVP
FT                   AKRVARLRGTCLTLPALLDTDGVVRNAPMLGWRDVPVTRMLQDKLPFPIEVVSENDANA
FT                   FAIGESYVAGSTHRPPTLYLNIENGVGGAIVIGGHLFRGAHGFAGEFGHLSVSLPQRQV
FT                   RRGISGELETLIGKDAVLDLYEEFGGPRDLDHLLSSIAAKHDGAVKAATIWADALSYGV
FT                   AQIIKFFDPAVIVLGGSVAPIYNHVASQVDHYLDVALIQGLPKPRIEVSGRGGEGAAYG
FT                   AACLMHQRLFSGGVDAVPITI"
FT   gene            complement(296900..297913)
FT                   /locus_tag="Arad_12396"
FT   CDS_pept        complement(296900..297913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12396"
FT                   /product="sugar-binding transcriptional regulator, LacI
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12396"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31373"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQF4"
FT                   /protein_id="ACM31373.1"
FT                   /translation="MNMTKRALLGATTVLCLLGTALTGAPAYAKTFKIAAIVQSLNTEY
FT                   NVLWADAAKSHPALADGTATLTVLDGRQDVLTQSNLFDTAITEKYDAIIFIPVDIDAGN
FT                   EPIERAKAAGIPVFGSNTVVSKTELYDAYINSNDVEAGEMLAKAVIDKAGKDAKVVVLE
FT                   GMLGQSAQVQRLEGINNVLKQNSGVTILEQNTANWSRAEAITLMENFLTSHGDQVQGVL
FT                   AENDEMAVGAIEGIRNHGLDPKKLPVAGVDGIKDALEAVKRGEQTMSILQDASGQSQGA
FT                   IDLALSKLVGDTYKPRAKVWDTNGGKLAWNGGKEEHYYVPWLAVTSDNVDKVLAGN"
FT   gene            complement(297968..298936)
FT                   /locus_tag="Arad_12397"
FT   CDS_pept        complement(297968..298936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12397"
FT                   /product="ribose ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12397"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31374"
FT                   /db_xref="GOA:B9JQF5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQF5"
FT                   /protein_id="ACM31374.1"
FT                   /translation="MTTATLAKRDGNVASTIARYGIVISFVLLFVILSVASPNFLSANN
FT                   LLNVLRQVSINGVLAVGMTFVILTAGIDLSIGSILALSGAVAASLVTGPDALNPFVGVV
FT                   AGLGVGAICGVVNGTLTAHFRVPAFVTTLGMLSVARGATLLFSGGRPIPNLSTDFRWLG
FT                   QGLLFGMPVPVIIFAIVFAISAVVLRYSIYGRRIYAVGGNPRSAKTSGINTSGIIFSVY
FT                   VIMGALAGLAGVMLTARTTSALPQAGIGYELDAIAAVVIGGTSLTGGVGRIGYTLVGVL
FT                   IIGMISNGLDLMGVSSYYQQIIKGSIIVLAVLIDRSRSRGE"
FT   gene            complement(298967..300565)
FT                   /locus_tag="Arad_12398"
FT   CDS_pept        complement(298967..300565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12398"
FT                   /product="ribose ABC transport system, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12398"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31375"
FT                   /db_xref="GOA:B9JQF6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQF6"
FT                   /protein_id="ACM31375.1"
FT                   /translation="MNDKSTTRSANPLGFGEREFVGGSMETIEASQVIPGEGAAHTLLR
FT                   ASDVTKSFNKVAALIDGQIALRAGTVNALCGGNGAGKSTFLGILMGLLRRDAGTVAIKG
FT                   TEVDFATPSDALDNGIAIITQELSPFLDMTVAENLYLGREQRRGRFFVDDRKMIADAEE
FT                   ILARLRFDIPAHARLRDLSVAQSQLVEITKAISRKSDILIMDEPTSAIGERETQMLFDA
FT                   IRRLTADGVGIVYVSHRLTEIFEIADDYTVFRDGRYVEGGAISQIDRKGLIRSIVGRDL
FT                   LDHRREAKSFDNAKPLLEARGFSSGGKFSDIDVTLHAGEIVGLYGLLGSGRSEFVNALY
FT                   GTEKRDSGEILIDGQPADLKTPADSIRAGISLVTEDRKQTGLSLTASVAHNITVANLPH
FT                   YARRGFMDRAEEAKSVGGHVKRFSIKTASPDLPVQSLSGGNQQKVVLARCVDTNPRVLI
FT                   CDEPTRGVDEGAKREIYAFLENFVQRGNAVLMISSEIPEILSNADRIIVFQRGRIAGEV
FT                   SGPDATQETLVHLAS"
FT   gene            complement(301078..301947)
FT                   /locus_tag="Arad_12399"
FT   CDS_pept        complement(301078..301947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12399"
FT                   /product="Transposase, IS4"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12399"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31376"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQF7"
FT                   /protein_id="ACM31376.1"
FT                   /translation="MPFKHNAVRRHHISKVKFKVPNWAEYEAGLRRRGSLTLWMTQDAV
FT                   SAWQAAKRTTRGGQPRYSDLAIETTLMPGIVFGLHLRQTEGLLASVLQLMGLDLAVPDH
FT                   TTLSRRANKQRWPRSRESRSAHIKGPVHVFIDSTGLKIYGAGQWLEQKHGAKSRRGWRK
FT                   LHLALDADSGDIIAHVMTDQDTSDASQVEPLLDQIDAPIRQFTADGAHDGSPTYDGVAR
FT                   HSAHAAVVIPPRANAVERPGADPSSQRDRHIAAININGRMKWQAATGYGKRALASTAIG
FT                   RYKSIIGH"
FT   gene            302026..302607
FT                   /locus_tag="Arad_12400"
FT   CDS_pept        302026..302607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12400"
FT                   /product="ATP-binding protein of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12400"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31377"
FT                   /db_xref="GOA:B9JQF8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQF8"
FT                   /protein_id="ACM31377.1"
FT                   /translation="MPQRDALMPWRRIIDNATLGLEVQGASRAEARKRVLPLLDQFGLK
FT                   GFENHYPAQLSGGMRQRVALLRTVVHERKMLLLDEPFGALDALTRTSMQRWLEGMWERH
FT                   RWTALLITHDIREAIYLSDRIYMLSQRPAQVVREIRVLLPRRRNFSDLNSPAATRIEAD
FT                   LLEALIGPDTAEQSPVADQDFATPIPTRHY"
FT   gene            303108..303614
FT                   /locus_tag="Arad_12402"
FT   CDS_pept        303108..303614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12402"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12402"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31378"
FT                   /db_xref="GOA:B9JQF9"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQF9"
FT                   /protein_id="ACM31378.1"
FT                   /translation="MTLGTSAYEALANRSVDFTLEILTWEGVQAELSGAKLKEFKYSDF
FT                   GVPEQYTTVIVSSDAYLKGNPDTAKAFLAAVRKGYAFAADILIAANPDVLTDRALVHAS
FT                   SKLLSDEHYLRGQDGAIGTFDRNKVAAVGDYLFKAGILLDQNGKPLTTEPDFSTYVSND
FT                   YLPVN"
FT   gene            complement(303664..305010)
FT                   /locus_tag="Arad_12403"
FT   CDS_pept        complement(303664..305010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12403"
FT                   /product="Coenzyme F420-dependent N5,N10-methylene
FT                   tetrahydromethanopterin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12403"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31379"
FT                   /db_xref="GOA:B9JQG0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQG0"
FT                   /protein_id="ACM31379.1"
FT                   /translation="MAKRRDQFKLGAFLLFTGHHVGAWRHPASIQNTELSDYIQLARLA
FT                   EDAKFDAVFLADSLEVRLENLEAASRKAHSGVYPFEPITLLSALAAVTSNIGLIATASA
FT                   SFTEPFNLARQFASLDRLSGGRAGWNLVTSPDPKAALNFGGEGQILHADRYDRAEEFAD
FT                   VVVGLWNSWEDDAFIRDREAGHYFHADKVHLLDHKGRHFNVRGPLNVPRSPQGHPVLVQ
FT                   AGASEAGRELAARTADVVFAAQLTLEEAASYYADVKGRLKKYGRSDDDLKILPGVFPVV
FT                   GRTQSEAEEKFEALQELIQPEVGLDLLSRFSGGFDLSGYPIDGPFPDLPETNGTKSRQA
FT                   LIIDLARREKLTIRQLYLRIAGARGHWQVVGTPAYIADVMEERFDNYGADGFNIMPPIA
FT                   PGGLGDFIELVLPELRRRGRFRNEYEGRTLRENLGLKYPQHPSSVRTGS"
FT   gene            complement(305010..306626)
FT                   /locus_tag="Arad_12405"
FT   CDS_pept        complement(305010..306626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12405"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12405"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31380"
FT                   /db_xref="GOA:B9JQG1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQG1"
FT                   /protein_id="ACM31380.1"
FT                   /translation="MTMPLLTISDLTLQFSTPRGSAVGLSDLSLTVERGEKLGIVGESG
FT                   SGKTTAAMAVLGLLPSSALVTGGSILINGEDIVHTSERRLRQVRGTVVSAVFQNARAAL
FT                   NPIMRIGEQIADAILSHRKMKRQEALERAVELLESVHFSDPIKQARAYPHQLSGGMCQR
FT                   AMIAMAIACEPQLLIADEPTTGLDVTTQKAVMKLLNEIVVERGMALILITHDLALAGNY
FT                   CDRIAVMRHGKVVEAGSTQEIFSAPSHAYTRTLIEATPKLLVVEAAIARAETPLLRVQD
FT                   LGKDFSGRTAVGDVSFAVGQNESVGLVGESGSGKSTIARLVARLADPTAGKIDFGGADI
FT                   GTIPARDFHRSPYRAGIQLVFQDPTDSLPPHMSVFATIADPMRRLKGLKGEALRERVEK
FT                   LADQVQLPRALLTRLPHQLSGGQKARVGIARAIAVEPLLLILDEPTASLDVSIQASILG
FT                   LLAELRRDLEMSYLFISHDLNVVSNICDRTIVLKGGMIVEEADSPTIFARPKHPYTRQL
FT                   LDAVLQPPQPAEDPRKTLARY"
FT   gene            complement(306623..307468)
FT                   /locus_tag="Arad_12406"
FT   CDS_pept        complement(306623..307468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12406"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12406"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31381"
FT                   /db_xref="GOA:B9JQG2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQG2"
FT                   /protein_id="ACM31381.1"
FT                   /translation="MSVIEEQRRVMSSIGTTTQLAGLCVALLVFVAIFGPSIAPYNPLQ
FT                   SSVTDTLQPPSWQHWAGTDQIGRDVLSRLLVATRLDMLIAMSAVLLSFLIGSVVGAFVG
FT                   YLGGWPDKLVGRVVDMLMAFPLFVLAMLLIAAVGTGVANIIYATAAINLPFYVRVARSE
FT                   VNARRDAGWVEAARLSGNGRVRIILFFLMPNILPVMMVQISINLGWAILNAAALSFLGL
FT                   GVQPPTPEWGIMVAEGAQYIPSGNWWLVAFPGAALMLAVLSFNLLGDAMRDFLDPRKRQ
FT                   "
FT   gene            complement(307465..308493)
FT                   /locus_tag="Arad_12407"
FT   CDS_pept        complement(307465..308493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12407"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12407"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31382"
FT                   /db_xref="GOA:B9JQG3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQG3"
FT                   /protein_id="ACM31382.1"
FT                   /translation="MITNGPWRMILHRLLMALPALFGILVLIFVVLRVLPGDPAALFAS
FT                   SPAAGEQEIAALRQQLGLDRSLPEQFGLYLVDLSKGNLGRSLLTGRPVLADLADRLPAS
FT                   LELIVPSFMVAVVIGVVLGTIAALKPDSWIDHVVRLICTVWISLPAFVTGLLLIYFFYY
FT                   LAGWAPAPTGRLDMFVVAPPAVTGFILIDAFLARDLEAFAAALNQLILPVLTLTFFAVP
FT                   PLARITRASMLAVMNSDFIRTARSLGLSSSRIVFVYGLRNALLPVLAVLSTTISALIGG
FT                   SVVIEKVFAWPGISAYAVDALMAGDYAPVQGFVLLVAILYLLVNLIIDILASLSDPRVS
FT                   LS"
FT   gene            complement(308508..310130)
FT                   /locus_tag="Arad_12408"
FT   CDS_pept        complement(308508..310130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12408"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12408"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31383"
FT                   /db_xref="GOA:B9JQG4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQG4"
FT                   /protein_id="ACM31383.1"
FT                   /translation="MTELSRRNLIKLAGASLPLLYLGSGGHALAESHNDTLRYITGGAF
FT                   NTLDPIGVGASADSVVLGASIYDRLVRFDRAPTDNKGSYVFDYNNIRGELAERYDVSQD
FT                   GLTYTFHLRSEATFHDGRPVTAEDVKWSLDRAVVANVTGRAQLQTGSLTDPKQFSVVDP
FT                   LTFQIKLEKADRLVLPNLASMFAPIYNSKLVRENVPADQPWGEAWLQNNTAGGGAYKVQ
FT                   SYKQGQQLVLVRHDGWKSSTLPAFPRVIIQTIPEAATRANLISRGDADITLNLLPETFA
FT                   TLRKNEAVKTIAEPMPGGIAYLIFNTKQAPFDDVRVRKAISLAVPYDVLFAIGASGQGA
FT                   PLFGAKWEKEPDTADYPQALPWRTDVEEAKRQLAAAGYPNGFTTKLHYNTNKAAFAASP
FT                   AALLQEALAKVGITIEIEPLPDAQWAEATSNKRLPLMIDRSFSMFPAADYFFRIFFLGG
FT                   QRWNLSQWDNAEVSEILPKARFETDPEKYAAYAKRLISLVYQEAPAILLWRPTQEVVTA
FT                   ASIGGFTTWFHNLVDPRDLARTS"
FT   gene            complement(310157..311500)
FT                   /locus_tag="Arad_12410"
FT   CDS_pept        complement(310157..311500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12410"
FT                   /product="nitrilotriacetate monooxygenase component A"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12410"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31384"
FT                   /db_xref="GOA:B9JQG5"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQG5"
FT                   /protein_id="ACM31384.1"
FT                   /translation="MTKRELHLNVNALNSGFHGAAWRASASNPAAFLDIDHFLAIARTA
FT                   ERGTFDAVFMADIPVMAGLPRSRPYQALEPTVVLAAMAVVTEKIGLIATASTTFNDPYN
FT                   LARRLLSLDHSSHGRCGWNVVTTADASAARNFGYDQQPPHHERYQRADAFTQVVKKLWD
FT                   SWEEGAFVGDKATGLFIDTDRVHPIAHKDDYYSVQGPLSLPRSQQGYPVLLQAGGSDDG
FT                   RDLAAKHAEAIFSIAQTIDEGTEFAADVRRRVLGYGRSGPILILPGLSTLIGSTETEVK
FT                   RREEELWGLYPENTALDRLAVLFRIDVGRLHLDKPLPDDIEMPANGDRTFAGATLTAAR
FT                   RDNLTARQLIRRLGGSIGHRFLVGTPKAIADDIEAWFVAGAADGFNLMPDVLPDGLTTF
FT                   VDEVVPLLRAKGIFRTHYTGRTLRDHFGLPVPLQNHGAPAHTSSAITH"
FT   gene            complement(311577..312863)
FT                   /locus_tag="Arad_12411"
FT   CDS_pept        complement(311577..312863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12411"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12411"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31385"
FT                   /db_xref="GOA:B9JQG6"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQG6"
FT                   /protein_id="ACM31385.1"
FT                   /translation="MNLLGFPWIMAQVVVTRKLIDRAMTLAARAHSEFPLPVVLNSPEL
FT                   ERFLEHVKAGASERDRNRQLPFDVVALIRQNRIGAIRLPLSAGGAGASFRQLLAFVVEL
FT                   AAADPNVAHILRNHFCFVELFAQPRVANSEKWTKLVAGGSIFGLAAGELGVTVGAGLVS
FT                   TTISREPSGLRVNGAKCYSTGSLYSDHILVRAAWEDGPKASVILPTDRKGVTIEDDWDG
FT                   IGQRLTGSGSTFLKDVVAHDEEIFPDAPEEGYRPAYSTTLGHLIVTAIAAGVVRAAAAE
FT                   AKDLIARRKRGFAHAPTPEPTQDPILLQTLGEISSAAFAAEAIVLAAADALDAVDAVVG
FT                   SGKRADDEAHAAALAASKAKVVVDGLALRAASSIFDVGGASATSRAENLDRHWRNIRTL
FT                   ISHNPASYKALAVGALELHSTPLPDNGFF"
FT   gene            complement(313026..313943)
FT                   /locus_tag="Arad_12412"
FT   CDS_pept        complement(313026..313943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12412"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12412"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31386"
FT                   /db_xref="GOA:B9JQG7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQG7"
FT                   /protein_id="ACM31386.1"
FT                   /translation="MAEFTLHDLQCFDAVVRSGGFQPAAAMLHRSHPAVFAAVAKLERQ
FT                   LGLVLLDRSGYRVRATDAGLSFHRRAQSLLRELEGLRAHAAQLSMGEETDIHVVIGDLC
FT                   PRPEVLGLLGRFFAQCPGTRLHLHFEAVGGPWERLIDGEADLILHWVEKSDSRAEWVDL
FT                   CNVPFIPVVAPGFLPKRIKQPITPDQMHTFTQCVIRDTARHSPQQDYFMIEGAPQCMVP
FT                   DQGMKKEIILQGLGWGHMPGFLIEEELRDGRLQSIAGRHLPGRTEELVVARRRDQPQGP
FT                   ISNRLWAYIQREAPILRHALKPAA"
FT   gene            314048..314839
FT                   /gene="pcaD"
FT                   /locus_tag="Arad_12413"
FT   CDS_pept        314048..314839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaD"
FT                   /locus_tag="Arad_12413"
FT                   /product="3-oxoadipate enol-lactonase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12413"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31387"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQG8"
FT                   /protein_id="ACM31387.1"
FT                   /translation="MTELNFVTVGDGTRIAYRFDGDAGKPVLVLSNSIATTLHMWDGQI
FT                   EDLSKHLQVLRYDFRGHGGSSTPAGAYSLDRLGRDVIEMLDALGVKRAHFLGLSLGGMV
FT                   GQWLGVRAPERIDRLVLCNTSSHLGPASYIEERIVATLQAPDMAQNAEAFLANCFPAAM
FT                   VAANGPIIEEFRAMLLSIDRQGLAGLFAAVRDSDLRRIVTLVSPPTLVIAGRYDTVTAL
FT                   SHSEQIAASVQGAELVVLPAVHLSNVEYPVEFIEAVLDFLR"
FT   gene            314927..315121
FT                   /locus_tag="Arad_12414"
FT   CDS_pept        314927..315121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12414"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12414"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31388"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQG9"
FT                   /protein_id="ACM31388.1"
FT                   /translation="MASALSRSYLLVQILCATIGASVTLSHARPSIRIKHSDNAIANHP
FT                   GTRFGAIVVGERFTPMGNV"
FT   gene            315317..316360
FT                   /locus_tag="Arad_12415"
FT   CDS_pept        315317..316360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12415"
FT                   /product="polar amino acid ABC transport substrate-binding
FT                   protein, aapJ-2"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12415"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31389"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQH0"
FT                   /protein_id="ACM31389.1"
FT                   /translation="MQAIFNVRRRITTAAAATMIAAATLLPNMANAGSTLDKIKERGVI
FT                   KVGVGTTPGFFTPDSSGRWQGFFVDFGRALAVTIFNNPDKVEFTNSSPQQRLPALQAGE
FT                   FDILLSGVTETITRAFKLGFHFGPVVFYDGQGLLVRKDLGVTKGADLDGATIGIQSGTT
FT                   GELNIADFFRKTGKKFTPVTIEETAEFTKALDSGRVDALTQDSTDLAAKRTQLKKPDDY
FT                   VLLPERLSKEPLAPAIRAGDDQWLEIVNWTIYATIQAEEFGITKDNVDTFLKSDDPAIQ
FT                   RFLGVDPSLGQAIGLDPKFAYNIIKAVGNYGEIFERNVGKGTPLNFDRGLNQLWTKGGL
FT                   IYSPPFR"
FT   gene            316371..317564
FT                   /locus_tag="Arad_12416"
FT   CDS_pept        316371..317564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12416"
FT                   /product="ABC-type amino acid transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12416"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31390"
FT                   /db_xref="GOA:B9JQH1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQH1"
FT                   /protein_id="ACM31390.1"
FT                   /translation="MNELRMRSHPIGPGFSKRGLLRRLRLWLGPAPAAQFAILLVCCTV
FT                   LWYFGINIAATMRRLGIEPGFAFLSQRANFEIGESLIAYSSADSYGRALLAGLVNTIYV
FT                   AVLGCILSTALGTALGIAQLTRNLVLTSFVRSYVEIFRNTPLLLQLFLWSAIFQNLPAA
FT                   RNAIKLAGAFLSNRGLYVPKLLLAGDAPVASTALSVLCGLIVVIALRRLLLGRPFYATQ
FT                   ISLAAIIAASATFWLSGGGIDLDLPTKGGFNITGGLSLSPEFAGLLAGLVFNSAATVAE
FT                   IVRGGIQSVQNGQWEAARSLGLRPGHIMRLIVLPQALRVITPLMTSSYLDLTKNSSLAV
FT                   AIGFPDLVNVANTTANTTGQTLEAIAIIAGAYLSLNLAVSLAMNLFNSRIVQIEGRR"
FT   gene            317564..318634
FT                   /locus_tag="Arad_12417"
FT   CDS_pept        317564..318634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12417"
FT                   /product="ABC-type amino acid transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12417"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31391"
FT                   /db_xref="GOA:B9JQH2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQH2"
FT                   /protein_id="ACM31391.1"
FT                   /translation="MSELQIGLSKWRRRPVTKGLLDNRSNTIITICSLAILVWMVTPLL
FT                   RWAGRAAIWSGTGSDCSVEGAGACWAFIAAKFRFIIFGFYPPALQWRPALAMFCICVLL
FT                   SISANPRYWGSKLLISWPVVILLLWLLMAGILVAPPIPTNQWGGLPITLIVSVIGLATA
FT                   FPIALLLALARRSSMGILRTLAVAFIECLRGIPLIAVLYIAMLIIPMALPSEATLDKLL
FT                   RAQIGITLFVSAYLAEVIRAGLQSIPAGQLEAAYSLGFGYWRTTQLVVLPQALRAVIPA
FT                   IVNLSIGILLNTSLLAVIGISDLLNTGKIAATDPVWLGFYTEAFVFTGAIYFAISFVAS
FT                   RYSLWLERRLAAGRNH"
FT   gene            complement(319036..319869)
FT                   /locus_tag="Arad_12419"
FT   CDS_pept        complement(319036..319869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12419"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12419"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31392"
FT                   /db_xref="InterPro:IPR016980"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQH3"
FT                   /protein_id="ACM31392.1"
FT                   /translation="MFLSRRIALKTIACLGILVSAFCTSPAYSQSVDPALQSLIGDSQR
FT                   SQPNSVRDKYRHPGEVLTFFGVKPDSVVVEILPGAGGYWTEILGPYLKQKGRYIAANGE
FT                   KDSASAEVQKDNAALAAKLAADPADYDRVEVTEFAANKHAIAPAGSADFVLTFRNIHNW
FT                   MAAGTTADAFTAFYKALKPGGVLGVEEHRGKPGEPQDPLAKSGYVRQDVAIGFAEAAGF
FT                   KFVGSSEVNANPKDTKDYPAGVWTLPPTYKLGAQDHGKYEAIGESDRFILKFQKP"
FT   gene            complement(320120..321409)
FT                   /locus_tag="Arad_12422"
FT   CDS_pept        complement(320120..321409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12422"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12422"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31393"
FT                   /db_xref="GOA:B9JQH4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQH4"
FT                   /protein_id="ACM31393.1"
FT                   /translation="MTSKRSGHVVLGINVLVLGYLPAAWKTPLLKKDSFIDPDYWANLG
FT                   KTAERGTLDALFLADGPLLGDPAYDANPIRLEPTVNWGHVAAATSRVGLVATASSTFND
FT                   PFELAERLLSWDHQTGGRAAWNVVTTRGVPAARNFGMPDIPSRDDRYERASEFVDVVRA
FT                   LWNSAATGQDVHHHGEFFDVDGRLRVPPSKQGHPVIFQAGGSPQGRALAGRAAEGVFAA
FT                   ELTKNQAIEHYRLVKGFARSNGRSPDDIKILPGLLLSLGSSEEEARRRSDKIHDAGPAS
FT                   YSIAWLSQAIGYDASKLELDERFPEDVLGPLKDTQTFLGSIGFRESIITQIRKTNPTVR
FT                   EYLKQTRYIGSGHAGFVGTPEQLADHIEDWFHAGAIDGFNLQPDRLIDGLAVIVDELVP
FT                   ILRRRGLYRHEYETETLRGHLQAASPTPSF"
FT   gene            complement(321431..322354)
FT                   /locus_tag="Arad_12423"
FT   CDS_pept        complement(321431..322354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12423"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12423"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31394"
FT                   /db_xref="GOA:B9JQH5"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQH5"
FT                   /protein_id="ACM31394.1"
FT                   /translation="MTRPYLALGLAGPHLVELTESRALLSRWDALAVAFSVLGIDRVDG
FT                   SAPAPVTLTSSAVGATLASATKYGRFFITASPQRDHPYNIARRVASLAHLSRGRSGLLI
FT                   GVRDAYAPEGPKDAPAWGGAGLGGGAPLNAQTAYDAARAVRALEQSWPHDSIIGNRETG
FT                   ILVESNRIVHVDIDNSFSIAGPLNAPEPATGASVISWYAATVADVPPVGGNDPIELVFG
FT                   AAGSVPVVALGEEPPVGAVAGVVLRAGLEQSVGNLLDTAERWLADGFAPIALGGSLRVA
FT                   LNLPAPAALPPTARAAFPLPQPHVSL"
FT   gene            complement(322367..323617)
FT                   /locus_tag="Arad_12424"
FT   CDS_pept        complement(322367..323617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12424"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12424"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31395"
FT                   /db_xref="GOA:B9JQH6"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQH6"
FT                   /protein_id="ACM31395.1"
FT                   /translation="MTAVDASTSLTYLRPATANEEALVARFQPIFDRIAEGNVERERNR
FT                   TFPVEQVQWLKDADFALLRVAEEFGGWGASLEQTYYLLALLAEADANVAHVWRNHLAFI
FT                   EDRLNARPSPTNDRWFQRFRDREFVGGGWTEANNGTYATIKTTVTREGDHYKVTGAKFY
FT                   ATGSLYADWLDVIGKGEDGSLITTLVNRHQPGVVLTDDWPGFGQRTTASGSATYREAIA
FT                   HEGDVFPASERVVYQGHFYQTALLAVLTGITRAILRDGITALKSRGRNYPQGLNEVPAL
FT                   DPQLLQVIGEVSVRVFSTEAALRRAANSLDQIAAAHAAGDVALRDKRAIAGEVAVAQAQ
FT                   LAIIDGVLHAATHVFGALGASATSEETALDRHWRNARTLASHNPVAYKARILGDYLVND
FT                   NSPVSSIARLGRGGQGN"
FT   gene            complement(323760..324752)
FT                   /locus_tag="Arad_12425"
FT   CDS_pept        complement(323760..324752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12425"
FT                   /product="peptide transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12425"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31396"
FT                   /db_xref="GOA:B9JQH7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQH7"
FT                   /protein_id="ACM31396.1"
FT                   /translation="MAKQFSTVVLRSISTLVIILILSFFISRIAYRDPAAMLAPRNATQ
FT                   ETIDAVARSLRLDEPWYLQLWYYLFRGPDIQGAPMGLMHWPPALGFSFRKQAPVTDLIL
FT                   AKAPVTLSLALGALVIWMAIAIVSGVVAARWQGRFIDHVLAFFAYAGLSVPTFLSGILI
FT                   SYFLFFQLSNHGIPWFPSSGYVPLTEDPLQWARHLLLPWATLAIAEIGIFQRVVRASTL
FT                   DVLGHDYIRTARAKGVSERRIYFSHALKSALNPILTLGGLELGAIMGGAIVTETIFGLD
FT                   GVGRMAIGAALDGDFPVVIGTTIFAAAAFIVTTLAVDLVAQWRDPANRN"
FT   gene            complement(324757..325716)
FT                   /locus_tag="Arad_12426"
FT   CDS_pept        complement(324757..325716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12426"
FT                   /product="oligopeptide ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12426"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31397"
FT                   /db_xref="GOA:B9JQH8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQH8"
FT                   /protein_id="ACM31397.1"
FT                   /translation="MRAMADRIQSAAASFLSGQSSSPAIVFLKRLWRERAVRAGASIVG
FT                   FVLLAALLAPAVGYLLGHGPMEQFQDTALDEMGLPIGPTLAFPLGADGNGRDVLIRTLY
FT                   GAQVSLIVGIPSTTIAMIIGTAIGLVSGFFAGRTDRVISQGIDVALSFPFVVTALSLLS
FT                   LNRGGTGQPIISPVVVVILIISLFSWAYFARLTRGLVLELRTSPMVEASRTIGASSARI
FT                   IWFDVLPNILPTLFVYWAVQLPANIVAEATLSFLGLGIQAPTPSWGNMIAEAQRTSLYQ
FT                   NQPWFLAGPGLALFLTVVGFNTLSAGLRNVLDPHRRRI"
FT   gene            complement(325700..327310)
FT                   /locus_tag="Arad_12427"
FT   CDS_pept        complement(325700..327310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12427"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12427"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31398"
FT                   /db_xref="GOA:B9JQH9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQH9"
FT                   /protein_id="ACM31398.1"
FT                   /translation="MSVFSVDDLRVRFGGVQAVKGVSFDIDAGKTLAIVGESGSGKSAS
FT                   LLGATGLLPTSAAVEGSVLHRGRELLGLPDRELRRIRGAKIGFVFQDPLSNLHPLKTIG
FT                   EQIGEAISVHRKVGRREKRERVLALLDDVGIADPQARLVEYPRHLSGGLRQRVMIAIAI
FT                   ALDPALIIADEPTTALDVTVQAAILDLLKRLQQEHGTALIFASHDLAVVSDIADDVVVM
FT                   RDGVVVEKAPASEIYLRPRQDYTRELLGAARLGGTKIYAVGRSWEVPRPLLAVQAISRS
FT                   FGSRSVLDGVSFTIGEGEILGLVGESGSGKSTIGRLIAGLDRPDAGLISLRGVDYSRPG
FT                   PGGGVLQGNRRRSIQMVFQDPYASLNPRRRIEAILSDPFVIHGAIGKAELREKVKQLVT
FT                   DVELPHEILDRLPSQLSGGQRQRVAIARAIALRPSLIVADEPVSALDITTQAKVIALLS
FT                   RLRDKLGVSFLFISHDLGVIGELCDRVIVLEKGHIVETGPTRQVFERPVHDYTRQLLAS
FT                   IPGRKRLPAYAELEDASHG"
FT   gene            complement(327324..329084)
FT                   /locus_tag="Arad_12429"
FT   CDS_pept        complement(327324..329084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12429"
FT                   /product="extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12429"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31399"
FT                   /db_xref="GOA:B9JQI0"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQI0"
FT                   /protein_id="ACM31399.1"
FT                   /translation="MHVTVLLRSAGRIAAPFLAVYTALCAPSFADEPKFGGTLRIASLE
FT                   SDLDAFDPLTGYSTDSWEILRATTRQLVTYPGSPIGLKEDTTLVPDLAKSWDVSQDGKT
FT                   YTFHLKDDIFFSGSTERKIVAGDFVYGIKRFCDPNKQVAAINYFNLVLSGFVQYCKDFS
FT                   KVPTGDLAASKAFIDSHQISGVSAPDDKTLVIHSDTKNYDFLNILSMNFVSPVASEIAS
FT                   KYFPDSVESRRNLPSSGPYYVASYDQGQKLVLKKAKNFKPESDEARKAYVDEIDVDFTA
FT                   NSEDAVVQKIQAGEADLSLYLDTPPRGAIQQYVSKKSPYLHATNSGSANFITINAQKNA
FT                   TSEGIEALRKPEVRQAFSYAVNRAHLVQSQGGSIAAVPLSQIITSTISGYEQFDPYPTE
FT                   GNKGNPAKAKELLAKAGYPNGITLDALYRTNAQNETIAVTLKEDLAAAGITLNLIPAPA
FT                   SQWRAYIQDPKSRWDVFLNGSFSPDWQGPSTRMLLGGWLNSDAAPCGAGNVYAICYSNP
FT                   ELNKLAAEAYPSDNADALWTKADKIVSTDLPWIPLFEKRKIAITSDHITQWVWSSLAVQ
FT                   ADITNIAVKN"
FT   gene            329426..331021
FT                   /locus_tag="Arad_12433"
FT   CDS_pept        329426..331021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12433"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12433"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31400"
FT                   /db_xref="GOA:B9JQI1"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQI1"
FT                   /protein_id="ACM31400.1"
FT                   /translation="MVFDGLSRNTASRFLGALLGLALVTSAAFAEDRGGTLNLIVQPEP
FT                   ISLNPGVNRLGPATFVGDKIYDSLVSYAQKDLAPIPRLAESWTVSPDGKTYTFKLRAGV
FT                   TWHDGEPFTSKDVSFSYSEFLPALQARSRDLRNEIERIEIPDDLTVVFVLKNPYPAFLR
FT                   SLNAAIVPAHKYVGVTDFRNAPANAEFIGTGPFKFAEWKKGSLIRLVRNDKYWDTGKPY
FT                   LDEIDFQIIPDANSRAIAFETGQVDALRAGDVENFDIPRLSALDGVKIREDGWEYLQPI
FT                   GYVHLNNRNPILAKLQVRQAITQAIDRDFIINTIFAGFGKPINGPFSSLSVYKDASVET
FT                   VYPFDPQKAAALLDEAGYKPGPDGTRFTLKLVPLPYGELWSREAEYLREALGEVGIKVD
FT                   IVSTDVAGWFKRLTIFDYDIAENFVYTTADPAIGISYGYKTVKGDKAGTTGANVNGYSN
FT                   PEVDALLDQGSHQPDEAKRKEIYSKVQQIISHDVPLVWTHDIVFPTLYRDRVQDLITTA
FT                   LGTDDNFASVWLRK"
FT   gene            331006..332052
FT                   /locus_tag="Arad_12434"
FT   CDS_pept        331006..332052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12434"
FT                   /product="inner membrane component of
FT                   binding-protein-dependent transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12434"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31401"
FT                   /db_xref="GOA:B9JQI2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQI2"
FT                   /protein_id="ACM31401.1"
FT                   /translation="MAEEMSRPSDRIRVHGQGAALGFVQAVSLRLAKAAITLLAVIVLT
FT                   FVLVRLAPGDPALLLAGDQGGSDPAFVAEIRQHLGVDGPIHLQLWHYLQAVARLDFGTS
FT                   YRDQRPVIDIVLERLPATLLLTISAFVFSIVTGVGLGALAARRPGSAIDSAVTTLSVAF
FT                   FAMPMFWIGLIFIIVFAVKLGWLPSYGMQAASAAAKGGWAAFGDLAAHMVLPVLTLGLY
FT                   YMSIHARVSRAALLQISDMDFIRTARAKGLPAWLVWRDHLLRNALLPTVTVAALQAGQL
FT                   IGGSILVETVFAWPGIGRLAFDSLASRDYNVLVAVFILSSFGVLIANLIADMAYRLIDP
FT                   RIDREVTT"
FT   gene            332049..332888
FT                   /locus_tag="Arad_12435"
FT   CDS_pept        332049..332888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12435"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12435"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31402"
FT                   /db_xref="GOA:B9JQI3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQI3"
FT                   /protein_id="ACM31402.1"
FT                   /translation="MIRRPRHPLLRAPVLFGFAVLALLLFCIVFADVLYPGDPWRMVSR
FT                   PNLPPLSPGYPAGTDMLGRDLAAGLVHGARATLAVALSVVCLAIGLGVTLGLAAGYFGA
FT                   AVDDAVMRVTEFFQTIPSLLLTIIIVAILSPTRLIVVLAIALISWPPVVRIVRAEVLSL
FT                   RRLDWVRAARVSGLSHLRIALLHVLPNVLPQVMIQASLLVAGAVMIESSISFLGLGNRD
FT                   AVSWGFLLGSGRTAFSVNWWLSTLPGLAIFLTVLAFNLVADGLERWLNPKSGAGGGR"
FT   gene            332885..334561
FT                   /locus_tag="Arad_12436"
FT   CDS_pept        332885..334561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12436"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12436"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31403"
FT                   /db_xref="GOA:B9JQI4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQI4"
FT                   /protein_id="ACM31403.1"
FT                   /translation="MSQSQPAATAPLVEIENIDIRLPEGGERELAVHDATLSIARGEVL
FT                   CIVGESGSGKSVLASAIAGLLPGNGLRVERGNLRFAGEDVLSLGETALRRLRGARIGYI
FT                   FQEPMTALNPLLTIGRQIAEALKAHGHPAPPERIAELLAAMRLPDPGTLRRRYPHELSG
FT                   GQRQRVAIAIAMACGPDLLIADEPTTALDVTTQAEILRLILDLRARRGLAVLFITHDFG
FT                   VVRDIADRIVVMQNGEIVEHGNAEQLLSAPTHPYTRRLLAAVPKLEARRSPLASDLPAA
FT                   LELEGIHKTHFTRRHFLGSARPATQALGGIDLTLRIGETVALVGESGSGKSTLGQVITG
FT                   LVERDAGTFRLSGEAIGRARDLFTRERRPAVQMVFQDPQSSLNPRHSIRRILTEPVLQT
FT                   GLSKEEAETRMMELLLRIGLDPSSADRKPHAFSGGQRQRIGLARALMPRPRLLVADEPV
FT                   SALDVSVQAQVLDLLAELQSDLGLAMLFITHDLRVAARVADRIAVMQHGVIVEEAATAD
FT                   LLRTPRSTYARALIAAVPGRNGETEPVANSSSRILEETPHD"
FT   gene            334973..335974
FT                   /locus_tag="Arad_12438"
FT   CDS_pept        334973..335974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12438"
FT                   /product="alkanesulfonate monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12438"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31404"
FT                   /db_xref="GOA:B9JQI5"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQI5"
FT                   /protein_id="ACM31404.1"
FT                   /translation="MARAAEEQHFHSVLTPTGTWCEDAWITTAALSHETKRLKFLVAFR
FT                   PGLISPTLVAHQAATFQRMTGGRLLLNVVTGGDRFEQGRFGDHLDHDARYERTEEFLSV
FT                   VRGVTSAPAGQPFSFKGKHYDIREANIDTSPYDLPQIFFGGASPAAQEVAAGQADVYLV
FT                   WARSPALEAENIAQLKARAAARGRSLRFGVRLHVISRDTEDEAWAMADKLLAWLSPERV
FT                   RKNWELLAKSESVAQSQMSALHVGREGLPASARELEIYPGLWTGYGLVRGGAGTALVGS
FT                   HTQVADLIEAYHHAGFDHFILSGQPHLEEAWHFGEGAAALLKTRGLLAPVSM"
FT   gene            336172..337401
FT                   /locus_tag="Arad_12440"
FT   CDS_pept        336172..337401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12440"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12440"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31405"
FT                   /db_xref="GOA:B9JQI6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR025559"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR041380"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQI6"
FT                   /protein_id="ACM31405.1"
FT                   /translation="MTLDNSYMDIRPLNDEEGRRKAFALFRQALLGIGDFGRTNPEIEA
FT                   RILREGKPLGAFEDNVLRGVVNGYDSSITLPGGKRVRHLSVTHVGVSPDATRRGIARLL
FT                   ITEQLRRARAEGYVVAGLRASDPRIYGRYGYGVASWSARHDLDLTRTELAISPSREGLR
FT                   IVDAREAFALFRRIADADAKPRAATLSRWEGWWAMQEYRTVHSPTPHHAVVFGPEGNER
FT                   GYLRFHVEPSDNWFTSSSRAVVVDDLVAHDDEAWQVLIGHLFTQDILHRVIFPSRPVDD
FT                   PLPLLLNNPRALEISGQRDESWIRALDLEALLTARRYGGTRQVTIAVEDNVFQDNGGIW
FT                   SLGPEGAERSSRRPEAHVAIAELTTLIFGAQHASLLAASGRIKTIAVEVTEELDRVFAS
FT                   SRRGHSGISF"
FT   gene            337479..337883
FT                   /locus_tag="Arad_12441"
FT   CDS_pept        337479..337883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12441"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12441"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31406"
FT                   /db_xref="GOA:B9JQI7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQI7"
FT                   /protein_id="ACM31406.1"
FT                   /translation="MADPIIVVTRAPDRQTIEAIASGLNSFNDEVTGIDDRLPLAVFAK
FT                   DPVNGNLIGGVTGRTSLLFLDVFYIARNHRGLGLGRRILQSAEEEGRRRGCRRGFSIQS
FT                   ASRLRASTNAMAGEFSVKYPAIHREQAGYS"
FT   gene            338141..338794
FT                   /locus_tag="Arad_12443"
FT   CDS_pept        338141..338794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12443"
FT                   /product="phosphoribulokinase / uridine kinase family"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12443"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31407"
FT                   /db_xref="GOA:B9JQI8"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQI8"
FT                   /protein_id="ACM31407.1"
FT                   /translation="MHIRTGFIEQLVHQITTLEGRVVVAVDGVDGSGKTTFADELALLV
FT                   MKANHSVVRASVDGFHNPKEIRYRRGKSDPEGFFLDSYNYDGLRRLLLDPFRSGAALVD
FT                   IARYDHATDEEISKPESVEPSAILLLDGIFLHRDELQDQWDFSIFLSVPFSVSYARMAV
FT                   RDGSKPDPLAPENRRYHQGQLIYLQTCKPEDRATIVIDNSVIEAPKLVHRRPEH"
FT   gene            338853..339350
FT                   /locus_tag="Arad_12444"
FT   CDS_pept        338853..339350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12444"
FT                   /product="phage-derived invertase/resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12444"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31408"
FT                   /db_xref="GOA:B9JQI9"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQI9"
FT                   /protein_id="ACM31408.1"
FT                   /translation="MIFGACSQPYQPFCSTYAQVSTEDQLNDAQVDELHVTGCHRIHQE
FT                   LGSGTSRTRPVVAKLLKELAADDVLVVARLDRLARSVSHLLISSRTSRSAACISAGCAI
FT                   RSIHRRCRGSWLPESPSPIRICRCAILLPNWPRCMRDLRAEVGNSNRLLSGRRWTMLAA
FT                   WD"
FT   gene            complement(339406..339954)
FT                   /locus_tag="Arad_12445"
FT   CDS_pept        complement(339406..339954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12445"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12445"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31409"
FT                   /db_xref="GOA:B9JQJ0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQJ0"
FT                   /protein_id="ACM31409.1"
FT                   /translation="MDDVYRLPEKFETQRHLVRRIRLSDAEAIFAGWATDPEVTKYPVW
FT                   RPHADISQAHDLTKHGDQEWQNGTSFPGVISPRGTPTELIGMIPPRLNSSRVSYGWLIR
FT                   RDYWGQGVASEVVRWVVEHALSQPAIFRAEATCDVENIASARVMEKAGMMREGLLLRYT
FT                   LHPNISNEPRDSLLYARVR"
FT   gene            complement(340478..340822)
FT                   /gene="ihfA"
FT                   /locus_tag="Arad_12446"
FT   CDS_pept        complement(340478..340822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ihfA"
FT                   /locus_tag="Arad_12446"
FT                   /product="integration host factor, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12446"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31410"
FT                   /db_xref="GOA:B9JQJ1"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005684"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQJ1"
FT                   /protein_id="ACM31410.1"
FT                   /translation="MSMKTVTRADLAYAVFQKIGLSRTESSDLVEVVLGEIGDALVRGE
FT                   PIGLSSFASLQVNAKTHRPGRNPRTGEEVLISARRVVKFTASDVMKSRIQKAHKTRKAK
FT                   LKASPPDPSR"
FT   gene            complement(341446..341649)
FT                   /locus_tag="Arad_12448"
FT   CDS_pept        complement(341446..341649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12448"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31411"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQJ2"
FT                   /protein_id="ACM31411.1"
FT                   /translation="MAQKRRFVRFFSLLGAHRENMICSWRGTYEAWFRSLIIESNNDAS
FT                   HDTSNSRMFSPTEHRGAFSPAI"
FT   gene            342115..342297
FT                   /locus_tag="Arad_12450"
FT   CDS_pept        342115..342297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12450"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31412"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQJ3"
FT                   /protein_id="ACM31412.1"
FT                   /translation="MSHRKNVAMLDVMLGNEARAADGLSLGMSAAVEPAGSVTLNGYVP
FT                   GGEFHTKLTAIAISR"
FT   gene            complement(342415..343299)
FT                   /gene="cysE"
FT                   /locus_tag="Arad_12452"
FT   CDS_pept        complement(342415..343299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="Arad_12452"
FT                   /product="serine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12452"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31413"
FT                   /db_xref="GOA:B9JQJ4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQJ4"
FT                   /protein_id="ACM31413.1"
FT                   /translation="MTTQTALPGPFGRESALAKTIIGEGAIVGHFPSEVLWTTLCVEAR
FT                   TVADNDPRLAQAMNSNILVHPTFARGLAYRFSETLANRDVDAGVLTSLSLDVFQSSPEI
FT                   ITSAVLDLQAVYDRDPSTSELLIPFLYFKGFLALQGHRIAHWLWRVNKKHMARHIQSRT
FT                   CEVLSIDIHPAAHMGSGIMLDHGNGLVIGETAIVDDDVSILQDVTLGGTGKETGDRHPK
FT                   IRRGALIGAGAKILGNIEIGVGAKVGAGSVVVSAVSAHTSVAGVPARVVGRPKSDLPGV
FT                   TMEQPTADPDYAI"
FT   gene            complement(343329..344069)
FT                   /locus_tag="Arad_12453"
FT   CDS_pept        complement(343329..344069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12453"
FT                   /product="4-phosphopantetheinyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12453"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31414"
FT                   /db_xref="GOA:B9JQJ5"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQJ5"
FT                   /protein_id="ACM31414.1"
FT                   /translation="MVSREVAGWMEDLAAIGSQLRSNWLEGEFHEVVSINVPHQPIDPN
FT                   GLPISTKEWGRAGSFRRVMDSNRSVTGWTAVRGIVGAMLQIPPNDVKIIRAANGKPSVH
FT                   AGPGISISHAGDIAVVAFSSEMTIGVDVEQIDGGASFLPAVMRTLSPSELEYLNGHPGG
FT                   QAKFLLRAWARKEATAKVFGSGLSVDFQCLTVANQAGRRFQCRLPSGNVIVKGTDLEMG
FT                   SGYTAALASTANIIDVYSYHVTGR"
FT   gene            complement(344152..345189)
FT                   /locus_tag="Arad_12454"
FT   CDS_pept        complement(344152..345189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12454"
FT                   /product="High-affinity nickel permease"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12454"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31415"
FT                   /db_xref="GOA:B9JQJ6"
FT                   /db_xref="InterPro:IPR004688"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQJ6"
FT                   /protein_id="ACM31415.1"
FT                   /translation="MFPNPFDDKPFQTRAKAATTFVFLIAANIAAWVWAWVAFADRPAL
FT                   MGTAFLAYMLGLRHAFDPDHIAAIDNVVRKLMQEGKAPYSVGFFFSLGHSTIVVLASIV
FT                   IAATAAAMQLNEIAEIGGVIGTTVSAVFLLIIGIANLLVLKGIWSAFKRVRRGEKIVDE
FT                   DLDAFLAGRGLIARIFRPVFRVVSRSWHMYPIGFLFGLGFDTATEIGLLGISAMQAAQG
FT                   MSFWTILVFPALFTAGMSLMDTTDSVLMTGAYGWAFVNPVRKLWYNLTITAASVVVAVF
FT                   IGSLMAAGLLVDKLALNGHFWRLLGELNDNLSSVGYGVVGIFIVSWIISIIVYRRKGYD
FT                   TLPAQ"
FT   gene            complement(345274..345765)
FT                   /locus_tag="Arad_12455"
FT   CDS_pept        complement(345274..345765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12455"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12455"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31416"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQJ7"
FT                   /protein_id="ACM31416.1"
FT                   /translation="MTQFSKTLFPGEGESVQIGTTTHTTFKAVGKETDNRIGLFEHRMK
FT                   PGAPGASPHIHRHQLEAFYVLEGTVEIFINGEHVAAPAGTYIQVPEDVPHGFHNPFDKE
FT                   AVMLIFFSPGQNREEYFRRLGALYANGRRASEQQLIDLMAEFDQFEVEYTGNVPGWGRH
FT                   "
FT   gene            complement(345841..346884)
FT                   /locus_tag="Arad_12456"
FT   CDS_pept        complement(345841..346884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12456"
FT                   /product="cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12456"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31417"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQJ8"
FT                   /protein_id="ACM31417.1"
FT                   /translation="MSGVNPLSSSNASVAAIPAPYPDLEKGKAPQTGNRNEVSASPTAK
FT                   AARFFGSGIGGTPTLELPADLAGGRGVFAKLEKYNPYSSIKDRPAWYMLAGAEARGQLV
FT                   PGTGTVVEATSGNTGIALAGFARARGYRCIIVLPDSASKERIELLKFFGAELELTPSEA
FT                   GYTAAIEKAQQLRDATPGAWFACQHENADNVLAHYETTGPELWRDLSGNIDILVCGVGT
FT                   GGTISGIGKYLKEKNPEIKIIAVEPSRSAVLSGKLGGIHRIPGLNGGFVAATTDRALID
FT                   EIVTVDDEDAWVMARKLAAAGIVAGISSGAVTHVCRHVRQRAAVAGARIATIFPDSGER
FT                   YVSLLSS"
FT   gene            complement(346881..347798)
FT                   /locus_tag="Arad_12457"
FT   CDS_pept        complement(346881..347798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12457"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12457"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31418"
FT                   /db_xref="GOA:B9JQJ9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQJ9"
FT                   /protein_id="ACM31418.1"
FT                   /translation="MEKATAARFFGQAAIWGASFTFIKFALQDFSPNQLVLFRLILGAV
FT                   TLAAIILFTGRSFKLSGTAWFHVAVSSIFANVVPYLLLSFGEQHTSAGLAGVLIGGTPL
FT                   VTLFISTLALRAEPATPRKVTGFFLGFLGVALVVSPWKVEGSSLLGALACFGAAASYAV
FT                   GYAYVSRFLSPLKLDPITLGANQLISAAVLLGLALPFFAWPAIETVSVIPLLSLLYLGV
FT                   LASGFANILYFRLIQDVGAATASAVDYVVPVFAVLFGAVLLLEPLSWNVILGGAVILIG
FT                   MAIAEGRIGSSSLSPASSGKANKS"
FT   gene            complement(347810..351862)
FT                   /locus_tag="Arad_12458"
FT   CDS_pept        complement(347810..351862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12458"
FT                   /product="indigoidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12458"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31419"
FT                   /db_xref="GOA:B9JQK0"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQK0"
FT                   /protein_id="ACM31419.1"
FT                   /translation="MTSSTLIQKLKEQVRRHPHRVAVASDTGSLTFLDLWRRSGQVAVR
FT                   LRLQGVRADTVVGVFVDSSLELEIAIWAVLRAGGAYLPLSPEYPSTRLRYALEDSGAKI
FT                   ILTTGPLASDARTITPSEGSIVCVEEHWETEGEDAQDGGDVCPNDLAYVIYTSGSTGRP
FT                   KGVAIEHGSIAHQLNWLHDAMGIDESVRILQKTPFSFDAAQWEILAVALGATVVMVGIG
FT                   TYRDPARLIETARRHAVTTLQCVPTLWSALLDAEGFRDLNLSQIFSGGEALTSHLAQGL
FT                   LAAHPSASVTNLYGPTETTINVSAYTVKADQLDDTDRVLPIGYPVYGTDLIVCEGPTEI
FT                   EDGDIGELCIAGPQLARGYIGNAEMTAEKFTTLIDAKGRERRVYRTGDLAIKGADGAVA
FT                   FHGRVDNQVKVSGHRIELDEIRLAIENHLWIRRATVVPWKTRLGTTQLAAFVELDDTEA
FT                   ALMDQSAAGSHHKSKASRRQVNAQLSNSAFRAPDELDGNSVILPFREASEDVAAQAFAR
FT                   KTYRNFRTRVRADRLVEAIRQIQHPPVSTSAQDVKLDKALIGQILRWFGPFTSDRRLLA
FT                   KYAYASPGALNASQIFVDVNGVEGLWPGLYYFHPADHTLTLVSPGTRSGGGVRFHIYGK
FT                   RGRIQEVYSTNVDEVLHLEAGHMLGLLEHVAAAHGLFPVKAAPPHTIPATLFSGDDYIH
FT                   TLSVELDRKPAPPPFAAPVILLQIHEETPDGVGPGTYRVDNDRLTIVGEPVIRRKDVIA
FT                   INQAVYDRSTFGIALIVSKDAGWEGFVDLGRLLHRLQVADPDIGLMSSGYSSLSGHEMA
FT                   TSSRVDALIGAETFSGNGTLSYFALGGGVSAEQRSSRGMEEDLVHMRGPTEILKDDLRE
FT                   LLPEYMVPARVRVIETTPTTPSGKIDLQSLRNLVEAEESARPIVPPGTRLELEVAAIWK
FT                   EILRLGEEELSIRDSFFDVGGNSLSAMALINRFNARFGTRLPIQALFAAPTVEALAGEI
FT                   GAGAATLSSRLVPLNAAPAARPVYCWPGLGGYPMSLRTLVRATGDNRHRFLGVQAHGIN
FT                   LDEVPFPTIQEMAAADVALIQRDHPVGPLTCIGYSFGARVAFEAAYQLEQLGRRVERVV
FT                   LIAPGSPLQKAAEAPPTADQFQDGRFLRILLSVFAGTLNSPLETELLGAVRDERAFIDF
FT                   ITDKFEDLQAELVARIVGVVKATFSFEYTFHELDQRTVAAPITLIKALGDDYSFLETAG
FT                   SRVRQSFQQVIELSHDHYSILRGEGHTALAQALSDLLSSDQEILMPHISVKHFPAQIDE
FT                   GRRQILADELASAVIKAFGCAPNVVSVALEPVEEANWDALVYQPEIIGRQKFLVRQPNY
FT                   DQRQNAK"
FT   gene            complement(352053..353626)
FT                   /pseudo
FT                   /locus_tag="Arad_12460"
FT                   /note="dipeptide ABC transporter, ATP-binding protein;
FT                   Frameshift (pseudogene)"
FT   gene            complement(352787..353626)
FT                   /locus_tag="Arad_12461"
FT   CDS_pept        complement(352787..353626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12461"
FT                   /product="ABC transporter, nucleotide binding/ATPase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12461"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31420"
FT                   /db_xref="GOA:B9JQK1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQK1"
FT                   /protein_id="ACM31420.1"
FT                   /translation="MSAPLLDICDLKVSFRRPGGYADVVKGVSFTLGRERLAIVGESGS
FT                   GKSMTVRSLLGLAGHNAIVTAHHARFGEMDLLSLSGRQLCAIRGHRIAMVVQDPRQGLN
FT                   PVQTAGRQIAEMLRIHRQTPRRDVRNAVEMLLDEVHIRDPRRVFDLYPHELSGGMAQRV
FT                   MIAMMLAGGPDILIADEATSALDAIVQRRILELIDEQVRLRGMGLILISHDLELVSDFA
FT                   DRVLVMYAGRTVETLISGQGYQTAQHPYTRGLIGCVPTLDDPGRRLPILTRDPDWAR"
FT   gene            complement(353639..354529)
FT                   /locus_tag="Arad_12462"
FT   CDS_pept        complement(353639..354529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12462"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12462"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31421"
FT                   /db_xref="GOA:B9JQK2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQK2"
FT                   /protein_id="ACM31421.1"
FT                   /translation="MGKVKTWLLDDSPNTRLQAQLGRVTRDVSALLHDPIASTGLLIVA
FT                   LMVGEALLATFLPVQNPGFQALGDRLQPPSAAHWFGTDTLGRDIFSRVLSGARPTLSIV
FT                   ACVLAIVLPFGVLVGITAGIFERLDAPIMRLCDVFMAFPRLVLAIAVAVTLGPGISTAI
FT                   IAIALTGWPSYARIARAEAVALRRAEFVQAAQVIGASPTRIMFTHILPLCLPSAIVRAT
FT                   LDASSIILITSGLGFLGASVPPPQAEWGAMVAEGRDVIFEAWWVSTMPGIAILTFALGF
FT                   NLLGDALRNLVDPRS"
FT   gene            complement(354533..355654)
FT                   /locus_tag="Arad_12463"
FT   CDS_pept        complement(354533..355654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12463"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12463"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31422"
FT                   /db_xref="GOA:B9JQK3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQK3"
FT                   /protein_id="ACM31422.1"
FT                   /translation="MTNEIPTLPSGRALFVGFAPAFSLAARQAWVYVRAIAQVFLRLAS
FT                   AAIVPAVVLLGLLFVIFTIGRLLPTDPVLTVIGDHAPQELYERMHREMHLDKPIPEQFV
FT                   LFVLDMARGNFGVATTTGNAVAQDIGRFLPATVELATVAILLGVGLGVPVGLLAVRFSG
FT                   RWPDGLVRLATILGSSIPIFWMGLVGLLLFYGHLGWVAGPGRLDIAYQYTIPAVTGLVL
FT                   VDTALSGNMAAFGNAVSHIVLPAALLGLVAFSDIARTTRGFLLWQYGQDYINVARLKGL
FT                   SETRVLWRHALPNAVGPLLAVVAWNYAYLLEGAVLTETVFAWPGLGLYITQSLMASDMR
FT                   AVLAGTLIIGTMFMVLNRVAEVAQARLDPRTRG"
FT   gene            complement(355878..356531)
FT                   /locus_tag="Arad_12465"
FT   CDS_pept        complement(355878..356531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12465"
FT                   /product="regulatory protein, GntR"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12465"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31423"
FT                   /db_xref="GOA:B9JQK4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQK4"
FT                   /protein_id="ACM31423.1"
FT                   /translation="MTRVSKRHTDPVARLRKAIETGYFLPGQRLPEVELAEWLGVNRVN
FT                   VKLALGKLDQEGLVEVERNKGARVRVISQKEAVEILQTYASLEMLVARNAAAKATAADC
FT                   ERLKSILAAITQAQAEEAYVEYSQHIGKLHAEIRRIAAHSTATRIIATLNAQIARFRAQ
FT                   TVLFPGRIKQSLRELEKIVDAICAADGVRAGQAMLEHLNNMGKALEQSLTRIDA"
FT   gene            complement(356871..357659)
FT                   /gene="ehuA"
FT                   /locus_tag="Arad_12466"
FT   CDS_pept        complement(356871..357659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ehuA"
FT                   /locus_tag="Arad_12466"
FT                   /product="ectoine/hydroxyectoine ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12466"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31424"
FT                   /db_xref="GOA:B9JQK5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014343"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQK5"
FT                   /protein_id="ACM31424.1"
FT                   /translation="MADQTTLPIITFREVKKTFGAQTVLSSLNLDVMQNENLTLIGPSG
FT                   SGKSTILRILMTLETVQAGGVLVDGEALWHDQGSEKSSRQASEPQTRAIRRKIGMVFQS
FT                   FNLFPHMSALRNIAEAPIRVLGLSKDEAYARALDLLKLVGLADKQSSFPIQLSGGQQQR
FT                   VAIARALAMRPKILLFDEVTSALDPETVGEVLSVIRDLAREHQFTTLMVTHHMGIARDI
FT                   ADRVCFLEGGRIIEEGSPAQIFEAPQNIRTRAFLKAILAA"
FT   gene            complement(357652..358365)
FT                   /gene="ehuD"
FT                   /locus_tag="Arad_12467"
FT   CDS_pept        complement(357652..358365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ehuD"
FT                   /locus_tag="Arad_12467"
FT                   /product="ectoine/hydroxyectoine ABC transporter, permease
FT                   protein EhuD"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12467"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31425"
FT                   /db_xref="GOA:B9JQK6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR014341"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQK6"
FT                   /protein_id="ACM31425.1"
FT                   /translation="MTILGIDIHQLNWFRLDVAAAILPKLISAANVTIYVAILGFAGAL
FT                   AVGIPLLMARRSRFVLIAGPGIFLADFIRSTPLLQQIYFYFFVLPQAGIILPPITTGIL
FT                   ALAIHYGCFVAEAYRAGLEALPSGQRDAITALGFSRFAAYRHVIVPQLVPFLIPALGNL
FT                   LVSIFKETPLLASIAVTDIMFVAMQYGADHFQYIEPITMCGLIFLVISLATSLIVRRLE
FT                   AMVSKAWLGRRPSRG"
FT   gene            complement(358442..359110)
FT                   /locus_tag="Arad_12468"
FT   CDS_pept        complement(358442..359110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12468"
FT                   /product="Amino acid ABC transporter, permease protein,
FT                   3-TM region, His/Glu/Gln/Arg/opine"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12468"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31426"
FT                   /db_xref="GOA:B9JQK7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQK7"
FT                   /protein_id="ACM31426.1"
FT                   /translation="MRDLLMWVPLLLDGLAQTLLLFLIVLALGSVLGLLVGFARLARIR
FT                   LVRYAALTFVEFFRGVSLYVTLFWLYFAAPFLGMQLSVWEAAVIGCSLTHAAYSSEYVR
FT                   AAVLSVPVSQTEAAVALSMSAFQRVRYVVLPQALVALLPLMGNEFVMLLKGTSIVSLIG
FT                   LAELTEQAHSIIVSTYQPVPVLLTVLGIYFILAQALIRLTQWMERRFGGWKLRGAAGAA
FT                   "
FT   gene            complement(359182..360042)
FT                   /gene="ehuB"
FT                   /locus_tag="Arad_12469"
FT   CDS_pept        complement(359182..360042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ehuB"
FT                   /locus_tag="Arad_12469"
FT                   /product="ectoine/hydroxyectoine ABC transporter
FT                   solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12469"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31427"
FT                   /db_xref="GOA:B9JQK8"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR014337"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQK8"
FT                   /protein_id="ACM31427.1"
FT                   /translation="MKRIFLASVLAIFSAGIVASSAAAESTLERIKRTGVVQIGFSNEK
FT                   PYSFKQPDGSLAGVDYELARAAFAKLGVHTVDGVAVKFSTLIPGLKAGHFDAIAAGLFI
FT                   RPDRCAEIAFAEPHIQIADAITVQKGNPKNIHSYDDVLKNPTIKIGTQQGSASRKDFER
FT                   LGIPESQLVVFQDFPEVFFALKSGRVDLTTSTIFAANESIAADGGKSVERATPFILPVF
FT                   DGKPSINYLGFGFRKDDQDLVAAFNDALRAFRSTPDYEAILAKYSVTPADVPSPDVKLV
FT                   DICKE"
FT   gene            complement(360224..361570)
FT                   /locus_tag="Arad_12471"
FT   CDS_pept        complement(360224..361570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12471"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12471"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31428"
FT                   /db_xref="GOA:B9JQK9"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQK9"
FT                   /protein_id="ACM31428.1"
FT                   /translation="MARKPIFFNLFELNNRTGDSHGLWRHPDSQHHDYNDIDFWVTIAR
FT                   KIEEGGFTAFFLGDFFGASDVYRGSPDVAIRHAMQFPSNDPSLIIPSMANATATLNFVT
FT                   TISTTYEHPFHVARRLSTLDHLTKGRIGLNVVTSYIAAAARYFGLDEPIPHDRRYAIAD
FT                   EFLTICYKLWESSWSDGAVRFDIENDVHIDPAMVRSVDHHGEFFKVAGPHVCEPSLQRT
FT                   PVIFQAGSSKAGRDFAARHAECVFVQGRTLAAVKENVTNIRRRAVDFGRAPDDILIFHQ
FT                   QTAIVAPTQAEARERLEDYARYRSPESALAQYCGSSGYDLSSLDPDAILAYAPTEANQS
FT                   RAAQYTTQSDRPFRVREVIDDVGRFGDGILVGTPVEIADQLEAIVDATGVDGFNFNSIV
FT                   TPRSIIDFVDQVIPELRNRGRIAEHRSTFRETLFGNGRARSGNASRLAG"
FT   gene            complement(361578..362927)
FT                   /locus_tag="Arad_12472"
FT   CDS_pept        complement(361578..362927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12472"
FT                   /product="xenobiotic compound monooxygenase, DszA family, A
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12472"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31429"
FT                   /db_xref="GOA:B9JQL0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQL0"
FT                   /protein_id="ACM31429.1"
FT                   /translation="MARRDKLILGAFLQTPGQHTAGWRYPRADAQASLDIDAQIAFART
FT                   AERGLFHAIFIADTLPFPVKLDAETLSYSARVVDFEPVTLLSALAVATSRIGLVGTVTT
FT                   TYYEPYFVARQFASLDYLSKGRAGWNVVTSSNGAEALNYSRREHPPHALRYQRATEFVD
FT                   IVKGLWDSWDDDAFLFDKGGGRFFSPDKMHLLDHSSQHFKVRGPLAVARPPQGHPVIVQ
FT                   AGSSHTGRNAAASFADVVFTAQSDLPGAIAFYDDVRARVAGAGRDPDHVAILPGVTPVV
FT                   ARTRSEAQEKYEQLQDLLHPVAGLAMLSGAAGADLSKYPIDGPLPAVPPTEGDKTRQEL
FT                   LVAHAKRTGLTIRELYRWLASGYNTIVGTPSDIADHFEHWFKSGGADGFNVRFSYLPGD
FT                   LDDFVDLVVPELQRRGLYHEAYEGTTLRDNLHIPRPPSRYSRIPGNEIRD"
FT   gene            complement(362997..364652)
FT                   /locus_tag="Arad_12473"
FT   CDS_pept        complement(362997..364652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12473"
FT                   /product="ABC-type dipeptide transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12473"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31430"
FT                   /db_xref="GOA:B9JQL1"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQL1"
FT                   /protein_id="ACM31430.1"
FT                   /translation="MPLFSRTRSTRGRSYVPPRRRGGLLKTVAFLVGAPFLFGAPQAFA
FT                   ATPADTLVVAKYISDLITLDPAEVYEATGGEVVNNIYERLITFDPSDFTKPVGGVAESW
FT                   TVSDDGLTFTFKIREGLFFASGRGVTAEDAAFSLERVIRLGKTPVFYLTQFGWSKENIA
FT                   DRVSFTGEKTLVLKLDKPYAPDLFLKVLSSTVSSVVDKQEALKHETDGDLGAGWLKKNT
FT                   AGSGPYQLAGWTPNEAVVLTANTHYKREPVALKSVVLRHIPEAATQRLLIEKGDVDIAR
FT                   NLSADQIQALSTNSNITIISSPKTDVSYIALNRGVKPLDDAKVQQALRWAIDYDGIVGS
FT                   ILKGQAKVHQSFWGSGSGGSLDETPYKLDIAKAKSLLEAAGYKDGFKLKLDVSSRSPDR
FT                   EISQSLQSTFGQAGVKVDLNTLDRAQLQTRFRGRQHDAVFFGWSPDYLDVHASASFFTI
FT                   NDDDSDSSKNKNAAWRDHWLVPELTKKTLSGLTESDPAKREAIYLDLQKQVRDNSPFIV
FT                   IYQQLGQVPVRANVKGFVPGPSWDTPAYWRTTKS"
FT   gene            365179..365868
FT                   /locus_tag="Arad_12475"
FT   CDS_pept        365179..365868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12475"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12475"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31431"
FT                   /db_xref="GOA:B9JQL2"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQL2"
FT                   /protein_id="ACM31431.1"
FT                   /translation="MPIAKLRHRNLIFTAIFANLIHIRGIFVAAIMIPDFITHYHPLED
FT                   PPFQNLSDASDDELPFIIARLSHRRAAGSKRIFGRVYMDYRRQTEAKLKDLFVKAGGRP
FT                   ERSAPNYFVLGTSKWFANLYPEVGDVRFPLSTFAPETISFTYPDSCVSMRLGPNFGLPP
FT                   DPQCPNHETVFRITELEKIIGKYGLPRDDADDGAAYADYHLREFERYIEVRVWTDAPIR
FT                   ALPGRSR"
FT   gene            complement(365939..366286)
FT                   /locus_tag="Arad_12476"
FT   CDS_pept        complement(365939..366286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12476"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31432"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQL3"
FT                   /protein_id="ACM31432.1"
FT                   /translation="MECAVTEQSISWEQDGIDSGWFFAKNVGSVRSSSSYRPGGWWFLP
FT                   KWLPDTEENDVGPFKTKTAALAEAERLAAISSQNRRQLLSAVAAEQRLHHSSPRRVGTS
FT                   HCRRLDGSFRV"
FT   gene            complement(366289..367821)
FT                   /locus_tag="Arad_12477"
FT   CDS_pept        complement(366289..367821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12477"
FT                   /product="transposase number 3 for insertion sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12477"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31433"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPU6"
FT                   /protein_id="ACM31433.1"
FT                   /translation="MTIRADELPDDLNALKAMVLSREAENARLRQIIKELQRHRFGRRA
FT                   ETLPEDQLLLGLEEAEQVEAHGLEAKEQASADLRQTRVAKRRTNRGSLPAHLPRIEMVV
FT                   DIDDHACPGCHHDLHRIGEDISEKLDIIPAQFRVLVVRRPKYGCRACEDVVVQAPAPAR
FT                   LIEGGIPTEATVAHVLVSKYADHLPLYRQAQIYKRQGIDLDRSTLADWVGRAAWHLRPV
FT                   HQRLLDVLKSSSKLFADETTAPVLDPGRGKTKTGQLWAYARDDRPWQGNDPPGVVYVYA
FT                   PDRKAERPMTHLEGFVGILQVDGYSGYRPLAAKNTVSLAFCWSHVRRRFYELAAAGPAP
FT                   IATEALRRIAELYKNEDEIRGRTQDDRRVIRQEKSRPITDSLAPWLTEQLGLISQKTKL
FT                   AEAIRYTLSRWDGLTRFIGDGRIEIDSNTVERSIRPIALNRKNALFAGSDAGAEHWATI
FT                   ASLIETAKLNDVEPLGYIADALTRIVNGHPNSQIDELLPWSYRTDKIPPMKE"
FT   gene            complement(367893..368249)
FT                   /locus_tag="Arad_12478"
FT   CDS_pept        complement(367893..368249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12478"
FT                   /product="transposase number 2 for insertion sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12478"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31434"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQL5"
FT                   /protein_id="ACM31434.1"
FT                   /translation="MIGPSGAVKVMIATKPVDFRKGAEGLAALVKAEMGTDPFSGTIYV
FT                   FRAKRTDRIKLIFWDGSGVCLVAKRLEDGEFHWPRMQDGAMHLTSAQFSALFEGLDWKR
FT                   VHAPSETRTPVQAG"
FT   gene            complement(368246..368689)
FT                   /locus_tag="Arad_12480"
FT   CDS_pept        complement(368246..368689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12480"
FT                   /product="transposase number 1 for insertion sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12480"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31435"
FT                   /db_xref="GOA:B9JPV0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:B9JPV0"
FT                   /protein_id="ACM31435.1"
FT                   /translation="MSISELTLKTKDDEPVRRFEVFTGSGRRREWSDELKAQIVAESHE
FT                   PGVTVSSVARRHGLTSQQLFTWRRLARKPLDVLPDGAPMFAPAVVVAQDMPMPRKVRRA
FT                   RSPRKAHGDAVIELEIGGATIRIASGADATTIAAVIAAMKASS"
FT   gene            complement(368851..370110)
FT                   /locus_tag="Arad_12481"
FT   CDS_pept        complement(368851..370110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12481"
FT                   /product="biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12481"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31436"
FT                   /db_xref="GOA:B9JQL7"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQL7"
FT                   /protein_id="ACM31436.1"
FT                   /translation="MTKDTVVIVDSYLPTNKGRGSLLDSFTNAGVNCVRVQSSPELPIV
FT                   FRSSLKLDGYIENITHTGNVDATVESISRYSPVAVIPGSEVGVEFADFLSERLNLPSNG
FT                   TAKSPARRDKFIMIETIRAAGIKAAAQIRIEDENHLREWHGKLGQRVVLKPIRGGNGGG
FT                   IRFCDTVEQSVKAYQELINTGNVYTPQNDAIVAQEYLFGTEYMVNTVSCDGKHHVCDIW
FT                   QTNRLSANEVLDLCGSISILPRERDPADALVKYAYEALDALDIRNGPAHLEMKMTPTGP
FT                   CLIEVGARTAGGDIQHHARLCTGESQLEWTVDAYLHRDRFKRRADEPYKVLSYFTSVAL
FT                   ISPHSGILNRYVGLDEIARLESIHEVRQLVQPGEQLSRTIDDLTYPVIATLMHPLEEIV
FT                   RRDAETIRYLDGTAFYLFEG"
FT   gene            complement(370141..372117)
FT                   /locus_tag="Arad_12482"
FT   CDS_pept        complement(370141..372117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12482"
FT                   /product="3-oxoacyl-ACP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12482"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31437"
FT                   /db_xref="GOA:B9JQL8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQL8"
FT                   /protein_id="ACM31437.1"
FT                   /translation="MNLSDGEIQFPHSRVSTRIVQLASGLPELADAYSPFQHGAPLDLL
FT                   PVLRKSDFRAVRESLLARARSQSAGAIILGSGGTTSEPLISVIPSGMFLEKIRQVWDPL
FT                   DPDDVVMNLNLGAELGSMSPFFNALSHKAGAVSVPLGPLGDREAVDRWLPFFEAVGATT
FT                   LAGTPTQISLVLQRLNETRRRVPTLKKIIWTGEAFSKATLDEVTLYGNLEIYGTYGSTE
FT                   TWVIGVSYPQCTIGTFHLVPYQHIEFLGGQITITCLDEDCINPVVRYQLGDRGRACVCS
FT                   CGRAGAFTVEGRSDDQVKFLSVLFYPREPYEAVLSHPDVRAAQIVLIDSGSPQERMEVN
FT                   VELQQHTDKALDKASKSVRDHLLGKLYRLAHEVHDRPERIRVVVVDRLLTNRRSMKRHI
FT                   LFTPQVTLKAKYMSKVAVVSGGGTGIGAAITEKLVTIGYRVLIVGRRASALEKTKEALG
FT                   NAVDSFVSDLSDERQVSELSTYVGNNYPGVDALINNAGGNFELLEPSASTDLKTIAANW
FT                   TGNFKINVLTAVLLTEALSPLLREDARVVLTSSIAAYRGSGTGSYAASKSALHPYVFDL
FT                   AKRLGSRRITVNAIAPGYVDETEFFGDGLPSGRRQQLKAETLTSAITHPKQVASLIGWL
FT                   VTDDAAQVTGQILQINGGARLGN"
FT   gene            372234..373115
FT                   /locus_tag="Arad_12483"
FT   CDS_pept        372234..373115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12483"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12483"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31438"
FT                   /db_xref="GOA:B9JQL9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQL9"
FT                   /protein_id="ACM31438.1"
FT                   /translation="MEFSQLRHFVALTEVLHFGRCAQQLGIAQPHLSRSIASLEAELEV
FT                   RLFERTSRRVELTTAGKAFLGEAFEVLRGQQRAINAARAANRKDRETLRIGFVSSATFR
FT                   VLPEAVRQMRALMDVHVEFLEQTTNDQIAFLQSGNLDIGLGHPPITAGNRIVVDILRPD
FT                   GYDVLFYEDHPMASYNSVSFEQIAGEPFVLFPEIEGPVFYNRFRELCRRSGKEMNVSHV
FT                   ASRMHTIHSLVSAGMGIGFAPLHTKSIQVDGIVRVPLTPYPEALKLDLAAFYDRLNRKQ
FT                   SLKLFLKIAQGV"
FT   gene            complement(373194..374393)
FT                   /locus_tag="Arad_12484"
FT   CDS_pept        complement(373194..374393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12484"
FT                   /product="chloramphenicol resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12484"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31439"
FT                   /db_xref="GOA:B9JQM0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQM0"
FT                   /protein_id="ACM31439.1"
FT                   /translation="MSISSISVAKEPAFRRGAFVVACVATLLGFSMTTSQSFLPGVMET
FT                   KGIPLAITGYAMASTSIFALVFGLLSAALMARLGTTVLMLAGMAIMCVCHLSFEITPKV
FT                   FGGIFLSRMVYGIGAGIFYPAALTFVKGMLHGPRTVSLFAIYTAMIPGSNLLGPPVAEW
FT                   YISNYGSERYFIFTAFPGVISVALFFLIWLQNYDRHQEFDLTANFSVIIRSPSSWLPLL
FT                   CLLVAGSIWGYVISFLPYAAAAKDLPGSLFIVASTIGLFTSRFFVVNHIKKFNSSLVSG
FT                   WAISSMAISLLVMALVRAPEAVAFCGVAFGISYALSYPFISIWILGEFDQKLHHIVISL
FT                   TNALFNFCMFLAPLFVSLFASSTHLKIDSYQIILSITGLVFIFIGYTWRYLTSFRKIRI
FT                   "
FT   gene            complement(374530..375969)
FT                   /locus_tag="Arad_12485"
FT   CDS_pept        complement(374530..375969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12485"
FT                   /product="Amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12485"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31440"
FT                   /db_xref="GOA:B9JQM1"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQM1"
FT                   /protein_id="ACM31440.1"
FT                   /translation="MIKSEYFMLDRASRRDPSLKEIKHLTPFTALSERNSLLSQSTIYW
FT                   ENWRRRFDKYARTINSKISALTHIPNSPSITARGVTSASYKDLISVKGITSKFGSDEIS
FT                   VIPPESAAIVAELENAGIFTQGKARTTEFGVGNNFSSCINPLFPLFSPGGSSNGSAAAV
FT                   ASGISDVSFGTDAAGSVRRPASFCGAVGIVFSESEEHRRGIVPVSSSLERIGAVTRSID
FT                   DILYLWKHHDLSQIYPQEVSATEGISLVAPYLPKLIDEEIARSFEDYVAQIRAVGFSVE
FT                   RVNWNIWPKRQYGWKMVAYELHQYFDTHRELFPMDQLRPSTRQTIQSGKSISLGEYQDA
FT                   CAKRDVVVREMEDFITGGGFSAILLPVDPYPVSRVPVQTTQHMLPLTPSDQFDPWNYMI
FT                   IANLCNLSAISYPFRVSSRGFPMAVQIFSRARSEILLMETAKALSDLLPRWIETHELVA
FT                   RRKVFEEAASDVFSTLNSLTA"
FT   gene            complement(375995..376540)
FT                   /locus_tag="Arad_12488"
FT   CDS_pept        complement(375995..376540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12488"
FT                   /product="GCN5-family N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12488"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31441"
FT                   /db_xref="GOA:B9JQM2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQM2"
FT                   /protein_id="ACM31441.1"
FT                   /translation="MIREATIEDASSIAAISLEIWFGTFLQNGINAFFADYVLQRYTPD
FT                   RYKEILSRDNEKIWVSQNSEGIDGFIRLITASVAPATAYSDTEISTLYVQPRHHRRGIG
FT                   QKLLEAAQQFCAESGRPDIWLTVNPKNERAIKFYKRTGFEKFGETHFRIGDQSYPNDVF
FT                   RIVLATGSRPSQSIHSLN"
FT   gene            complement(376599..377774)
FT                   /locus_tag="Arad_12489"
FT   CDS_pept        complement(376599..377774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12489"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12489"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31442"
FT                   /db_xref="GOA:B9JQM3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQM3"
FT                   /protein_id="ACM31442.1"
FT                   /translation="MTHVRTLTFDELVEEIFEPDSPNVLRSELSDLLLTSPWSFHAGAE
FT                   PAFSKLPSTMYFSTSGSTGTPKIIAKTLRQVDLEVAAVSGYLPAPPNEVISFAPVNHAF
FT                   GFFCGLALALRRGIPYQYRPISSGIGPITPPERNLLILALPAAYKAIERDRDKLSGNEH
FT                   TTILQSGGPISTAYVDTVIDVANLAVEGVEIYGSTETGAIAHRRTSLFPNDWELFSDVE
FT                   VLPNRTETDLLTELIVSGPRCVQPRTASAKAIMNGLPHIRTGDLVRFTEERQFTLCGRL
FT                   DRVIQINGANTDLDFLQEFLNRRFSQAEFYVAAASDTVRGTGFVVHFHCRGSQFVIQQF
FT                   RREIARALHEEFSRNVYPLDIHYSTAPFRKSSAGKITGISHAAVSNRMDVA"
FT   gene            complement(377852..378133)
FT                   /locus_tag="Arad_12490"
FT   CDS_pept        complement(377852..378133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12490"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31443"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQM4"
FT                   /protein_id="ACM31443.1"
FT                   /translation="MEIGLIKDALTQGINDNFGILIADDNAGIPFRQISELNFDSLRAL
FT                   EFVEMVEILFDFRIDLYSDDVQTNFRDLNTLALLCKRKLDDAAVFTRA"
FT   gene            complement(378134..378523)
FT                   /locus_tag="Arad_12491"
FT   CDS_pept        complement(378134..378523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12491"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31444"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQM5"
FT                   /protein_id="ACM31444.1"
FT                   /translation="MPTVRIVSNIAEPQKRREIARRLTVVFGRSGVKISHLLFVWQHVE
FT                   LSDVYPGPFSLVDRSLSIEGNFASVTIEVSQKRSKEWRRELLQKTREIFADGLSDEYIF
FT                   LGLVAVDPDNFLNATSENSRRQEVY"
FT   gene            complement(378535..380289)
FT                   /locus_tag="Arad_12492"
FT   CDS_pept        complement(378535..380289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12492"
FT                   /product="Prenyltransferase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12492"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31445"
FT                   /db_xref="GOA:B9JQM6"
FT                   /db_xref="InterPro:IPR001330"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQM6"
FT                   /protein_id="ACM31445.1"
FT                   /translation="MSVVTSNIVTVQPPFEFLRTADGGAGTFGSDLWATYAATRTLRWI
FT                   DRLPALPKRAQIAGYLQSCQNSDGSFSWQRGLTPDIWATFYCSQTLADIGHSVSTSESL
FT                   VEWISSLQDKDGGFAMMPGQTADVWATYYATRVFREILKLPVPNLHRLAEWLSRLQRGD
FT                   GGLAWNIKTVETDTRAAYYAIHAKHAAGLDHDVKWDDQRLRGWLQSLQAPSGGFRFSPA
FT                   YAPCLWATFRATKALSIQNWQPSEPGACEKWIFERQRTEGFARWENYEVSDVWANFSAV
FT                   GALQALNVTINDGQKDRTQRAIESFSVDGAGYTYRQPSAAADALTTASALYSAVDNVET
FT                   DSVERLSVWLQRAHMPWEDGVMYMPGRGAEIRCSLWATAALVYAGRQFSDIGRLTNWIS
FT                   RLQNPDGGFGYWQGRGSDLVSTSAAISALETLGQRFAEHVDVERLTSFVLSCIREGGGS
FT                   NVPKGPITTSSTAQASRLLVKVGDRDGGLSLLEHLPQRMRLSGYVEQLGGPPTLYATYQ
FT                   TVLALQANGLEIPAQISRFLDRLITREGYIGWTPLGASRQDPLILPLHGLLSRKLGEPL
FT                   FLLPELVL"
FT   gene            complement(380286..381584)
FT                   /locus_tag="Arad_12493"
FT   CDS_pept        complement(380286..381584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12493"
FT                   /product="coenzyme F390 synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12493"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31446"
FT                   /db_xref="GOA:B9JQM7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQM7"
FT                   /protein_id="ACM31446.1"
FT                   /translation="MGYPFPFQHSDLHGRCADELLHFRNASNIDLREEITDSWLSSAWE
FT                   RASRSEHYRQIGEFTRSKFDSIKPISKKTFKESYTAFDAADVTSIIKYYETSGTTGIPT
FT                   PTKRTFEDIVWNYVGVSLLWGEIVNRSDRSIVLLPSDIAPIGDLIAGCCEIIGSAAVRC
FT                   YPFTQGIVSWDRMEVLFRNFRPTVIWCAPGTLLQFTRILRQRKSFDDIASSVVKIMLSG
FT                   EVVTESLQRSLGSWWQAEVYNASYGSTETGTIAAAGRNGRLNILEYSFLCELRNDDGEV
FT                   SPLEEGARGELIISSLHGFARPMLRIATGDAVSIMAPESGLHTLEVLGRKEEAILIKDV
FT                   PYLAGDIENHIYKIPDVTGYLLDMAEGSVTRVIVEQMPDGSSTDHIMQHATRILGDAGI
FT                   DLRIEVVSQLPISTKSGAGLKNWKRSNVLEARK"
FT   gene            381938..382204
FT                   /locus_tag="Arad_12494"
FT   CDS_pept        381938..382204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12494"
FT                   /product="catalase"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12494"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31447"
FT                   /db_xref="GOA:B9JQM8"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQM8"
FT                   /protein_id="ACM31447.1"
FT                   /translation="MRDQCCAHHRVDDDHYQQPGDLFRRMDAAQRQTLFDNTARAVGGA
FT                   AIHIQERHVANCMKADPEYGAGVREALSRLAIVRPVDGSVAAE"
FT   gene            complement(382279..382383)
FT                   /locus_tag="Arad_12495"
FT   CDS_pept        complement(382279..382383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12495"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31448"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQM9"
FT                   /protein_id="ACM31448.1"
FT                   /translation="MDRRVWRLVIRCPEELGEAALFDVAGSIAASPSR"
FT   gene            382560..383003
FT                   /locus_tag="Arad_12496"
FT   CDS_pept        382560..383003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12496"
FT                   /product="transposase (ISmav2)"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12496"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31449"
FT                   /db_xref="GOA:B9JQN0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQN0"
FT                   /protein_id="ACM31449.1"
FT                   /translation="MPWRETSVMEERLRFVARLLEGEGMSAVCRDFGISRKTGYKIFNR
FT                   YKDEGLEALTDRSRRPVRYANQLPDPVEAMIVRLKKEKPHWGARKIRELLVRKLAGDVR
FT                   LPARSTVHAVLDRHGLVSQARKRNRANKAMGTTLSQALDPNDL"
FT   gene            383637..384371
FT                   /locus_tag="Arad_12499"
FT   CDS_pept        383637..384371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12499"
FT                   /product="IstB-like ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12499"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31450"
FT                   /db_xref="GOA:B9JQN1"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQN1"
FT                   /protein_id="ACM31450.1"
FT                   /translation="MERTQVLELMSTLKLYGMRSAYDEVMGNGIKRQHEPPRIVGDLLQ
FT                   SEIAEKQARSIRYQLSIAKLPLAKDIDDFDFTDTPVNESLVRELATGTFVADQRNVVLV
FT                   GGTGTGKSHLAIAIARALIRNSTRGRFFNVVDLVNRLETETRNGKQGRTADYLTRLDFI
FT                   ILDELGYLPFAQAGGQLLFHLISRLYERTSIIVTTNLAFGEWPSVFGDAKMTTALLDRL
FT                   THHCEIVETGNKSWRFKNRSQS"
FT   gene            384397..384834
FT                   /locus_tag="Arad_12500"
FT   CDS_pept        384397..384834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12500"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31451"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQN2"
FT                   /protein_id="ACM31451.1"
FT                   /translation="MAYPLQPRPAPGRPSADRLQGGEDWTPIRGQHSAPIDNILNNCLI
FT                   VPHSIADSHAALGRVQQARPPATRAKQSVKDCLIIEGVLRYVISERAVGRAQRIVFASS
FT                   NTSDYHQGHGSLHPALRAEFDACDLGFAPSWSAARYEIDRL"
FT   gene            complement(384944..385726)
FT                   /locus_tag="Arad_12501"
FT   CDS_pept        complement(384944..385726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12501"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31452"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQN3"
FT                   /protein_id="ACM31452.1"
FT                   /translation="MTSIAFTEVGVRSAKRALKNYFPAIQSSHLTEALAAACGFKTHAA
FT                   LGAALKASNVKDPSFLLLDRQSFGKRLAEVSGHIASDSDIPFDLPCFVEEADGISTTSR
FT                   RYFEIDYSRSARKLAWRNVMVAAINAGIDQRLFSIRPGDNRWPGGENGGPRETFSFKFS
FT                   IGNIPAVASVHDGGFDELSIHAAFWPTEDGLRVVRSLNGNFRAGEVFATGWLERRDGAW
FT                   LQVSSSSPEFACRKHRLEEVASLEVSPRGYADRGSFKV"
FT   gene            386050..387174
FT                   /locus_tag="Arad_12503"
FT   CDS_pept        386050..387174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12503"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31453"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQN4"
FT                   /protein_id="ACM31453.1"
FT                   /translation="MYSTLDGAKNHAKQLKRILSASGLIYSLAKCQAAVARAGGFRDWH
FT                   DLTTNLQVDARSRPFFDFWGALVQQLPVPCHVPVRSYLRDCDDVSSNKKGLSEKWVRDV
FT                   IPYCASLELVHRKHSSVLMPGSGRGQKLRLEIVSGMLLNVEGHDGFAPQLDPETLAIVQ
FT                   SGKPASLLPTLARRADFAHEIDVLISSEIIRVEREATTILGPPSSSLRDQIVRRAQRWN
FT                   SQKEPEIKTYEISEELAARLKLQLELDRAEGGPKAPYDELEHLGVVLASRFSVAREFAT
FT                   MQAVVDAMGPTIRPRVSSIWCDSRACAVYAVEIKLGMNRSTLAEQIRASFLRATDGFNG
FT                   LTVSHGSNTEFFNPEWPEFEQEDLQIEIDETITF"
FT   gene            387471..387986
FT                   /locus_tag="Arad_12504"
FT   CDS_pept        387471..387986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arad_12504"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arad_12504"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31454"
FT                   /db_xref="UniProtKB/TrEMBL:B9JQN5"
FT                   /protein_id="ACM31454.1"
FT                   /translation="MFNILTARDFYSVLVEDFDDFVAEPHSARRAMHCAITAYHLHEWV
FT                   WGDWLSKNKTARDALGISARDRDLFLQWIDRYCVWFRIVQDLANGTKHFARDPGFETVF
FT                   VGGFGEGGFGVGPYGKGYLVIDWGQEAGDQRWLPAAHLLEVVVRFWRDFFQKYLPSHDL
FT                   PASRHHVD"
XX
SQ   Sequence 388169 BP; 83983 A; 111352 C; 109937 G; 82897 T; 0 other;
     ggaggtgcaa agctggctta tactcaagag atgaatttta acgttgaccg tagtaggctt        60
     acgctctatg ttagggcgta gtcgtattat ggagattaca tgggtgacag aacagtcact       120
     gaccgcatga agcgacagcg cgagctgcgt gcggcggaag gatggcagaa agttaccgta       180
     tgggttccaa cggtggcaga tgccgaagat gtcaagaaac tcgctgccga gcgccgggcc       240
     agggccgaag cgctcgctgg ccttagcgaa gaggtgccga aggtgaacgt cgaaacagcc       300
     gaacggatcg cgagggcgat cgccgagcat ggctccaacg cttacattac gccctcgggc       360
     gccgtcttgg aattgatgaa acagctcgct agggaagatg atctggtaag tttcgcgagt       420
     gcgttcgtca tcatagcaag ggcaaagccg gccaacgcaa aattcattac agcacgcgtg       480
     ccggccatga tcagcgagtt tcttatccgc catcgcggaa ttgacggggg tgcgatgggc       540
     aaatggggca tttcaaaccc tggctgggcc gatgagacca aggctgccgt acgcgatccg       600
     gaacggttcc cgcaggttgt cgaggccctg gctcaagcca tcaagcgcag tcagaccgtg       660
     caataatgcg agaagcggcc agcaatcact ctcccgccag agcatttgaa attccggata       720
     cggtattcgc cttacagcgg gaacatccga gcaactttat tgctcgcgac tgtgcgaatc       780
     atatctaaaa aattgaaaca ccaggtgagg actggcctga cctggtgcac aaatatcggt       840
     gtcgaaggcg catggcaagc cagtggggcc tgttcgactg ctttggggtg gttatctacg       900
     caatatggca gaaagtcaag ttccttttcc gtacctgccg gcgcagctgc aggccatccg       960
     agcctcgatt tccgagcccc gcttcgcaag ctaccttgcg aagggcggca atcacgaaga      1020
     atatgcgatg gcgctgtatc tctacaacgc ccgggttgcc aaagcgttcc tttatccgct      1080
     taatgtggca gaagtgacac tgcgaaatgc cgtcgacggg atccttgtcg caaagttcgg      1140
     agcgagctgg catcaggacg ccaccttccg cgatcaaacc ctgacaggga atggcctggt      1200
     gacgctcgac aaggcgatac aaagggcggg tgcaaacgca gcacgtgacc agatcgtcgc      1260
     gacgctcacc ttcgattttt ggtcgaacct cttccggccc gaatatggtg ccctctggcg      1320
     caccaccgtc aatatcgcct tcccccatct gcagcacggc gaaagccgcc aggaaatcca      1380
     gaatctggtg aagccgatca atgtattccg gaatcgcgtg gcccatcacg aaccggttct      1440
     cgatctgaac gtgaccgaca ttcatgccaa gatcgtaaag ctgatcgaat tacgatgcgc      1500
     tgaaacggca acctggatga agcatcactc cactctcagt accgtcgtca gaacgcgccc      1560
     tcgccgggac ggcaccaatg ccaacacgct ggccgcgaag ctcgatccgg cgttcgtgcc      1620
     ggtcaagccg gaaacgggtt tgggtgagct ggccgaattg ctcgacgaaa agcatcaggc      1680
     aatcatctgc ctcgacgatg acgggcatcc aatcgcggcg ctcacggtag tcgacgccat      1740
     ccgcttcatc acagaatgcg cgaagaggct gggcgggatg atcgatctaa atgatcatac      1800
     ggtttcggac ctgatcaagg cggccaacct cgcggaccga tggacgcaaa tggatgacgc      1860
     caccccgctc gccttggcgg tgaaggaact ccaaaaacct cgcatccaga ttctcgtcgg      1920
     gatcgaggct gcatcaggca aggcgacggg cgcgattttg cgcgcacacc gccgctattg      1980
     accgaaagga ttgcccttga gcttcaaact ggtggattct ggctggtcgg acgaactgga      2040
     tgccggtatg cgggaaagac cggaaacggt tttgattgtg tgcccgttca tcaagaagca      2100
     gaccatagag cgcctgattt tcgcgcatca cccccgtgat ctgcgcgtca tcactcgatt      2160
     cgaccttaac gccttcaatg cgggggtaag cgatatggat gcgctgtctc tcctcctcca      2220
     aagcggcgcg aaaatccggg gagtcgtcgg cgtccattcc aaaatgtata tcttcggcgg      2280
     caaccgggcg attgtgacaa gcgctaatct caccgaagcc gccatgtttc agaataagga      2340
     gttcggcttc gccgctgacg acccctttat cgccggacag tgccagagtt atttcgaccg      2400
     cttatgggcc ggcaccaagc acgatctgtc gcaagccgat atcgagcaat ggcgtcaaat      2460
     tctcgcgcca taccgcgtcg ggacgaggaa tagcgtttct ctacccgact ttggagagac      2520
     ggtgaattcg gcatcgccgt tggtactgga gcctccgacc gatgcgccta cgcagtcttt      2580
     cgtcaaattc ttcggaagag cggacaaccg cgcgtcgctg tccatggcga tcgacgagga      2640
     ggttattcgc tccggttcgc attgggcgtg cacgtacccg cgtggaaagc ggccacgcca      2700
     ggttcgagac ggggccatca tgttcatggc tcgtatggtt caggcgcgga gcgactacat      2760
     tatctatggc cgagccattg gcagggaaca cagaccaatt ctggatgacg ccacaccagc      2820
     cgacgtatcg ttgagagcgt ggaaagagaa ttggcctcac tacgttcgcg tccacgatcc      2880
     ggtcttcatt aacggaccgc tttcggcagg agtgtccatg gtcgacatga tgaccgaact      2940
     tggtccggat tcttttgcgc caacgcaacg caatctgaac gccggcggtg gaggcaatct      3000
     caatccgcgg cgcgccatca tgagaaaacc gcatatggag ctcacgccac aggcctataa      3060
     gtggatattc gatcggctcg ataagtcgat gatgcggttt ggagcgctcg atctcaccga      3120
     tccgcgtttc gaccttccgg cggcgcaaga caactctcca gatgcgctgg cgaacacccc      3180
     acagctgtca aggcagtctc cagaggagta gaaaatggat gtcccccacg tctctcgtca      3240
     gccacctgag atcggtagcc gggtgaaaat ctactttgat cgcaagtcag gtgatctcat      3300
     cattgagacc cgtgagggac agcgcagcag ggactttatg ggcgtttgca tcggcgacgc      3360
     agttttcgag acggaaccca ccgtgaggag cagcacccgc tgtatcgtga cgggaacttt      3420
     tctcgcgatt ccaggctcac gcgagagccg cgatatcgag tcggatatcc gcacgcaggg      3480
     aagatcgcat ctggagtttt actggtggcg tgacaagacg tggccactgc gcaaggcgcg      3540
     cttggcgttc attgcgaagc ctcacggtgg cttccccacc tcgatggttg ttgacggaga      3600
     agtctgatcg ggggcgcgcc ttggcgcgat ctgttttcta taggccaaag atctcgaggc      3660
     cgggaattgt catctgcggc gttcccagca acgatctggg aagtctcgct gcaaaaactt      3720
     gcctaccgct atccccgatg cggaaatcag cagcgataag tcgatgacta aagtttctat      3780
     ttcaccagcc gtagattgcc ccgcttcggt gttatcgaag catttggaga ggatggcacg      3840
     gcgaccgtaa cgagcccaaa caagagtttg acgatttcgg attcgggtat cgatagcgtt      3900
     tcggagagcc gctcaactcc gccgccgttt tggcgaaggt catccagcac cttcttccag      3960
     acctgcgact gctcgcgacg gatcggcttt ggctcatccg ttctccaacc tcggcgggaa      4020
     atttccataa acaattgttg atacgtccat ttggatgcca gacctaattc gtgaagccga      4080
     taggtcattg cggcaactga aacggaccag gcacttttga gctcaaccac tttaggaagg      4140
     cctgtaatac gtccaaccgc ccgcagaggg gcctcgggca ttaggaacgc ggcagcaaat      4200
     tcgtttgcct gcttttccgc ctcgagaccg tttggcgcgg catgcttatg caagacaaga      4260
     tgccccagtt catgagcagc atcgaaacga ctccgctcgg cagacttttg agaatttagg      4320
     aatatatagg gtctgtcgtc tcgccagacc gagaaagcat ccacttcctt gccgtcctcg      4380
     cccagcgaaa agacccgtac gcccttcagc tcgagcagat gcaccatgtt tttgatcggc      4440
     ctgtttccga gcgcccagaa gtcacgcagt ccggccgcag cactctgagg agtatcttct      4500
     ctcatatctg ggacggatgc caccgggagg tcgaactcaa tatcaagcca gtccgacaac      4560
     atgaacgcga tcgcgcccgc tgcaacagca ccgtcccttt gccttgcggt cattttgctc      4620
     atggagcgaa aactaacgcc ttccggtcgg gggatgtcaa cgtcgtctaa catgaaaaaa      4680
     gatagcggga attgcaggat acgagagagc ttccgagctg tttcctcgct cggaaggtat      4740
     tctccggcct cgtagccggt tacggctcgc ggttcgatac ccactttgga ggcaagttct      4800
     ttcatcgtca ggcctgcgcg ctgacgagcg accgtaagcc gtgatttgtt gaacatcacg      4860
     ctaccttacg cgttaccggg acatcgatat cggtatcatc gatcggatct tcgacaggca      4920
     gccctccatc agcgtcaggc agggggatga agatccgctc ttcccaccct gtaacattac      4980
     gatcgtcgaa agccgaaggt agcgagagct ccgctcggca gacatcatct tcaatgtgaa      5040
     tcagcagcat ccaagtggga taactcaata tggttgcagc cttgcgaagc tcggcttcaa      5100
     ctgtttcggg aaacatatcc gattcaagat tgttcttaag gacagcggct tccgtgtaga      5160
     ggcctttgag tgatttcgtg cgaggtgaac cgtgtgccac acaggtgagt gcatcggagc      5220
     tcgccacgac gatgttgacc tgcgatgaat cgttgatgac gagcgagtag ttgctgggat      5280
     catccttacg ccatcccaaa ggaagcagtt cgtcgcgcaa tgtacgaacc acgaagcgcc      5340
     atgcttccgt tcctggaatg aaaggcggat cgttatcggt gcagttgagc cgcgccgtat      5400
     gaccagccaa gaccgctcgc acaaccgcct cgaccgagac attcaactct gccaatcggc      5460
     gtctggcgtc gaaaggattt tgatggacga cacttgctga cattgccatt gaatcaccct      5520
     aacttcattt tctccacctt ctagcaggtt taaaaaatga agtccactgc ctcggctccc      5580
     tccaaatcgc ctatgggcct cggtagaact gatcgtctct aactaaagtc tttaatgtct      5640
     tctcgacgaa cgcatggggt gacgtcctca cctagataac gccccatgcc cgaaacctcc      5700
     ccctccccgt catctcccgc aaccccagtt ccaaaacgat ccgccgcgcc gcctgcggcg      5760
     tcacatcgag cgtcttcgcc accatttttg cggacaccaa tggttttgcc atcaccagct      5820
     cgaccagctc cggcagcttt gaagacgtcc gtcgtccgtt cagctttcgc tcgaacatcg      5880
     tgcgcgccaa cgccagccgg ttatgctctt tcagaccgat ctcgccggcc gccaaaaaac      5940
     catgggcgat ggcgagcagc cgcgtctccc gatcaggatg tcggcgccga tcgacgggaa      6000
     tggttttcag gccgagattg acggcggcca ggtgagcgcc ggtagtgatg ccggcctggc      6060
     gcaatatcga cgcggccagc agccggccga gccagggcgc gtgctgaagg acggaaagtt      6120
     cgttccaggc atcaagcgcg acgatcgcct gcagcaccgc cggcagatcg tttgcctgtc      6180
     gcaacacgcc gcgccattcc tccagccgcg catcctcgtc ccagtcgaga tcatagacga      6240
     gagtgtctcg ttcgcgggcg tcagcgcgcc cgggccactt cgcctgttcg atcgccgctt      6300
     ccgatcgcgc gagcaacgca tcgatggcgg catagtcgac gccagacaga ttctccaagg      6360
     catccccatc ctccccctcc ccttccggat cgatggcgac cgcgggccga atgacgccgc      6420
     cgggctccac cgcctcagcg ccgaccggat tgctgtccga cgtctgtcgc aagtttcgga      6480
     taccctcggc ggacaaggcc caatccggcg actgcgcggc gatgcgccgg cgggtgcgca      6540
     gaacgtcgcg ggcgatggtc agttcgtggg tcggggtgcg gatgtcgcgg gtgtggtcgt      6600
     gcagcacaag gtcttcgaga tggacgagct cgccgtcgat ccacagcgag gcgcaagcgt      6660
     cggcaaaatg ggatcgttcg atccacccgc ttccgacagt tgagcgggcg atgcgctcgt      6720
     caaggcgcgt cagcgcgatg ccggcgtcga aagccggtct catcaaggca ctcatgctga      6780
     ttttcgcgag atcgtaagcc attgaaatca tggtaaatga tttcctacac gaatgctatc      6840
     taaagattag agttcctcac atggtatgat tttgggttag ggttctaacc atcgataagt      6900
     ataggttatc gatggtagat tgatttcgcg ccgcaaatca gcaagaatcg gagcaaatca      6960
     cggtcctgga ggccgccaaa accgtccttt tggagcgcct gtggcccacc caaaaaaatc      7020
     actgaccgcc gtcgagcgcc gtgccgaaga actcgacacc attgccgccg tgctgccgat      7080
     ggaacgccgc gacgaactgg ccgagctgct caccgaccac gatgtcgaaa cgctgcgcca      7140
     cctcgtcaac cagggcatgg gcgacaatac gctccgcgct ctaacctcgg atctcgccta      7200
     cctcgaagcc tgggggatgg ccgcgaccgg acgctccctg ccctggccgg cgcccgaggc      7260
     gctgctgcta aagttcgtcg cccatcatct ttgggatcca aaacgccgcg aggccgatcc      7320
     ggatcacggc atgccgaaaa acgtcgacga cagccttcgg cgccagggat ttctcaaaac      7380
     cgtcggcccg catgcgccag gaaccgtgcg ccggcggctg gcgaactggt cgaccctgag      7440
     caaatggcgc ggttttgacg gcggcttcgc ctcccctgcc ctcaagtcgg ccattcgcct      7500
     cgcggtgcgc gccgtccccc ggacgcgacg ccggaagagc gccaaggcgg tcaccggcga      7560
     tatcttggca aagctgctgg cgacttgcgc caccgacaat ctgcgcgatc tgcgcgaccg      7620
     ggcgatcctg atggtggcgt ttgcctccgg cggccgacgg cgcagtgaga ttgctggact      7680
     gcgggttgag cagctgagta ccgagccgcc gattcccgtc gaagacggcc ctcccctccc      7740
     ctctgtcgcc atccatctcg gccgcaccaa gaccagcagt ggcgaggagg aggagatcgt      7800
     ctatctcacc ggccggccgg tcgaggcgct gaatgcctgg atggtggccg ccaagatcga      7860
     gggcgggagc gtgtttcggg ggatcgggcg ctgggggact ctttcgcggc gggcgctcga      7920
     tccgcagtcg attaatgcga tcctgaagca gcgggcggag atggcgggat tagatagtgg      7980
     ggagttttcc gcgcatgggt tgcggtccgg ctacttgacc gaagctgcca accgcggcat      8040
     ccccctcccc gaggccatgg agcagtctcg ccaccgttcg gttcagcaag cctcaagcta      8100
     ctataacagc gcgacccgac gcagtgggcg ggcggcgcgc ctcctctaaa gggcgtttgg      8160
     taggctccgt ccaagcgagt tcgctggcga ttttccacgg aaaagatctt gttgcgttga      8220
     ggtgaaggcc ggaaactcgc agcttcggcg caatggtgcg tgggatgata caaccattct      8280
     cgctctccag catcgaacca tgatgttcct gacttcaaag gccctcatca ctcagggttc      8340
     ttgtcagatt tgcgctggtt gaacgggcga gcgaacgaaa tccgtcgcaa aactcgaaaa      8400
     ttcttttctg cagcgtgtgg gtggaagacg aggagccttg ccttagtcgt ctaaggcgaa      8460
     gccttaatgg acgcataccg cccttgctat gcaggcgaat ttcaaaaata agctatttcc      8520
     cgctgctgac gtcaagtgct ttacgcaatg ctcacaagct tggcggtcca ttcaagattc      8580
     gataggaatt gaaatctatg tcgcatcagg agccgattcg ttgcaagaac ttcgccgacc      8640
     tccacgccag actgtaaaga tgctggtcaa tttattcctc atggtggcag ttgctgtttg      8700
     gaatatccgg gacgggctgc tcggctcctc aaccgcgcta atcatcggct ctttctttgc      8760
     cctatgggcc gttgtcgtcg cgtttaattt gatatgctgt cgaatccatg tgagcctgga      8820
     tgaaacatcc ttggtcataa accggatggt ccgctcgccg gtgcaaatcc tatggaagca      8880
     gatcgaaacg gccaagcttc ctgaaggccg cgcgccggcg attatctcgt ggcgtgcgtc      8940
     gccgggtgcc aatcttcaat acattggggt gtcgcagcga cgccttggtg aggagggcgc      9000
     taaagtgctt cgcaatgcga tattaactgc acgtcctgac ctcgatacgc ttgtcgccac      9060
     gtgagcttct gttcacttag acgttccaag cgtccgttct agttagacgt atgttctccc      9120
     acgactgatt ggggtcattt gcgggaggga cggaatctta cgctacgacc cacctcaaaa      9180
     ggcgcgacgc aacaaataca caccgcaggt gaccaaaact aagacggttt agttacggcc      9240
     attgaaggcc gtgatgccat gcgtccccac cattcctgta gatttgcgtg ttggcggatg      9300
     agttccgccc cctcgggtgt cataaggaaa tagtcaaaca ttggagcggc gtacagatcg      9360
     gcaagtgtta ggtgttggcc aacgaaccat ggagcatctc ccatcaggtg ggacatcgcc      9420
     gctaagcagt tgcgtgcttt cgggagagcc gcggcaagct tttcctcgtc agtgggaacg      9480
     cctctgccag gcttcgatat ccgctccacg taaactcccc acaccagttg aggatacgca      9540
     tagttgtcag caatgctgat caactgattg catcttgcac ggtgcaccga ctctaagggc      9600
     tgaagctgcg gcccttcgaa agcttcatct atatatcgag tgatcgcact ggtctcatag      9660
     agactaaatt cttcatgctc gaatgcagga atgcgcccga aaggatgctt cgctaagtag      9720
     tcggctggag gaccaccatc tgcaaagata tcgagtggca caagttcatg ttcgatgcct      9780
     ttctcaatca agcatagtcg agcaatccgg acgtaaacgc tataatctgc tccaaacagg      9840
     cgcggttgtg ctgtcatctg ctcaccttcg tgcaattggc gatacgttgg gattcaaagc      9900
     aagccgcgtc catagtagtt tatgccatgg cccatctttc aggagcagat cgcgcgcaac      9960
     tgctgcttct gccggaggcg atggacgatt acgtggggcc ggacgtagga tcaatcggtc     10020
     gcgctttcgc cttcatcttt cgcccaacat gagccttttg tatctgggtc tttaccgcat     10080
     ctgatgccgt aaaggatatg acacgacggg ctgcaatttg gtaatcctct cccgttttcg     10140
     gattgcgtcc tggccgccta ctcttctcac gtacgttgaa tgccgcgaaa gaggaaagcc     10200
     ccacgttctc accacgtatt aaagcactac aaatttcttc taaaatggtg tcaaccagct     10260
     ctgctgactc ggtccgtgac agaccaatct gtcgaatgat cgaatgcgtg atatccgcac     10320
     gggtcagcgt tttgatcgtc atgggtcctc gcaattggcg ggcaacaccc ctccatctgt     10380
     ttaacatcga ggatatttcc ggctcacggt caatccataa agggagagaa gccgagggaa     10440
     tgcatcgtgt cgacttggaa gcattccggg ccaaaatgaa gttgaccaag aaagggttga     10500
     attttggcta gatcgacacc ctcgtcaaac gcaaacgaaa tatgcggcgt atagctggga     10560
     aaatcccagc tcattccgag ccggcgaaac tcagcatggc gctgagtgag ccgctggcag     10620
     ccgaagatca acacgatcac cccgccgaaa ttccgcaccg atcttcggcc cccaacgcgc     10680
     actgtcaaat cgcttacgca tggcaatatc tgttcccagt tcaccatacc gtgggaggtt     10740
     gcgatcgtta catgcagctt gtccgaggcc acggtatccg caaaaccttc ggatttggcc     10800
     caaaccagaa attcatcatg gttgagaagc ggtttgctta cgaacatttg ccaatcgagg     10860
     gtcggaccga gagctgctca aaattcattc ggctaggatc gtatatcaca aatgttaggc     10920
     ctcatcgatg tcgatgagga tcacgcaatc aggccgctga agcggcatca tgtcgccggc     10980
     gccggcgaga tctttccttt gagcggggaa agaaggctct gccccctctc cccagcaagg     11040
     acaaaaagcc gtttccccat ccttcggccc gaaggcctgc aggacctggc cgaacatgtt     11100
     cggccggccg ctgacgcggt gggcgatacc cctcggtttt tctccctgcc ccccactccc     11160
     ccgctgctcc gcgcgaactc gggaagcagg agcaggcgct cccgcttcgc tggatcaaaa     11220
     aggagagacg agatgactat ttataccgaa accgcacgct tcgacaccgc aagaacaatg     11280
     accgaaactg agatgtggaa ggtcgcccct tcgatctttg cgacgaccgc ccatgaaagc     11340
     cggtccgacc gcttcaagcc gattccaacg atcgaggtgt tgcgtggact gatggcagag     11400
     gggtttgtcc ctgtcggtgc caaacaatcg gcaagccgca ccgaaggaaa agccgacttc     11460
     acaaaacacc ttattcgtct gcgtcgcgtc gatgacggga agacctatcg agtgggcgat     11520
     accgtctgcg aaatcctgct gaagaacgcc aatgatggca cgagcgccta cgagctgctg     11580
     gcgggccttt tccgtatccg ctgcatgaat tccctcgtca cccagaccgg caccatcgat     11640
     gccatcaagg tccgccattc cggcgatgtc agtgccaagg tcattgaggg cacttaccgg     11700
     gtcctgaatg aggccgagcg cacgcttgta gcgccacagg attgggcaac ccacaagctc     11760
     aatcgtgacg aacagcagat catggccgag gcagcccatg tcttgcgttt tggtgataat     11820
     gacggcgaaa cgaaaacacc gatcaagccg gaacagcttt tgttgcctcg ccggcacgac     11880
     gatcgcgccg acgatctttg gaccgtttgg aacgtgacgc aggaaaatgt cataagaggg     11940
     gggttgcgtg gcatcggccg ggaggacctt ggccggcctc gccgcgtaaa gtcgcgtgcg     12000
     gtcaatggca tcgatcagga tatcaagctg aataaggcgc tttggctgat cggtgagaag     12060
     atggctgagc tgaaggcggc aagatagtga tcgggcatat ccgttgagtc gggatgtaaa     12120
     cacagaggcg ccgtcatttt gggcggcgct gttaacaaga ggctagtgtt tggcaatcgt     12180
     ggcattgagc ggagaaggaa atccggagct cggaacaatt gtcaaagtgg cggacgctct     12240
     tggcttcaga ctatcccttg ttgcgaaatc tgacgctcga ccggcggctt gagcgccatt     12300
     accgcgcctc cctgttccgt gccgcatcga gcagcgcgga tcaggcccga gggaagtccc     12360
     gatcccctcc cctcgatact ccccgcccgc ccaggagcgg aatgtccttt ggacatatgt     12420
     tggcccgagg cggcaacccc ggccgaaagc caggtgttgc gcctccgaga tcggtcccgc     12480
     gtcgaggctt gaggcatggt ctgacaacct tctggcggac atatggtggg tcgcatctcc     12540
     caacgcgccg cttgttatgt ggccacgaca gccggctcca tttctttgta tttccagatg     12600
     ccaccgattc ctgcgcatgg cattcgggat caaacgtttg gccgccgcgc cgacagatgt     12660
     ggtgcttcgt atccaccagc ccaaatcagc cgcgggcagc gatagaggcg atgttgctcg     12720
     tctgggcatc tatcgttgaa cgcggatgag acgaaaccac acgtcttgcg tatctccttg     12780
     ttcgtgttgc cttgagtgat ggaccactac ggcgggccgg acagccagca accgcctgcg     12840
     cggatgattt ccccctgtcg cccagcgcaa gctccgcttg tcgcgctgag cgccattcct     12900
     cgcgcggcaa aatccccttc tgcggcggtg cttcgttgca ctgcgcccct ccggtgccgc     12960
     gggcacttcg ggtgcagtgc aacgaagcac cgccgtttgt cgtgaccatc ggcaacgcaa     13020
     acaaaggaga cactgcagtg accgatctcg ttaacttcat ccgcttcaac gacaacggca     13080
     tgctgtccgg caatatcgcc tccatcgcct acgacctcga catttcgggc gaggaatttg     13140
     agagcaccaa cgccaaggca cccgcctatc gactcttcgc caagagccct cgcggcaaac     13200
     gcgtcgagat cggtggcatc tggaagaagc agaaccagaa cggcggcgac tacttcaccg     13260
     tcaccgtcaa tatcggatac ggcaggctca acgccaatct cggccgttat ccaggtcagg     13320
     acgacgacga cctcatggcc gtcatcccct gggattgatc gtaaagacgc aacaaccccg     13380
     gccggaaggc cggggttgtt gcgtcgccag actcgggttc taaggctgcc gtctccccgt     13440
     cggcgatggc aaaataatcc cgaccaggct tcgcctgacg tcaaatgcct gcccagcgac     13500
     gcaacttcga tgataacgcc cgcttgtatc agcagccatt tgttcggttc gtagaccacg     13560
     cacgaggacg tcgctgtcgc cgttgcgtag acaggtagtt gtgccggcgg ctgagctgtt     13620
     cgtcgtggtg agtagtccgc ggactacttt ggaggagccg gctgtgatca atagcgacga     13680
     aagcgcgcgt gacaagatcg aagcggagcc ctttggctga tccctcggaa agatatggct     13740
     gcccgtcaaa atgagcgcga ttcggaacgc gaggactacg aacttcgctc ttcctttaaa     13800
     aagcgaagga gtagtgccct tcgcaagtag tctagctatg acgcttggta gtccgcggac     13860
     taccaagcgt catgcgatcg aaaacgcgct ctgtacgcga atagcgccac ttcaacattg     13920
     caaggcaaaa cggctggaag tggcggttgg gtcgcaagtc ggaataagta gtccttaggt     13980
     accgtggtac ttgcacagcg atgagatcaa cgaaccagag aggttagggc agccttttaa     14040
     ccggtcatcg ccaacgcaag ttgacaccgt actctgccat ggccagtacc tgatattcgg     14100
     gcgcgacacc cggaaaactg ctggaatttg cggtttggtt aagcgtttgt aaattggtaa     14160
     cgaatcgggg catactataa ctgcgcagtt tgagggcatt ccgcaaaaat tgcgcagtta     14220
     tacgggaaaa ccattatgca gccgagtctc gttctccagg acgatcaaga gcaccttccg     14280
     tcgcttctgg caacagatgc gcaggagcta tcctatcagc ttcagcagca ccaggctaaa     14340
     atcttcccgc cgcattcgca aaagacgatg cgggcgtttt cacctgctga agctgcaagc     14400
     ttcataggta ttggtgaggg ttatcttcgg caggttgcag ctgatgggca tggcccagat     14460
     ccgctcccaa atggacggcg gttgtatagt gccgacgata tggatcgtat ccgccgggtc     14520
     ctggatgaac gtaacggaac cccgaaatat gtgccggccc gcaggggatc cgaaaagctg     14580
     caaatcgttt ccgtcatgaa cttcaaaggg ggatctggaa agacgacgac agccgcgcat     14640
     ctcgcgcaat atctggcgtt gaggggtcat cgagtattgg cggttgacct tgatccgcag     14700
     gcttcccttt ccgccctgtt tggtcatcag cctgagctag atgtcgggga aggagagaca     14760
     ctctatggtg cgatccgcta tgatgaaccg cgaccaatcg ctgagatcgt gcgagcgacc     14820
     tatacgccga acctgcattt aatcccggga aatctcgaat tgatggagtt cgagcatgag     14880
     acgcccagag caatggtggc gggtacggca gagacaatgt tttttgcccg tatcggggag     14940
     gcattgacgg aaatcgaaag cctctacgat gtcgtggtta tcgactgccc accacagctt     15000
     ggcttcttga caatgtcggc gctgtgcgcc gcgacatcga ttttgatcac agttcatccg     15060
     caaatgctgg acgtgatgtc aatgtcacaa ttcttgacca tgacgagcga gctcatgtct     15120
     gttgtggaga aggccggggg gcgcaccagt tacgactgga tgcgttacct cgttacgcgg     15180
     tttgagccta atgacggccc gcaaagccaa atgaccggct tcatgagggc gatcttcggg     15240
     aatcgcatgc tccataatgc catgctgaaa tcgacggcgg ttgctgacgc cggcgtgacg     15300
     aagcagaccc tttatgaagt tgagcgggct cagttcacgc ggggaactta tgatcgcgcg     15360
     ttggagtcgc ttaacctagt gaacgccgag atcgaggctc atatccggtc gacctgggga     15420
     aggaaatagg tagatggcga gaaagaatct cattgaagtt tccatgccaa gtacaacacg     15480
     gtccgacgct gagtccccga gggacacgcg acccattgcc ggttttgtac ctcagacgag     15540
     aagcgcaatt ccggttggcg gcattaccaa gactcttgga aatatcaccg aaaaaatgga     15600
     acgcgccaat gatctcgagc ggcaacttgc cgaagggcag gcgatcatcg acgttgatcc     15660
     tgatctgatt gatggatctt tcgtcacaga tcgattggag attgacccag ttaaactcgc     15720
     tcaactcgta gaccagatcc gcgagcatgg gcagcaagtt ccgatcctcg tgcgcccgca     15780
     tcccacatcc aagggacgct atcaggtagc ctatggacat cgccgattag cggcggcaag     15840
     ggagcttggt ttcaaggttc gagcggttgt ccgagacctg acggacgatc agttggtggt     15900
     gagccagggg caagaaaaca gtgcgcgaac tgatctttcc tacatcgaga aagcactatt     15960
     tgctttgcgg cttgaagagc gcagcttccg ccgagatatc atcatggcgg cgctgggagt     16020
     ggacaaggcc gcgctctcta aaatgctgat tatcactagg caggtaccat tggatctcat     16080
     aagtaccatc ggcgctgctc cagagattgg ccgcagacgt tggcttgaac tgggagagcg     16140
     gttggagagc gttgctccag aaccaatcat tgtcgagttg tccgcggacc actctcgaaa     16200
     gctctcaagt gatgagcgct ttcagcgtgc gctggttttg gcgaccaaga aatctcaagt     16260
     tcctgaatca tcggtcgcga ggtcggaaat atcaggcgtt ccggtaaaat tcaaaaagac     16320
     agcatccagt gcaacctttg tcttcgatag caaggccgca cctggtttcg atcagtttgt     16380
     gcaggagaga cttcaggatc tctttgcgga atttcagcaa ggtaaaggag cgtaagccgc     16440
     aaaagaaaaa ggcccccaaa acgacgctgt cgtggaagcc cttctctgat cttaagcaaa     16500
     tcaagaatcg cattttcacg aatcacagtc aagagtcttt ggcatcgttt tgatgagcgg     16560
     attttttttg cctcaacgta ggtgaaggca aatggaaact ggatatgtga cgacgccctt     16620
     tgggcggcgg ccgatgacgc ttgggatgct cgcaagccaa aagctaacgc gcgaaatcga     16680
     ccctgccacg tcggtcgaca aatggaagat ctaccgtgcc ctctgtgaag ccaagccatt     16740
     gctcggtgtt actgatcgtg cgctcgctgt tctgaacgcg cttctgagct tctatccgaa     16800
     gaacgaattg tccgaggata acggcctggt cgtgttcccc tcgaacgctc agctgtcact     16860
     gcgctcgcat ggcatggccg agcagacgat taggcgccat ctcgccgccc tggtcgatgc     16920
     ggggcttctc attcgcaagg atagcccgaa cggcaagcgt tacgctcgcc gaggtaggga     16980
     aggggaggtc agtgaggctt ttggcttttc attggcccca ttgctttctc gagccgaaga     17040
     gatcgagcat ctcgccgcca cagtggtagc cgagcggctc catatccaac agctgcgtga     17100
     acgcatcagt ctttgccgtc gcgatatcgc aaaactgatc gagacggcac tcgctgagca     17160
     gatccgcgga gattggcagg gcatccatac gggcttcaga agcctaattg agggcctccc     17220
     acgctttccg accacagcag cgctggagaa tctgctcgat gaactggtcg ttttgcgtga     17280
     cgacatcgtc atccaattgg aaatgcagct gaaaacacaa aatcaaagcg gcaatcccta     17340
     tcaaaatgag cgtcacatac agaattcaaa ccccgaatct acaactgaat ttgaaccgag     17400
     cttcgaaacg aagcagggcg cgccagcgga agacaaacct gacccgctaa ccgtgccgac     17460
     agctgaaaag gcagatgtat ccgttagccc gcggcaagtg ggtaggcgaa aatcagccgg     17520
     cgcggtaggt ggcacgaatg cggaaaacca cggggatttg aaatcatttc cgctgggcct     17580
     ggtcttgcaa gcctgcccgc agattgtcga ttacggcccg agcggtgtga tcggcagttg     17640
     gcgtgacctg ttgtcagctg ctgtcgtcgt cagaaccatg ctgaaagtga gcccgtctgc     17700
     ctatcaagat gcctgtttgg ccatggggcc tgaaaatgcg gcgacggtga tggcctgcat     17760
     tctcgaacgt ggcggccata tcaactcggc tggcggctat cttcgtgatc tgacccggcg     17820
     aactgaacaa ggacagtttg cgatcggtcc gatgctgatg tcgctggtgc gcgcaaatgc     17880
     tcctactgga cggaggacgg ggtaggttgc gctgctttcg gtttgcttcg gctgagcagg     17940
     ccggcgcgga tttgagctgc tcgtgaaacc tccggtggtt ctggcgtcgg ttcgagggga     18000
     ggggcgggag catccgatga acgctttgcc actttcgtga acgccagctg cgcggccatc     18060
     cgattttctt ccgtaattgg ggcgatcgcg ttgccgtcga tatcatgccg gaaagcatcc     18120
     ggttgggcgc aggcgagaaa atagcgtttc gagtgggtgt aggcggaaac tgcgcgccga     18180
     agcgcggtaa cggcggtatc aggtttcagg agtgcgcgaa tatcgttcca aatgccaatg     18240
     gcaaaagggc ggattgggtc accagctgac ttgggaagaa gatcgatcgg gcggatcagc     18300
     aatacggaaa tggcttcagc cttgttgagg tcagaagagg ctgcggggat cacgccttgg     18360
     ctctccgtcc agggttttgt catcggtcat tctccttgct cggttccgat aaacactgga     18420
     acgtgcaatt ttgatgacag ccctgaaagg gtttcgcaat aaaatggcgg tgtcgctgcg     18480
     ccgttaggtt acagagatac ccttttataa aatgggtttc tctagaccat ttacaacccg     18540
     accaggcctg taaccctttg cgcgcttttg ccgcaagagt tccaggaacg cttctacagc     18600
     tggcttttca ctcggaaaca cgtctatgcg ttgctgtccc ctggtgccaa ggcgacccca     18660
     tatccgcacc agcgaagtct cgccaaacag cgtcggctcg agcgcgagct catagaagcg     18720
     cgccatgttc ctgctggggt cgacgcgctg gatgtgaagt cgataaggtt gcgggctcat     18780
     ggcggaagag tcgcacgggt gcggttttgc gtccaatcag aggtttgaat cggtctggcc     18840
     caaacgattc aaccatttga tggaatagag gaggataggg caggcatgta aagctggccg     18900
     caatatttgg cgcttcgatc gtctcatttt gaggttggga ggcaatcagg aagaagccgg     18960
     gaagtgggga gcgataagtt ccgctgcccg gttagcccac cggagcgtgg ttccagccct     19020
     atgcctgcgc cagggcattg agcaacagta gaagacggcg tctcgccact ggcgtcatat     19080
     ccgtcagtcg ttcgaccaac tcgcgccctt ccgttgtcgc aatgaacgca agactttcgt     19140
     tggcttgtgg ggaaatttga gtgagatctc cggcgccgga ttccgggagc ccgtcgaaga     19200
     acattgccgg caacacgttc aggaaattgc caatttccca aagcatggaa gcgctgacac     19260
     gatttgtgcc gacctcgtat ttttgaactt gctggtaact gataccgacc ccttttccca     19320
     gttcggtttg ggagaggttg gcacgaactc gttgaatgcg gatctgttgc ccgacgtaaa     19380
     agtcgacggg atggattctg gatagtgttt ccgcctgagg tgtcgccttg tgccggcgta     19440
     tcttggtgaa tgtcgttcgt tgtttgctca tgtcataccc cgattttgga gatgacgatg     19500
     atagagaagg gcggcgccga aactttcgaa atcttgctac attcttatca ccggaattcg     19560
     cctgtgattg cgtaagtgcg gaacatatat tctgcatcaa gcctatgagc ggcaagtcat     19620
     ggatatggaa gtctgtcggc caattggtgt ggaatatcct gatcagaatt ttggatattc     19680
     aacctatttc catcccgaac tgcgaagatc cgcgcgtaaa acgatgtcgc acagatcaag     19740
     gtttgggcaa aggatacctg atcatgtttt tgactacagt tatttttatt aaacgaagtt     19800
     tgcagcatac cgacggcaga taaaggttat ttacaaggta gctatgaacc ggagtcgaca     19860
     aatgcgtgtt tccttcggtg tcatgattgg cggatctgga ccatatctac attatttcaa     19920
     gtattaacaa ccgaatctca tccgaaatta ccttaagttg tatgaatgat atttaatgta     19980
     aaagaataag ttgcttattc ttgggagttg tgagagcttg aagtgcgatc attgctatag     20040
     ttttgacgga ggggaaaatg aaaactatta gcgcattgat ttcattcgca ggtatagttt     20100
     tggtatcgac gtccctggca ttcgcgcagg ctgacccgat aacagcgggg attgtggttc     20160
     aaggccttac ccaagcaatt ggtgatatgc ggtcggcgct aaacgaggcg accaatgatg     20220
     caaaaagtgt agggaactca tatcaagcaa acgctcagaa cgttctaact gatatcgata     20280
     agatgttcgg taagaatctg aacttagcgt ttgataagat gactgatcag cagcgacaac     20340
     ttgtccagaa cggcgagcgt cttgttgcac tgaccaaaga agccacagac gagcttacaa     20400
     agaaaaattt tgatcgagca agaagcctaa tgattgaggg tgacattgtg gcgtatgaca     20460
     caagctattc tttgccatgt cgaaccacaa aaccaagagt gatgcaggtc gaaccggtcg     20520
     agataagcgc ggatgatgag gcacctgtca ttcatgtccg cggcaacttc ttgctgcagg     20580
     gaaaaggcct aaaggtctcg ttcgcgaaaa cggaagccca ggtgcttcaa aggacagata     20640
     ccgaaatatc ctttgctgta ccgcaatccg ttttggatga cgcaaaaggc aagcaaattg     20700
     cgattagcgc cacgctcgac ggactaacga caattacacg gaaaataaga tttgttcttg     20760
     gatgttccga gaaatcgcgc agccttgaaa ctgcgccatc cgttcagttt ttgatcaatc     20820
     cgccgataac tttccatgta caaggaacgc ttacgacaag tcatcttgtc gatacggttc     20880
     tgcctgacct caaggggcaa ttttccaata ctggtaacgg ccattgcgac gattcctatt     20940
     cagtcgatca aaactactgt ctgatcgaca agaatggagg ctttgaccac gtggacatct     21000
     ctaacccatc ggcaaattgt ggaagctcca ttggtcctat caatccatcg ggcgatcatt     21060
     gtgttttcgt tggcggtcat gttcaaggat gcggcgcgat tcgtggtcct ttcaatgtgt     21120
     gggcgggctg caagggaaga ggatgggtta aatacgacta tcagctttat cgaaaggata     21180
     gggtgatgac cgaggcaggc cattccgaca ttgagaaaga aggaattcct ggcgagacgc     21240
     ttttctcgtt tccttttcca accgcagccg ggaagaaaga agagatgcaa tttaccttta     21300
     acgtaatcgt gcaaaaaatg cggggcgaca aggtgctgga acaggggacg ctgtctcaag     21360
     cacaagccac ccatggtact tggcaggcta atgtcaagga cggacagttc tcgttgacgc     21420
     tccaatagtg agctttagtt cttcggccgg cagatgaccg gccgcatttg tgagatcacc     21480
     acgccgcctt tcggcgtggt gatggcgccg agccaattgt ttgaaaacat gccagcgcat     21540
     cggccgggtt caaccgctgt caatcggcac ggatgtcctt tggtatttag acgtaagaat     21600
     gcgaccgttt cagtttggtc tgacagataa tttgagattc ggcgtatcga gattgtcaaa     21660
     ttaagtgcaa ctgggaaggc gtgcgccata gcttgcaatc tatcgatccc attgatgtgg     21720
     tcggagtgca agtggagatg aataggatgt cggttcgtcg ggaactcgct tttctatgcg     21780
     atgccatttg gccgttgaat gccgaattct gttcagagtc gtagacgtag gtgaagcgtg     21840
     cggtctgtcg ttcgggtgat tcagggttcg ccattcttat ctgctcgaga gtcgtaatag     21900
     tgccggtatg gaacgcgccc tggctgaccg cgtgttgcga gcggcggatt acggtatggc     21960
     gcattggaca atcttagcct gattttttga ttgaagctta cctttaaagg caaatagatg     22020
     tcctctagtg atctccattt ggcaaaaatc gaaaaatttg atccataaat ggtgcgtaaa     22080
     tctcttcagt gccctattta tgcatcattg cgctcgcctc attcgcgcgg taatatcccc     22140
     ataaatagat cgcaagatgt gttcgtgact gattaatgga gcagtaggct tatggccaaa     22200
     ccagccgcta gaagctattc gcggtatagt gaggaggcag cgcgtttgct gggtcaatcc     22260
     atcaagctgg cgcggataga tcgcaagctg actgtcgagg aactggcgga acgtgctggc     22320
     atgtcgcggg gccttgtcca gcgtattgag aagggcgaca tgggctgcgc gattggtgcg     22380
     gtgtttgagg cagccgccat cgttggcgtt cggctttttg acgccgacca gacgactatc     22440
     gccgcgaagg tcgcgacgaa tgatcagctc ttgaccttgc ttcctcaatc cgtacgtaac     22500
     cccgcccgga gagccaagga tgacttctga ggtcgcactc gatgaagtct atgtctggat     22560
     ctggcttccg ggcaaaaccg agccggtcgt ggccggcctg ttgtcacgcg ccggatcgac     22620
     gttggtgttc aactatggcc gctcctatct ggaacggccc gacgctattt caatctacga     22680
     tccagaactg ccgctcaaag caggagttct tccccttcct gccggattgt ccatgccgag     22740
     cagcttgcgt gatgctgcgc ccgacgcctg ggggaggcgt gtcatcgtca atcgccggtt     22800
     cggacagaag ggggcggcga tcgatatcgg ccagttggac gaactgacct atctgattga     22860
     gtccggctcg gatcgcatcg gagcccttga tttccagcgc tcggcaaccg cgtatgagcc     22920
     acgacaggcg cacacggcct ctctcgagga gttgctgacg gctgccgaga gggtcgaggc     22980
     cggtgtacca atcacgccgg aacttgatca ggcgcttttt catggcagtt cgctcggagg     23040
     agcaaggccc aaggcaatca tcgaggagcc tgataccaaa tacatcgcta agttctcctc     23100
     ccgaaccgac gtctacaatg tggtcaaggc cgagttcgtc gccatgcggc ttgccgctct     23160
     tgccgggttg gaagtggcgc gggtgcgtct tgtgggtgcg gctggtaaag atgtgctgct     23220
     tattcagcgt ttcgatcgcc tgtggttact aggaggctgg cgtagaaagg cgatagtttc     23280
     ggcactgacc ctcttcgaac tggatgagtt tatggcccgc tatgcgagct atcaggatct     23340
     gaccgaaatc attcgccacc gctttgcggc accccgcgcg accttacacg agctctttgg     23400
     ccgacttgtc ttcaacatcc tgtgcggaaa caccgacgac cacgcgcgaa atcatgccgc     23460
     cttctgggat gggacttcgc ttgctctgac ccccgcctac gatgtctgcc cgcagggtcg     23520
     aaccggcaac gaggcaacgc aggcgatgct gattgccggc gacaacaggc agagccgtct     23580
     ctctgtctgc atcgaggccg ccgcgcagtt tcaactgggc gtcgaggagg ctatcggcat     23640
     catagagcga cagattatta ccgtgcggga tcgctggtcc gaggtttgtg atgaaggtgg     23700
     actgactgag atcgacagaa accttctctg gcgtcggcaa ttcctcaatc cgttcgcctt     23760
     cgagggggct cccgttcaat tgcttggctt gattgaatag ggggcaatgc catcacataa     23820
     attcttggcc taataggaga caaaggccca catcctggcg cagcgagcct gaggcctagt     23880
     ttgcttttgc gacggcactg agagcttgtg ctgcatcgaa gcccaagatt tcagcaagct     23940
     cgagaaattc gatcacatcc actctacgct gcccactttc aaggcgtgcg acaaaagact     24000
     gatattcgcc gagcctcgcg gcaagatccg tttgcgtcag gcctttggcc tcacggtttt     24060
     caattagtag cgctatcagc gcctgatgtc gtttcgtgcc gagagttttc gtcacgtcat     24120
     cacccatctt cggacaagat ggggctttca atatatctgc ttttcagtta tcttaaattc     24180
     agatattctt tgaaaccgag cgtttccgta agtggggctc gatttatctg catgtgggcg     24240
     acgaaacgat gcagccattc tgatcgcagc taggccttaa tgcgtctgag gtcgcaggag     24300
     gtgtatgaag gtgatacccg atgagacggt cgatctgctg gaagccttgc tttttacaat     24360
     caggaaaatt gttgagagcg gtgctcaagg caagcagcgt atagcgaacg cctatcatga     24420
     cgcttgttcc ctggcgatgg cgatagatcg tgatggcggt tcggctggcc cgcgtatcga     24480
     ggcatgcctg aagcacttta acatccataa ggacgccggt gacgtcgcct cagcgggttg     24540
     gatgctggcc gcaattcaag agcgtgtgtc cgaacgcaat ctttacggct ggcgtaaact     24600
     cgaggagatc gtgaatgcag cggtgcacga actgctcctg tctgtacagg catcaccgaa     24660
     ttgagtgtgt ccctacgcta tccgtgtctg gatgccgaga gcggtggcgg cgagaaaacc     24720
     gtcccacatt cgagaaatgt ctgtctgcaa ttattgcgct aggcgtttcc gctgacctcg     24780
     ccatcctcgt ccaattcgcg caccggtaga taggcatttg tttccagcca ttccttgacg     24840
     atatgacgga tcatatcgtt cctcgtcata ccgagctcgc cggcgatgga tagcaaggca     24900
     tcttccgttt ccgcttcaag gccaatcggc gcagcattgc ggatcaggag cgccgcacgt     24960
     cgcagcagca cctgtagatc ggcgcgggat gcgtcgccaa tgcgatcggc catatactca     25020
     agctgtcccg ccatatccct tggcatgcgc gcgtccccac ttcgatagat ggcattactc     25080
     atcatctctc tccctcaggt ttggtcaagg ctcggctgcc aaccgcgcgt catgcctttg     25140
     ctcatcacgg cggaggaaag agaaagctga tgtcgaaggt gctgaatcct atgcacgaga     25200
     tcggtgacgg ctgccctggc gtccccatta tgggcggcaa tgatcgcatc gatcggatcg     25260
     atttcaggtt cttctactat tgctgcggct tcgatactca ttggacacac gtctccattc     25320
     cgccggatgg ggcggctctc ctcgtcaaat tgtttgaaaa ctcaggccgg tgcgcagctc     25380
     gcgtttgttc ttaaaatgtt ctcattttga cgcggagtca agctcgcata aattcatcgc     25440
     ggagccttgt gggaaacctg accgatgatg caggcgatac tcgttcgatc aagccctagc     25500
     ttcccggagt ggtgtgtcca ttcgagatca agctttggga ggcatcccca gatatgacct     25560
     gagggcgcgc tcggtaatgt cgctggccgt cgtcttttgt ttcaatgcct cgagcttagc     25620
     ggcaataatc accgcaccgg acaaagcgat ctgaaaccgt tccggcttgt cgtcgacgga     25680
     gccaggatta agaggggcgg ccggttgtga gcgctcttcc tttactggtg ggtcgacggc     25740
     aatctcacta cctgctggcg tcccatgcgt cccctcatag gagcccagcc ttccgatgga     25800
     atcggcaatc aaggaatcca ggtctgtcaa attgcggcgt gactttggca gaggcggaat     25860
     atccgtcatg tcgtcctccg atcgcttcat gcagcttcgc ttacgatttt agtgatatcg     25920
     gtgatcacgc tgataatgtt tcctcgagcc ttggccacct gctcggattt gcctggatct     25980
     ttcccgatat gtgcaagcga gcccgcttct ttcgaaaatt gctcgtagac tttccgcgct     26040
     cgcacgaagg tcggtagagc gggaagcctg tggtcgcgga tcatctgcac ggcatcctgg     26100
     aaggctgtgg tgttggtgtc gatgccttca acgcgattga ggatgagcct gaggggggct     26160
     cgtttcagat tgttctgcgc ccaatcgaag agttttacgg tctcgaccat ttccatgaca     26220
     ttggctttcg ccggcaccag cgtgatatcg ctcgaaacga tcgcggctat cagcagatcg     26280
     ttcatggacc cctggacgtc gaccaggatg atttcggcat tcgacgtcgt gagagcgact     26340
     ttcagatcct gtggggtgtt tgccggcgcc accatcaacg atggtggcaa ggtgccggca     26400
     cgctggcatc ggttcaccca ttgaaggcag gattgttgct tttggtcggc atcgatgatc     26460
     agaactttgg cgccgttctg ggcgagctcg gatgcgatga gaaggcataa ggtcgatttg     26520
     ccgacgcccc ccttagagtt ggccacagcg atgatggtca ttgagcaggt cctcatgacg     26580
     tggtgaatgt attcatatat accaaataaa tatcagtgcc gccttttgca agcgctattg     26640
     ctgcgagcgc tgagcgcatg cttggcgctc tccctagcga tggatgtgtt agcactcctg     26700
     gcagcttcag aagcccaaga gctgcggtcg ctgacctggc tttgtgcagg gccgttgctt     26760
     gcatcactga tatcagctcc agcccgtcat gcgcttttgc cactgtgctc cgtcttagga     26820
     gtgcgcgacc tgtcatcact gctgatactg tcggaaatga ttgcagtgtg atcactttcg     26880
     taagtgatat aagtagttga aatataatga taaaagtgaa ttatatggtt ggcaggatag     26940
     cagttttcgg tgtacgaaaa ctgtctgtgc ccgatgggcg gcctaacggc tgattgactc     27000
     gtccggcagt cgccataggg gcgaccggag cgagaaggca tgagcgagat cgagattgga     27060
     caaaggcgag cgaggcgaaa caaatcggtg cgcgtcaggc tgtcggcggc cgaattctgc     27120
     gcccttaccg cctttgccac ggatgccgcg ctgcccacca gtgaggtgtt gaggcgattg     27180
     gcccgcgagg cttctggtct tggtccaact tttgagggag atatgtcgaa aaagattcaa     27240
     ttgataatcg ttcagcttcg taagatcggc gtcaatctga accagattgc gcgtgttctg     27300
     aacagcggca gcacacccgg ctatgagcct ctcctgggtg gtatcgaaag gctcgcgagg     27360
     ctcgtcgcgc agcacgaacg tgatctcgat gagcttaggg ccaggggccg cgctcgggca     27420
     ctgcgtctgg tgagaaccga tgtttgacgt cgacgccttc ctcgaattgc ttgatgacat     27480
     cgagcgacgc aaaagccaac gcgtatcgcc aggtttcccg ccgcagcagg gtgtcaatat     27540
     gcgtgccgta cggaaagcgc ggcagaagcc cggaccaaag tcgaagcggc atgggcctgt     27600
     tggtctacca tatacgggca gcaagccgcg cacgggtgcc gcaccgatgg atctgctgct     27660
     cgaagatgaa tggcgcaaac gccgcagggg tggggcaggc gggagcagct cacccgttcg     27720
     cagcctcggt cagcctgata agaccaagct gcaacccggg ccgaataccg acagtggcac     27780
     cgtaggagcg aaggcggaaa cgcgcatccg ggtcgctggt ccgcaggaac gccttgcgat     27840
     cgccggggga tcacagccgg ctgtcgtcaa gctcgtcagc tatgccgccg gaagcagccg     27900
     tgtcggaaag cttctcacct atcagagtcg ggatggtgaa ttggcggtcg agcgtgagac     27960
     cggcgcgaaa atggcgggcg ggcaatggat ccaggcgctc gccgacgaat gggcggagga     28020
     ggacggccgc cagccctcga aggacgtgct gcggctctca ctgtcagttc aatcaggctc     28080
     ggacgacgct gtaggcgcgg cactgaagga ggcattgccc ggtcatcgga tcgcttgggc     28140
     gagccggccg attgaagcgg gagagggacg gatcgtcgag gtcgtgatga gtgccgcggc     28200
     gcgcgcgcat cccaaacagc acaaagtgca gcgcatctac gacaatcgga agtcactggc     28260
     cggcctcgcg gtgcggctcg aagacgcatt cggctccgga acagaaatcg aggttcatgg     28320
     ctttgcccat ggggttgatg gtgtcggccg ttatcttgcc caggtccgca aaaggacgcg     28380
     ccatgccacg tggtcggctc gcatggacaa gggtggatct ttcgtcgggg atgtcttggt     28440
     tggcactggt gcttcctctc tggcagaagc gaaggactgg aagcgggatc tccgctcgca     28500
     ggaacgacgc gacgtcgccc atatcatctt cagcgccaaa cctggcacgc cgcgggaggg     28560
     gttcgttgac gccgtgcgcg aaacacttgc ccgggagttt gccgggcatc gttacgcctt     28620
     cgtgttgcat gaggatcgac agcatctgca tgttcacgcg gcgatgaaaa tgctgtcgga     28680
     gaccggccag cgtcttcatc cgcgcatcca ggattttaag cgttggcgcc agacactcgc     28740
     cgaggaagcg cgcgatcgag atatcccaat ggatgcggtg agccgcttcg agcgggcgaa     28800
     cccacccggc tacaagctga aggatatccg tcgcgttcaa cgcgggatcg ccacggacaa     28860
     tgtgcgccgg cgcgtcgaag cggtgaagaa tggtgccgtt cacatcccgg ctcgggaaga     28920
     gggtaagcgc cgcgcggcgg ccgcagcgca tggttgggat gaggcggcag ccatcaccgc     28980
     gcagacaatt ccagagatcg ctccggaggc cggcgtgctg cgtctctatc gcgcggagcg     29040
     accgggctcc cgctcgtcgg cgccgatctt tacccgcgat cgcgcccagg ctgcggaact     29100
     ggcgcatcgg tatggcggag cgctgagttt catcgatgtt cgtccgaccg agatgcatca     29160
     gatcaggcct gtgcgcagtc agtctggcat gggcagcggc gatgaccgct ttgtggtcgc     29220
     tcgcgaactg gcagacacga tgcgcctggt tcttccagca gaagtaatta ctgcaacgat     29280
     tatgcggttt cgccgacgca gcgagatcgc cggcgaatat caatcacccg gatatcaggc     29340
     aggcagagcg ataaaggaga ccgacgaaat ggccaatctc gatatcatga aaacctcttt     29400
     cgcggagatg gatgagcaga tggaggtcat caggaaaaat ctcccggccg accgccagcc     29460
     gcaaatcgac gagctgcacg gcaagctgaa gcagacacag caggacatgc tcaaggcgca     29520
     agagacgatc gagaagaggc gcggagccgt tgagggggag acctttgtcc agcccgtcaa     29580
     acacgagttc agccaattta cggccgagga gcggggtgag ctgattcgct atgtcgctcg     29640
     gaaggcgaat ggcagcatcg gcgccgttgc gttcaccgat catggcgaca aagtcgagat     29700
     tgcccgctgg aaggaccgcg agacggtcct cgccgctatg caggtggctt cgcagaaatg     29760
     ggactccctg actatcaacg gaaccgacgg ttacaaaacg atcgccgttg agcttgccgc     29820
     ggagcatggg ttcaaggtca ccaaccctga attacaggac aagctcgtcg cggcgagtga     29880
     acggattgcc cgaaatcggg ttggtcgtgc cgggattacc ccaggcgtac tccctgagga     29940
     cgcaaagcct gagacacaga tagagacccc gacgtctgct accgaactcg cccttccaga     30000
     aaggtcgtcg gaaccagaga tcgacggcga caaggtcagg cccgccgacc gcgaccggca     30060
     gtcgatgctt gcggcaatgc gcgaagccgc gaaaaaatgg gacacaatca ccgtcaatgg     30120
     atccgagcgt gacaaggtgc tcgccgtgga gcttgcggcc gagcacggtt tcaagatcag     30180
     caatccggag ctgcaggaca agcttattgc cgccaaggag aaagtcgatc agcgccggca     30240
     aagggagctg gcccgggaag aaaagctgac tgggttcgtc gacggttcac aagcactgcg     30300
     tgatgttgag ctcaagccgc cggttgaaga ggaccgggag gccggctcag tcaccgcaac     30360
     catgagagac ggtcggctcg ttggtcatgg tgctgcgcct tacgagcata atcccgaaaa     30420
     tgacaggagc tattatgtta cgcttgcgcg ggccaatggc gaccagcaaa caaactgggg     30480
     tgtcggcctc gaaagggaaa tgcggacgca taggcctgag atcggcgagc atatcaccgt     30540
     aagctatacc ggttccgagc cggtcgttgt cgatggtgaa ctcaggaatc gccataattg     30600
     gcagatcggg cgggcgggtc cttcggacaa gcttaccgac aatacgatcg gtcgaagcga     30660
     cgccgaaatt gcgatcgcgc ttgaaaccgt tcgtgatcga acggatgccg aggcgcagcg     30720
     tgaggttcgc caggccgagc gcagtaccgc cacgaacgag aggcagatcg acggcggcgg     30780
     cgaggatcac gcctatcgga cccaggccga ggcgaatgcg gccgttcgcg ccgaacgctc     30840
     ggtggatcag aacccgtcaa agcccatccc agccgatgtg aatcagtcgc ctgaaattga     30900
     gcgccaacgt cagatccaac aggagctgct ggctgaaaag caagcaaatc gtcaggctga     30960
     atcacaaaag caaacgcaga agccgcgtta acgacaacag tgaggcctca aatgggaacg     31020
     tggccgatga gggccatatc aaacacgctc tgaccgttta ccggatcagg aatgatgagc     31080
     atggtagctg aataggcgac attggagtga gtggtaatcc aggcggctgc ttcaacggac     31140
     atccatgatg taaggttcag cacatcggca tgcaatgcag tgagtggctg tgccaggatc     31200
     ggctcatagt gggcaatgcg gttgcgcagc cgtcggaggt cgcgcagctt ttgggcgatg     31260
     gtggcgcgtt ggaggccgcc ggtattgaag atcgggcgta agatgcccca taggtggttg     31320
     gaagatcggc caaacaagga actccagaac ccgaaattca gctccgcgat catctgacca     31380
     tgggaggccg acttgccttc tcgaagaaga agggcacgcg cttccttgat gcattggcgc     31440
     tggtacgatt ctttgaggac agtgggactg tcgaaccagg ccgcgccatg agcggtcgta     31500
     aggaccgcat cgcacctgtt ccgtagggcg atttcgagca tgtggaggga gctgtaaaaa     31560
     tccgccgaaa gctgaacatt gtagctgtag aggcgttctg ccagggcgac atcattgttg     31620
     gcccacagaa gataggtcga gaatcgatcg gctgagagaa tgtcaatgag aggcataggt     31680
     gtcaggaaaa agcttgaatt ctgtatcggt atatgccata tggaatgcgt atcccccggc     31740
     tggtccctgc tctgcatacc gccggggcaa gttttttctg ggccttagtt gcccgtgtct     31800
     cttccaattc gacattcttt ctctccatga cggacgaata gcacgttccc gtggagttag     31860
     catcattatt tgccagctca gaaataggcg tggcggcggg attcgaaccc acagcctctc     31920
     cgccccttca agttcctatt cctgtagggg tcgaacgcgg actgctcttc cagcgagttt     31980
     gagctggaaa cgcagatgac gttccgggac gttcctcagt attgagcttg tgagggattc     32040
     gaccccatct gtagaggcag ggggtgcgcc gacccccccc gcgcgctcac atcatgattt     32100
     cggccgctca agtcaattca ggaattgaaa gaaggagatc tccgctccca gcgttgcgaa     32160
     ccagctaagc agcggcgcga agccgtgatc gacgctgaac gcacatgcgg tcagagcgat     32220
     gaggacgccc gcaatgcccg tccaggataa gggttgggtc tttgtagtac atggtagtct     32280
     cctgtttgat gcgatgttct ggatgaacac cgcacccaaa gtgtgagagc gttttatgca     32340
     tacgacaaag tcggcagttt tcccgcagat caggaacctg aaagtcatcc atggcatgct     32400
     tgttagtggt gagccgtgga tgccagttcg tgtcgcgcct cgcctctacg gttacatgac     32460
     gttcacgccc atgtcgccga attaataata atcggctgaa ccgatgtgca tcaaaatacc     32520
     aggccatcct tcgccgaaca aaatacgcgc tcatagcact gatcgaccgc gcgtcgatta     32580
     taccgtttga gcatatcgag gtcgttgcgc aggaatctga catttaccgg ttgttcccgg     32640
     cgctccatcg atgcgatcgt ctgcgcaaaa acctccggtc cggcacggcc ctgcgcgaaa     32700
     gccggcaaat cggtgaatat atagtccaca aaggccgtgc cacagagatt gaatgaaaac     32760
     gacagatgcg gtccggcatc ggtggccgcc tggctgaatc cccggtcgga gagcaggcag     32820
     cggtcgctct catagtcgca gatggccacg aggacgtatt tcttcccatc ctcgaacagc     32880
     gtcttgatga tctgctcgaa gaaattcggc tggccgtccg ccatcggcgt caacagcatg     32940
     aaaagcatgc gcagccattc cacatattgc gcgtcactga ttccgagctg ggcgcataga     33000
     tgcgcctgct gcggcttcct gccgctgacg atacggcggt actccgccag cagcacaggg     33060
     tttgtcggat cgtagctggc gaggccgggg aacgtgttga gaacttttgc aatggaaaag     33120
     ggattgcgga cgaaattaag cagcttggcc gcaaatagat cgatgatttc ggtcttgatg     33180
     tcatggttgc ctgccttgag tttagcgagc aggctctttg tcagatcctc gatgttccct     33240
     tcgtatttct gaaacagcgc ctcgaaattg cgtcgtagat cgctgtcgtt cgcaacgtca     33300
     aagctgaaaa gatcgaagag cgacaggttc ctgctgatgg gactgccgtt cgggttttcg     33360
     aggacgagct tatagtcgtc ccggtcggcg agcctgaacg aataaatccg cagattagct     33420
     gccttcgcct gagggttcag ggcgttgagc ctctgctcga cctggctgag gaagtgctga     33480
     ttgcgcgtgg tgttctgcag catgaactaa tgaagcgctc ttccatccct gccgaccacc     33540
     gcggttattc cgcggcggcc ttggtcttct ccaaagtttt cgatttcggt tttgcgaccg     33600
     gggtaatccc ccgctgctga ttgagagcta ggagccgggc caacacctct tcatcggata     33660
     agccatccgg ccatccatag gcttgtgcca cggccgtatc aagcaccttg tgagcatcat     33720
     tcagccaggc cgggcgcgca ttgtaaagca gcgtcaaggt cctcgatttc aactcctggg     33780
     ccgccttttc atcgaccggg aggatcctgt ctgggaagcc ggtcatcact tcggcctcgc     33840
     gacgtacaag gtctgccggg ttgagccaat tttcacggag atcgttcaga cgcttagcgg     33900
     cggctgcgat agccagggca cgggagtctc cggcaaactt cgccgcagga atatctgggg     33960
     tcaaaccttc ggggaacgga aacgtctcaa aacccatgga gggcgtatat tgcggatcgt     34020
     tccctacccc atgccatccg ccaagtctta gcgtccattg ctcgtggtag cgggaatgca     34080
     ggattccgaa cgtcgcgtca tcatcacgcg caatcgcgac caaccgggaa tctggcaaaa     34140
     cgcttttatg catccatacg aaaagacggt gtttcgcgac acgcggcgta attatgaagc     34200
     gctccagatg gtcaacggtc tttcttagac ctggcaccgt ctcaccgtgc tgccaatatt     34260
     tgatccggcg tctgtcgcgg cggtttttat cgcggtcagg cttcacgtat gtgattatgt     34320
     gcgcgaacgg atcctcaaac agcgaagccg ctgtttcatc aagctcgcca aaatcgataa     34380
     tccattttcc cgatggccgc cgtgtgatgt cgtttccgtt tgcccatggg cgaaggacat     34440
     cggcattggg gcgtccgttc ggattcaaag gtcgcgacag ccattttctt gccaaatcgc     34500
     cttcgatatc gaatgcgccg actttgacgg gcccctggaa agacagcctg cggttttgcg     34560
     ccaattgcac ggccattgtt gtgtcggccg catcgaccga caggtcggaa tgtattattg     34620
     gcacctccac gccgtcgcgc ttagccccac cgcctttcat gccgtcgaaa cagataaggg     34680
     aaaccctaac ggctgcgcca tccacggtcc attcctcatc atcccaggca tcgaagatgc     34740
     tgccggtttc gacaatccgc ttgagaatgt cgctgcttgc gccgcgccgg atcgattgcg     34800
     ttgctacgaa acctgcacgc tcttgcgctt tcgccagtat ccgcgctcgg gccttttcaa     34860
     accagtacat gacgaaatcg gcactgcccg gcacgcggcc ggcaaatgtg cgccgcagct     34920
     gctcaacata aggttcgccg agcagactga tcattttctt atcaccaatg aaaggcgggt     34980
     tgccgatcgt cacatgggct tccggccaaa cggcttcggt tccgtccttg tttagaaggg     35040
     catcgcggca ctggatattg tcgagcggcc tcaaaatcgg tttgcgctcg acatcgaacc     35100
     cgtttttgcg catccactgg atttcgccga tccacaccgt cacgcgggcc agctcggcag     35160
     cgtaagggtt aagttcgatg ccgccgactc cctgcggtcc gacggttgga aattggcgtc     35220
     cgaagcccat ggcctcggct tccaagttga cgcgatgttc cagatccttc agtcccagca     35280
     acgcgagata gaggaagttt cccgatccgc aggcgggatc aaggacccgg aattgccgca     35340
     ggcgttccag aaagccgccc agcagatcgc gcctgcgttt ttcagatgtg cggggtttct     35400
     cgatcgtcgc ctttacggtt tcccattcct gccatagcgg ctcgaggatg accgggcgaa     35460
     caatcatcat gatcttttca ggatcggtgt agtgcgcgcc gagctgactt cgcttggttg     35520
     ggtccagccc gcgctcgaac aacgtgccga aaatcgacgg atcaatatcc gaccagtcaa     35580
     gagcggcggc ctcgccaatg atcttcaggt cgtctcgcgt gagcggcaag gctgtggcgt     35640
     tgtcgaacag accgccgttg aaccattcaa tctcatcgac gccgaacagc ccgccggatt     35700
     tcatggcggc aaatagttgc tccatcaggc cctttgcaat gtccggcttg tggaacgcct     35760
     tatcgagaat ctggctgaac aaatgccgag gcagaaggtt gatgtcttcc gcgaacatgc     35820
     agaacaccag tcggttgacg aaatgcgcca cctcgtgggg gtcctgaccc ttctggtgca     35880
     ggcggatcgc caagccggcg aacttgtcgg cggcctcgcg cgtcagagcg tcgatcgtct     35940
     tggctggttt cagacgctcg ggatcggtga agacccaccg cagcagatcg cgcttacctg     36000
     catccctcag atcatcgagc tgaatcgtat gaaccgcgga aacggtgttc gtccagtttg     36060
     tatgaacaat gaaccgatcc atgtcggaca cgaccagaag cggcgggttt tcgagagcga     36120
     cggcatattg ctgcagctgg gcgtaggcag cggtcaggtc cctccgcttg cccttatatt     36180
     cccatccgaa atgaccacgc ttccagacgt cggcccatcc ttcgccgccg gcggttttgg     36240
     aggcgcctcg ctcaaagcag taccagtcgc ctttctggtc aacatccgtc ggcttgtcca     36300
     cgccgagcac gtcgcacaaa tcgttgaaat gagattgcga agccgagcgc tctttgagcg     36360
     tcgagtgttt ccatttggcg atgaactgat ccggtgtcat ggatgcgccg cggctgaata     36420
     tgggcgcttt gcgctcggtc tgatcttcac gttttccccc tgattcacct cgtacaggtt     36480
     gttacgtaag acaacttacg gtcaacgaca atccagtata tgagctgccc ggatttttca     36540
     cgccggcgtg gggtttcatg cgttgcggta ctctaagtcg tctgcattgc tttgggtata     36600
     cgtattcatt ttccaagcga agctcttctt gaggtgttgg cgatccttgc ggaatatccc     36660
     tgaccttttt gattgacctt gatcaccgtt ggaaacgatg gcaccgcggc cttcaggtgt     36720
     tcgaccactg gcttaagtag atcgaccaca atcagcacca agatcgaagc ctcggctccc     36780
     acagccaagt cacccgccag ccgcggataa ccgagatcgt acaggagagc ggtctttcca     36840
     agcggcctcc cgagcttggg gcatggatca ctattccggc aaccgatgat gacttgcgct     36900
     aggaggttgg cgctagaggt tttaccgacc gcgaagtttc tccgacttta tgcctgatgt     36960
     ggcggcaata tctcgatggt gctcttcggc aacccagata ataagcgaaa ctagtggttg     37020
     aaatctgacg cttggtaacc gaagataaag gccgcaatgg ttggattgtc accggtcttc     37080
     ttctggagct gcaaaccgaa aagaccgccc ttccgcctgc ggcttggtct ggcaggaagc     37140
     ggaatggcag cttcaagtcg cggatgttca agagcaaaca ttgatcacga taaggaatga     37200
     ctaaaacgat gttgacggat gcgcacggtt gctcgccaaa catcattcat tattttgcaa     37260
     acggcttctc tattgcgata gaaatattgc aactgtcacg cccgtaggaa aaaattctac     37320
     gctcagcgcc gtgattttcc atttgagcaa caaaaatatt ttggctagtc gcggtgagag     37380
     taatttgttt ctttgattta aaatgaacaa cagtatttat acgtcttccc gtcctttcgc     37440
     aaatatctga agaccttatg gtagttgaag aagaacaaat accggaaaaa gaattagatc     37500
     gtgatatatc ttcatcgctc ttgataggct ttccgtcaat tgcgccaatg ttttcgaata     37560
     gaaatacctc tattttctcc aaggtaacgc tactacaagt gttgtagact ttttcttcgc     37620
     ttaccccaga gtatgtttcg tcgtcatctc cgtgcctttg ccagccagac gatgcttgaa     37680
     gccaaaaata taagctctct atactcctgg atgattcatt tatgtaataa tttgcggtag     37740
     ttttgaaccc caacaaatcg gtatcatagg cgaatatacg ctgcccttca ttcgagattc     37800
     tccattttcc atctggaaat tcagcagaaa atctatctgg gctatcgtta attgacggac     37860
     cgccatgcgg aaataagcca tctccccgcc ctagcgctgc aaggtcgatc atttgcttac     37920
     ggtaaaaaga ggtcggtcca acataagtta ggaccgcccc cggcgtcttg cttttaggat     37980
     cgagcagtgc cttttgattc cagcttatcg cccattgacc gtctgcagtt acgacactcg     38040
     tcggcagcga atccgcaagg gactcatttt gcgctagctg gtcattgtag tctttgagct     38100
     gcttcttggt atcgtcgatc cattgaacag cgtcctcaca tgtctcattc actgcatcga     38160
     tgcagaattg gtcggtcttg gccttcgctg ggtcgatata ctccttcgtc gcgtaggcct     38220
     gaccagattg aacaataact gctccaccgc tctgcgcggc ggcgttaaga atgtcctgtt     38280
     gactaccccc agaggcggcc acagccacac cgcgcagtgc ggcggccgct gctgatttct     38340
     tcaccgtctc ctcgatggtc cccgaaggca tcgagtccac agaagcgtgc cccgaggcaa     38400
     ccgcgtaggt gtagatgccc gtggaaagcg ctttctgtat gtcgccgttc gaactgtaat     38460
     actcgtacca agcagcaaag gccgcagcac ccgcgggtcc ggcttgggta gtaaccaacg     38520
     tcttgaaggc atcgcgtgca acgtcgctct ccttcataag ctgcgccata ttagcacttt     38580
     gtcgcgtcat gggatccata ccaagatgcc agacggcatc gaccacctta ccctcgcggg     38640
     ctcgtctctc tgcctcgctg aatacttcct gataattcgt cagggttctt tccccgtatc     38700
     gcgccgcagc ctgtattgcc tgtacaccgt cgttcgcgga cttgatgagg ttctgtgccg     38760
     cgtccctcac ccccttggag ggattcgtaa gggcgttcgt gatcgctgtt tggctctccg     38820
     tgtcgagttt ggctccgatc gcttcgaagc tatttacggc ggcaaccaag gtttgatcgc     38880
     cagatgcttt cgcaacttca ttaatagcgc cagaaagagg aaaagataat tttattgcat     38940
     ccgttatttt agccttagta aatgaattta ctaagttatt cacagcgtcc tctacggctt     39000
     tttttgggtc gaatatgttg ggcggatcat cagtacacgc gcaccagctg gtataaggaa     39060
     cacacttgtt cgtgcaggcg aaggccttaa gagaaataga aaaaaataca caaagagaaa     39120
     ttagaactaa aatcgttcta cgcatccgtt tcccccacca gtcacagagc tgttcgccaa     39180
     gacatggtaa gcgttttggc atggcgcgtc gagtatctgc gggcatggct caatgccaaa     39240
     gttatgtgag ctttgtccat ctcacgcctc attacgtcac ctagcgtttc atattgctgc     39300
     ctccggcgga aaaagtacgc ggtgatacag atttggctgc tgcgtagtgc tcggctgctc     39360
     ggatttcgct cgaagacaga gccgatgctc cgtaggtagt ctgcgatgtc tcgcaacagg     39420
     tgatcgcgct catcaaacca ctgctcgatc cgacgaagcg cctcgcttac gcttttccga     39480
     atttccggtt gcagatcaat ttccccgagc acatagccat tttgcccaac agcacagata     39540
     tcgcaaccgg ttgccagaac ggcctccacg aaattcggaa tttggtcttt gcccattttc     39600
     atgtgtcgtc taccctccat tgctgtatga aacagattag acgcagaacg taacgacaac     39660
     tcgccgatgt gttagtgcca aattccaaca tgcctcgggc tattatggtg gaattcgcaa     39720
     gcacagaatg tcgccggccg gcgaattcag caccagaacc ggtgcttcgg ttcccgcggc     39780
     cagacgagct gttcgcgcac caagtgatga ccgaggtcac gccgattgat tgagacgaat     39840
     gcgatagagt ttccgcgacg atctgtgccc acgcgggcca tcgtgaaggt tgacccattc     39900
     aggaactggc caagtctacc cgctgccatc agagcgcgtt ccctttcgcg ctcacaccgc     39960
     gcgcggccgt atggcgcatc gatattggcg atgcgaaccg gctcgtgatg attgccccat     40020
     cgatagatga caaagctgtc gccaccttcg atccgcaaag tgactggctc acacgcgctg     40080
     ttctcgcaat aggtcgcgtg aacgctggtc cggatgacgg ccgaccgtgc acccgcgtcg     40140
     accggcgcgg cgatagcaat gaggatgagc gccgcgattg tggcaaccgc caggtaggaa     40200
     aaagctcgcc ccattgtgat caatcccaag gaatgacagc caggacatcc tcgccgccct     40260
     ggccggggta gcggccgagg ttggcgttga gcttcccgta tccggtgttg atgctgaggg     40320
     tgaaatattc gccgccgctt tggttctgct ttttccaaat cccgccgatt tcgatgcgcc     40380
     tgcccagcgg gctctcggca aagaggcggt aggccggggc tttggggttg tcgctaatgt     40440
     aggtttcgcc ggcaatatcg atgtcgtagg aaatcgatgc gatatttcct cttaggcttt     40500
     ttctgtcctc ggaaaactcg acatagttcg tcagctcttt tgtatttgca gtcatagagc     40560
     attctccgtt gttagaattg aaccgagatc gttggcgcag gcgacgagcg tcttattgac     40620
     gcgaaaccag cacccgattg ggatgcggca tatcgggata ggcccaaagc ccgacgcgcg     40680
     attgctgggc gatcgattcc tcaaggctat agggcaggta gaccggcttg ccggtatttg     40740
     ccattgccgc aaaggcaaac ccctgcgtga tcagcagagt gccgacgtcg agtgcgttat     40800
     tgccgatatg ggccgagcag atcaccagga tcgtggccgg cttgccggcg gctggcgccg     40860
     tcaattgggc gaccggagca caggtgggcc tggtatcctt gacgatcgcc gccagcatcg     40920
     ccagcgatac agccccacag tcttgcttct ggccggactt gtcggtgtag gtggttccgc     40980
     ggatacaagc ctggacgcca tagagccgaa ttatctggcc tgcctgctgc caactgtccc     41040
     ctgtgagaaa agtcaggtcc gactgcggaa ccgcaaagac attggatgat ggctgtgcgg     41100
     attgcgcgtt ggtcgacgta taagatgcca tcgccgccaa gatgctcaag gcaaagacca     41160
     ggctcacaac cccaaggttc gccggcctca ttgctgcacc tctttggcgg ccacgggcgt     41220
     gcagtccacc ccgtcattgg aattagtgat gcagccgaca ttgtagccag cgccggagat     41280
     gaggtaggaa cacacgctgg tgccggcgcc atcacgcgtg cctgctgcgt tgcagtcgag     41340
     gccggacttt gcgaggttat agagcttgcc tccgacccca cagccaaact ggcatgcctt     41400
     gaggatcgac gactgcgaga tcgtggcgca tgtcccctgg tagcagacct gctgtccgat     41460
     caggcttgtc atgccgtttt tctgggccgc ataccattgg ccgcgctgat agcgctgcca     41520
     tgccgtcact tgtgctgaag gattgttcaa aaaatcctcg cgcgagccat cccaataggc     41580
     ttgcagcgtg ccgctatcgc agaattggaa cgcgccataa cagcgggttc cgttgacgac     41640
     gggtgaaacg ctgctgaaat ttccctcgct ttggctgacg ttggaggcgt attcagcaca     41700
     ttcggccggc attccggcgt tcagaagact aacggcactt tcaccggcga acgccaggga     41760
     agcgacaaga ccaaatgcca gtccgaaatt tgcgaagaca tcccttctgt tgggcaacca     41820
     tagagaggga gatgcggata gagcgacaga tgtcattgaa tgggctccac ctcataggag     41880
     ccggtgaagg ctttgccgtc ctctgcgatt tcagaggtcg tgagtgtctt ggcgtcaggc     41940
     gataggatag ccgtgccacc gagcggcaac tgcggatttg ccatctgcac cagtcgcgcc     42000
     gctcgcagcg gtcgcactgg cggcgtgccg ggcctgatca gcacgagcag ggccgtgcac     42060
     atgccctgca aattgcaatc gccatttgtc tgcgacagca gccacgtccc cgatggagtt     42120
     gcgatccgcg ccgtatagat tttggcggtt cctaacgcct gacgaatgcc ggcgagatcg     42180
     tcgtcggccc aaacgccatc aggatcatgc gtggcatcct tggtggtgag tttgagcgca     42240
     agcttataac catcctgcgc ggcagcaggg tcagtggagg ctaggccgag gaccagggtc     42300
     gtggccaaaa cggtgaggat cggtttcatg aggtacctcg aggaaggtta gcgcggcaga     42360
     cgacgccgga ttgcgcgagc cttgtcgatc agcgcggcaa aacccgcggt gataaggcgc     42420
     gcaagatgaa ttggctgggc cagcaatgtg cgcaaaagtc gataaaacgc actcagcgcg     42480
     acgtataaga atttcaggat gcatatcgcc gccgcgcagc aaagcccgat gagcaatccg     42540
     ttgaagagca gaaagagcgc caacaccaga acagtgtagg ggaggttgtc catcggatgg     42600
     gcataggcgg atttggccgc ggtcgtgacc catatcccgc cgatcgtggt gatcccgctg     42660
     attgcaatcg cggcaatgac gatctctagc aaacccaggc gatggaagaa ccagatctcc     42720
     ttgcgcatca gcatattcct ttgaacctgc gtttcggcga gcggatgccc gcctgctatt     42780
     tcttcaaatc gaaccatgca cgggtgcttg tgccgctcgt ctgcctgatg tcgaaatacc     42840
     agggcctgtc cctccggggt cgcggtttac ggtcgagctc gatccgctcg ccgcgctcgg     42900
     tcgtgtacct ggcgcaatat tgttccgagt tgcccccgtg tccggattgg gcttccgctt     42960
     cgacataccc gctcggacaa tcttcaaacg cgtcatagcc gggtgctccg gtgccagcag     43020
     cggtacagat cggccaggaa aaaccgggca acgccattgc ggcaatcagc ttttgcattg     43080
     gcggaacaca gtaggggatg ccgtgccagc ttggggtttg cgctgcgacg caaaggacaa     43140
     tctgacaccc ccaatctgca tccgcggctc gggccagctg gtgctcagag agccaaaaag     43200
     cgagcgtggc cgaggcaaaa acaccgcatc tagtgatcgg caacatacga atacccacca     43260
     gttacaaact gtttacaaag tcacttgcct atggctcatg attttatata tatgcactat     43320
     ataaatcagg agacgcaaat gtccatagcc tccgtccgtg ctgcggcgct tgccgcaacc     43380
     cttgtttttc cgtcgctggt tctggcaaat ggcgtgtcgc caatctcgat cgctgccacc     43440
     gtcccagcct cgtctgactg ccccgatggt gcggcggatg cggagactat tcggcagctg     43500
     atcactaacg agacggcgcg acagggtgtt gacgccaggt tggcgcttgc cattgccgat     43560
     caggagtccg gcttcggcgc ccacgtcaat tcgccggcgg gtgcgcgcgg ccccatgcag     43620
     ctcatgccgg caacggccgc acgctacaag gtggcggaca tttgcgatgc ggctcagaac     43680
     attcgcggtg gcgtcagcta cctcaaggat ctctccgcca tgttcggcgg caacatcatg     43740
     ctggtggttg ccgcctataa tgcaggagag ggccgcgtcg ttgcagcccg tggcgtgccg     43800
     gcgattgccg agaccgtttc ctacacagca ctcgtcacca acgcctattt tggcttcgac     43860
     agtattttaa agggcggcaa gcggcctagc caggcagtca aaccggacac tcgagcagct     43920
     gaagccggtg tcgacctgct ggcggaaacg ccatcgcccg acaaaccaat ccccatcaac     43980
     caaaccagaa ctgaagccgg cgaccgcgat tggatcggcg gctcggttct ttacgtgcag     44040
     tagtccagaa ggagcaccag atgaaggcaa acttgtataa tcccgcccgg tccgcgatgt     44100
     cctcgcgacc gatcagtgga aacagcctgg tcctcgtggc cattgccggt gctatggcga     44160
     tcggtaacgc cgatatggct tatgccgccg gtgacatttt ccaaccgatc aattcggtgt     44220
     tcacgacgct tctcaacttc atgaccggaa ccttcgccac gacggccgcg accatcgctt     44280
     gtgctgcggt cggctatatg gcgctgacca gccgcatccc gtggagctgg tgcttctcca     44340
     ttatcgtcgg tatcgccttc atctttggcg gcgcgcagct ggtgtcctcc atgtcgtccg     44400
     gattgggcgg ctgatgagcg aggcgcaggc aaaggcggaa gtggcacccc tcgttctcgg     44460
     ccttacccgg ccgaggatgt tttggggcgt gccgatcggt ctgtttgtgg gcgagttgat     44520
     gatcgtcgtc atgacgttcc tcaacacgaa gaacctggca atgttccttc tcttcctgcc     44580
     tctgcatgcc gcagcctatg tgatcacggt gcgcgatccg catttaccga acgtcgttcg     44640
     ggtgcggatc gccaaatgcc cctggacgaa gaaccgccac ttctggggcg gcaattccta     44700
     tgaaccctaa cttttcagaa atgtaagggg cagtgatgca aaaggcagtc cgcaaggatc     44760
     ttcgcttcgg cgccgagatc gcccgcgaaa agccgatctc agcgcatgtc ccctatctgc     44820
     ggcatgtcga cgaggagacg ctgcggacca aagacggcat gctgctgacg atcatcaagg     44880
     tcggtggctt ttgtcaccag accgccgatc aacagatcat cgatgtcgag gcgacggcgc     44940
     gcaacacctt ggttcgagcc ctcgccgaca gcaggtttgc cgtctactcc catatcgtgc     45000
     ggcggcgtat tccgcctgat atcggcggcg ccttcgacat tccgttctgc aaaaatctag     45060
     acgagcgcta tatggcgagt ctggctgaca gccgcatgta caccaacgaa ctctacctga     45120
     cgatcatccg gcgcggtttt caggggaggg tgggccttgc cgatgcgctg atgtcgcatt     45180
     tccgcaaggc cgcggggatg tccgagcagg cgctcgatcg agaagcactc caggagcttc     45240
     gccagcacgt cgctaatatc gtcaagggca tggagcatta tggcgtccgg atcctgaagg     45300
     cggtgctgcg cgagtacagt gttgcctctg agccgctgga gtttctggcc atgcttttga     45360
     atggcggcca acaggtcaac atggctctgc cgcgcatgcc gctcgaccaa tatctgccga     45420
     cacgccgtat tacatttggg cggcggatgt tcgagatgcg aggaggcagc gacgatgaca     45480
     cccggttcgg cgcgatgctg tcgatccgcg aatacccgcc ctataccgcc gcgggaatga     45540
     tcgatgggct gttaaaagcc cccggcgaat ttgtcgtctc gcaaagcttt gcgctgcagg     45600
     atcgtgcgcc aatcctgtcc gagatggatc ggatcgaacg tcagatcagc gtttcggacg     45660
     agcgtggcac cagccttgaa agcgcgatct cgattgctaa ggatgagctg gtcaatggcc     45720
     gctctgtcat gggctatcac catctgacgg tcatggcgct cggcaatacc atcaaggaaa     45780
     ccgagtccag cgcccaggca atcaccaagg aactgcaaaa tgcgggcatg gtggtcgtgc     45840
     gcgaggatct gaatgccgag cccgccttct atgcgcagct tccgggcaac tttgcctata     45900
     ttgccaggcg agcgctaatc tcgtcacgga atttttgcgg cctggcgtcc tatcataatt     45960
     tcgcgctcgg caagcccgct ggcaatcact gggggccggc ggtgtcgttg ctgcagacaa     46020
     cgtcgatgac gccttacttt ttcaacttcc ataagggcga agtcggtaac ttcatcgtca     46080
     ccggcccgac agggtcgggc aagacggtgg cgctgctttt tctcctgtcg caggcaatgc     46140
     gggcacggcc gcagccgcgt tgcgccttct tcgacaagga ccgcggcggc gagattttta     46200
     tccgtgcctg cggcggccaa tatgaggtgc tgcagcccgg catggcctca ggcttcaacc     46260
     cgttgcagct cgaagacagt cccgacaacc gggcgttcgt ccacgatttg ctcagctacc     46320
     tggtccgccc gaagaatgag gccgaaaagt tgtcggccga acaggagaag attctggctc     46380
     gagcggtaga tcatatattc aacgtgccga tccgggagcg attgttctcc gacgtcatcc     46440
     acctgttgcg gggcggcgag gccgccggcc gcgacgatct ggcatcgcgt tttgaggcct     46500
     ggtgtgacac gcgtggatgg ctgttcaaca acccggtcga tctctggaat tcggatcgtg     46560
     gcgtcttcgg ctttgatctg acggcagtcc tcgacgatcc ggaaatccgc acggcagcac     46620
     tcggctatat cttcttccgg atcggccaga tgctggatgg agagcggccg atgatgctct     46680
     tcgtcgacga gggctggaag ctgttaggcg acgacaaggc aggtgccttc atcaatgacc     46740
     agctcaaaac catccgcaag aagaacggga ttgtcgggat tggaacgcaa tcggctcgcg     46800
     acatcacgac atcgcggatc gcgcacacgc ttctcgagca gagcccgacg aacatcttct     46860
     ttccgaatcc gaaggcggac cgggaaagct atgtgacggg ttttgggctc tccgaagtcg     46920
     agttcgaatg ggtcaaatcc acctcttcga cgagccgtca gttcctggtc aagcatgacc     46980
     acgacagcgt aattgcgcgt ctggatctct caggccttcc ggacttcatc aaggtcctgt     47040
     ccggccgagc cgaaacggtt gcagagtgcg agcggttacg ccatcgccat ggcgacgcac     47100
     cggaacactg gctcccgtat ttctgcggtt ggaggcaaga gccctccaat ctctcaggaa     47160
     gtcaggcgga agcgcaatga gggcgtgcga ccggaacatt caattatggt tcgcgctgct     47220
     gatcgtagcc tcagccatct cgccggcgct ggcacaggtg ccggttaatg atgcggcacg     47280
     gacgacgcag gagacgaata ccgccgcctg catgcaacgg gcgcgtactt tcaaacagtc     47340
     ctccgtaacc ccctcgcgtg gcctgacaac cagcgtgaca tcgaagggtg atcttgccgg     47400
     tatccagcag gtcaatggag ctgatatttc cgggtcgccg ttttcaggaa cctcgattgc     47460
     caatagcgac ctgtcgatcc ttctggccgt cggtcaaagc gtgcaggcat tgaagacgaa     47520
     gaacacaggc caagtggtga gcgcgttggc ggcggtcgcc gccgcgatca gcgccaacac     47580
     gtcgacactc aagaaccagg caaccgcgat tggcaccgcc aattccctgc agggcgcctt     47640
     cgaccagaac acggcggcgc gtctgtctgg cgcccagatc tggaaccaga cgatccaggc     47700
     agtgacaaca acgacgcaga tgcgaaacca gcggcttgtc gatcaagccg cggccgaaag     47760
     cgccgcgaca aaagtcatga cctacgatcc gggctcggtc tcgttcgtcg gcggcaatga     47820
     ataggagaaa tcactggatg aaaatattca aaaccctgcc ggctgccctg gtcgtcgcca     47880
     ttgcagtggc tccatgcggc ggtgtctttg cccaggtgcc tgtcatcgac gacgcgaccc     47940
     tgtcacaggc caccaagact gcctcgaaca ctgctcagat catgtcgtcg aacagcgata     48000
     tcctgcaaac ggtaaacagg acgcttgctg cggtcacggg aaatcgctcg accagtgaga     48060
     tcgcgggtac ggctcttggc tcgggctttt cgatcgggag cgcgcccgat ttttcctcac     48120
     ttctcagcgg tcagatgtcc tggggcaatc tcggttcgtt cggcaatacc gctgcaacga     48180
     tcctgaacgg gttgaacctg gtcaaaaccc tgtccggcca gaccggaagt gcaaatttga     48240
     cgcggggcga caaggcctat cagggcctgg tgaatacggc gacggcgctg accgcctcca     48300
     tcgccggaac gcaaaacagc gcccagcaac gctcgaccgc cttccaggcg gttcaggggc     48360
     agatcggggc ggcaaccgac atcaagggct cgatcgatca gaattcgcaa gtgcagaccc     48420
     agaccgcgca aacggtcaac gaactcgtcg gtgctgtgaa tgccggaaac gcggccctca     48480
     atgccgagca ggtgcgccaa ctggcggcgg aagccgcaac ggcggcattc atgacctatg     48540
     acgcgggcca ggtctccttc gtgggccatt gaaagggctg atgatgcaaa tgctgaaagt     48600
     gccgttcctc gcgttggcgg tcgctgcctt tgctgccttg ccgggatgcg ccagtcataa     48660
     ggagctcaag gctccgtgct cggccgggat cagctccgtc ttttcctcgc aagcctatgc     48720
     cagcggtatt ggcgatcgtt gcggaccgat ggtccgccaa gaagccgtga ccattttcta     48780
     aagcgcgagg cagcatgaac ccgttcgata tcctgtttgg caagatcgac agcatgggcg     48840
     tcagcgcggt gcagacgatg tatacgacgc ttgccagcta tctggggccg ctgttcctgg     48900
     cggcgctcac cgtctatgtg gtctggtggg gatacgagat gctgttcggc cgtgcccaga     48960
     tgaccgcggg caccttcgtc tggcggtttg gccgggcgtt catctgctac accctgatcg     49020
     tctcatgggc cacctatcag ccattgatcg taaaacccct gctggaagcg ccggatggca     49080
     tggcgaccat cgtttgccag tcgactggcg gcagcaattg tggtggagac ggtagctccg     49140
     gatcgtccgt cacccaaggc ctgaccgata tctggaatag cgggcttgcc gtggtcaagg     49200
     cgatggcgga tgcaggcggc atcacggctg tcggcatgta catccttgcg atcgtcgtgc     49260
     tggcggtcgt ctgcattctc tgcgccatcg ctgtcacgct gctgatgatc ggcaagatga     49320
     ccatgtttat cctgctggcg atcgggccga tcgtcttgtg ttgcgcgctg ttcaatctga     49380
     catcgcgggt ggtggacggt tggatcacca gtctcgccgg ttacgcgctg ctgccgatca     49440
     tcgtctacgt catcctgggc tttatgctga ctctgctgaa gggcagggtc gatgcgctga     49500
     ctgccgatgc cagtgctgca aacatgacga cattggctcc gttcatgctg atgtcgatcg     49560
     tcaccgcctt tctcctgacc cactcgatct cgatcgcact ggcaattgcc ggcgggggcc     49620
     caagaattga cgcactcggt gcagcggcag gcttgatgac ggcgaggctt gcctggagag     49680
     ctgccgccgg ttccgggcga ggcgtcgccc aggctggcgg atatctgttc aatcaaaggc     49740
     ccgacggccc ggcgacgatc ggggacggcg atcccgcggc agcgcaggtc cgcgccgccg     49800
     ccgcaaatgc tcgcaaataa gcctgtcgaa tagcgaccct cggagatctg ggaatggtga     49860
     agactgacaa tgcggcggcc gaattcggta cgcctgcccg agtgacgaat tccggcgtga     49920
     tcgattcccg ctattacagc gagggcgaac ggtgggagcg ctcggtctat cgctcggtgg     49980
     ccatgtctcg cggcgtctgg agaacagttg cggtgctgct gagcattgct ttggcggcgg     50040
     cgatcggtct tctctggatg ctgctgccgc tcaaatcctt tgatgtcgtt gtgctcgagg     50100
     tggacaagac gacgggctat gtcgaggcaa gccgaccgct gcaggagcgc ggcgacctca     50160
     cgcagaatga agccgtgacg cgggcgaata tcgtgcgttt cattcgtgcc cgcgaaactt     50220
     atgacccaaa agggctgcgc gacaacttcg acctggcgtc gctgtattcg acgggcaaag     50280
     ctgcggccga tctggcgaac gcctattccg gcgcgaacct gtccaatccc gtcaaggtct     50340
     acggcgccaa cacgacggtc agtgtcttcg tcaagagcgt gattttcctg aacgacaata     50400
     cggcggctgt tcgcttctcg acgacccgct ccggcacatc aggtccgaca gtcacggatc     50460
     attgggtcgc caatgtccgc ttcaaatata cctcggagcc gatgcgaaac gactggcgct     50520
     tcgacaatcc tttggggttt caggtgaccg aatatcgccg cgatcaggaa accgtcacct     50580
     ctggggagga tgcccagtga agacaaggca tcttcttgta gcggttgccg ccggagcaat     50640
     catgcttgcc cgcccgccga tcgttttggc ggaagtccag ccgcaatcgg tgagggccga     50700
     cgcccgcatt cgcaccgtac cgttccagaa ggacaatgtc gtctatctcg ctggcatgat     50760
     gggcgtgtct acgatgattg tcttcaacga ggacgaacag atcgcgacgg ttgccatggg     50820
     tgacagcctc gcctggcagg cagtcccgga tcagtcgaag cgcttcctgt tcattaagcc     50880
     actgcagcct gacgcgcaga ctaacatgaa cgtcgtgacg tcgaagcggg tctatacgtt     50940
     ctttctgaac ggagcgaagc ccggcaacac gaaaaccgcc gttattaaac tccgcttttc     51000
     ctatccggag gattcgctag atgccaatct gctggcggcc gcccgccaga atgcggccat     51060
     gccgaacgtc cgcgcggctt tggcaaaccc cggccggatc aactacgact atggctataa     51120
     gggcgctgtc gatgccaggc cgacctcgat gttcgatgac ggcacgaaga ccttctttca     51180
     attcagcgga gaggttccgg cattcttcgc cgtcaaatcc gatggcagcg agtctctcgt     51240
     caactaccgg cgcgagggcg actacatcgt cgtcgacaag gttgcccgcc aatggaccct     51300
     gcggtccggc aatgtcgtga cctgtgtctt caacatgaag cccccgatcg gcgccctgaa     51360
     gccggcaaac ggtaagccgc aggagatcag ccatggccat tgatttcgag gaagaggcgc     51420
     gcatcgtcga gacggtcgcc aagcccgcag atggccggcg aggcaggctc atgccggttt     51480
     tgttggcctc ggttgctctg gtggtgcttg cctatgccgg ctatgtcagt ttcatcaagc     51540
     cacaggctgc ccggaagacg gatgcaaacg aggagttcaa gacggcgagc cacgccgctc     51600
     acctgaactt cgacccggaa aatccatctc cacccccttc tgacaacaag ctcgttcttg     51660
     tgccgccaac acccactccg acggtggttc cgccacctca gattaccgcc cctgtcgtca     51720
     tgccgccggt catcgatgag gaggcggcac ggcgcgctgc tgaagaggcg gagcgggcaa     51780
     ggaaagaaga ggagctgcgc caggcccggc tccgctcgaa catgctggtc gtcgatcaat     51840
     ccgtcagggg cgaaagtgca gcttccgttg ttggtgcggc atctgcgcaa aatgccggct     51900
     cgggtggcag tgccaatgcc agtgccgacg aagacccgga ccgcaggttc gtgcagtcgg     51960
     tgggatctca ggacgtcgag acggtgacgg cctctcgcaa cgatcggatc gacgcgctta     52020
     ttccccaggg ggtattgatc cgcggtgtgc tcgaaacggc gatccagtcc gatctgccgg     52080
     gcatggtcag agccgtgatc tcgaccgatg tctattcctt cgatggccgg cgggtccttt     52140
     tgtcgaaagg aaccatgctg acaggcgagt ataagagcgg gatggcgcgt ggtcagacac     52200
     gtatcctgat cgtctggacg cgagcgctgc gaagcgacgg gacatctgtc gccctcggtt     52260
     cctacggaac ggacgatctc ggccgctcag gcttggccgg cttcgtcgac aagcactatc     52320
     tcgagcgttt tggtgcggcc gcggtgctga gcatggtcgg aggtatctcc tcctttgttg     52380
     ccggcctgaa cagtgatgga tccagcagct caggttcgtc gtcctcaacg agctcggacg     52440
     cgcagaccca ggcacagcag accctttccc agaccatggc tgagatggcg aatatcgcgt     52500
     tgaaggattc gatcaatatt ccgccgacga tctatgtcga ccagggcact cagatcatgg     52560
     tgttcgtccg aaaggatctc gatttctcct cattataccc tgacccggtg aaggaagccg     52620
     tcaatgaact tcgtcgtgcc cggatcagga atgcgcccag cacctccggc caatgacgtg     52680
     acaaaatctg acgtgctgag atcagaagag ccaaagtccg aggatccaaa atccctttgg     52740
     gacagcctgc ccatctatgt caggcagacg gcccagccga tccgaaagtg gttagaggat     52800
     ccggctgtga tcgagattat gtgcaatcgg cccggagaaa tctggatcga gagcctcaat     52860
     agccaccata tgagccggta cgacgtgccg gcgctcgatg agcgggcgat tacggcgctg     52920
     gcgcaaatga ttgctggaac gacacagcaa agcgtcaacg aggagacgcc gcttctgtct     52980
     gccgccatgc cccatggcga gcgcttccag gcggtgctgt ctccggtcgc ggttttgggc     53040
     ggcgcctttg cgatccgcaa acaggtcatc cgcgatatga cgcttgatga ctatgtagag     53100
     ctcggtggtc tcgatgacgt ccaggtcacc ggggccggta tggcggctgg tgaggaattg     53160
     agtgatctcg agcacggact gatcacgcgg ctgcaggact cgtcacccaa ggctcggcgc     53220
     gaatggctgc gctttgccgt cgaaaaccgc atcacaatgc tgatttctgg agggacctcg     53280
     agcggcaaga ccaccttctt caacggtctc ctgaaggacg tgccggcatg ggagcgcctg     53340
     gtgtcgatcg aagacacgcg cgagcttaaa ccctcgcagc cgaattatct ggcgctcgtt     53400
     acctccaagg gcgggcaggg cagggcgcgg accacgatgc aggaatgcct cgaggcagcg     53460
     cttcgtctcc gtccggatcg catcttcatg ggcgagatcc gcggtgctga agccttcagt     53520
     ttcctgcagg cggtcaatac cgggcatccg gggtcgctat cgacactgca tgccgataat     53580
     ccgcgcggcg cctatgagcg cctcgccatg gcgactatgc aggcggggct tggcctcacc     53640
     aaggcggagc tgatggagtt cgtgcgcttc gtcgtgcccg tggtcattca ggtggcccgc     53700
     gatcccgcca ccatgaagcg cggcgtgcgc gagatctatt tcagcaaatg gagcagtcga     53760
     tgaaccgctt cgagaaagtc gtggctctcg tcgcgggacc gatcgtgggc gcaggtgctg     53820
     ccttctacac ctggtcggcg agctacgcgg ccggctcata tctgatgctg aaaagctcga     53880
     ccatgtggaa gagttttgct ggcggcgacg tgctgatgcc ggcaaagcaa gcttgggttt     53940
     atcttggcaa tccgatcgtc acgaagttga tttccgttgc cacgatctcg acgctggcat     54000
     taagtgccgt ggtcgctgtt gcgatcacac tagcgatcaa gcggccctgg caggtccgtc     54060
     cgccagctga tggctcccgc ttcgcgactc tcaaggatct cgagagtgcg gggctactgg     54120
     gcggcgcacc tggcaagtcg gtgctgctcg gcaccttcgg caagggccgc aatgccgtcg     54180
     acgtccgcta tagcggtgac agccatttct tcgtcaatgg cccatctcgc tccggcaagg     54240
     gccgtggctt cgtcatgccg aaccttctcg aatacgaggg atcggtcatc gtgctcgacg     54300
     tcaaactcga aaactacacg ctgaccggac ccgcacgtat ggcgatggga cagcggtgct     54360
     atgtcttcgc gccaggatct gcgcattcac atcgttggaa tccgctcgac ttcgtgcgcg     54420
     attggccgga gcgatcaacg gatctgatca atctggccgc aacgctgttg ccgatcggcg     54480
     agaaagagga ggcctattgg aagcagaccg cccgggggct gcttgctggc gctcttggat     54540
     atgtgctgga gtcggcgtct atggagggca ggcgaaactt gcgctccgtg ctgcggctgc     54600
     tttcgaccgg ccgtccgttc tcggccgtgc tgcaagagat catcgacaat gaaccggaac     54660
     tcgaccagtt tattctgggg agctttcgcc agcacctcgg gcgtgacgag gaacagcggc     54720
     cttcattcga gggccatgtg accacggccc ttgctgcgtt caataacctc ctgatcgccg     54780
     aggcttgctc gggaagtgat ttcgacatcc gtagcctgcg tcgcaagccg ttctcgttgt     54840
     tcatcgcagc acctgtctcc gatttcggaa ccgtcgaacc gattatccgg ctactgatcc     54900
     agcaaatcca tgatgtgatg ctgcgatcgc tccctggtgc cgatgaaccg cacaagatcc     54960
     tgatgatgct tgacgagttc taccagttcg agcggctgcc tgaaatcatt aagcgggcgc     55020
     ctctggtcgc tggctacgga ctgacgatcg cgctcgtcgc ccagaacatt ccgcagctcg     55080
     atgagcggta cggccagcaa acccggaatg cgcttctggg caacatggac gtcaagctca     55140
     gcatcgccgt tggcgatgac gctacggcga aaatcgtctc cgacaatctc ggtcgcaaat     55200
     acgtggagcg tgagggctgg gggcggcaga ctgggcttct ctttggaaag caggcatcgt     55260
     ccggccggtt tgaattggtg ccgctgattg atccaggttc ggtccagcgg ctggatgaca     55320
     gcaataccgt cctgcaggtc cgcggcggct atggcgccat cctgaacaag ctgaactttt     55380
     acggcgatat caggtttata gcgcgacgac gggaggttga gggatggaag agcgagcttg     55440
     tcattccgga gatcaggatc cagaccgagt ggccactatt cgcgcctcag ccgccggaac     55500
     tagccgtgga attgccagca gttcaggacg aacagcggca atctagcgac attgaccacg     55560
     agatgatcgt gttggagcac gccggcgccg tgttcgtcga gccggcgcgg ctcatgcatg     55620
     tctatcgatc ggcgatatct gcagtggatg accagccaac tgccgatctg ttgtttcgac     55680
     tgaggaccgc gcctggaacg atcggcgata taaaaggaga gaaaagccgc tttgttcggc     55740
     aggacagacg cgcaagagag caggcgctgg cgtcggtctg gccgctgcgc aaggcgatct     55800
     ctgaggcgcg atgggctgtc attggcgcac ggctctccga cagggcggag cgtgaggaat     55860
     tgtttttctc gcgcggcatc aattcaatcg tggcggatga tcttgatgcc cacgaggacg     55920
     agaccaatca tctgcacttg gggttctcat cggcccaggc ggtcatagat caggtcacgg     55980
     acgttgcgga agccgcgatc ggcaatgagc agaatagcga tccgaacgca ctcgcggcgg     56040
     ctctcggcaa tcttaaggct gctttggagt attccatgac ggaattcgaa gaggagaacc     56100
     gtctaccagt ttccacctgg taaatcgaac aataatggga tcgtcagcaa agctggaaaa     56160
     tcgcgataaa gttttagttt gacgatcaat ttatacgcgc aacggctgtt gccttgcagg     56220
     tcgcatgtct gatctatatg aagaggaaga gtgtccatat cgctcggccc atttccatcg     56280
     acttgctttc ctggctttac gttcaccatg acatcacgcg acaaatacaa cgcttatcgc     56340
     cgggcctggt gggcgaaatc gctcggtgac catctgacgg aatctcgcgt gttcctgccg     56400
     cgggaagctc atgactgggt tgtgcgcttt gctgcagaag tcgaggagcg acttcctttc     56460
     gttctgggta agctcgttgt tgcacagata aagggcgtag aagagaaggc cgagaccgaa     56520
     cctgtcgtcc cagcccagcc gcaagacgaa gccgttgaaa agccgaatag cgtcgagcct     56580
     atctcagctg ataacctcca taagctattc tatgtcgtcc tggcgtcgcg cttccccaat     56640
     gatacgggat ccacgcggtt gaggcaggtt ggctttctag gagcagtagc ggcagagatt     56700
     gccgctggcc gaaagccgac ggcgagctcc atcgcgaact gcacggacaa ccacgtttcg     56760
     caaatcaccg ggttggcaaa gatcatgaag gaccgaggcg tcattgatgt tcgcagcgcc     56820
     ccgtcggttc gaaagggcaa ggccgccaag atctttagta tccgcccgga tgctctcaaa     56880
     gcgatccatg ccgctcacct cgaggtcacg gggcaggtga tcgacgacat cacgcccccc     56940
     tgaaattctc ttgctgagat gcggtcgtga ccgcccagtc gctgagaaga ttcgcaactg     57000
     cttgtattca ccttatcgtt tgctatattg ctcgtttaag cggttccccc tgaactgctt     57060
     gaaagcgaac gggttcaata tcaacgattt acaccattga tcgggcattc gatgattcga     57120
     ttgatgaggt gaaaggacag tacacggcac aacgaaaaag accctgaaag ttggcgcttt     57180
     caaggtctat ccgtcaaagc tcaatgcttg aatacggggt tcatcaccca caagaagtac     57240
     ggtgatcttc tccataaaac gcatagttgt caagcagtga cgccgctttg gcgaatggtt     57300
     ttctgttgcc gtgtccttgg aagaggacgc gaatgacaag catgccaaat tcccatcgag     57360
     cctatgcaaa ccggcgagta actgccgcta gccttgagac tgatcgcatt gttgcagatt     57420
     tccaatttga tcatcgaagc ggatccagca tgagccgtcc gtcgcggacg caggcgctac     57480
     aggtggccaa acgctttgcg tcggcaatcg ggctgaaagc tgcaaagatt gcgctcatcg     57540
     accagctgtt tgcgttttcg aagactctgg actggtccga cactgagacc gttcccgtcg     57600
     tttggccatc aaatgaactg ttggcgcggc ggctgggcat caaggtatcg acgctgaaat     57660
     accatcttgc cggcttggcc gaagcaggcc tgatttgtta ctcggatcat ccgacctacc     57720
     agcgtcgcgg ccggcgcagc gaggatggtc gcatcgtcga ggcctatggc atcaatttat     57780
     cgccgattgc ggcccagtac agcgaactac tcgatctcgc agatgcagcg gactttgaag     57840
     cacggaagtg caagggcctc tccaatcggc gcactctgct caggaggggc atcgcggcaa     57900
     tcatagaggc ggcgagactg gaactgggat cactcaacga tgagtggaat tcgctgctag     57960
     cacgccttga tcgactccgt gagcgacgcg ggcggggatc ggtcgatttg gcggacgtcg     58020
     ttgacgcgct tgtaaccctg cgtgccgagg cagccgatct cctcgaagct ctttatgaca     58080
     gtcgagattc cgacactgcg gtggcgaaaa ttcggcctct acaaactaca gctgaaactc     58140
     cagattctga atcttgtaat gacgagcgaa attgcgctga cgcgcaatac atcgatcagt     58200
     ctggcgccac gggcgcaacg gcctatgaaa acaagcctgc ggagacttcc gtgccaggca     58260
     agcgaaaagc gccggcggca gacgacgaca tcgtcaatgt ttcgttgccg ctgctgcggt     58320
     cggcatttgt tcatttatct cagatggtgc ccgaggtgtt cgatcactgg gcggcgttcc     58380
     gctcatcggg cgggcttctt tgccgacttt gctacgtcaa tccgcaagtc tatcaggagg     58440
     ccgtggaggt gcttgggcag gatcttgcga tcgtcgcctt ggcgctgacc gctgaacgca     58500
     atgcaaaggg ctcagtttcg aacgcgggcg gctatttgcg agaactggtc aatcggagcc     58560
     accaggggac tttgaggcta agccgctctc tgttcgggat ggctgcatca agtcgaaagg     58620
     cacattaatg atcgtcagga tgtgctcata cggcaaaatg actgatgatg ctggagaagt     58680
     cgggatcagt ttgagggcgt tcttgcgaaa gtcgtgcgtc agctatcggt ttttcgcaga     58740
     cggagaacga cctcatatcc aaaagttttt aggagcaatc ctgctggtcc gacctcatcc     58800
     gtgacgacgt ctatggagtc gctttcacga acttcgccag aaatttgcag cccctgatcg     58860
     aaacaatgga ctgtccattc agcaaaggat tggtagccct gttgccgggc gagctggtcc     58920
     agcgcgaaac ctcgcgcact gtccttgctc aagccgatat gggggacatt tacgacaatg     58980
     gtgttagggg cattagccat attcgaactc atttcccaaa gtgatgattg acaacgcgga     59040
     ggcgatcgag tgtcgaggca tacctcgtcc ctctgatgga cgatgcaggc gggttgatat     59100
     agcggttgat tgaggacaaa ggcacgataa gatacgaaat gcaacgaaat caaagccggt     59160
     aagcctttgt taaaaaacag aaaattattt atccctccgc caaacgacgg gagtgatttc     59220
     aaagaattat tcaagcgatt ggctgcagcc ggagcgggcc ggcctttagg cagtgacggt     59280
     tttcctgcag ggccgtggac gcccgagctt cttgcattgg cgatttcaca gattgattcg     59340
     aaccgggttg gggtggatct gcgaacggta cagctttggt ttcaagagaa cgagaagggg     59400
     atcagcactg ccaacattcg ttggcttgca aggatttttg ggtgcgatga tcctgtcgca     59460
     accagtgaat ggcagatgga gcttagcgag gcgcaatctc ggttcacggc aaagagacga     59520
     gaatcgaaga atgcgagaag cagcgccaac gttgcccccg aggttctgga agtggcgtgg     59580
     accgccagtg gcgatgatgt aacaggaacg ccggtggagt tggcacgcga caccgatatc     59640
     aagcggccgg accggcgtcc cggtttggcc ctaagatcgg aagcactttt ttctcacgga     59700
     tctcccttga atttaccggc gtcggtcttt gcgggtgcaa ccgctcttgg gttcttgtcg     59760
     tatatcacgg gcattcatag cgccacttac attcgggcgg atggcgtcgt gaagcaggtt     59820
     ggatttcttt gggcaccgaa ttggacattc ctcttcatgg tgcttttgcc actgtttttt     59880
     tcgcttgtga cagagctgct tgtcttttgg aaaggtgaag ggcgcttgaa gctattagcg     59940
     cagggcggca agatggaaag cgaccatgat tgggggcgca atgtagaggc ttcttcctat     60000
     tcatattggg cggtgttttt gatttgcgta ttgttcgctg gtctttttca atggatcggc     60060
     gtgtgtttga ccccactcat gaaaggcggt gccgactacg cgacaagttg gggttcacta     60120
     gctgttgtgc gccccgaaat tatatcggtg ccaatgtcga ttgtgttcac agcgctcgca     60180
     tatctataca tgtgcctgtg cttctacctg tttttcgtgg gtctcatttt gcttcacacg     60240
     atggtccatg atctctggag acttgaagag gcatcgaagt cccggtcgga ggtggaatat     60300
     cgacgtgaac tcaatgaact cggcctcaga ctgatgcgcg ggatttttcg gtgtacggtt     60360
     ttgggtgttc tggtcgccat atgcatgaaa gcccaaagcg cttacctgac atcgaatcga     60420
     gaggacatcg tagcttggtt tgtcggtgat atctcatcag ccctgcatca ccacgcggat     60480
     gtcagcaaca agttcagcta tagaatgccg acgcattaca gcagccttct tgtcgctgtt     60540
     tcggcctgtg ttgtttttct gtatggttcc atccgtttag gtggcgggag tcgatttcaa     60600
     ctgcctttgt ggaagatgtc ggcggtcgta gcgttactct tcgtcagcta cttgttggtc     60660
     gatgcattcg caggcttttc gatccttctg ggcattgggg tgctcctcgg gatatatggc     60720
     ctgtgtgatc caggatttgg gcatcgtgaa cgagtggggt aggaaatcag agtgtatcat     60780
     agttggcttg atcgatggga tgagcggcgg gcgcggcgcg gcgaggaggg gaagaaaacc     60840
     tcggatttcc tccttgacgc ggaacgggcc tttcccggcg cgaagaagac agcaagtctc     60900
     gaggagtttt gtgttcttgc ggaccaggcc gtggctgatc cagccttctt cgatgaacca     60960
     agtgggagcg atcaagggtt tcaaaagcaa gatgggtggc tcaaatttcc atcggacatg     61020
     tccactgacg ttgaagagaa caatgttgtc tgggcgaaaa tcacagaaag cgggtctttc     61080
     gatcaggcat tggtgatttt tcaccattgg aatgcaagtg cacggaatca acagattgcc     61140
     agctttttct cgaaacgagg catcacggtt gtcgagattg ccatgcccta tcatttcgag     61200
     cgcagacgtc ctggctccac gcacgccgat tacatgctta gtccgaatct cggtcgaacc     61260
     atccagtctg taaggcaggc agtgtgggac gggcgaaaac tcattcgctg gttgaaaagc     61320
     gaaggctatc gagagatttc ggttctcggt atgagcttag gttcctgggt cgcagggttg     61380
     atcgccgcgc acgacgccag tgtgtcaaaa gcctcgttgt ttctcacagc gggaagtctc     61440
     gcggatatgg tttggacggg gcgcgcgaca cgatcgatac gtgaaagcct tgagcctgag     61500
     ataaagctga ctgacctgcg tagggcttgg gctccgctca acatggagaa ttacgcgcaa     61560
     aatctcgggc gaccggatct cgatcttcat gttgtgctgg caaaaagaga caaggtggtt     61620
     ttgccagaga tatcgcagag gttcatgcaa aggttgaagg atgccggcgc tcagccaaat     61680
     attctggaat taaactgtgg tcactattcg ctcggcatgc cgccttacat tttgttagcg     61740
     ggtttgagcc tgaagcggtt tctgtagatc cgctgggctc agggctcgtt agccaaacca     61800
     agaagatgac tgtagctgcc atgcggatag tcgagaaaaa gcgtgcacgc aatggtcgta     61860
     gctgatggct tcggacctgg attgccgtta cctaatcgcg tcggatactg gccagccttt     61920
     agcgatgtgg gtcaatgtct gggaagtcgc cgcattattg ggccagaaca agagctgctc     61980
     cagctacacc ttgaaagtat tcacgaaagg tcggtggccc ttcatcgatt ggttcagcac     62040
     aaaatggtca caagaatgaa gttccccgct ctttctttct caaaaattag tcaaagcaaa     62100
     tagagttttg taaaattcaa ttgtggcgtg ttaacagtag aaatcttgtt ccaacacaag     62160
     ctttgtacca acacggactc aatatcaccc tacccgtaag ggtgggtgcc gacggtttat     62220
     gttgactctg tagttcactc agccgaaaat gggcaatagc tatggagaaa aatactaatg     62280
     accgatgaga gtaacaccgg agcaattgct ccggttgtgg gccaggatgg cgtggccaaa     62340
     gcgtcgacga ccaagaagca gagattgcca ccacgcaaga aggaagctgc caacttggtt     62400
     ggagcagcat cgaaggcgac agctgcaagg tcaccgattg ttaaatccaa aaggtctagc     62460
     gaacaggaaa gaaccgagaa gctcaagatg atagagatgc gcgttgccga aggcacagcc     62520
     acgctcaagg acgtcatcaa gagcgccggc atatccgaac agacttatta taactggaaa     62580
     cgggctgtaa ggcccgttga tcacgagaac aagcggccca ttccgggcag cgatgagttt     62640
     gcagatcttg ttcaacttga aagagagaac cagcggctac gccagattct ggcggaaaag     62700
     ctgcgtgcgg aaaatgccga actgcgcaag aggcttgggc tggaataatt tagaattggg     62760
     gactgtactt gcgatcagtt tttccattgg ctgcacgttc ctgcgttaca gcaaaaattt     62820
     gggtgtctct ccaatttccc cactagggtg agccattaga gttgtgaatg tgtttcctcc     62880
     ggctggtaac agttgcggag cgcagtgaag aactgtcttt gcccgctggc aggaatgaag     62940
     tgacgccgat cggcgtcgat tttacggatt tgcttgaggt caagagtata tgaaaacgac     63000
     acaacggagt ttcgttgttg cattcaagtc aggccggcga cagctgaaaa tgggaacgaa     63060
     gtcaatttgg ggtgacacgg accttaaggc tttggcgtgc gaagtcgaag ataaggcttc     63120
     gcatctgttt ggttcaaatg aggcatcgag cacgcccgat atagaccgcg acatgctgcc     63180
     tgatcggatc gatgcggctt ctgccagcga agacgctgtc gaccttgatg ttgcacgagc     63240
     ggcggtacca tcggccaaag atgtggaggc tgacgttacg gcgcaggacc aggcaaatcg     63300
     ttcggcagat gagggtgtag cgcaggtgca ggacattggt ccagcatctc agccaaatgc     63360
     aacaacaatc ggcggtattc gaaatcgcac caagcgtgct tcgggtcgcc ggatcccgca     63420
     tacctccatg accgcgcttg gagatcaagg cgggcaatcc gagactgccg tgaatccgat     63480
     ttccgtcgac gaagtggccg tccttgatgc agaaaacaag cggctcaaga agctgttggt     63540
     tgaacagctt cgcgggcaga acttacagct tgagaagatg cttgagcgat ttgctggcac     63600
     ctaggtagac cgacaggtaa aatggtatgt accgaggcca ttgctgatgg cttcgggcgc     63660
     tggcggaact gtccagcgtt tggcatccga aactccgtcg agaggcgagc gtgatccgtc     63720
     accaccgatg gcagtaaaga aaaagggtat agcaaaggaa tattattatt tttcaattat     63780
     ttatagataa gtagataatt ggtttattat ggaaccccaa agccctgaac tgtaatcggg     63840
     agcgtgttcc ggcatttgtc acgcggataa ctgcaactgt tggttatgat ctggctcctc     63900
     attccttcaa tgacgagaca tcatactcga tgttctcgga agggcgggtc atcccataac     63960
     caacaatcca cgcaccaatg cccgccgcta ccggtcggca gcttgaacgt ttcgtcgtaa     64020
     tcggcaagtc cggagcgatc gtttgagaga tcgaggagtt gctggaccac ctccccttcc     64080
     ctctggatac ggccgttgat cgccgtcatg ctgaatccga gcacgatgcg ccgccgtcga     64140
     tcgaagagtt ttggccagag caaaagtccg agcgaacata aaatcgagag tttatcgcat     64200
     accttattga ttaaattata ttaaaaacta gagtggcgcg ctttcctgtt gaaagcgatg     64260
     accgctatac tgatgctccc cttggagcat gggcctccat gtgcccgaat gggagtacag     64320
     gtggattctt gatttattta caattagaga ttgataaatg agcgcaccca cagaggagat     64380
     gatttcagtc caaaagctag ttgaaaggct caatgctgag tatgcttttg aggttgatta     64440
     cattggtgcc gatctcggcg gctttagttc gcaaaacaac caattgacac ttaaagacaa     64500
     gcgccgaatg gttcttaagc gttgcgatca aagtcagtgg gaccctcgta atgttgatat     64560
     cgctacgata ctagcccacc atagttcgct catttatgct ccgttggcga cagtcggagg     64620
     tagctccaca ttcaagttcg acggttgggt ctatgccgtc tttccctacg tggacggtga     64680
     gaaacttcat cagcattccc ttgatgcgga gacattgaaa agcgcggcaa gagcattata     64740
     cgcttttcat catatcgcgc atttcgccgg atcccatgca gctcagcggc ccaatgtttc     64800
     agattttgag cgggaagtaa cgtccgtact tgagccgaca ctcagcctat ctaccgatca     64860
     cgctgacatt atcattcgat cgattgaggc taaacgacat atcttgcact ccttttccag     64920
     cgacctctcg tccataaacg tcggtgcgtc gtcggtaata catggcgatt ttcacaacga     64980
     gaacattctc tatcgatcag accacgtcgt tgctatttta gatttcgaga tgcttcattg     65040
     gggcaacgtg gaagatgata tcatcagctt catagctctt ggttgttgca ataacggatt     65100
     ctccgaggaa aatttgagaa tggcaaatat ttttgttaag gaatacctaa gtttacacgg     65160
     cgaaaatctt gaccttcata cagctttact aagatttatt cacttaaaat cgtcatcttt     65220
     attcttacaa aaaatgttaa tatacactgg caacatgctt tacgcccaga ttatcgaacg     65280
     agataataag ctgtttccat ccatcatgaa aaagcacagg gaaatttcca agacgctatc     65340
     gagcctctga gggatgtaac gatgaatgat atcttagctg ttgttgcgtt ccactccaaa     65400
     tctcgtagtg ttcgtcttga tagctataag cattcggcgg ttcagataat atcggcatcg     65460
     gtagcaatcg gcatatcgac aacaatatcg aacgccccac ttgtggatgt gtgcgcttgg     65520
     tgggacattt gattgagcaa gccgggggag gtgtcaattg acactgtcat gccctactgg     65580
     tgcagatcca ggaacgtgat cgcctccctc agcttgatca ccaccccctt ccgaccatcg     65640
     gaaggaatat cggcggccgc agcacctggg gaagattcaa acggcactag tgggctcttc     65700
     cgcaatttcg gtgcgtcgga ggctaacact ccaagttgga ccactaaacc caagcgcttc     65760
     aagccaggat gcgctaacat tagagccgga ccattcggcg ggtcatgcca atgacactct     65820
     attgactaac atatagacaa ccgatatcag agctactcaa attgcaatgc ttggacgagt     65880
     gcgccgctcg tcacctacct ctagtgctca tcccacagga cgattttact actacgagcg     65940
     gagcaccaat attgtcgcaa cttctatcag aaaaagaaca gaaaatgagc aacggctttc     66000
     ttttgccgtt gcttgcaatc gcggttcctg ccgcattgca gaatttcgtc ttctccgccc     66060
     agcaagtgct cgatacgatt atggtagcac ggttgaacga cgaatacgtc gcggccctcg     66120
     cgttctgcgg cgcagcattt ctggtgatca ccagtagctt gtttggcatc gcgcttgcca     66180
     ctagcgccct agtggcgcag cactggggtg cgattgacta tgctcggatg agatcgtatc     66240
     tctttctggg tatcgcgcta tcgatgcttg ttgccgtacc agctgtcgtt ttgttcgtcg     66300
     ggtttcctga gctgctaatg agcctcggac cagactctat tcaggtgcgg aatgcgggtg     66360
     tcgaatacct acaaattgct ggatggagta tcttgctttg gccgatctct gtcggcttga     66420
     gcatggcatt gaatatgatc ggccaggcgc gtttgagctt acttattagt gtcgctttcg     66480
     cggttattac aattgtttca aattatgtat tgatatttgg ctggggtcca attccaaaat     66540
     tggaaattag gggagctgcg ttcggcactc ttggaacaag cgtcctcttt gctggagtct     66600
     atttattatt cgtcttgcgc cccaataatg cccttcgttt ttcgagcaga gaactgagtt     66660
     caaccattac tctcccgctg atacgcaaac tgattgctca gtctactccg ctgtttatca     66720
     atggtacgct ttgggctggg gggctgttta cttacaacgt catatttagc cagctcggca     66780
     cggccggcat gaccgtaatc gcattgctgg ctcccatcat cactgtatca ttggttattt     66840
     tcaacggact agcgacaggt gcgaactccg taatcggcaa cgctttaggc agaaaagact     66900
     ttgattacgc gtggaattgc gcgaagtctg caatatcttt gacccttgta accggtgcct     66960
     gcacgtctct ttgtatgctt ctgcttcaag gagttcttcc cactctgtat tcgggtgtct     67020
     cacaaggggt cttcaccgaa ttcgaatccg tatatacgat tgctgccgct ttcatttggg     67080
     tgcgcggcct gaatattttc ttagtcaacg gcctgttgag aactggtgcc gacaacgatt     67140
     acatattgaa attggacacg atttcttctt ggggaataag cattcctctc acatgcgcag     67200
     ctgtatatgc attcgatctt tctttgatct tcgtctatct cgcatcctta actggggact     67260
     tcgttaagat gattttctac gtggcgagag tccgtaagcg gctttggttg cgatccttag     67320
     tctaatttct cgagcgtaaa gttatataca tgggaggaac gtgtgagctt tatcgataaa     67380
     gatcatattt tagcgtttgg tgcgggccgg ttgcacgacg gccaccttaa tatctctggc     67440
     tacaagcatg cgatggtgca agccattgca tgctgtattg cccagaacca aagcgcggcg     67500
     ctcaacaatg taccacatct aacagagaca tctataataa cgaagatctt gcagaattcg     67560
     ggctgcaccg ttgattatag tggcgacacg ttgcgattag atcccacaaa aatggataac     67620
     tcatccatcg accctctcct gagtcaagag atacatgggt cgttatactt ggtcccggcc     67680
     tacgttgcac gatttggcga agccgtcttt cacggtgcgg gcgggtgccc tatcggtgaa     67740
     aacggaggcc gcccggttca gcatgtgctg gacgttatgg aaaaatttgg gatcaagtcc     67800
     agtatcacta atggtgcggt caagtgcgag cgaacacaga ccattcgggc tgttgatgtt     67860
     gacgcccaaa actactccga cgatccgtca acgcttagtg gaccggccgt cagcggggca     67920
     acgaagactg cattgatttg cgccgctatg gccgatgaga cacgcatccg taatccatat     67980
     ctgaagtcgg atgtgtttgt tcatctcgat gtgcttcagc agatgggtta tcgcgttgat     68040
     attgatttag ggatgataac catacgaaag cctctctcac cgaatcgatc gccaggaatt     68100
     gactacacat tgaatagctg cgtgagcgag attgttacat acgctatcgc agcagcaatt     68160
     cacgatattg atctcgtcat gaagataaaa aagggcgagc gtgtagcgca ggctctcgcc     68220
     ccggaattga ccatactctc acggatgggg ttacccgttg agattacgga agacgcagtt     68280
     agcgtcgggc gagccaacac cattctcggg caagcgataa ttgtcgataa tagcgtaact     68340
     agcattcaaa gcgaccatca tccatttcta gtgctgctta tggcaatacg aggatgccgc     68400
     ggaagcgttg ccgacacggt ttggcgaaag agggtccatt atgcagaagt attatctgcc     68460
     atgggtgctt ctattcgcat agaaggaaac accgtacatg tggatggcgc tccaaattgg     68520
     gtggtgactc ggaatgttgt ttccggaggg gatgttcggt catctgctgt tattgccctt     68580
     ctgggcacat tgctgaatag caaagtttat atcgaaggcg cgcatcatct ttctcgtgga     68640
     tatgtagatt ttgttggtaa actaatcagt ctcggagcga acatagacac ctatgcaaat     68700
     gctaggctct tggcatcatg agagttttat ctatagctaa tgtctccaat attgataatc     68760
     cggaatgtga ctcgggtatt atattccaac gtctaattgc agatgaactc gtcaattacg     68820
     gaattcaata tgatgtcctt gtccccaaga cgttttcaac cgcacgagaa tattgcggag     68880
     ctgcaaatgc agttgaattt cccttgggaa ccactcgata tgaatctcga ttttcattcg     68940
     attggaatga gtttaaacga gtaattactc tcttaaaacc ggacgttata ttcaactctc     69000
     aggtggagct cacgtctgcg atccgagctt tacttgtaac tgagggtaag accataccga     69060
     ttgtgtctta ctgccattat ccggcgcttt gggcgggaga cgggcaaaag ccagaaaagg     69120
     acgcgtcact ggatcatgcc gcgctatggt accctatcgt acaggatata ttgtcggcgc     69180
     tgaacaccgc agaccgtttt attattcaaa gtgactttgc tggcaagctc gtagccgcag     69240
     ctgcgtcatt ctataatgtc cccaaacata gggaaattgg tgttgtcgca ccgccggttg     69300
     atcctgccat gctttcggac gagccgacgg aagcacgttt agcccggcgc cgtaatcgga     69360
     aagtgattta taatcatcga ctctacgcgt cgtacggaac acaggacttt attgaccata     69420
     tctcagaatg cctcgacttg aattgtcgct tctttataag tgatcctatg ggtaacaggt     69480
     caatgcatcg ggctttttta tccggttcac cggccgatta tcgccaacgg ctctcagcga     69540
     tgccatgtgt cgatgtttca ccgttaggat attccagggc cgcatatcga ggggaaatct     69600
     tgagttctcg tgtgggaatt gcggcgtttc gtccggcttg tgtttggtcg atgtccgcgt     69660
     tggactgtat gggtctgggt acgccggtga ttgcgccaaa ctacgcatcg tatccggagt     69720
     ttatcccacc ggagctgctg tttaattctg tggcggagtt cagatgtctc ttagtccggc     69780
     ttttagaaga cgacattttt tggtgcaatg cctcagacca atcacggacg atggcgttga     69840
     gattctccgt tcaagatagc gccgcacgtt tctttaagat gttttctacg cttggggatt     69900
     ccgcatgtgc ggtatagctg gggttgcttc ccgacaggca catactttgc ttcggccgga     69960
     ggtggttcga atggcgcttc accgactggg ccatagaggg ccggatggta cggagacgta     70020
     ccattgcgcg cagggtgtct ttggtgccgt gcgcttggct atgaatggcc ttgaaagcgc     70080
     agctgttgca ttgaaagaaa atggcgggaa actgtctcta ttctacaatg gtgagatcta     70140
     taaccaaagg gaactgcggg cagaattagc tgagcatggg gtccgttttt ctacgacaaa     70200
     tgatggcgaa attattctgc acctttacaa gctagcgggt ctagcgatgc tggatcgcct     70260
     agatggaatg ttcagttttg ctctcgtcga cgaggataaa ggcgagacaa tcatcgcccg     70320
     cgaccgtttt ggcattaagc cgctatacta tcactatgac gatagccacg gtcagctatt     70380
     ctttgggtcg gagttgaagg tcatccgctg cttaacagag agagctcctg agattgatag     70440
     agtttcagtt gcgagttatt tgcatctgag atttattccc gcaccatttt ctatttatca     70500
     aaatataaga aagcttgaac ctggatgtta cttgcggctc aaccgagaag gtttgcggcg     70560
     tgagaagtat gttttagcta gtcgggatcg ggtagacgcg cgacgaacgc agcaatcttt     70620
     gtctggcgaa ttagatgatc ggttgcggga cgcggttgcc gagatgcttc attgcgagac     70680
     cgaaatcggt tcatttttga gtggtggtat tgattcgact ttagttgtac aacatgcaac     70740
     ccgattgaac gcgggacaca aagcattttc ggtcgggtat aagcaggcaa ctattgcgga     70800
     tgagacagaa caggcgaaga agtcagcgtt ggcattaggg actgatcacc gcgttacatt     70860
     gatgtcgtcg gacgattgct taacacaaca gctaaagcag tcgtcgtggt atttggacga     70920
     acctgtactt tcgacggtga gcctcccaac atttgagttg tctcgcttct cgcgacagtt     70980
     tgtaaaaggt gttttagccg gtgatggatc tgatgaaata ttcatgggat ataattatct     71040
     ctacgatctt cggcacgaat tgggagaaca tcaacttcta gaaaggtaca tcgctaagat     71100
     tggttggctt cgacccgcga taggcagtca agttgcgaag gaatacttcg cgtttgatcc     71160
     atttgacact gttcttttgc caagcgatga cccgtgggaa gcaattcgtt catttgaggt     71220
     aaactatcgg ctcccggact accatttgca tcgggtggac cgattgagta tggcgcattc     71280
     tttagaggtg cgaataccat atctgcataa aagcatttac gattttgcct tctcgttctc     71340
     tgcgagggat ctcattgaaa aatttccaag gaaagcaatc cttcgtggca tttccgccgg     71400
     cggtgctatt gaccatctgc ttcagaaaaa gaaaatgccc ttcacatcgc cttacgcgga     71460
     ttggttacac ggcccgctaa aagaatatgc ggagtacctc ttctttcaat caacggttgg     71520
     tgaaagcctt ggtatcgatt tgacgcagct ggggagagtg gtgaatttgt ccgaactgag     71580
     taatcactta aattcaactg aaatctgggg ctttttctct ttgttcaact gggctcaagt     71640
     taccgacgaa tctacacctt ctttcggcct tcgccatggg taaacttatt gtatcggatc     71700
     tagacggcac actactcaat aagaagcggc gactgtcacc cagaacagag gatgtgctgc     71760
     gcacaatttt tgctactgaa ttttctttta ttgttgcgac ggggtgcaac agaaatgatg     71820
     catcctctgc attgaaccgg atgcagtttc ccatgatttg taataatgga gcggcgatct     71880
     ggcggccaga agattctaaa ttttcagatg tgaaatatat ctcttcggga gctgtgcagc     71940
     agatattgga tgtcacgaat tccatcaatt cggcgccttg ccttttgatg atcgacgacc     72000
     gatctaagct tgaatactac tgcaatgcga gagcaaaaac tgacctcaag atgtgctccc     72060
     agttggatgg catgggtgta ccgcagtctg acggacgctt tgatcgaagt ggcgttgtta     72120
     atatgaggtt cgtaagtgaa tcgccgtttt ctttggaatt gatccaagaa attcgtgaga     72180
     tttcaggctt aaacgttgtc tatgagaggt caatatacga atctgcggta tactttgtag     72240
     aaatttatgc tgagcatgtt agcaaaggag acgcaatatc gtcatttctg cgaagcaacc     72300
     cgcatgaaga agtcatttgt atcggagatg gattaaatga tttgagcatg cggagcgttt     72360
     gctcgacgtt ctgcgcgcct gcagatgctc acaaagatat cttagaaatc gcagatatag     72420
     ttataggtga aagcgatcga gacggtgtcg cggaatttct tgagaagata cttttggatg     72480
     actagattgc agtctttcga agttggtatc taacaaaact gattgagtac acatgctttc     72540
     gtctgtcata atgtcaaatg ttacatggtc tgcgacagat gaggcgcttc tcaaagacat     72600
     aaaccttact tttggggcag agcgaacggg ccttgttggt cgcaacggtg tcgggaagtc     72660
     ctcattgcta aagctgatat gtggtgagtt gcttccgcac agcggtaccg tgttagtgaa     72720
     tggtagcgtc ggcttcctgc gccagatcgt ccagatcgaa agtcagctga ctgtcgcaga     72780
     tctgttcggg gttgccagtg cgctcgcgac gctcaaccgt atagaacggg gagacgcaaa     72840
     tgatgacgac ttcgcgctcg ctgattggac gttggagtca cgtattgcgt cgtcactggc     72900
     cgacctaaaa ttagatgtcg cgatgaatac tcctcttgtt tctttgtccg gtggacagcg     72960
     tactcgcgct gcactcgccg cgctcatttt tgacaagcct agttttgttt tgctggacga     73020
     accaactaac aatctcgacg gggaaggtcg taatgcagta attgactttc tgtctcactg     73080
     gcgttcaggc gcaatcgtag ttagccatga ccgtgatctg ctagatacca tggatgcagt     73140
     tgtggaactg acatctcttg gttcaacacg ttatggtggc aattggagct actaccaaga     73200
     gcgcaaggca gtggaactta gtgcatccaa acgcgagctc aatgaggcgg aacgtcggtt     73260
     aatagatgtg gaccgcgcta gtcaagctgc ggctgaacgc aaaacccgta aggacaacgc     73320
     cggtaagagc aaacgcgcca aaggcgatgc gcctaacgct gcattgaaca gcatgcgcga     73380
     ccgcagcgaa aagaccggag ccgaaaatgc tcggcttgca gaacgtcggc gcaatcaggc     73440
     acaagctgat gttgtcgcag cgcgcgaacg cattgaggtc ctacaaccct tcgcggttgc     73500
     gctcgcctct acgcaattgc ctgcaaacaa aacagtacta gcgctggaat tggtttcagc     73560
     tggctacgat cctttgtgtc ccgtcgttca agacctgtcg ctgaaaatcg tcggcccgga     73620
     acgtatcgca atcatcgggc cgaacggcag tggcaagtct actattcttt cggtgattgg     73680
     cggaggcctg aaaccatcgt cgggaattgt aaaggttttt acacccttcg ctatgctaga     73740
     ccaacggatg agcttgctcg acccgtcagc cacgattcgt gacaatttcc ggcgtatcaa     73800
     cgttgatgcg gatgaaaatg tctgccgtgc tgccttagcg cgttttaaat ttcgagccga     73860
     tgctgcctta ctgttggtgt caagtctgag cggcggtcaa atgatacggg caggccttgc     73920
     ttgtgtgctt ggcgggaaac atccgccacc acttctcatt cttgacgaac cgacgaacca     73980
     tctagacgta gagtccgttg aaaccgtaga gaggggttta tgcgcctacg atggtgcgtt     74040
     gctggtcgtc tcacatgatg ctaggtttct ggacgctatc ggcgttaacc gcacaatcgc     74100
     gatgggtgct cgaccgcgcg gatcgttgcc ccgacatcgt gtctgatctt ctcaactatc     74160
     gtcaatcgta agcggaagaa cgcgcagctg gcgccgactc tttcactttg cgctgccact     74220
     ttcatgacta gttgttacca cgattgactt atcacccaag taaattgaag gtaagcgctg     74280
     ttctgcggcc acggctgaca gaagttgacg cctattttgt gagctgatgg cagccagacg     74340
     ctctgcctct gccagcgcgg cagttttggt tttgaagggg ccgacatcgt tttcttccgt     74400
     gtcgggtaac cacttcggaa ggaaccacca gcctccaggg cgataactgg aactgcttct     74460
     gaccgagccg acattcttgg cgaagaacca gccggagtcg attccgtcct gctcccatga     74520
     gatgctctgc tctgtcacgg cacactccac gcctattctt tcatcggggg tattttatcg     74580
     gtcctgtacg accagggcaa taactcgtcg atctgactgt tcgggtggcc gttgacgatc     74640
     ctggtaagcg cgtcagcgat atagccaagc ggttcgacat cattgagctt ggcggtctcg     74700
     atgagcgacg cgatggtcgc ccagtgttcg gctccggcat cagagcctgc aaacaatgcg     74760
     ttctttcgat ttagagcaat tggcctgatg gatcgctcga ctgtgttgga gtcgatctcg     74820
     atgcgaccgt cgccgatgaa cctcgtcagc ccatcccagc gtgacaaggt gtaccggatt     74880
     gcttcggcca gctttgtctt ctggctgatg aggccgagct gttcggtgag ccagggcgca     74940
     aggctgtcgg taatcgggcg acttttctcc tgtctgatga cacgacgatc atcttgcgtc     75000
     cggccgcgta tctcgtcttc gtttttgtag agttcggcaa tgcgccgtag cgcctcggtg     75060
     gcaatgggtg cgggaccggc ggcggccagc tcgtaaaagc gccgacgaac atgcgaccag     75120
     cagaaagcca gcgagaccgt gttcttggca gccaacgggc ggtagccact gtaaccgtcg     75180
     acctggagaa tgccgacgaa gccttcgaga tgggtcatcg ggcgctcggc cttgcgatcc     75240
     ggtgcataga cataaacgac acccggtgga tcattgccct gccaaggcct gtcatcgcga     75300
     gcataggccc agagttgccc ggtcttggtc ttgccgcgtc ccggatcaag cacgggtgct     75360
     gtcgtctcgt cagcgaagag cttggaagag gacttcaaca catcgagtag ccgctgatga     75420
     accggacgaa ggtgccaagc ggcacggcca acccagtcgg caagcgtcga ccggtcgagg     75480
     tctatgccct gccgcttgta gatttgcgct tgacgataga gcggtagatg gtcggcatat     75540
     ttggagacca gaacgtgggc gacagttgct tcggtcggaa tgccgccttc gatcagccgg     75600
     gcgggagccg gagcctggac gacgacatcc tcgcaagccc ggcacccgta cttcggacgg     75660
     cgaacaacca gcacccggaa ctgggccgga ataatgtcca gcttctcgct gatatcttcg     75720
     ccgatccgat gcagatcatg atggcagcct gggcaggcat gatcatcgat atcaacgacc     75780
     atctcgatcc ttggcaagtg agctggaagc gagcctcggt tcgttcgccg tttggcgacc     75840
     cgcgtctggc gcagatcggc tgaggcttgc tcctttgctt ccaggccatg cgcctcgacc     75900
     tgttcggcct cttccaagcc caagagaagc tgatcctcgg gaagcgtttc ggcgcggcgg     75960
     ccgaagcggt ggcgctgcaa ttccttgatg atctgccgta ggcgggcatt ctctgcctcg     76020
     cgcgaaagca ccatcgcttt cagcgcgttc aggtcatctg gaagttcgtc cgcccttatc     76080
     gtcatgggtc aagaacagca tattttgcct cccaaaacga gatgtcggat ggagctgatt     76140
     caattggtcg cggctgctat ccggcctgaa caggcgtgcg cgtttcgctc ggcgcatgca     76200
     cgcgtttcca gtccagcccc tcgaacaaag ccgagaattg cgcggatgtc agatgcattg     76260
     cgccgtcctg catccggggc caatggaatt cgccatcctc aagccgcttg tacctcacaa     76320
     cagaatgcag ccactaccaa cgcagatacg cagttagtgc gggtaacgca tccgtttcat     76380
     cctttattcc cacggcagtt gccgtgcgtc ggcaagcgct acaaccggca cggtgaacgc     76440
     cttttgctgc agaccgagga cgccactgtt tggtcggttc ctccgcaatg gactgatctt     76500
     gtgagcttgg atcctgaggt cgtcatgggc aacggacgat cgctcttgcg ggtggtcgac     76560
     ttaatggagt tggccactct ggtgaagcgc ctttcgagca aatcggggcc acgctgacgt     76620
     gcggaagtgt aaggataaat atgccgcatt tgtaaagtgg attatgccgc aagaggtcgc     76680
     ttttatgaga ggtttcgcct gtacatgcga agtatcacgt caaatagacc ataagcatcg     76740
     tcttgacgag gtagcaaaat gcgtcataat tagcattacg ataacaccgc ttcatgtcct     76800
     tggagccatt gatgtctgcg aagtacgaca gcaagcgcac aaagacggat gtcctcatcg     76860
     aagagggcac gttcaatccc acccccgaga aggtgcgcga tccaaagttt cggggcagcg     76920
     agttcttcga tccgcacgac gccgtgcagg tcaaatacga gatgctgcgt cgcgtctcca     76980
     tcgacaaggt gtcggtgacg gaggcctccg acgagtacgg tgtttccagg ccaacctact     77040
     accaggccaa ggtgaacttc gacatggccg ggattgccgg attggtgccg acaaagccgg     77100
     gcccccgcgg tccccacaag atcgacgaca gggtcctggc atttctgcag gcgcagctcg     77160
     ccccaggaga acccgttcgc gcccgggaac tggccaagct gctccgccaa gaactcgata     77220
     tcgagcttca tcccagatcg atcgagcggg ttctaaaaaa aagcggcaca taaacattgc     77280
     cgcgaccgcg gcatgcccga cccaaccgtc gaccatcgcg tcccagtacg aggtattgcg     77340
     caaggctgct ttcggcgcag cgctgccgct tatggcccgt agcggcctga tgctctttct     77400
     gcgccggggc atgtggggat gggttcaggc gctgacagca acagcaagca ccccgcgaga     77460
     gcagatttac ccatcgtcaa ttgcttggcc gctgcacggc gggcacagcg ccgttgttca     77520
     cgtccttgcg acaatcgcca tgagcatcaa cgatcggaga tcaccatgaa tgtacatctc     77580
     aaagtccagc ctcatcacct cgaacgcggc gcctacctgt acatccgcca gtcttcaatg     77640
     cggcaagtcg ttgagaacgt cgagagcgcc aggcggcaat atgcgcttcg gggacgcgct     77700
     gtcgccctcg gctggcgcga cgagcagatt atcgtcatcg acaacgatca aggagagtcc     77760
     ggtgcatcgg cggcgtggcg cgaagggttt cagcggctgg tcagcgatgt cggcatgggg     77820
     catgccggga tcgtcatggg cctggaggtc tcccgtctgg cgcgcaacaa tgccgactgg     77880
     cagcgtctgc tggagatctg cgcccttgcc gacaccctga tcctcgacga ggacggcgtc     77940
     tatgatccgg caagtttcaa cgaccggctc ctgctcggcc tgaagggaac aatgagtgag     78000
     gccgagctgc atgtgatcaa agcccggcta cgcggcggca ttctcaataa ggtgcggcgc     78060
     ggtgagtttc gttgcctcct gccgaccggg ctggtctatg accatttcgg caatgtgact     78120
     cttgatccag acatgcaagt cagagaaacg atcattcatt tctttgagat gttctctcgc     78180
     ctcgggtccg cctcccagac cgtcaaggtc tttcgcaatg aaggcctatt gtttccatcg     78240
     cgcctacaca acggcgacac gctgtttcgg ccgctcaccg catcgacggc gatgcgtgtc     78300
     ctgaacaatc ctcgctacgc tggcgcctat acctatggcc gacgacagtt tcgacgcacc     78360
     atcgacggca aaaagactct gcgtgcgcgc gacattgatg actggccggc ctgcattccc     78420
     gatgctcatc ccggctatat cagctgggaa cgacatcagg agaatctgaa gatcctcaag     78480
     gcgaatggcc gtggatttga agcggcacga gcttcaatcc caagggaggg accggcactg     78540
     ctgcaaggcc gggccgtgtg tgggcagtgc ggcagccatc ttagggttcg ctatgcggcg     78600
     cggcgtggcc ggcaggaagc ctggtacatt tgtaatcgtg cccgcattta tcgtggggag     78660
     cctatgtgtc agtcgatcgc cgggcctccc gtcgatgaag ccatcggtat gctgattgcc     78720
     gagcagatga cgccggcggc cgtcgaactc gctctcgaag tccgcaagga gatccaagcc     78780
     cggcatgaag aagcagaccg gctgcgctgt cgcgcaatcg aacgcgccca aacggaagcc     78840
     gagctcgctc agcgccgctt catgcttgtc gatcctagta accgcctcgt cgccgacacg     78900
     ctcgaaggtg aatggaacga gaagcttcgc acgctggcca gtgcccgcga agagcgcgaa     78960
     cgtggccgag agcacgatca attcatcctc gataaagctg tccacgaacg gttagtcgcg     79020
     atgacggccg acttcaacca gctctggaaa gatccggata ccccaagccg cgaacgcaag     79080
     cgattgctgg cccacatcat tgaggatgtc actctcttaa agttgccagc ggaaggaacc     79140
     accaagcttc acgttcgctt caagggcggc aaaatccaga cgctcaccac catgaaccca     79200
     aaatcctctc ctcagcagat caagacaaag cccagtatca ttgaactggt cgataggctt     79260
     ctcgacgatt acatttatcc cgagatcgcc gagattctaa acgagcaggg acatcgccca     79320
     ggtggaaccg cacgtcgcgg ctgccaggac gcccgcttta cacccctcaa agtcgcctat     79380
     ctcatccacg aatataagct gcgatcacga tatgatcgac tgcgacagcg gggaatgctg     79440
     acaagacagg aagcggcagc gcatctcaat atcagcgagc aaaccgtcgc cagatgggcc     79500
     aaatttggcc tcatcaccag acatgcctat aacgggcact atagcctgta cgaaatcgcc     79560
     gatggagacc tgccgcaaaa gcaatgcagc cgatggaatc cactcgaaga tcgcgctgct     79620
     gcgtatcgac aaatgcaaac cgagccaaga acatcaactg gcgaggaaag aggtgtagta     79680
     tgaacgccga tcgttggcga ccaagcatac gccactgcca tcccagaaga tcagtttgat     79740
     gcggtcggtg cgcttggccc tgaacacgta gatcgtgccg gagaatggat cagttcccat     79800
     ctcagccttc accagcgcag ccaatccctc tgcacccttg cggaagtcga ccggcttggt     79860
     ggcgatcatg actttaaccg cgccggacgg accaatcacg atgatgcttt catggccgca     79920
     atgacggctg caatcgtcgt ggcgtcagcg ccagatgcaa ttctgattgt cgcaccacca     79980
     atttccagct caatcacggc gtcgccgtga gccttcctcg gtgaacgtgc tcgccgcacc     80040
     tttctcggca tgggcatatc ctgtgcgacg acgacggcag gcgcaaacat cggtgccccg     80100
     tccggcaata catcgagcgg cttgcgggca agccgccgcc aggtgaacaa ctgttgcgat     80160
     gtcagcccgt gacgtcgcgc caccgaggaa accgtcacgc cgggctcatg gctttccgcg     80220
     acgatctgcg ccttcagctc gtcgctccat tcacggcgac gaccacttcc agtgaaaacc     80280
     tcgaatcgtc gaaccggctc gtcatccttg gttttaagcg taagctctga aatcgacata     80340
     tgtctaagcc ctctattcag gctcaacatc gtcaatcaca acatgatccg gaaggtgggg     80400
     tcaaaacgac gcttacaatt gaagtattca cccgtggcgt ttagtcaaat tatcgaggat     80460
     cagagtatgc actaactatt cgtgtgatct cggctgtaga aaacattgtc ggtgagacga     80520
     cgaactcggc tatctcgtca caatatctaa tggggcgaaa gtatctttca atccaatgaa     80580
     ttgcttcgct ccttgcatag cgagaaaaca atatccttgt ctctttctga cagagcgaaa     80640
     tcgtcgtcag aaagcatgca gctttgaatc taccatttat aaccactaca tccggatgct     80700
     caaattccct agagtcccaa atggatgtgg gatatctgta gtaggcgtcg gagtgactgg     80760
     aatcatcagg gaaaccccaa tcgcccgtaa cacctatatc ctcataatga atatgaaatc     80820
     tggactcctc gtatgtatcc gcgagcatag attgtagcgt ttgagaaaat tgcttgtcac     80880
     attcaaccga aatgactcga ctgcacccat tcgcaagcgc ctcgatcgaa ggatgaccgc     80940
     caccgtacac aaggacattc gtagcatttt gaaagtgttc caccaggaga tcacgttctt     81000
     tttctgatag tggcaaatcc aagccgttca ttggggcggc cgcctcaagt tccgtcatgc     81060
     tcgacttaca aagctgctcg atatcatcgc gaggtattgc gtcgattgcg atttgtactt     81120
     tctgctgtgc agatgagatt gcgcactgca cattctcaat tccaaccaac tgcttgatca     81180
     ccatgtcaac ctgatcgcta aacctcagga taccatcatc aaaggacccg tttctgttca     81240
     ttcgcatata aaacataggc gtatggcgtc gatttctgga tccactctga tctgacagaa     81300
     aacccctccc tcggctcttt ttgagaagaa agtattccgg agttctgacg caataatgat     81360
     ttatctgcgc aaatttatat ccgtgttcct gttgttcaac cgagctcgtc cgccaaaaat     81420
     cctcaccttc caaccaacgt ctattgactt ctgatgagga ttcaattggc ctaccatttc     81480
     ccgatagaaa tgttgtggaa ggagcttcat gcgctttgcg caataaagga cgatgtgtac     81540
     caatttccga aaatcccaca accggatatt caaatcgaaa gaaggtctta atctcccggt     81600
     ttcgggtaaa ggtttcgcta gccgcggacg tgaaattggg cgatataaat ttaccaggaa     81660
     agctgtgatt tcctccgtct ccaaacaggc gccaggatat caagatccca gcgcagggcg     81720
     aaatcgcgga aacgaggtcg ctaacttgtc cgctgccaac accgatattc aagaattcat     81780
     ctgcatcaag ccaaattacc caatccgact gttccaaaag gcccatttca ttagccatcc     81840
     tcgcggcgct ttgctgcgca gagactccgg cgggtggcgt atgtctaata tgcaatatct     81900
     cccgtgcttc atttagtgca tctagtatgg cgtctgtacc gtcgctgcaa tcattagaaa     81960
     atacgatgat acgatcaaat ccaatgactt tatgataggc aatccactca acaatgaacg     82020
     gtgcttcgtt tttcactgct gagaatagaa catttcgatt tgatttttgg tctaccattg     82080
     atgccgatct ttaatcgcgc agagaactgc tcgggggtgg ctggaaacta atcagggcac     82140
     gttatacggc gatagtcata gtgtctatcg cgacatcatc agtgcttgct ccgatcatag     82200
     cctgaggcgc tcctggctgg tggatgacag tctgcgattg aagtctcagt ttcagcgcgt     82260
     cacagatgcg aacgaggtgt tggtcgctcg aaccgactac ccaatggccg agagtgctgc     82320
     ggttgacacg aacgcctcca tactcaaagg cctgcgctag agcgcgtcca ttttactcgg     82380
     gttcatatcc gcaagcggcg aaatagtttg cgcactcttg gggtttgaat gtacccttgc     82440
     cgaatttctt gcgaaactgg atcaggtcgc attcccagtg cccgaactgc ttgcgatcgg     82500
     caacgacgtc agggcggcgc aggatgttca attctgggct gaagcgctgg ccgtgtcgac     82560
     gtcgagcatg tcgcggccgg cgcctggccc ggtgttccgg caggtgccgc cacagcttga     82620
     tggcctgacc atctgcggag taagcgaact tgtagatcgt ttcgtggctg accaagatcg     82680
     gatgacgctc cagccgcatg cgaccagcga tctgccgggg cgaccatccg tgcaagatcc     82740
     ggtcgatcac ggactgccgc acatgtgaga accgcgccag ctttcgcaac ttggcacgac     82800
     gctcacaagc catgtcatgg gccgtcacgc agtaatagcc gttgagatcc ggtatcaact     82860
     tgtcgacgaa catgttgcgc ttgagctcac gaaagatcgt tgagcgatgc cgtccaagtt     82920
     tttcagcgat gatctcgacg ctgatgccgg ccatccgcca gcgagcgatc ttgcggcgtt     82980
     catccaggtc gatatgggag taggtgtgtc tcattgcgca ttccttgcga gcgataaccc     83040
     attggcatct ttcgcaagtc gcgcttcaaa cttgaaccca cctacaatta tagattgtgg     83100
     ttcgtaatag taattatgga actcagtttg gtagaggtgg ataaaagtgt actttcgctg     83160
     gacgattctc gcttagcgga aagtgggagt gttgaattcc atataaaact caccccgcgt     83220
     ttgccatttt acgatcaccc gcaattggta aatagtgaag catttcatag gcctgtcccc     83280
     gcttcgcggg gtcaattcca aaccaaaaat ggggcagatc acggcggaat tcaacaagca     83340
     ggcggccaac tcaaggtaac cccctgaaaa cgacaccgtg cgcgcgattt cgttcaatgg     83400
     agcgcgtgag cgttgcaagc gtggtcgatc tcattgcatt tgtcaggcat tcttgatgtt     83460
     tctgtcgtaa ggtctcctcg gttagtggag cctctggcgt acccggcatg aaaaaagagg     83520
     ctgcgcgcaa aactttcgcg tttgtgcacg taagggtgac ggatgcgggc gccaattcac     83580
     cgctcgattg cggatctatg gcgattgtga tccgtttcat aaattcgatc actgccgtct     83640
     cggtcacaga ctggttgctg agttcgttga gcccgatccg ctttcgcaaa gccatggagg     83700
     ctagagcgta tcttaggtta aattgcgcaa acacctcgag atcactcgcc gcgcgcgcct     83760
     ctcctccaac gagcctcgcc atgaaaggag agatccttgc ctcaatgtgc atgatgtccg     83820
     cagccgtcaa tccgtgcgcc gagatgatat cgtgaagtgc ctcaacagcc gcatgactgc     83880
     aggcgcagat cggatatttt ttcaggccgg tccgcatcaa gaagaactcc tcgccgaatc     83940
     ctccgagtac gtggaattcg tcaagttccc ggtaaagcct tccgaacccg aatttccctt     84000
     cgaccgcaaa tgtggggccg gtaatgccga cctttgccag cagcgccgaa aatactccgg     84060
     cacggcaagc aagtgccggc tggaggcgtt tctgaagcac ctgttcgaca ttcgcttgct     84120
     gggtgccggc tgcctgcccg agggctaggc ccaaggcatg ggcggtctgc tgcgggtcaa     84180
     gtttcagcag atatgccgcg gcacctgctg caccaaaccc accgaagatg gcagtatgcg     84240
     accagccggg cgacgggccg cttaccgaat tggcaaggcg cgccatcacc tctgtgccaa     84300
     tcacatatgc ggtcagaaat tcctgccccg tcgatcgttg tctctcggcg atggccgccg     84360
     ctgcgggcag gacgacggcg tccgcatgga cggtgccgtt cagactatcg tagtcaagag     84420
     caacggcatg caagctgttg acgaatgctg cggaggttgc cggcagcgat tggcccgtac     84480
     tccaaagttt ggcttccgcc ctaccgcctt ctccaatcac caaatcggcg acgttcttca     84540
     cccccgccgc cgaggtgcca gccgccgcta ccacgacggt gtcaacgatc aagctgatcg     84600
     ccttgtctac gactgcatgg ggcagatgct catatcggag cgcagaaatg cgatttgcga     84660
     gtttcagtgt tagcgacccg cactcatcga cgaaaatcat ggaagcgccc tggccattgc     84720
     gagaggtttc tcaaaacgcc ctgcgggccg ccccaaaccg agatgatcgc gaagagtgtt     84780
     gccttcataa tcgcgtctga ataagtcacg tctctgcaat gccgggatga caagatcgac     84840
     gaagtccgtc agtccaccgg gaaagcttgc aggcataata ttgaagccgt cagctgcgcc     84900
     ctgcttgaac cagcgctcca tctcgtccgc gatctcttct ggcgatccga tgacgacatg     84960
     atggcctcgc gccgccacga ccctgagata gagttgccgg atgctcaggt tttcccgatg     85020
     ggccagatca atcaacagct gccttcgtcc cttcgggcca tttgtctcgg gaatatcggg     85080
     cagcggacca tccaagtcgt agtttgaaag gtcgacctcc cccatggtcg tcgccagcgt     85140
     cgccagtccc actacgggat cgaccagatc ctgcaaagca tcgaattttg cgcgtgcttc     85200
     ttcggtggtg cgtccaacaa ctggaaaaaa gccgggcatg atcttgatca aatccggatt     85260
     acgtccgaac gctttagaga ggttcttgac gtcggcgtag aactcctgcg cgccggccaa     85320
     tgtctgttgc gcggtaaaca caagctcggc ggtgcgtgcg gccagacgcc ggccagcttc     85380
     ggacgatcct gcctgaacaa gcacgggata tccctgtgga gatcgtgcaa tattgagtgg     85440
     tccgcgcacc ttaaaattag ccccggtatg atcgagaaca tgcagctttt cggggtcgaa     85500
     gaacaggcct ttttctttgt cgagagtgaa cgcgtcgtct tcccagctgt cccaaaggcc     85560
     gcgcacgaca tcgataaatt cctctgcccg attgtaacgg tcgccatgct ccgcgtgggc     85620
     gcttcgcccg taattctgtg cctcggcttc gttgttcgac gtcacgagat tccatccggc     85680
     acgtccaccg ctcaaatgat caagcgaggc aaattggcgg gcaaggctga aaggctcgct     85740
     ataggtcgtc gtgacggtgc cgaccagccc aatctttgag gtagacgccg ccaaggccga     85800
     caaaagagtt atcggctccc aaccgacggc cctcgacgtg cgccgaagag cctctatatt     85860
     tgcggcgccc cgaacagcca gagaatcggc gatgaagacg agatcgaaca ggcctcgctc     85920
     ggccgttcga gccagctcga cctgatgttc caggctgaac gctgcgcttg catccgcctc     85980
     cgcaagtcgc catccagcaa tgtggtgccc ggtttcctgc agaaaggcac caagtcgcat     86040
     tttcctggtc acggtcgaca ctccctcaac gctgcaaagt cgaatcgaat gtgacgccga     86100
     gctgtgcttg accaatgatc tgcgcggtac ggtcgtgccc ggcgtgaacg acatgggttt     86160
     cgagattgcg gaccgaccgg cccagcggat gctcctcgaa ttgcgcggta gcgcccgccg     86220
     tatagaggat cgaccggaca acgtcgaaag cggcgcgcgc ggcaaaagac ttggcactca     86280
     tcgatcgcag ttcagcctcc accgtcgatt ttgtgctcca gcttcgaact gcttcctcga     86340
     agagggcgct cgctgcatcg agctgcagct tcatctcgcc tgtccgcaat tggatgatgg     86400
     gatcctggct cctgttgcgg gttctcgtat attgaaggaa ccagtcaaac aggccttcgg     86460
     cactgccgag atagttcgcc gcaaagccaa gatggaagcg cccctgccag cgctgacgag     86520
     caaaagcccc gggttcaccg agcgcgtgaa tgtctggaac gaagacatcc tcgagccgca     86580
     tgattggact gcgggcggaa cgcatgccat gcggtcggta ccagtcatcg tcaaacgtaa     86640
     caccatccat tcccggctcg atcaacatca tctggaggtt gtcgaaatag ctgctggcgt     86700
     cgtccagcgc gacggaggtg atgataatgt ccgcagcgcc accattggta acgaagtttt     86760
     tgacgccgtt gacgataaag ccgccatcga cttttctggc acgggtcttc atctcgtaca     86820
     tgttgacgcg tcccggctcg cttcccaccg ctgcaaacag gctgaacttt tccagattgg     86880
     gcttcaggaa gcgctcgatc tgagccggcg tcccgacggt ttcaagctgc cagagcgcgt     86940
     gattatgaag ttgatagcaa tggccggtcg gactgtcgcc gctgcagact gtccgcagaa     87000
     gctcaagaaa gagccctggt tcttcgcctg tcaagctgcc gcctcgccct ccgagcgatt     87060
     tcgaagcaga tgcatgccag aggccgagat cataaatcgc gcgaaggctt ttgaacggaa     87120
     tgacaccgtc acggtcggct atgactcctt cctcgcggaa aagcgtgttg gttaactccc     87180
     gcagttggtt gattgcctcg tcatgaagtg gcttgatttg aacttggggc ataagatctc     87240
     caaaacgtgg ctgaatgtga gaaacatcgt taggtgtcga gcacggacga atgaaataga     87300
     gaggccaatg gaaggggttg gtgcagcagc gtctgatcca ccatgtagtc ctgaaaccaa     87360
     cgaacattgt cggcgttcgc tgcaagtccc gacggccatg gatcagggcc aaactctgcc     87420
     accgctgctt gataggcagc acttccaaac ggcatcaatg tgtaggctgg atcctcatag     87480
     gaacggcaga cttttgcttt tgcgtcctcc cacgcttcga taaggtagcc tggcaagccc     87540
     gcgaatttgt cggccgtttc ttgccgaata atgagcaggt gcatgatcgg aaaagcgccg     87600
     cgggcgcgaa aataagccgc cgcctctgcc tggcgatcgg ggaagagcgg ccggaccgca     87660
     tcatcggtaa ggagtaaaac cggagggcgg ggatcgatgt aggcgtcgac aaggccacgc     87720
     cggagaaggt ccacaccttt tgttccggcc gccatgcgct cgatcgacag gtcctcgcct     87780
     tgccaggcaa tctcttcagc gtcctgaacg acccaatgga tggagcgcca cggcacgcca     87840
     tagagactgg cgagatcacc cttggcgaga accgaaagcg tgacttggaa tgagcgaatg     87900
     gcaacccttt tgccgatcag gtcgcgtggg gttttgatac ccgacgtgac gtgcacgaaa     87960
     atatggttct ggctgaacag ccgccgagga aaaaccggga ccgccgtgaa ggccgcgcct     88020
     tgagcgcgtg ccatgatgta ggaggcgagt gatacctcgg cgatgtcgaa ttccctatcc     88080
     cggagcatgc gaccatgcct gtcgccgccg tcacggccgg gtggattgat gccgacatcg     88140
     agggctttga gggaaaaatt cggatgttgg ggaagccagt tcatgaagaa cgggatgtgc     88200
     cgatcaaaag aggccagcgc gatggtcaat gaggggcgtt cgtccgtcat ggggcaacct     88260
     cgtcagaaaa caggttgccg gcaccacacc ggatggccca gttgcgccaa acgcgtggtg     88320
     tcgcgcgcat gctgcccatc cgcgcaatgg ccgcatccac ctcgccttgc gtcagaaagg     88380
     tgatggtccc gagcgctgag gcttcgcgtt gaaggcgcgc gttgaccttc agataatagg     88440
     aggtgcgaac gacgtgttcg agggaaatgc ccgtcgcggt aaagccatgt ccgcgcatca     88500
     ggacgacacg attttgcgca aggcgcgcgc taaggtcgtt ggcgtgatcc atggtggtca     88560
     caagaagatc tgtatcccca aaggcatcgc gcatatccca gacggggata tcggcaccga     88620
     taatcgcagc tacgtgcaaa accggccgca gcctgacgtc ggtcaccgta aaaggcagga     88680
     cttcctgcgc gtggccgtgg acaacggcgt gtacgtccgg tcgatctcga tagatcgcgg     88740
     cgtgaatgac ccgctccgag tagagtgctg tcttcgtcgc ctcgaccggc tcccccctcg     88800
     tatcgaaagt gaggacatca tcggtttgaa cctgctccgg actaaccgac cgcgataaga     88860
     ggaaacgatc gttcctttcc ggatcacgaa cgctgacatg accgtagctg tcaaccactg     88920
     cctcatgggc gagaatgcga ttggccacga ccaagtcccg aacaatgtct gcctttatga     88980
     ccatgtgcct agcccagaac ttcttttgcc agcgcaaagg ctttcaacgc cttttcggcg     89040
     ttcacttcat tgttaaaagt cagcccttcc cggaagctcg cgtcactaag tgcactcact     89100
     tcaaggccgg gtttgacgtc ggtacgccgt gaattaacga aaccgcggcc tgcccagtca     89160
     gcctgagccc cttgcgacag aagccagttt acgaagacct ttgccgcgtt ggggtgcggt     89220
     gcattgtgta gcaatgcgac cgcaccccaa ccgggcgtcc aggctgtctg gttcgggggc     89280
     gtgctgagcg cggttacttc cttcgccaga ccattggcct gaagctgggc gatttccgaa     89340
     gggctgaggc cggaagtgat ggggtaggca cctgccgcga tccagtcact cagttggcga     89400
     ttggaagatg caagggttgg ctgttgctcg gttaagaagg cacgcgcctt gtcctctcca     89460
     agcaccgtca gaagcagtgt gacgaggtgg ccgctaccgc gtgtacgcgg atcgaggata     89520
     gcaatctttc ccttccactg cgggtcgaga agatcctcga gccggctcag gcttgctttc     89580
     ggtattttgg cgcgatcgat gttgaggttg ttctgcttgc cagcttggaa cgcgtagaaa     89640
     tatttcttgt ctctgtcgag gaatccgcct tcgaagccgc cgagccaatg ggtatcgtca     89700
     aggatatctg gttgcgtgat cagcgatcga acagggtcga accaccctgc cggaatctgc     89760
     tcggagaaag cgctgccact aaagccggcc accatgatat cccagaggta ttgcttgacg     89820
     cgccgctcgc tgcgcaaacg tgcctcgaaa tccggcgagg agccggcggt atattccagt     89880
     ttgatcttcg ggtaggcttt ctgaaattcg agaatggaca gccggtacgg ttggatgggc     89940
     ggaccgagta ccgtgagcgt accctcagtt tccgcagcgc tcacaatgtc gttccaggcg     90000
     ttggcggctc tgccaattcc ggcgaaagcg gcgagcgcag gcaatgcaag agctgtcatc     90060
     gagaaatgtc ggcgcgaaat cagtctttgc ttcatcggat tctctttcat gatctaatga     90120
     tggtcgggga actcaaaaac cgcacaatga cctcagttcc ggggccaagg acagcagagc     90180
     gggattgata agcaagtagc ggttccccgc cgtagaggtc gacgacggtc tcgaaacggt     90240
     ctccgataaa ggtcacttcg cggacacgac cggccagatc gtcagcttgc gcttccggcg     90300
     aagccagaca gagaacgatg tcctctggac gtgcccataa ggaaatggac gttccaaccg     90360
     aaatagcgtt tgcttcttca tctcgaaccg aagtcaactt gccgcctttc aagcgaacct     90420
     ttagctccga tccgttctcc tggattacct tcgcactcag cgacgaagat cgcccaacga     90480
     aactgcggat atagtccgag gcgggacgct catagatttc ttgtgccgta ccgatctgct     90540
     cgacacggcc ggcgcgcatg acggcgacct gatccgaaag ggtgaaagcg tcgagttgat     90600
     catgcgtaac aagcacgatc gtcaatccaa ggcgttgttg gatgtccttc agttcacgtc     90660
     gaagctggga tcgcaaactg acatcgaggt tgctgaacgg ttcgtcgagg agaaggagct     90720
     ttggctccgg cgccaaggca cgcgccatcg cgacccgctg ctgctgaccg ccactcagac     90780
     gtgttgccga cctctgctca aagcccgcga gtccgacgat cgcgagcgtc tgtgacacac     90840
     gttcggcaat atcttgccgc tttagccctg cccttcgcaa tggataagcg acattttgtc     90900
     cgacggtcat atgcggccag atcgcgtaac tttggaagac caacccgatg ccgcgatttt     90960
     gcggtggcaa caagtgccgg gctgcagtgt ccacccaagt cgcgccgtta aattcgatcc     91020
     gaccaccatc agcagtttcg agacccgcga gtatccgtag caatgttgtc ttgccacagc     91080
     cgctatcgcc cagaacggtg aatatcttcc catcctcgat cgacacgtcg acgccgtcaa     91140
     ggacagtgcg gccgtcgaat gatttcttca atgactggat cgtcagcatg gaaaaccctt     91200
     atgcatgagg cgcgatccgt gaccctagcc tgcgcgcaag cagggccgcc aaaacggcaa     91260
     ccgctacgat cacgacgccg acgactgcag cttcttcctg gtgtccgtcg atcatatatt     91320
     cgagctgcaa tatcgataat ggccggttgt cactgctgac caaaagtgcc acgtgactaa     91380
     tattgcgcgc cgcggcgatg aacgacatga cagcgacgac ggcgatagag cgagctgtca     91440
     gtggcaagac aattcgccat aaggtttcga aggtggacgt gccgccgacc caggaagcct     91500
     cttcgagttc acggtgaatt tgcgagaggc tgcctttgat aagctgcacc ccgagagtga     91560
     gcgtggagag cgtgacggtc acgatcaagc tcaccgtcga gccataaagg tatgtcgaac     91620
     cgctttcgag gatgagccaa agcatggcaa gcgacagcag gatgcccggt accgtgaagg     91680
     gaacccagga cgtcacatcg agaatgatcc ttgcggcacg ggaggagcga acgaccgtat     91740
     agccaatggc gatgctcacg atgacgcagg cgaatgtgca gcctatggca agaacgagcg     91800
     tattggcgaa ggatgacagg aagactgggt ctgcaacaac gccggtccaa tgacttgttg     91860
     tccagacact ctccaaagaa aagaagccaa acatcgtcat gacgctgctg gcaatcagga     91920
     atgcgacagg catgacggtc aaaagcgcgg cgaatgttgc cacaaaaatg aaggctggta     91980
     ttttccaagg cccaagtgtg atccgcgctg gtttcgagtg acccgatacc gttaccgcgc     92040
     gtcccccgct gccaattctg accgaaagca ctgccagcca ggctagaacc gaggtgatag     92100
     aaatgccaag cgcactcgct cctgcgaaat tgatcggatc gttgcgcgtg aggtgataga     92160
     taagggtgct gtagacctca atccgcctcg gcatcccgag tacaagctcg atttcgaacg     92220
     attcgagtga gcgcatgatc ccgatgatgg cggcaacggc gatagccggc gccagcaccg     92280
     ggatcgttat cctgagaagc gttgcaaagt ggccatcgcc tgccacgcgg gcggcctcct     92340
     caagacggga atccatgttc tgaaacgtcg gcgtcaacat catcaccttg gccgagatgg     92400
     ttgtcgtgac gaggtgagca aagacgatgc ccgtccagga ataaatgtcg aacacaggtg     92460
     cgcttggccc gaagaaccgt tgaattgccg aattggcaac gccgtagtgc ggatcgaaag     92520
     ccaatatcca accttgcagc accgcaagag ccggtaggaa aaacgaaatc cagaaacaga     92580
     attctagatg acgccgtccg ggcaaatcgg tgcgtccgat cagccatgca atgaagattc     92640
     cgattgggag ggccaaaagc tgtgtcgcta gggtcaggcc gacggtattg acgacagcgg     92700
     acaaaaacat cggctcggcg aatacctgcc gccacgcgtc gaggccgaag cgggtgtcgt     92760
     cactgcccgg tattgcgatc tcgaagctgc cgcgcaggat cgcggcgacc ggagcaatca     92820
     tcgccattgc aaaaagcata gtccaaagcc agaagctcac tgatgagggc atgcgcaggc     92880
     gcaactctcc tgaactgatg gcttgtcggg atctcgattt atttagtgtg ccgtgcatac     92940
     cctgtttcaa tctaattgtg cgactgccgc acacatgttc atatagtgaa ataaatacca     93000
     tagggtgatt tgcgcacaca ggcaaaagcg cacaaattta gtggactatt tagaatgtta     93060
     ttttcccaag tcgccgcgcg atgtagggag gcacctgaca agaattgaag cgagataatg     93120
     atgaccgaag acgaaagcac gttcgtgaga tcaatcgcac gtggtttgaa ggtgatagag     93180
     gccatgtcgg ctgtgcagga cggcttatca ctttccgagg ttgctatgcg agtagacctc     93240
     gaccgcgcga ctgcgcgacg catcctgttg acccttcagt cgctgggcta tgtacgacag     93300
     gctgagaaac gcttttccct ctcaccgaag gtattgggtc taggctacgc ttatctttca     93360
     ggcaccccgc tctggagcgt atctgccccc tacctgatga ctgcggcaac tgcgatcagt     93420
     ggaagttgtt caattgctgt gcttcagggc agcgaggcga tttacgtcgc ccgccaaacg     93480
     agtggaaaac gaagcttggc ccaatcagtc gagatcggca cgcgcttccc tctctattgc     93540
     acctcagcgg gcaaagtgct tttaactagg ttctcagacg atgagtttca ggagtacacg     93600
     gctacgacgg aactcaacgc atttacgacg cggacaatca cctctgcgcc caaacttcgc     93660
     acggaagtcg agcacgtcag gaagcaaggt tgggctatat cggaccagga atacgaagac     93720
     ggcgtgcgct cggttgctgt tccgattctc gatgctactg ggaaaactgt cgcggcgatg     93780
     gttgcgagtt cgcaggccag tcgcctcgtt gatgacgact ggcgggctat tgctgacgat     93840
     caccgacgaa tcttgattga cgctctcgag ccgcttgcgc ctctctggtg ggcgcagaca     93900
     ccagtcaggt agccctccgg cttaggtggt tcgtggcccg ccgccgtcga caaccaggtt     93960
     tgttcccgta atgtgacgtg cgtcgtccga tagaaggaag aggattgcgt cggcaacgtc     94020
     gtccgccgtc cctgcggctc caagcgctgt gctcgcttgt ggcattcccg ccttctgcat     94080
     cacttccaag cgttcggaga cgattggccc tggagagagg gcattgaccc ggatcccatc     94140
     tggaccaaat ctcgttgcaa ggccctgggc cagtaaaatg agagccgcat tgaccgacga     94200
     tcccggaagg tgttgcggcg aagcgcgcaa gccgcctcgc ccactgatca gcacgatgct     94260
     gccgctgccc ctggcgatca tatagggcag tgccgcgcgc accggccgca ccgagccgaa     94320
     tagctttgca ttgacgaccg acgaccaatc gtcatcggta agcgccagaa aatccccgaa     94380
     gatcggtacg gtcgatgccg tcacgacacc gtctattcgt ccaaaatttt caacaatcgc     94440
     cgtcgccgtc gttctcacgt ccaaattgtt ggtcacatca gcctgcatcc aaacgacgtt     94500
     gtgggtctcg gaaaggacgt cgcgctggcg agaggatgca accaccgtgg cacctttcag     94560
     tgcgagttgc ctgacaacag ctgcgccgat cgtgccgctc cctcctgtga cccagatgac     94620
     ttttccgaca aattcactgg ccattatcat tttcctttga gctgatcgac aggactgtcg     94680
     aaatcgtgcc ctatcccgtg cctaattgac gtcacgaggt ggtacatcgg tttgctgccc     94740
     caattaatcc aaccacctcg actggagccc accccaagac atctgagcgg tattgcaaca     94800
     ctgctgcggc ttggagtggg cgttgcatta gtctccattc ggccggaaga gcggcggcag     94860
     cattggcgcc atccctacgg gctaaagcaa cgaggtgtgg ggttgcatcg aggacagtaa     94920
     tgcacattcc aaaacgagct cttgcagctt cagcctgagc gatggagata agggactcgg     94980
     caactgcggt attcaaaaat accttcctgt ttcaaacgag cgttaacata gcgaggaaag     95040
     ataagaatgc aattaaacat atataaatta tggattattt ccagcgctta acgtcacgac     95100
     agctcggaag ccattttttg gcctcttcgc cgcattgctt gccatggttg ccacaaagaa     95160
     gcgtcgaact cgacagcata cggtgcttcg gttgctggcg tcacatgcgt cacggcaagt     95220
     gaatatgaaa gttgccgctc actcccctcg actaaagaga atgtaaagcg gaagatcagg     95280
     tgcgccgaac atacgggcgt attctcgatt aaattaagac gcgcttggat attcgacctc     95340
     aaaagctgcc gacttcgcag gcagttcacc gcaaagcaac aatcgccgga ccttccatcg     95400
     agcgcgcgat ccccatcggc cgacatcctt ctgcgacgga gacgccgcag ggccggcgat     95460
     aacggatgta gtcacttttc tttgcagcgg tgcgcttttc agagcctttt ttggaactct     95520
     gcttccagag cctgtttgcc gacaaggcgc ctgacccctt cgcaacataa cgcaatgtca     95580
     aaagacacac cgcaacacag acctgaccga tagtgcatcg tcacgagtcg ggccgtcaca     95640
     ttcggcagcg ccctctccgc ttcaaacaaa gatgggtcgt ccttatgcat atcaaggtat     95700
     tcgttctcgc cgccttggct ctctcctccg cggtggccac gaacgccgcc gacatgactg     95760
     ccgatcaatc agcaccgcag ccggagcagc aagcctattc ggcttacaac tggtcgggct     95820
     tttatctcgg cgcgcaggga ggatattcct ggaacaaggc aaaatatctc ggcgccgatc     95880
     agagcctcaa taccggttcg gccggagcgc atgtcggcta taacttccaa accggaaaca     95940
     tcatttacgg tatcgagaac gacttcaact acaatttcga caagggcaac aaagcagatc     96000
     ttcagtggga tgcgtccggc cgcgcccgcg ttggctatgc cttggatcgt acgctactct     96060
     tcgcaacggc cggtctcgct gcagcgggcg gcaaggtcga tgctccggcg atcggaaaga     96120
     aggatgatat cctgatcggc tggacagccg gcgccggtgt cgagcgtgct ctaaccgaca     96180
     atatcctcat ccgcggcgaa tatcgttatt ccgatttcgg caagaaggat tttggttcgg     96240
     atatcggaga tttcagcgcc actcagcaaa agataatcct cggcgccagc tacaagttct     96300
     gagaagaaca atagcctggt tttcgcgcag taagcgcgga taagttgcga ccaaggtgaa     96360
     agcgcttttc gagcgtttgc cttggtcggc gacagtaaca acgttgccat cgagaggatc     96420
     gggactacca tccacggcgt tggtacacga atcgtttagc ggtcgtggtg taggcgaaag     96480
     ttgaggcggc gcgcactacg cgaagcattg tcaagacggg cacattagcc aatagcgtac     96540
     gaagcgcgtg aaattgctgt tgtagacatc cggatcggct tcctcccatc cagacagccg     96600
     cgtcggcctc acgccgtgcc gggtcctgac gtacgttcca gatttcttga gtatccttgg     96660
     aagccaacag ccgtccaaaa cccaaaccct ctcggattgg aatccagcac ttcgagtcgg     96720
     acgaccatcg gctccttgaa acgctcagct agtaacagtt caatcgcagc gcggccaagc     96780
     ccggcccccc tgctcttgcg cgcaatgaag aattgtcgga ggtaagcacg cctgcctgca     96840
     gacaatgtgt catccctctc gatgcggttt cgatccttgt agggtctgaa atcgcaggca     96900
     ggcgggttct tccggttggc cttcggcgga atgaccggcc tgatcccatg gatcagcagt     96960
     tcttcgcgca ggaaattgcc gtcgtatccc ttgtcggcaa gaaataacct cggtttgccg     97020
     actggtatcg ccagtagatc aggaacagcg ctgaagtccg aagcttcgcc gcccgtcagg     97080
     atgaagccga gaggacgtcc ctgaccgtct gcgcgggcgt ggattttcgt cgtaaagccg     97140
     ccgcgtgatc gaccaaaacc ctcctgataa atcccccttt agcgcccgct gactgagagt     97200
     ggccgcgaac ggtggtgctg tcgatcatgt gctgccagtc atcggtcagc cccaactcga     97260
     caagcgtttc aagcagcgcg tcccaaacgc cttgttcggc ccaacggcga aagcgcacat     97320
     agacggaatt ccactttccg tagcgttcgt acatgtcgcg ccaaggacag ccgacccgaa     97380
     gaacatgcag catgccgttc agatatcgtc ggttgtcgtg tgcggggcga gactttctcc     97440
     cacgctcggc gggcaatagt ccctcaatga tccgccattc catattcatc aggtcgccgc     97500
     gcgccaaaac tgcctcctaa aaggcagtct tgaatcatgc tcctgctgat ttgggaatcc     97560
     actttgtcaa cagacctaat ctgaggcgtc aagggtgtgt tcggcggggg cttacggtcc     97620
     cctggtttcg ttatttcttc ttcccttgat cgtgatgcca cttgatggcg aagaacatgc     97680
     ccgtgcctaa cacgagaacc ttgaacgtaa tgaagactat agggaaccaa tccatcattt     97740
     tgaatatttc caggctatta cttgacacta tctatcgtga gatagcacta tctcaaaact     97800
     gctgcttcag cagcttcatt ttttgttcaa atatcgtcaa atctaacttc gtgctgattc     97860
     cgacgaagcc tctccttttg tcccgagccg cgccacagcc atttggctac caattcctca     97920
     tggctgcctc cttgccgaac gagtcgaaat cctcaacaat cttcccgcaa aagattctgt     97980
     cagccttcaa acgtaatctg cagcttgacg tcgctcggcc gtgcttccac ggctcgatcg     98040
     aaggcttcga tcgattgctc gaatgtaaac gtctccgaga tcagcggctt caggtcgacc     98100
     cggccggagg cgatcagcgc aatcgagcgc tcatattgat gggcgtagcg gaagaccgtt     98160
     tcgatgcgga cttccttcgt cgaggcggtc gagacatcaa agccgaccgg ggcgaccggc     98220
     aggccgacgg cgacgataac gccgcccgga cgcggcagct ccatcacggt ctcccaagcc     98280
     ttcggcgaac cggagcattc gaagacgaca tccgcgcccc aaccgtcggt caggcgcctg     98340
     acctcctcga tcaggttctt ctcgcggatg ttgacgggga tcacgccctg atactgcgca     98400
     gcgatatcga gcttcggctg ggcgagatcg gcgacgatag cacgggcgca gccgccggcg     98460
     agggctgcga tggcgaccat ggtgccgatc ggccctgcgc cgagcacgac ggcggtatcg     98520
     ccgggtgtaa tcttcgcctt ggccgccgcc tgcatgccga ccgcgaaagg ctcgaccatc     98580
     gcaccctccg caaagctgac attgtccgga agcttgaagg tataattggc cgggtgcacg     98640
     acaaagggcg tcagcacgcc atggatcggc ggcgtcgccc agaaggtgac ggcgggatcg     98700
     acattgtaca tgccgaggcg gctcgccttc gaattggcat cgggaatgcc gggctccatg     98760
     cagacgcggt cgccgacctt cagatgagaa acaccggcac cgacttcggc caccgtgccg     98820
     gccgcctcat gaccaagcac catcggcgca ttgacaacga acgggccgat gcggccatgg     98880
     gtgtaataat gcacatccga tccgcagacg ccgaccgtat ggatcttgat cttcacctca     98940
     cctggtccga cctcctgtgg caggtcgatg tcacgaagct tcagttcatg ttggcgttcg     99000
     agaaccaatg cgcgttgcgt cgtcattttt attgatccgt ttttgatgtc caaggtgtct     99060
     cggaggaagc ttttgcgaag cgctagttga tcgcgaatcc agaatcgatc ggcatcgaaa     99120
     ctccgttcac catggccgcg cggtcggaaa gaagaaaaag cacgacctcg gcgacctcgt     99180
     tcgtctcgac gaagcggccc agcggcatgc gggccaacat cggcccggct ttctcggggt     99240
     cgctccacgc cttctttgcc atatcggtca gcgtaatggt cggattgacg cagttgacgc     99300
     ggatgccatg ccggccgagt tcgttggcca tgacgcggct catggcatcg agcgcgccct     99360
     tcgaggcgca gtaggcggcg tggtcggcaa agcctgtggt agccgacgcg ctcgacacgt     99420
     tgacgatggc gccgccagcg cccagagcaa tccgggaccg cgcatactct tgcgagacaa     99480
     tcaatggcgc acgggtatta acggcgatca gatgatcgaa cgcctccgtg gtgacgtcga     99540
     cgaaggcttc aagcgtcgtc gtccccgcgc agttgaccag atagtcgacg ggcatcgcgg     99600
     cagcagcggc agcgcgcgtg gcgaccgcat cggcaagatc gacggcaata gagcggctgc     99660
     cgatctcggc ttcgagcgat ctcaagtctg cttccgagcg gctgagcgcc accacttgcg     99720
     caccacggct tgcgagcatc tgcgcgaccg tgcggcctat gcccttgccg gcgccggtta     99780
     ccagaaccga ttttccagaa aagtccatcg aagtcatgtt gtcagctcat ctctcttttg     99840
     ctgtcaagtt ttgcctggag gatgacgacc accagaagga agccaccgcg aatgacggat     99900
     tgccaataag ccgacagcga aatccatccc aggccgtttt cgaaattaag gatgttaaag     99960
     accaagccaa gcagcagggc ccccgccagc gtggcgccga cggaaccagc tccgccggtc    100020
     aaaagcgtac cgccgacaac gaccgacgcg atagcaaaca gctcccagcc gacgccttcg    100080
     gtcggctgtc cagcgccgaa ttgcgcggcg agaatgaccc cggcgagacc agcaagcgcg    100140
     cccgaggcca gatagacgat agtgagcgtg cgctcgacct tcaggccgat gagtgcggcg    100200
     atcccctcgc cgtcgccgat cgccagcaca tgacgaccag cgggaaaccg ttccagcacc    100260
     agccagccaa cgatgtaagc ggcaagcgcg atccatgcgg ggatcgggaa cccaaggaaa    100320
     tcatcctggc caatcatcgt gaaaccggtg tcataagaca ccgaaaccga ctggttgtca    100380
     gccaatagca gcgccgtgcc ataggacgcg agcatcatcg ccagcgtggc aatgaagggc    100440
     tggatgcgca tctttgtgac gaccaaacca tttaccaggc cggcaagtat gcccgtaccc    100500
     acgccgccgg cgagacccgc ccaccatgaa tgggtcgata gcatcgccgc gaccacgctg    100560
     gagcacgcgg caacaccgcc gaccgaaaga tcgattccgc cggtgataat gacgaaggcc    100620
     atgccgagcg cgaccagcgt gaacatcgag ttgtaacgca ggaaactcaa tatattgaat    100680
     gacgacaaga aattgtcgta gcgcagcgca ccgaacagga taagtgcggc gagcgcgaac    100740
     aacacaccaa ggcgggcaag atcgccggag gatttcggtt tcagcaagtt cagcatctct    100800
     gctcctcaaa tcctgtctgc gcgctgctgg atgaagaccg caatcacgat cagtccggcc    100860
     ttgacgatga gggcggcggc gtccggcacg ccattggcaa gcaatgtgta acggacaagc    100920
     tggataacaa gtgcgcccat caatgtgccg ataatgttgg cgcggccgcc ggtgagcaac    100980
     gatccgccaa ccgcgacggc ggcaatggcg tccagttcca tccccattcc gacaagattg    101040
     gcatcactgg cggaatttcg agcaaccacc accagtccgg ctatgccggc aagcgcgccg    101100
     ctgatcatat aggcgacgat tttgatgcgg cgaaccggaa tgccggtcag tcgcgccgct    101160
     ttttcgtttc cgccaacagc aaggatctgc cggccgatga ccgtgtagcg gatgagcgca    101220
     taagcgaggg cggcgatgac gagcatcagc accacttgcg ccggaatacc gaaaaagttt    101280
     cccatcgcga tgaactggaa acaggggttt ttgaacacct gcagattgcc gttggtcatg    101340
     acctgagcaa cgccacgacc ggcaatgaac agaacaagtg tcgcgacgat cggctggatg    101400
     gaaaaccgcg tcaccagcag cccgttgaag accccgagca aggctgcgac gacaaccgga    101460
     atcacgaagg cgaggccgac ggcgagtgcc atattgtcga tctggaagac atcccccatg    101520
     aagatcatcg gcgccagcgc acccgagatc gccatcagcg agccgacgga gaggtcgatg    101580
     ccgccagtcg aaatgaccag cgtcattccc gtcgcgacga tgacgatggt cgccacctgc    101640
     gtcaggttaa cgttgaacgt ttgccacgac agaaaatgcg gcgtgaccat catgttgaag    101700
     atcaggagcg cgatgaaggc cgcaaacgtc ccgtagcggc tgagcatcac cagaggcgat    101760
     gccttggctc gtcgggtgtg tttgagagaa gatgtatcgc tgactgtcat gtcaattcac    101820
     ctgatgggcc atggcggcga gcaggctggc ctccgacaga ttttgccgtg gcaactccgc    101880
     aaccgacatg ccgtcgctca agacaatcac gcggtcggct accgccaaca gttcttcaat    101940
     ttcggaggag atcatcagca cgctgagacc ttcgtcggcg aggccgcgca acagcttgag    102000
     aatttcagtc ttggcgccga tatcgatacc gcgtgtcggc tcatcgatga tcagcacccg    102060
     cggattggta cagagccagc gcgcgagaag cactttctgc tggttgccgc cggataattc    102120
     cttgatcgcc tgctcgggcg aagcgcattt gatgccgagc gatttgatga agcgggcgac    102180
     gatctcgtcc tggcgaaccc ggtcgacgac accgttcttc ttcagctttg gcagcaatgc    102240
     gagagtcata ttgtcgcgaa tgctcatgtc agggataata ccatcaacct ttcggtcctc    102300
     tgacacgagg ccgataccat cggcgatcgc cgcggccggt tcggaatagc gtctaggctg    102360
     tccctcgaac tgaaggcttc cgcgttcgag cttgtcgaca ccgaagagta tgcgggcggt    102420
     ttcggtcctg ccagagccga gcaagccggc aagtccggtg atttcaccct cgcgcaaaga    102480
     aagaactacc tcgcggacgc ggatgccgtg cccgccattg ttcagctgca gccggattgg    102540
     cttgtcgttt ctcacgtcga tatcccggcc tattgcctcg aaggcagcaa gctcgcgccc    102600
     gagcatgttc tggaccagat ccatcttcga catgttggcc agggggccag ccgctaccgt    102660
     tttgccatca cgcatgatcg tgacacgctc gcaaagggca tagagctcat ccagccgatg    102720
     gccgatgaaa cagacggcaa ggccgttctt ctgcaacgtg cgaatggtct cgaaaagcac    102780
     cgccacttca cgctcgtcaa gagaagacgt cggctcgtcc ataatcaaca gcttggcatc    102840
     ctgcatcacg gcacgggcga ttgccaccat ctggcgtgtg gccgcactga atcgcgacac    102900
     gggcatctcg acatcgatat cgagcttgaa ctgctgaagc accttacgcg caccgtcgcg    102960
     catcgctctt cggtcgagaa accccatttt gcgaggttcg cggcagagat agatgttctc    103020
     ggcgaccgag cgctgaggtg ccaggttgat ttcctgataa atggtggcga tcccgcccgc    103080
     ctggctttcg gccggggacg agaaggagac agccttgcca tcaaagtgga tcgtaccccc    103140
     atcgcgctga taggctcctg taaggatctt gatcaatgtc gatttgccag cgccgttctg    103200
     gccgacaagc gccatgatct cgccttcacc gatttccaat gtgacgccct gtaaggccga    103260
     cacaccggcg aaggatttca taattccctg catggagagc aacatgcttg tccatccttg    103320
     tgcgcacttg ctgaagggtc cggccggaag gactgacctt ccggccggtg gccgaagcaa    103380
     gcatcgagac gctcggtctc gatgcctaac cctgggaggt attcagtatg ctccggccaa    103440
     ttcgttcttc gcgttagtgc catcatagaa tttgtcgatg ttcttgaccc agggctcgat    103500
     cacctcgccc ttgccgtaac gtgccatggt ctcaaaggcc ttcggtccaa agcgcggatt    103560
     gcattcgacg acggcgccga tcttgccttc cgcaacgagc ccgacagctt ccttgccgcc    103620
     gtcgatcgac agcacgagaa tatccttgcc cggaaccttg ccggctgcct cgatcgccga    103680
     gatcgcgcca attgccattt cgtcgttatg ggcatagatg atatcgacgt ccgggtgggc    103740
     ctgcagtagg gcttctgcaa cctgacgacc cttatcgcgg gcgaaatcgc cggattgcga    103800
     ggcgacgatt tcgaagccac ctgccgcctt gatggcttcg tcaaagccct tcttgcgatc    103860
     attagccggc gaagatcctg tcgttccctc cagctcgatg atcttcttct tgccgttggc    103920
     attctttgcc aaccattcgg caatgcgctt gccttcgtcg acgaaatccg agccgataaa    103980
     ggtcacatag tccttgccgg gcttggcaag tgacggatcg acattgcggt caagcagaat    104040
     gaccgggatg cccgccttct tggcggccat aatggccggg atcagcggct tttcttcgcg    104100
     cggcgcgagg aagatgatgt cgacaccctg cgcgatcatc gagttgacgt cagccacctg    104160
     cttggcggcg gaactggcgg catcggtgta gaccagctga taaccgagct ttttggcttc    104220
     gtcctgcatg cttttggtct cggcgatacg ccagggattg tttgattcgg tttgtgcgaa    104280
     accgaccttg tatatgtctt tcttcgcgag cggcggcgcg gcgaaagcta ttgtgctcac    104340
     gagggccact gccgaagcgg ctaccgaggt tgtcaaaaga ctgcggcggg taatcatgat    104400
     tgcgttctcc tccaagaaag ctgcgcggtt cgcgcctcgg cttgttgccg atggcgcact    104460
     cttgcggtat tagtaattga aagtcaataa ttagtaattt cgatttgtaa ttaatttgta    104520
     gtgcgcattg cagggacata tcttgacagc aatggcggcc agcacgtaat tcgcaaattc    104580
     actcggatgg aaaaattggc aaaagctgac aacccaaacg atctcatttc cgcttcaccc    104640
     aaccggcgca agagcagccg cggtgacggg cgtgtcacga tgaccgacgt cgctctcgag    104700
     gctggcgttt cgcagaccac ggtctccttc gtgcttggac agaccgccgg cagcaaattg    104760
     ccgcaggcga cccgcgagcg tgtcatcgag gcggcacgca ggcttggata cagcttgcca    104820
     gatcattctc cttcgcggct ttcggttgcg cccacggtgt cgggaactat cggtttcatg    104880
     gttgatcagc tggcgaccac gcacgatgcg gtggtcgcca tagaaggtgc acgacaggcc    104940
     tccctcaatg gtggcaacat cctgttggtg gcgcagatgc ctggagatcc ggagacagaa    105000
     gcgcgcacga tcgaggcgtt gactaaggca gacatttccg ccctcattta tatggctatc    105060
     ttcacccgag agttggtcgc acccgcctat ctctatgaac tcaaaattcc cgttgtcctt    105120
     ctcaattgtc atacgtccga ctaccgtttc ccatcggtcg ttcccagcga gatcgctggc    105180
     ggacagaacg cgacactcca cctgatccaa catggacacc ggcgcattgc aacgatcacc    105240
     ggcgaacctt ggcaggaggc aacccaggac cggctccgtg gatatcgacg agcgctcgcg    105300
     acggccgata tcccttttga tccacacctt gttgtcgagg gcgactggtc gaccagtggt    105360
     ggttatgaag cgaccaagaa gctattgcgg ctcaaggaac tgccaacagc catcttttgc    105420
     cagaacgaca gaatggcgat cggctgctac gaggcattga aggaattcgg cctagatatc    105480
     ccgcaggaaa tgtccgtggt cggttatgac gacgaagagg tcgcacgtca cctccatccc    105540
     ccattgacca catcggtcct gccgcaccgg gcgatgggag aatgggcgat cgagcgcctc    105600
     gggatgccgt tcacgccgca aggcaaccgc ttccccatca taaagctcga gtgcccgctc    105660
     gtgcttcgag gttcagttgc cgcacctgcg cgctgacatc gccgaggacc aatcgaccca    105720
     cccacggcgg ctaactgcgg cctccgctgc tccgttcagg gccttcccgg acatgatggc    105780
     cgggggaggc aacctgcttc gacttattca actgtttctc gcaaaagcgt gctgctcttg    105840
     ctgcgccact tcgacggctg catcatcgac aaagtacggg actcttcgtt cagtcggacc    105900
     aatatggcgg ctttgcgcgg aaaacggcat ttcacccggc ggcctcattc tgagaacgag    105960
     attgcagggc gcgacagaca gcttcgcgct cgatatcaac aagaggcggt ccgttacaga    106020
     gatagctttg agctggggtt tcaatgacat cagctatttc aacagggcat ttaggaccac    106080
     gtacggaatg acgccgaggc agatgcgcca ctcgcatcaa tgaaaggccg agccttcggc    106140
     catggcgaca ctcgtattca atctgcatgc gctagcgtac tgcgtgatgt tggccgctaa    106200
     ctgcctagtt cgaccgatct tcgtcttgcg gcctgcaccg ctgcctcaat gaggtgacgg    106260
     agacccttgc catcctccat cagcacgtcc aaagccgccg cagttgtgcc attcgggctt    106320
     gtcacttgtt cccgcagcgt tgccggtggt tcggtggcct cgatagccag cttggcggag    106380
     ccaaataccg tctgcttcgc gagcaagagg gcaagctcct catccagccc tgcctgtatg    106440
     cctgcctgac acagcgcctc gatgaagtga aatacgtagg ccggtccgga gcctgagaca    106500
     gcggtgaccg tatccatcaa ggcctcgtca tcgacaaacg cgacacggcc gatcgaggac    106560
     agcagctctt ccgccagagc gcgctgaacg aatgttgttt cagcgcttgg acagcacacg    106620
     atcatgccct cggcaatggc ggcaggagta ttcggcatgc agcggataat ggcggcaggg    106680
     cgcttggcgc gcaatgccat cttccggata ccgatgccgg ccgcgaccga aatgaagaag    106740
     ccgccatctg ccaaaagagc ggaatatcgc tcgacaacat cgccgaccac ctgcggcttg    106800
     gtcgcgatca ctgccacatc ggcttggaac gcgacaggca ggtcatctgc ggatgcatag    106860
     gttctggcgt cggtttccgc cgctctggct cgcaatgcgg cattgggctc gacaatcgtc    106920
     aaatgatgct gcccaagctt gctccacttt cgcagcatgg cgaagcccat atttccggct    106980
     ccgattagga cgacgtgcgc cattttattt cctccgatca gatgtgttcg cgagctccaa    107040
     cagagccagc cactgcttct cgtctacggg cacggatccg ttcgcctccg accgagcctt    107100
     gatgcgccgg tcacctggaa tgcgtttctg gccggcgacg ctcaatgctt cgatgagggt    107160
     tcccacgcgc tcggccaggg gcggcaatcc atccgcccct gttcgcggat cgatcaggat    107220
     gatcgtttcg cctgttcgcg cgctcctcgc cccaggcgtc tccgaccaat cgacttcata    107280
     agaaaaatct gcgccgacga gcgccgcgca gagaatttcc accatcagcg cgatcgatgc    107340
     gcctttgtgc ccaccgaagg tcgacaatgc gccgccgttc aaaatggcgt gcgggctatt    107400
     ggtcgggata cccctcttat cgataccgct tgcctcgggc agcaaccgcc cttcccttgc    107460
     agcgacctgc acgtcgccat gggacatggt ggaggaggcc tgatcgaaca ccagcggcgg    107520
     cccctccgcg cgtggtgcgg cgaacgccat aggattggtg ccatagacgc cggccctgcc    107580
     accggggggt gccacgaccg caatgctgtt gacgaccgcc aatgagacaa agccacgatc    107640
     cgccagatct tcgacatcga gatagagagc gccgagatga tgggagttgc gaatggcgac    107700
     tatcgcaatt ccgttctctg cggccttttg caccagcctc tccttggcat cggccaaggc    107760
     aatctgtgcg aaaccattgt ccgcatcgac tctgatgaag cccggcgcca cgtcaacgac    107820
     cttgggattc ggatcgccat tcacataccc gcttttgatg atagcgagat aatccttgat    107880
     ccgaaacaga ccatgactct cgctgccgtc ctgctgcgcg gttgcgcagt tcagcgccag    107940
     tatgccggcc gatcgggcgg aataaccatg cttcgtcagg atgagttcga gcgtctcgac    108000
     gacggtttca tacggctggc gatacatcgt tggtcagagc gccttttgga gttccggcag    108060
     tgcctcgaag agatcggcga cgaggccata gtcggcgatc tggaagatcg gggcctcttc    108120
     gtccttgttg atggcgacga tgaccttact gtccttcatg ccggccagat gctggatggc    108180
     cccggaaatg ccgcaggcga tgtagagctg cggtgcgacc accttgccgg tctgaccgac    108240
     ctgccagtcg ttcggcgcgt agccggcatc gacggccgcg cgcgacgcgc cgacggcggc    108300
     accgagcttg tcggcgacgg gaaggataac ttcgcggaac ttctccgccg agccgagcgc    108360
     gcggccaccg gagatgatga tcttcgccga catcaaatcc ggacgctcgg aagcagcgat    108420
     ctcctccgac acgaagcgcg aaagcccctt gtcgccgata gccgagacaa tctcaatcgg    108480
     agccgcgccg ctcgctggtg ccgcggcaaa agccgccgtg cgaacggtaa tcaccttctt    108540
     cgcatcgctc gactgcaccg tctggatggc gttgccggca tagatcggac gcttgaaggt    108600
     gtcttcagcc acgacttcga caatctcgga aatctgcatg acatcgagca gcgcggccac    108660
     ccgcggcaat acgctcttgg cggccgaggt cgcagctccg ataatcacat cataagagcc    108720
     ggcaagcgat acgatcaggt ctgccagcgg ttcggagagt tgccgggcat aggatgcatc    108780
     ctcagcctgg aggaccttgc caacgcccgc gagcgtcgaa gccgctttcg caacggtacc    108840
     tgtgtctaaa cccgccacca gcacatggat gtcggcgccg atcccggtcg ccgccgtgag    108900
     caccttggct gtttgatctg agagaaccgc cttatcgtgg tcggccagca agagaatggt    108960
     catgatatcg tctccttgtc tcttcgcacc actcttaaag cgcgcctgct tccatcttga    109020
     gtttgtcgac cagttcggcc acggaggtga ctttcacgcc cgccttgcga ccggccggct    109080
     cctcggtctt gagaacccgc acgcgctgga cgacctcgac accgagttca gcaggcgtct    109140
     tcttgtcgag cggcttcttc ttcgccttca tgatgttcgg cagcgaggca tagcgcggtt    109200
     cgttcagtcg cagatcggtc gtgatcaccg cgggtaggat cacatcgatc gtttgcagac    109260
     caccatccac ctccctggtg actgtgatgc ttccgtcgcc gatcacgatt tttgacgcga    109320
     acgtcgcctg cgaccatccg agcagcgccg aaagcatctg gcccgtctgg ttgctatcat    109380
     cgtcgatcgc ctgcttgccg aggatgatga gatcgaaagc ctcctgctgc gcgactgcct    109440
     tcaggagctt ggccaccgtc aacggctcga cggtttcgtc ggtctcgacc aggagccccc    109500
     ggtccacacc catggcaagc gccgtgcgca gcgtatcttc ggccttggaa ggaccgacgg    109560
     aaacggcaac gacttcggaa gccttgccgg cttctttcag gcgcaaagcc ccctccaccg    109620
     cgatctcgtc gaatggattc atcgacatct tgacgttggc aaggtcaacg ccggtgccat    109680
     ccggcttcac gcggattttg acgttgtaat cgacgacacg cttaacaggc acgagtattt    109740
     tcatggaaca acgtcctctg tctttccggg ttttcgtaaa ggccggccga tcaggcagcc    109800
     ttgtaatagg aggcatttga cggcggcagc ggttccttgc cgcatatccg gtcggcaagc    109860
     ttctccgcga tcatcatgat cgcggcgctc agattagcag tgacgacgcg cggcatgatc    109920
     gaggcgtcca cgacacgcat gcgccgtacg gccttcacac gcgcctcgct atcgaccaca    109980
     gcctcgtcat cgatgcccat gcggcatgtg ccggacggat ggtaggaggt gccgagattg    110040
     gcccgcacga atttctccag ctccgcatcg ctttgcgcat ccgatccggg agaaagctcc    110100
     tgaccacgat atttgtccca tgccggctgg cggatcagat ctctcgcaag ccgcacgccg    110160
     tccaccagat ctttcaagtc ctgtggcgac tgcaaatgat tgaagacaat atagggcgcc    110220
     tcggcgggat cggcggaacg aagcgtcacc gaaccccggc tctcgggccg cgacaggtcc    110280
     atccagaact gaaagcccgg tatggcaacc agcttgccat tcttgacata gcgtgtgagc    110340
     ggcaggaact cgaactgcat gttggggaaa gagacatcct cgcgcgtccg cagaaacgcg    110400
     cccgtctcga agaaatttga ggcccccaat ccctttcgtg tcaacagcca ttcgacaccg    110460
     agcctggccc gaccaaaaag attaagctcg gagacgagcg agtcctcata gttcgtcgca    110520
     tattgtagat tgacgcccgg atggttttcg agatttcggc cgacctgacg cgcctcgcct    110580
     ttgagcgcta tgccgtggcg acgcaattcg tcggggtcgc cgacacccga cagcatcagc    110640
     aattgcggcg tattgaacgc tccggcgcaa agaatgactt cccgctcgca atcgataagc    110700
     cgcagcgtac cgttttcgag gatctcgata ccgatggcag ctccgttctc gaccacgacc    110760
     cggctgacca aggtcttgga catgatgtgc aaattgtcgc gcttggccgc cgggtgcagg    110820
     tagccgcgcg ccgacgacca gcgccgtccg ccgtgaatga aggattgggc aatatggagc    110880
     ccttcctgcc gatatccatt gtgatcgggc gtcaccggat agcccgcctg ctcgccgcca    110940
     cgcaggaagg catcatagag cttgtgctgc gccttgcagc ggctgatccg catcgggccg    111000
     tcgcccccgc gccattcatc cgcgccgtcc gcgaatgtct ccatgcgacg gaaataggga    111060
     aggcaatggg caaagtccca ttccaccaag ccctgctcgg cccagccgtc gaaatccatt    111120
     ggatttcccc ggttgtagat catggcgttg atcgaagacg aaccaccgat caccttgcca    111180
     cgcttttcgt ccatggtgcg cccgccgagg tgcggttcgg gacccgattg atagccccat    111240
     ccaagcttct tgctctgata ggcaaagggg agtgctgcgg gcatggcgat cacaggtccg    111300
     cgatccgatc cgcctgcctc gacgagaaga acctggatcg ccggatcctc gctgaggcgt    111360
     gccgccagga tgcatcctgc cgagcctgcg ccgacaatga tgtagtcgta agccattctc    111420
     tgtcccctca ggtgagccgg acgtgaccca ccaatattgg atacgataat agtattttgt    111480
     ataaacttat gtcaaaccaa aaacccaacc ctcaggagat ttggtgatcc gcccatcacc    111540
     ggggaacgac aaatccgcca tagccgcaga caggtaggcc cgaaacgacg cgcagtggaa    111600
     aacgtcgcag ctttagtcgg ctcaggagcg atgccgacgg ctcgcctgca ccgacttttt    111660
     cgtttgctcg atatgggttt ccagcaaagc tgttgcctgc tcgatatcgc cttcacgaca    111720
     caatgccagc agcaactcat gctccttgcg aggccgctct tttccggcgg ccagagatac    111780
     ctgcatgcgg acgaagcggt tcacatgacc gtaattcgct tcgatcatcg acagaaggcg    111840
     aggccggtga cagggcgcat agatcgacca gtgaaactgc cagttcatgg tgccccagct    111900
     ttccgggttc ggctcgcggt tatagccttc gagaatgctc tccgcgtgac tgaaatcctc    111960
     ctcggccatt tccggaatgg cgagacgaag cgcatggcat tccagcgcaa tgcggatatc    112020
     cagcatctcc aacacatcga ccaaagaaag gctggcaacg atagcgcccc gattgggttc    112080
     gattttcacc aatccttcgg cttcgagctg cctaagagcc tcgcggacgg gaattcggct    112140
     gatgccgaat tgttcggcca gctgatcctg gcggagctgc gttccctccg tgagatcgcc    112200
     gcttagaata gcttctcgca atccatctcg cacaacatca ggcgcggatc gacgcggttc    112260
     catgatctta gtcaccacta taaccttata cattttatat atattgtata atttgcaatt    112320
     gcgccttatg caagcagatg cttacgtcaa gcaacagctt tgcgggagaa gatcgcgcat    112380
     ccggcggatc ccaccatgat cagcacgatg gacagcatct gctgatttga aagtcgctcg    112440
     ttcaagagca gggtacccat aagggcactg atggccggcg ctgcgctcaa caggataccg    112500
     agtgcgctcg gcggcaatcg tcggaaggca aacatttcga gcatgtatgg gatggcgctc    112560
     gacagcaaag ccacaagaag accgacggcc aaaatctgcc agccaagaag tgaggccccc    112620
     gcattataaa ccccgaaagg gacaccgaag gtagccgcga cggccattcc cagcgaaacc    112680
     gctcgcactg gtccgagcgg agatattttc ttgccgaaga gaatgtagca ggcccagcaa    112740
     gcggccgcgc caaccgcaaa aagcaggccg acgggatcga ggtcattctc cgttctgaac    112800
     gggagtagaa aaagcaggcc gcccacggcg gtcgccagcc acaggaaatc gagcggccgt    112860
     ctgaatgagc aagggcgaca agcagcggac cggtcacctc gacggctgcg gcgacgccga    112920
     gaggaagacg cgcgaacgcc tgatagatca ggatgttcat caagccgagg gagacaccaa    112980
     agccgataat cgcgagtggc agggatcgtt gaggtccctt ccgccagggc cggccgatcg    113040
     ccatgagcag aagagccgaa aacccgaggc gcagggcggt cacgccttct gggccgacag    113100
     tggcaaaaag gctcttcccc aacgccgcgc cgagcgccga acaagtcagc gcgccgacga    113160
     tggcggggga tgcctaggct tgagcgccgg agctgacagc agtcgtcctc attcgtcgaa    113220
     accttctttg tggcgcaaga caagcgggat cgatcagcga acccatggtt gagggtaacg    113280
     gccgcgatgg tgctctatcg gatatgctgc aggaagcttg caagccgctc gcttggagga    113340
     ttggcgagca gttccttggg gcctccgtcg tgcaggatgt gacccttgtc gataaagagt    113400
     agacggctgc cgacgtctcg agcaaagccg atctcgtggg tgaccacgac catcgtcata    113460
     ccttcatccg caagctgtcg catcacctgg agaacctcgt ggcgtagttc gggatcaaga    113520
     gccgacgtcg gctcatcgaa aagcatcagc ttcgggcgca ccgccagcga cctggcgatc    113580
     gcaacgcgct gctgctgccc gcccgagagc tggctcggat agtgccctgc ccgttccgac    113640
     aggccgacct tggccagcag atccttggct atcgtctccg cttcggcctt gccggaccgc    113700
     cgtaccttca aagggccgaa catgacgttt tcaagcgccg tcatatgcgg aaagagattg    113760
     aactgctgga acaccattcc cgcctcgagg cggatctggc ggattcccgc gcgcgtgcct    113820
     ttcgcactga gaccatcgac aatcaagtcg ccgctctgaa tggtctcgag gacattgatg    113880
     cagcgcagca gcgtggactt gcccgacccg gaaggcccga tcaggaagac gatctcaccc    113940
     tgatctatcg acagatcgat ggatttcagg acatcaagcg tgccgtaact ttttacgacc    114000
     tttcggaatt ctacgatgct catgtcattt gaatccgctt ttcaatcacc cggaagatga    114060
     ttgccataat gctgatgatg acgagataga tgacaccgac ggcggcccag atctccacgg    114120
     cgcgataatt ctccgtcatg atctcctggc ccgtccgcgt cagctcggca acgccgatga    114180
     caatcagcag cgaggtgtcc ttcaacccga tgatgaactg gtttccaagc gccggaacca    114240
     tccggcgaaa ggcaaccggt ccgatgatgt aaagcaggac ccggtggagt ggcagcccca    114300
     tcgccagtcc ggcttcgcga agtccgtgcg gcacggccat gaagccccca cgaacgattt    114360
     ccgcgagata ggccgaggaa ttgaccgtca gggcaatcat gccagctgtc agagccgtca    114420
     acttgatgtc gagaagcgac ggcagcgcga aatagatgaa catgatctgc acgaccatcg    114480
     gcgtgccgcg gatcaggcct atatagatct gcgcgatcaa cgaaatatat ttgggcgcgt    114540
     aagtcctgat gacgccaata atggttccga ggatcattcc cgccaagagc gacgcggcgg    114600
     caaccatgac ggttacggcc gcgccgcgaa ggagtgcggg aagagcgtcg ataattgccg    114660
     accattcgaa ggtcatgcga gctcccctta tgtgttggtt tcgacctcaa tcgcctcgca    114720
     aatcagccgg gaagcttacc aaaccacttc ttatagatgg cgtcgtagcg cccatcagcc    114780
     ttgatcttct tcagtgcgtc gtttgtcttt acgaccagat cgctgccctt cgggaaagcg    114840
     atcccgacag gaatgccatc accgacgggg gcctccagga tcttcacttt gcccttgcct    114900
     tcggtcgcag cgtagtatgc gaggaagggg tagtcataga cgacggcttc ggcgcgtgat    114960
     gactgtaact ccatgaacat gttggtgacc tgcgggaaca aggtgacttg agctgtcgga    115020
     gcatgctcct ttagccaggt cgtcgaagcg gcgccggtta cggacgcaac cttcttgccg    115080
     gcgagatcgt tgccggattt gatcgttgcg tcgttcgcaa cgatgagaac gccgagagcg    115140
     cttgtgtaat atacgtcgga gaagtcgacg acctttttgc gggcatcggt catgaagatg    115200
     ctcgaaatag ccaggtcgat attcgcggtc tgtagcgcgg ggatcagcgc gccgaagtcc    115260
     atcggcgtga cattgtactt gaagcccgct tccttggcga tttcgacaag caggtcttga    115320
     tcgaaaccaa catacttgcc gtcctgcata aaatcgaacg gtttggagtc gacactcgtg    115380
     ccgaccacga tggtcttgtc ttgcgcaaaa acggcctgcg taaaggccac ggtcgcgaca    115440
     agcgctccga agaatatacg tctattcatc tcatgttccc ctttgagttc gttttggtta    115500
     gcgagcgcat ccgtccttga cgaaaggagg ctgctcgccc acaaaatgga tacaatcata    115560
     ctatatataa tatttcaacg taatattgta taaaatatta ttggtgtgcg caatctgcgc    115620
     aaggcgagac tgcggtcaag tccattccaa catgagaaat tgctgcccat cggggcaacg    115680
     acatgcgaga tcccctgcgg ccatggggcc acggaggatc gctaccagcg ccttaaaggc    115740
     gcttttcgga aatcatcttc gtgcgcaaat aggcctcgag cccctcgatg ccgctctcgg    115800
     cgccataacc cgactcatta acgccgccga atggcgtttc cggttcgtgc acggatgtat    115860
     ggttgacacc gacaacgccg gcttcgagcg cttcgctgac cgctgacgcc gtcgatccat    115920
     tggcggtgaa gagataggct gcgagaccga atggaagaga attggcgcgg gcgatcacct    115980
     catcgacaga cttgaagggc gtcaactgag ccaaggggcc aaacggctcc tcgatcatca    116040
     cacgggcgtc gtccgtcacg tccttgagaa cggtaggcgc atagaagtag cctcggcggt    116100
     caaggcgctc gcctccaagt gccaccgagg cccctttttc aacggcatcc cgtataaagg    116160
     tgtccatcat atccagccga cgttcagtga tgagcggtcc catctgggta gcctcgtcga    116220
     gcccgttgcc gacgacaatc ttgcagcttc gctcaacgaa ccccgttacg aagcgctcat    116280
     agacgttttc ctggatgtag aagcgggtcg gagacgtgca gacttgcccc gcattgcgaa    116340
     acttggcggc tatcaacacg tcgagcgcct tttcgatatc ggcatcatcg aaaacgatca    116400
     ccggcgcgtg cccgccgagc tccatagtgc agcgcttcag cgtgtcagag gccagacgct    116460
     gcaacagctt tccgacaggc gtcgagccag tcagggagac tttcttagga atgggagagg    116520
     caatcagatg ctcggaaatc ggcgccggcg gcccgaagac gatgttgagc gctcccgccg    116580
     gcaccccggc gtcctgaaag cagcggccga tcgcaacggc ggtaccgggc gtctcgtcgc    116640
     tcggcttcac gataatgctg caaccggccg cgagcgccgc cgccatcttg agagtgacgt    116700
     tgcctgccgg gaagttccat gcggcaaagc cgagtgctgg acccaccggt tccttgaaca    116760
     ccatctgccg caccccggcg gcacgcgcag ggatgatgcg gccataggcg cgcttcgcct    116820
     cctcggcata ccagcgcgtc gcgtcggcac agaattggac ctcgcccacg gcttcggcca    116880
     aggccttgcc gttctcgagc gtaagggtgc gggcgatatc gcctttgcgg gtttcgataa    116940
     ggtccgccgc ccggctcaga atctgccagc gataggcagc tgtcgtggtc ttccaaaccc    117000
     ggaacgctcg cgccgaagcg tctagcgcgc aatccagatc atccttggtc gcgtgaggaa    117060
     cggtggcgat ttcggccccg tcagctggat tgacgagtgg cgccgtcgcc ccgctgcttc    117120
     cctgcaccca ggtgccatcg attagcattt cgagtttttc agcgtacatc gtcattcccc    117180
     tgattgcgtc atcgaccgag caacatctca gctttttccg attgtataaa taataatgtt    117240
     atcgtatgca attataaatc atcgcataat atgctgttgc tatcgagggg gagccgttcc    117300
     atgaccacca aaaacgaagc cgttgacgtc gcggtgatcg gggccggaag cgtcggtatt    117360
     gccgtcgctt attatctggt cagaaagtac ggcattaaag atatcgcgat catcgatccg    117420
     cgtgatccaa tgagcctgac ttcagcacaa tccggcgaga attaccgcaa ttggtggcct    117480
     catccgatca tggcggcctt caccaacgac agcatccggc tcatggaaga gattgcgtcc    117540
     gcctcggaca accgcatcaa catgacgcgc cggggctatt gcctcgtcac ccgccggtcg    117600
     gatccttccg atctcatcga ggatctctat cgtggttatg gcgaagacgc cgaaggcctt    117660
     attcgcgttc acaagggcgg aggcccgcat gacagctacc ggccaccggt atcggcggac    117720
     tggcggcagg ctcccgacgg cgtcgacgtg ctttgcgagc agaacctcat tcgcagcacg    117780
     tttccggcct atgccgacga tatctcggcc attcttcatg tccggcgcgc gggctcgatc    117840
     agtggccagc agcttggcca gttcatgctg gaatatatca aggaccaggg cggacggctg    117900
     ctgcgtggtg aggtcgtttc gattgcgtca gcctcgcctt tccttctctc ggtcaagacg    117960
     agcgacgggg ttgcctccct tcgcgccgac cggatcgtca atgccgccgg gcctttcctc    118020
     aaggacgtag cggcactcct gggcgaagaa cttgccgttt cctgtgtcta ccagcaaaag    118080
     atcgccttcg aggacaggga gggcgtggta ccgcgcaacc tgccgttcac gatcgatctc    118140
     gacgatcaga aacttgcctg gagcgaggag gagcgagcct tgctcgctga ggatcacgac    118200
     actgccaaac tgacggaact tatgccaggc ggtatccatt gccggccgga tggcgcggag    118260
     aacggcaaat ggatcaagct cggctgggcc ttcaacgacg ctccttccga cccccatggc    118320
     cccgaaccca tcaacgacca gttccccgat atcgtcctgc gcggcgcgag ccgtcttcag    118380
     ccggggcttg ccgcctatat cgggcgcttg ccgcgtggcg cacatcatta cggcggttac    118440
     tacaccacga ccgaggagaa ctggccgctg atcggcccga tgcacacgcc tggcgctttc    118500
     gtggcgggcg ctctttccgg attcggtacg atggcggcct gcatatcggg ctcgatctgc    118560
     gccgactggg tgatgggtaa aacgtctgcg ccctacgcca ggatgctgag cgcggcccgc    118620
     tacgacgatc ctgcaatcat ggccgaactg gcagcgctcg acaatcgtgg ccatctctga    118680
     cggaaacccg gctcatcgaa tgaggaacgg caaacactat tcgctttacc cggcatggag    118740
     ccggagcaga caggcaagga gataagattg aagaccgata ttgttatcat cggaggtgga    118800
     gcgatcggcg cggctgttgc ttacttcctg aaacggacgg atgcgagcat ttcggtgacc    118860
     gtcattgagc gggatccgac ttataatctt gcgtccaccc cacgtgcttc gggtggtgta    118920
     cgccgacttt tttccctgcc tgagaacatc gcgctctcca attacagcat tccattcttc    118980
     gacgattttg cggaaaccat ggccgtcgat ggcgtgccgg cggacatcgg cctgaagaag    119040
     aacggctatc tcttcatcgt gccgccatcg agccgcgaca tgctcaagca gaatttcgag    119100
     atcgaaacga gcatgggctg caacgttgtc tggctggagc cggacgaaat caaacacaag    119160
     ttcccgtcga tgaatgtttc ggacctgggg tctgccgtct attctcccga tgatggttgg    119220
     cttgacccgc atagcgtgct catgggcttc cgcaagaaag cccgctcgct tggcgccgat    119280
     ttcattgccg aagaagtgat gggttttgag cggacggcaa cgcacgttgc caaggtcaag    119340
     ctgaaatccg gtgcggagat caaggcggat catttcgtca acgccgcggg cgcctgggcg    119400
     aaggacattt gcacgatgct cggcttcaag gttccgatcg agccgctgcg ccgtttcgaa    119460
     cattacttcg aaaccgagga gccgatcgag ccgcttccct atctgaagga cccggagcgt    119520
     ctggccttcc ggccggaagg caagggatat tccggcggcg ttccgacact tgccgaaccg    119580
     cgcggataca atttcgaggt cgatcacgac tatttcgaaa atgtcgtttg gcccgcactg    119640
     gcgcatcgct tccctcagtt cgagaagaca aagtgcaaga acacgttgcc gggcctttac    119700
     gaccagaacg attttgacgg caatgtcatc attggtccgg gcgcggacgg tcttgcgaat    119760
     ttccatatgc tcgccggctt ctccggccat ggactgatgc acgcgcccgg atgcggcctg    119820
     gcaatgacgg aattgctgct gaagggacgc tatgaaacga tcgacctcag ccgtcttggc    119880
     tggcaaaggc tcctcgatga caagccgctt ccagagcggg gtattatcta ggccttgagg    119940
     cgcaacggtt gaataatcgt tgcgcccaca gcccgctaac gcctgcgcat ggcggcgcgc    120000
     aacgacttct gtgtctgttc gatgtgcttt tcgagcaatg cgaccgccgc atcggcctcc    120060
     ccttccctgc agagccgcaa cagctcggca tgatcctgtt gaggcttcgc ctttcccgtc    120120
     gccagcgaca cctggcggcg ggtgaagcgg ctcacatggc cgtaattcgc ctcgatcatc    120180
     gccaggagct tctcccgatt gcaggggcaa taaagcgtcc agtgaaagcg ccagttcatc    120240
     tccccccagg cggccgggtc agatgtttcc tcataatcgg ccagaatttg ctccgcagcc    120300
     tcgagatctt cgacagccat gttggggata gcaagtttca aggcccggca ttcgagcgcg    120360
     atgcgaatat cgagcatttc aagaacatcc tcgacggaca atcccttcac caccgcgcct    120420
     ttgttggcgt gcagctccac cagcccttcg ccttcgagct gacgcagggc ctcgcgaacg    120480
     ggtattctcg aggttccgaa ctgttctgcg agctcgtcct ggcgaagctg ctggccctct    120540
     tcataggccc ctgtcaggat cgcttcccgc aggccgtccc tgacgagttc aggcgcggat    120600
     ttgcgcactt catttccctt aacagccatc aaagtacctt ctcagtccaa ccagctcctg    120660
     gattagatgg cagcgttttg tataaatttg tcaacagcac acaaggataa gcgctgtgga    120720
     gaatgcgacc accttgcctc tgtctggaca cgctgtctgg tgggtggttg cggcagcgaa    120780
     accgatatca ctgtcattca agccgatcct tccgtcgctt ccttgagcaa acgtcggatg    120840
     ccgtcggcaa caattctgac cagttccgtc gcgctcgatt tgctcacaag acgaatatcg    120900
     aacgagccga gttcttcgaa accatcctcg gcgccgagaa ccctcatgtc gtccgtcacg    120960
     taggaacagg ggagcggcgc caccgccaag tccgagacca cggccgcgca ttgcaccgta    121020
     gtgcgggggc tgagataggc aaggcggtag ggtcgacctt ttctttccag ttgctcgagg    121080
     gcagcggcac gccagatgca cccatcctcg tgggtcgcga ttggcaaagg atcctgccga    121140
     aaggcggagc ccagcccggc cccggcccag acaagcttct cggtgcctat cacttcaccg    121200
     cgcagcgctg aaggattacc gacgatgcac gtaagggtaa ggtcgagccg ctgttcgtct    121260
     atgcgctgga cgagacgatc gctcgcatcg acgacgacgt cgaccacgat acccggatag    121320
     gcgtcggaaa ggtccttcag gattttcgga aaaatccgcg cgctgatatc aacaggagcg    121380
     cccagccgca ccacacccgt tagctgcgga tccaccaatc gagagaccgc ctcgttcgac    121440
     agcatcaaca tcgtgcgagc ataggtcagc aatgtctctc cctgccgcgt cagcttgatc    121500
     gtgcgtgcag cgcggatgaa caaagctgag cccagttgct cctccagctt cttgatctgc    121560
     atcgatacag cggaaggcgt acgcgaaacg gatcgcgcgg ctgcggagaa gctcagcgtc    121620
     tccgcgattg caacgaatgt tcgtagcaca tcgttatcga gcaacggcct ttgccgactt    121680
     aagtcatcaa ccatcattcg ctctcgagga ttttcgtatg cgggcgatct gccggcgcga    121740
     ctggtgcaag gaaaagtgaa aagcagttgc cgaaactccg ataaagtata taattattac    121800
     atatattata caataatata aatccaggat aaaacacacg catcggccat ggatgtgggc    121860
     agcaccccac catggtgatc ggataacgga aaactgaaag gaactggcaa tgccttggat    121920
     tcgagtggat ttatctacgg gccgtaccgt tgagcaaaaa cagaaggctg ccgaggccat    121980
     cactgacgcg ctggtgaagt tttgcaactg ctcacccgag tcggtcagca tcgtgttcaa    122040
     cgacgtgacc gcggacaact gggcctttgc aggcaagctt ctttcgcaaa ccgcaaaacc    122100
     ctaaagtgaa aacgacctca tgttttccta ttgttgaatt ctaggcaaaa ttcagtcggt    122160
     tttccatctc gccatgagcc agccactgcg atgaaaagcg atatcgttca ttgtcttatc    122220
     tcaagctggg cctagtcagc atcaagcaga aaagcggatc aacctaaggc agaaatcaac    122280
     aacctttgct atttcgacac aagcaccaag gcatttgtcg ccccgccgga aattatgagc    122340
     tgctggttgc ggccaacgcc agcgaagtcc atcgggcaat ccccatcagc ctcgctgaag    122400
     actatatcgc gcctgtcgcg aaatgacggg aagaaataag aaggaaacag catgagcaac    122460
     gtagatctca aggccggtgc tgtcgatgag gacatgcaca ggtccttctt ctgctgaaat    122520
     agagcgccct tgccgtctct cagacgatcg ccccatccgt gcccgtcggc taagcgtcgt    122580
     gtgatcgggt atggcaaggt cgaattccag cagacccagc accgacgcca gcaaggcctc    122640
     agtctgacgc aactgcaggc cgaacaccac gcccagcgta agagtagtct cgatggccgg    122700
     atcggaatag cgcggttggc caccgcgggt cgtgcgcttc ggcgcatgcc actgcgacaa    122760
     agcttccgcg atcatccaca gcgtcaggtt gcctcgccgg cgaaggcctg cctcatactc    122820
     ggcccagttc gtcaccttga acttcatctt gccgatacga tgacggcggg cagcattgtg    122880
     tttgaaagga gtaacggtga ccgggcgttg tttcgatcac cgctccatac agcccaaccg    122940
     ctaaacgatc ggtgcgctaa tcccttggtc ttgatgtcca cgctgttgcc ggttcggccg    123000
     atcgaccaat cagatgtcgg cgatccacat tatttgatcc ggcgtttgaa cagaccgcta    123060
     aggtaaaacg agagcatgag gaattgtgtg gcagtgcctg atctagcttg aatgggctat    123120
     gggggtggcg atgattttcg cggaggccca tggttttgaa atcaacaacc aagagacgtc    123180
     agtcggcgac aaaacgtcca ttgaagccgg atgagtctct catgatcctg caattccgga    123240
     tctttctgaa agacgtgagc cccatggtct ggcggcgggt gcacgtgccc tcgaccatga    123300
     cgctacgcga gtttcacggc gtgcttcagg tcgtgatggg ctgggagagc attcaccttt    123360
     atgagtttgt cattcatacg gtgcgttacg gctcctggga aacggccgct aactcgccga    123420
     agatcgcgct tgacgatctg aaactgcgca agggtagccg ttttctgtat gagtacgacc    123480
     tcaacatccc gtggcagcac gaaatccggc tggaagagcg cgtgagcgtc aatgcgaaaa    123540
     ctcgctatcc gaattgctcc ggaggggacg gcaattgccc gcaggaggat tgcggtggcc    123600
     cggagggctg gatgtggcga caggacaacg ccttcggata cgaaatggtc gatgatctgg    123660
     ctacgacggt ggcgcttttc caggaaatca gcgaaacgaa gtccttcgca gtactggagg    123720
     acccgggccg gttggaagaa ttccgtgaaa cgcttgaacg gattgagcag tgcgcttctt    123780
     ggaatggcca gccattcgaa cgccggaaag tgaatgagcg cctgcggcag ggcgaccatc    123840
     ttgtactcat gcatcagcag atgtgagccg ccttacgcgg cgattttccg agagaagatt    123900
     ggcagccgga agcgccgtct tgtcaccaac ctgcgcacgg gcgcaggtga tcgccgcctt    123960
     gcattgcggg taatcgatcc ctcctgatcg ggatgcttgc gatagcactt gcggcgcggt    124020
     ctatcgaagt catggcggct taccaaagaa ttttcggatt gctaactcat gcggaatatc    124080
     accgtccccg acaagactgg agaacggcaa aagcatgttg caggcgcaat cgattttcca    124140
     ttccggtcat tatggaaaac gcgtcacgga aaaatgatat gcgggcacgg ctagtactgg    124200
     aaatagtggg tgacaacggc gagaccatcg cgaccgagac ggttgccgat ctggtaaaag    124260
     tgacgaaagg ggccgaggat ctcggtttgt cgttgtcgga ggcgaagacc cttctcgcga    124320
     agcttcagca gaagatggtg gagacacagg tcgatgtgtg gctccggcag taccatgagg    124380
     gtgatgggcg tgccttgcgg cacaagggat attaccctgt cacattccac acactgttcg    124440
     gcgatgttcg cctgaagagt ccgcgatact gcctgccgcg cagggacaga agcaacggcc    124500
     cggttacagt atcgcctttg aggcaattga tccccgatca tgtcgcgccc gagcgtcttt    124560
     atctcgaaac gcgctgggct tcgctggtgc cctacgcagc ggcggcagag ttgttggcgg    124620
     atatgctacc gatcgactgc ggatccaacg caacgacggt gcggcaacat gcgctgcgaa    124680
     cggccagccg gatcgaacag gaactgacgg aagagcgggt ttccttcatg cagaattcct    124740
     gtctacgcga ctggatggac ttgcccattc ctgatgggcg gatcgtcata ggcttggatg    124800
     gcggatatgt tcgcgatcgc gacgaccgca agagaaactt cgagctgatc gtcggccgct    124860
     cgctgcccga agatggcgat ccacgttaca tcggctttgt tcatgggtac gatcgcaaac    124920
     cgcagcgccg gattctcgac catctcaaaa agcagggagt gcaggccaac caggatatca    124980
     ccttcatcac agatggtggc gaggaagtcc gctcactcgc gaaaatgatt gcaccggcca    125040
     gcgagcatgt gctggactgg ttccatatca ccatgcggat caccgttctt cgccagttcg    125100
     cacaagggct tgaaaaccac gatgaacagg ccgggctgaa tatgcttgac gccctcgaaa    125160
     ggatcaaatg gtatctctgg catggcaacg gataccgtgt gcgcggcgaa atcagcgatt    125220
     tgtactgcga cgctgtagca atcgaaacag cttatccgaa catacggaaa ttcctgatgg    125280
     ctatcggcga attccgttcc tacatcgccg caaacgatgc cagcctgatc aactacggtg    125340
     agcgctaccg gtctggcgag cggatatctt cggccctcgt cgaagccacc gtgaacgccg    125400
     tcatcagcaa gcgtttcgcc aaaaagcagc agatgcaatg gagccggacc ggcgcgcatc    125460
     ttttactaca aaccagaacg cagaccctcg acggctcgct gcggttaacc ttcaagaaat    125520
     ggtatccagg catggcaaac gacaatcacg aacccggcaa caattccgcc gcggcctgat    125580
     tgccacacaa ttcctcatgc tctcccaatg gcgccggctc tacagcccaa aatgctaaat    125640
     tatgatacta ttttgctcca caaaatgtgc tggggcggat gctctgaagg cgtgacgaac    125700
     cgctcatagc acagcattcc ctcagtggta tttatcacca actaaaggat ctacttatgt    125760
     atgccatcat gcataagagt atcagtcttt ggtgaatccc gcgctagcgc attgttgagg    125820
     gagatctatc ttccgtctca cgcccactct tggaggaatg gtaggcattt ccggtttggg    125880
     cttgtcctgg gaggatctag tgagacatta tttggccggc gcgctcagcg ccttcatctc    125940
     cgttgcaatc agctcggcgg ctctcgccga aacgctgacg attgccaccg tgaacaacgg    126000
     cgatatggtc cgtatgcaga agcttacgga cgacttcaaa gcgaagaacc ccggcatcga    126060
     cctgcaatgg gtcacgctcg aggaaaacgt cctgcgccag aaggtcacga ccgacatcgc    126120
     caccaagggc ggtcagtatg acgtgctgac gatcggcacc tatgaagtgc cgatctggag    126180
     caagctcggc tggctggcgc cgctcgacaa gctcagcgcc gacaagacct acgatgtcga    126240
     tgatcttctc ccggccatcc gcagcggcct gaccaccgac ggcaagctct atgccgcacc    126300
     gttctatggc gaaagttcga tggtgatgta ccgcaaggac ctgttcgaca aggccggcct    126360
     gaagatgccg gatgcgccga cctggacctt cattgccgac gctgcccgca agatcaccga    126420
     caagagccac gaagtctacg gcatctgcct tcgcggcaag gccggctggg gcgagaacat    126480
     ggcgttcctg acggcgacgg cgaactcttt cggcgcccgc tggttcgacg agaagtggaa    126540
     gccgcaattc gaccagccgg aatggaagag cacgctcgac ttctacgtca agctgatgaa    126600
     ggacgccggc cctccgggcg cttcgtccaa cggcttcaac gagaacctct cgctgttcca    126660
     gaccggcaag tgcggcatgt ggatcgacgc gacggttgct gcctcgttcg tgtccgaccc    126720
     gaaggaatcg aaggttgccg acaaggtcgg cttcgccttg gcgccggata acggcctcgg    126780
     caagcgcggc aactggctct gggcatggag cctcgccatc ccggcttcct cgaagaagac    126840
     cgaatcggcc gagaagttca tcgcctgggc aaccggcaag gactacacca accttgtcgc    126900
     ccagaaggaa ggctggctga atgcacctcc cggcacccgt gcttcgctct atgcgaatgc    126960
     ggattaccag aaggctgctc ccttcgcgaa gatgacgctt gactcgatca attcggcgga    127020
     ccccacgaag cctgctgtaa agccggttcc ctataccggt atccagttcg tcgccattcc    127080
     tgagttccag ggcatcggca ccgccgtcgg ccagcagttc tccgctgccc ttgccggcca    127140
     gatcaccgtc gatgccgccc tcaaggctgc gcaacagctg accacacgcg aaatgaccaa    127200
     ggctggttat ccgaaataat caacctccca agacgggtgg gcccgcaaac aaaacccacc    127260
     cccccttagg ccgccgaacc gcttcggcgg cctctttttc cgcagtgttc ctatagccgt    127320
     agctagcttc agcaaagacc gtttctatca tggcaacatt acatacccgt tctgccgctc    127380
     gcgtcatgat gacgccgtcg gttttgctgc tcttcgcgtg gatgatcgtc ccgctggtga    127440
     tgacgatcta cttctcgacg ctgaactaca atctcctgtc gcccggcgcg catgacttca    127500
     tcgggctgct caattacgaa tacttcgtca ccgaccccgc cttcctgaac tccctgatcg    127560
     tgacgctgct gctggtcggc ggcgcgctga tcatcaccgt ggtcggcggc atcgctctcg    127620
     cgctccttct cgatcagccg atcttcggcc agggcattgt ccgcatgctg gtgcttgcac    127680
     ccttcttcgt catgccgacg gtcgccgccc tcatctggaa acatatgttc atgaacccgg    127740
     tgaacgggct cctggcgcat ctgttcaagt tcttcgggct cgatccgctg acctggctgg    127800
     agaccgtgcc gctgttttcg atcgtcatca tcgtcgcctg gcagtggttg cccttcgcaa    127860
     ccctcatcct tctgacggca ttgcagtcgc tggatgagga gcagaaggaa gccgccgaaa    127920
     tggacggcgc cggcgcggtt tcgaagttca tctacatcac cctgccgcat ctggcgcgcg    127980
     cgatcacggt cgtcatcctc atcgagacga tcttcttgct ctccgccttc gccgagatcc    128040
     tggtcaccac caatggcggt cccggcacgg cgacgaccaa cctcacctat ctcgtctatt    128100
     cgcaaatcgt tctgtcgcag gatgtcggcg gcgcatcggc gggcggcatc atcgccgtca    128160
     tcctcgccaa tatcgtcgcc atcttcgtga tgcgcgcggt tggcaagaac ctggaggcct    128220
     gagatggcac gcaatgtctc tacacggcgc aaggtggtcg tatcgctggc cgcctgggcc    128280
     gtcgcgctcc tcatcttctt cccgatcctg tggacgatcc tgacgagctt caagacggaa    128340
     ggcgatgcga ttgcttcgcc gccgcagttc ctgttcttcc actggacgct ggagaattac    128400
     ttcgaggtgc agtcgcgctc gaactatttc ctccacttcg ccaactcggt gatcatcgcc    128460
     ttcggctcga cgatcctcgg cctgatcgtc gccgttcccg ccgcctgggc gatggccttc    128520
     tcgccgacca agcgcaccaa ggacatcctg atgtggatgc tgtccaccaa gatgatgccg    128580
     ccggtcggcg ccttcatccc gatctacttg ctgttccagg gttttggcct gctcaacaat    128640
     cagttcgcca gccgtctcgg catggtcgtc gtgctgatgc tgatcaacct gccgatcatc    128700
     gtctggatgc tctacaccta cttcaaggaa atccccggcg agatcctgga ggcggcccgt    128760
     atggacgggg cgtcgctggc aaaggaaatc atctacgtgc tgacgccgat ggcgatcccc    128820
     ggccttgcct cgacgatgct gctcaacatc attctcgcct ggaacgaggc cttctggaca    128880
     ctcaatctct cgtccgtcga tgcggcgccg ctcagcacct tcatcgcctc ctattccagc    128940
     ccggaaggcc tgttctacgc caagctttcg gcggcatcga cgatggcgat cgccccgatc    129000
     ctgatccttg gctggttcag ccagaaacaa ctcgtccgcg gcctcacctt cggcgcggtt    129060
     aagtaaggaa gacaaacatg ggtagcattg tcctgaagaa ggtttccaag gtctttggcg    129120
     aagccaaggt cattccttcc atcgacctcg agatcaacga aggcgagttc gtcgtcttcg    129180
     tcggcccgtc cggttgcggc aagtccacgc tgctgcggct gatcgccggc ctggaagatg    129240
     tctcgggcgg gcagatcctg atcgacggca aggacggcac caatctggcg ccggcccagc    129300
     gcggtcttgc catggtgttc cagtcctatg cgctctatcc gcatatgagc gttcgcaaga    129360
     acatcgcctt tccgctgaag atggcgaaca tgccgcaggc cgagatcgac aagaaggtcg    129420
     ccgatgccgc gcgtgtcctc aatctcaccg attatctgga gcgcaagccg cgccagcttt    129480
     ccggcggcca gcgccagcgt gtcgccatcg gccgtgccat cgtgcgccag cccaaggcct    129540
     tcctgttcga cgaacccctg tcgaacctcg acgcggcgct gcgcgtcaac atgcgtctcg    129600
     agatcagcga tctgcaccat cagctgaaga cgacaatggt ctatgtgacg catgaccagg    129660
     tcgaggcgat gaccatggcc gacaagatcg tcgtgctgaa ccgcggcaac atcgagcagg    129720
     tcggctcgcc gctggagctc tacaagagcc cgcgcaatct ctttgtcgcc ggctttatcg    129780
     gctcgccgaa gatgaacttc gtcaagggtg cctatgcgca gaaccttggc gccgacacga    129840
     tcggcgttcg tccggaacat gtgctgctgt cgacggaaag cggggactgg aagggcaggg    129900
     tgaaccatgc cgagcatctc ggctccgaca ccttcctcca catagaggcc gacggcatcg    129960
     gcgccatcac cgcgcgcgga accggagact tcccggctcg cgccggagat accgtctatc    130020
     taacgcctga caaaagccga atccataaat tcaacgagaa aggaatggca acccaatgaa    130080
     acgacttgaa ggaaaatcag ccttgatcac cggttcggca cggggcattg gccgcgcctt    130140
     cgccgaagct tacctccgcg aaggcgcgac tgtcgcaatt gccgacattg atgttgaccg    130200
     tgcgaagaaa actgccgagg aactcggccc caaagcctac ttcgtgcaga tggacgtcac    130260
     cgatcaagcc tcgatcgatg ccgccatcgc tactgtcgac gagaagacag gcggcatcga    130320
     cattttgatc aacaatgcag cgctttttga tctcgcgcca atcgttcaga ttacccagaa    130380
     gagtttcgat acgctgttcg ccatcaacgt ctccggcaca ctgttcacgc tgcaggccgc    130440
     ggcgaaatcg atgattgcgc gcggcaaggg cggcaagatc atcaacatgg caagccaggc    130500
     gggacgtcgc ggcgaggctt tggttgcggt ctattgcgcg acgaaggcgg ccgtcatttc    130560
     actgacccaa tcggccgggc tggatctcat caagcatggc atcaatgtca atgccattgc    130620
     gcctggcgtc gtcgacggcg aacattggga tggcgtggat ttgaaatttg caaattacga    130680
     aaatcgcccg ctcggcgaaa agaaacggct ggtcggcaag gctgtaccgt tcggtcgaat    130740
     gggaactgcg gaagatttga ccggaatggc aatcttcctt gcgtccaagg aagccaatta    130800
     cattgtcgcc cagacataca acgtcgatgg tggcaattgg atgagctagc agctatcaat    130860
     cgcaaaggtc aggttcattg tgatcaaaac aatcggaacc agcaggatga gcagcccaat    130920
     cagatcggtc cagccccgtg ccccgcggaa ggtcgcacct cagctggcgc cgaaattcga    130980
     gcaaatcctg acaaccgagc atgatacctt cctttggcgg atcgacgact acccctgggt    131040
     acgctcgctc tggaattttc atccggagtt cgagattcac ctcatccgca agtcctccgg    131100
     cacagcctat gtcggtgact atatcggcga cttcggacct ggcgacctca ccgtgatcgg    131160
     cagcaacctg ccgcatgatt gggtctcgca catcggtaag gacgacaaga tcccaggacg    131220
     ggatcttgtc gtccagttcg atcctgacaa actgcggcag gcaagccagc atctacccga    131280
     aataaaacgg cttaactccc ttctgacgac agctcagcgg ggattgaggt tctcgggagc    131340
     aacggcacag cgcgcggctc acctgctgga aactattggc aaattcgacg gattggaaag    131400
     attgatccgc ttcctgcgtg tcctggaatt gctggcagat tctaaggaat gcgacgttct    131460
     atcctcacct gaattcgcgc cgaacgtcga tgccatcaca ctgaacacca tgcagcgcgc    131520
     cattctccac attaacagtc actttacaga aaaaatccaa ctccccgacg ttgctgccgt    131580
     cgccaatatg tcaacgaaca gattcagccg gtttttcatc aagaatacgg gccgcagctt    131640
     taccgattat gtcgtgagcc tgcgcatagg acgagcttgc agactgttat cggagagtga    131700
     caagcccgtc atcgatattt gctatgaagt cggctatacg aacttgtcca actttaaccg    131760
     ctcctttctc cgtcatgtcg gaaaaagccc ttccgcctac aggagggctg ctcacggaaa    131820
     acgtgtctcc acggattccc aatgagtaaa gcataagtgc tatgcgacaa gtctgccctt    131880
     cgactttatc ccttgcatca cggcaactgg tctaccagag cgctggtcgt cggctgtttc    131940
     tgcgtcgccc aaattgaatt gggagaccaa ctgatgcaga tgcgttgcct cactcgccaa    132000
     tatggcgctt gccgcactgg tttcctcgac catcccggcg ttctgctgcg taacttgatc    132060
     catctggttg actgcggcat taacctcacc gagacccatg gcctgttcac tggcggacgt    132120
     cgcgatggaa agaacacggt gattgatttc ggtcacgtgg ccctcgatcg cgttcagggc    132180
     atcgcctgtt gcacgaacca gcaaaacgcc gttctcgact tcttgccccg acttacgaat    132240
     aaggtccttg atctccttcg cggcctttgc cgaccgctgc gccagttccc gcacttcctg    132300
     agcaacgacg gcaaagccct tgccggcctc gcccgcgcgg gccgcttcaa cgccggcgtt    132360
     gagggcgagc aggttggttt ggaaagcgat ctcgtcgatg accccgatga tgctgacgat    132420
     ctgcgacgaa gaactctcaa tgcgccgcat ggcttccacg gcatcggcaa caatcttggc    132480
     cgagcgggtt gcgctcgccg tcgcttcgct gactatagag cgcgcttcct cggcacgctt    132540
     ggaggagttg gcgacgttga ccgtgatttc atccaaggcg gcggcggtct gttccagtga    132600
     agccgcctgc tgttccgttc tgcgtgagag attgtccgtg ctgacgctga tctcgcgtga    132660
     gccgtcattc attgcacccg cggcaatcga gacagacgtc aaggtgtccc tcaattgaag    132720
     tactgccgaa ttgaggtcac gtcgcagcgc ctcgaaatca ggagacatcg gctcaagaag    132780
     ctgaaaattg aggtcgccgg cggccaggcg ggtcaatcca tccgccaagg ccgaagtagc    132840
     gtctcgaaga cgcttatccg ccgccgcgtc agcctcttgc gtcaatcgct tgcgatcgac    132900
     ctctgcaatc tcacgatttc tttcggcttc caattcgagg cgcctgttgg cgatcgcggc    132960
     ctgccgaaaa acttcgacgg cgccggccat ctggcctatt tcgtcagttc gatccgcata    133020
     gggaataacg ctctcggtgt cgccgacagc aagcttggtc atcgatgcgg tgatggcctt    133080
     gatcggtttg gctatgctga tcaaggcata gatcgaagac ccaagcacca gtgagagcac    133140
     cagtccaatg acggcaaagg cagtaaagcg tgtcttgcca taggtgttgt cggccgaaac    133200
     aacggcagct tcggcattct gcgtagcaat tgccacgagt tcatccatgg ccgcaaacgc    133260
     cggctcactc gcttccatca tgctggtcag aacgccggtc gcctcgtcat attggctcat    133320
     cttggcaagc gtgaagacac cctcgccctt ttggctgaac tcggtcaggc tcttgtcaat    133380
     gatcgcaagt agttcgatct cccgagcgtt gggtccgagc tgttgggcac gcaagacttc    133440
     atccttggca accccctgaa gcttctttac gctctcttct gcggcctgca tgatgtccgg    133500
     tttcgatgcg gtgatatagg taaaataggc cgcctgaatc gcctgcatgt cggacttgat    133560
     gtcctttgca gcaaggatgc tgggcagcga gctccgcgtt atctccactg agccttcatg    133620
     caaatctgtg agcccgttga ccgacgtata tgcgaaagtc accacaatga tcgcgagggc    133680
     cgaaaatatc gctatgagcg atgttctgat cgatggctgt ttcagccttt tgagtttcat    133740
     gaagatcctc tccccttctc aacgcgaatg ggaagatcca acttcccaag cggcgacaag    133800
     agaaacataa agtataatca attaataaaa tgtaagctct gcgaatagcc tcggactgat    133860
     atcgcttaaa ttcaacagaa attttaaaat ttgaaaatac tatatgtata tattgaggat    133920
     atcatgatat atgtggaaaa atgacttcgc ctatgcgaat gacaagtcct gcatctaaac    133980
     taatactatt acgcaacaaa aactacacca tatatatatt ttgcataaaa gtatcatact    134040
     cctgacttcc agcacctcca cgcgcgaaca taacttcagg catcggacgg atggccgcct    134100
     cgcgcaaata cagtagcagc tggattcaca gcggcttaac taccgacggt attgcgcgtc    134160
     aggcgacggc tttggcttcg cctttccacg ctctccccct ttgcgacgag agcgcgagac    134220
     gatttgattc aacttctgct gtcacgattc tcgcaaaagc ctattgctct tactgagcca    134280
     actcggtcgc tgcctcatcg ataaggcctg cgacctcgac aaactttgat atgagcgacg    134340
     catgacttgc ctttaaggta atgaccttcc gggcattcag gcgcgccgac atcgccacct    134400
     gattttcggg cgcaatcatc cggtcctcgc tagatatttg ataccaggac ggcttcttct    134460
     tccaggccgg ggcggtgacg gcatctccaa aggtactggc cagcggcgcc ttttgggttg    134520
     ccgccataac gaaaccctct tcgggcgtca tatcctggca gaagctttca tggagcctat    134580
     cggccttgag ccagaggtag ccatcgctgt ccggctcgat attggccatt gccgcgggag    134640
     ggtgctgctg agtgatgccg cccggacttt cgccggcgtc gggcgcgaag gcggcgatat    134700
     agacaagccc cgccacattc ggctgatctc cgatttccgt tatgaccgcg ccgccatatg    134760
     aatggcccac caacaagaca ggccctttct gttgggccac cattttgcgt gtgcgttcgg    134820
     cgtcctcggc cagagacgtc aatggcagtt cgacggcgtg aatggactga tggcccttgc    134880
     gcgccaactc gaggaccact tttccccaat gcgccgctcc accccagaag ccgtgcacca    134940
     gaataatagc aggtttgtta ctcatggttt tctccttttt tgaagtccaa agccggcgtc    135000
     gtttccgaac cagcatcgaa cagcgtcctc attcgatttc attaagatcc ggatcaaaag    135060
     actgaacgcg tggctgttct cgtttgttga acagaaggcg caggacatcg ggacgggaat    135120
     agtggccggt gggatcatag gccgccttgg cgaccccaat gaagccgagg tcaatatccg    135180
     catacattat cccctcctcg gtttccggga tagcgtctgc cagaggtgag ccgtccggcc    135240
     cgaaaatcat cgtgaagcca ccaccttcaa gcagcaagtt ctgttttgcc ggtgtgtcca    135300
     ccagcatctc gatcatcggc tttgaaacca aggcacaggg cgcaagcaca taacattggc    135360
     cttcaagcgc atagacctga ctggcggcaa gattggcctc ggcactcagc tgaaacgctg    135420
     caccgcggta gacggagaag cttggccagc ttgcgacatg gatctgctcg ttttgtgagt    135480
     acattgcata ttttgacagc ggctgaatgt gttcggcgca acacagggcg cccagccgac    135540
     ccagctttgt cgaatgcacc gcgatatgcg atccatcgcc ctcgccaaag accgtgcgct    135600
     cggcatgggt cggtttgagc ttgcggcgat tggcgatgac ctcaccgctg tcgctgaaaa    135660
     gcgcctgcgc gagataaaga ctgccgcctg cccgttccgt aaagcccatc acgacgtgga    135720
     tagaattcct tgccgccgca gccctcagcc gttcatagtg gacatcgcca atctccatgg    135780
     cattggcaaa gtatttgccg acaaactgca tcccccaggc cggtgaatcg agccagatcc    135840
     accagggata gccgggcagc cagacttccg ggaaagcgat gagcgacgcc ccttgcgaag    135900
     cggcctgttc aatgaggccg atcgccttat cgacaccctt ttcgatatcg agaaattccg    135960
     gtgcggcctg cacagccgca actttgtatt tggtgggtat gacggttccc tctgttctaa    136020
     ctcagggaac aatggtgcca cagcgcaagt ccccgcactt gggctggctg gcctccattc    136080
     ttgtcggaga cggccatttg atatgcgcgg cacgattctt gcgttataat cggcaagaaa    136140
     atgcacattg aaccggatga ttgaaagcaa agcgaatgat gtctgcgaga tccgacacac    136200
     tttcgctttg gaaggaacag ctttggtcga cctatgttcg tctcgaaagc aaagccgaga    136260
     cagacggatt ttatggcgcg gtccaggagt ttcttccgca cagccatagc ctgagcctgg    136320
     tggattcgac ggcccagctc accgagagaa cgcggcgaca tatccgggcc gatcagcagg    136380
     aggtggtgct cgttgcgttt cagctatcag gatgcgggct tgtcgtccag gatgagcgac    136440
     aggcacggac ggctccaggc gaattcgtcc tttacgaaag catgcgcccc tattccctgg    136500
     gttttgacgg gccattcaag caattggtgc tgagagtcga tcgagagcgg atgatctcga    136560
     cgatgccatg catcggcaat atgacagcca ggacgttcga cgcaaaacag ggtgctggtg    136620
     ccgtcgcgtt ggacttcctc cagagtctcg cggcgcgtgg aagccagatc gacgaaggca    136680
     gcctttcgcc gatggagcgc accgccttcg atcttgttgc caccggtgtt ctgtcgtcga    136740
     ccggagatct ttcaccacgg cgcgtgcttt ttgagcggtt gcgtgatcgt ctcatcgaga    136800
     aagtgcgaga cccttcgttc aatcaaacag atatggcggt cctggccgga atgtccccaa    136860
     ggtctctcag gcggctttgc gcggaaaacg gcatttcacc cggcggcctc attctgagaa    136920
     cgagattgca gggcgcgaca gacagcttcg cgctcgatat caacaagagg cggtccgtta    136980
     cagagatagc tttgagctgg ggtttcaatg acatcagcta tttcaacagg gcatttagga    137040
     ccacgtacgg aatgacgccg aggcagatgc gccactcgca tcaatgaaag gccgagcctt    137100
     cggccatggc gacactcgta ttcaatctgc atgcgctagc gtactgcgtg atgttggccg    137160
     ctaactgcct agttcgaccg atcttcgtct tgcggcctgc accgctgcct caatgaggtg    137220
     acggagaccc ttgccatcct ccatcagcac gtccaaagcc gccgcagttg tgccattcgg    137280
     gcttgtcact tgttcccgca gcgttgccgg tggttcggtg gcctcgatag ccagcttggc    137340
     ggagccaaat accgtctgct tcgcgagcaa gagggcaagc tcctcatcca gccctgcctg    137400
     tatgcctgcc tgacacagcg cctcgatgaa gtgaaatacg taggccggtc cggagcctga    137460
     gacagcggtg accgtatcca tcaaggcctc gtcatcgaca aacgcgacac ggccgatcga    137520
     ggacagcagc tcttccgcca gagcgcgctg aacgaatgtt gtttcagcgc ttggacagca    137580
     cacgatcatg ccctcggcaa tggcggcagg agtattcggc atgcagcgga taatggcggc    137640
     agggcgcttg gcgcgcaatg ccatcttccg gataccgatg ccggccgcga ccgaaatgaa    137700
     gaagccgcca tctgccaaaa gagcggaata tcgctcgaca acatcgccga ccacctgcgg    137760
     cttggtcgcg atcactgcca catcggcttg gaacgcgaca ggcaggtcat ctgcggatgc    137820
     ataggttctg gcgtcggttt ccgccgctct ggctcgcaat gcggcattgg gctcgacaat    137880
     cgtggccatc tctgacggaa acccggctca tcgaatgagg aacggcaaac actattcgct    137940
     ttacccggca tggagccgga gcagacaggc aaagagataa gattgaagac cgatattgtt    138000
     atcatcggag gtggagcgat cggcgcggct gttgcttact tcctgaaacg gacggatgcg    138060
     agcatttcgg tgaccgtcat tgagcgggat ccgacttata atcttgcgtc caccccacgt    138120
     gcttcgggtg gtgtacgccg acttttttcc ctgcctgaga acatcgcgct ctccaattac    138180
     agcattccat tcttcgacga ttttgcggaa accatggccg tcgatggcgt gccggcgcaa    138240
     accgcaaaac cctgaaagcg ggttgtggaa tcgccgacgc gtccgacgtt gccccctgcg    138300
     tgatcctgtc cggccagcag atcttcgccc atacgcatgt tcagcggaag ccggagacat    138360
     agccatacga catgggcgat tccgtcatcg agaaatcggt gcggacgata gaacggatca    138420
     catgtgaatc cgctcacacc gccagatccc acatttcgat cgatgctcgg ttaagctgac    138480
     ggtcacagca cggcccagaa acgaaaaagc ctgccgcggg aggaggtgcg gcaggctttt    138540
     cgaaaagaac cgaacagcga ctgggaggag gagtgtcgct gttcctacag acgtccctgg    138600
     gaggaggagt gggccgtctg aaattcgaag ctctgcggga ggaggtgcat cgcttcgatg    138660
     ggtcgattat acaccggcca cggacgattc ctatacctta tgctgcactg cagttatgca    138720
     agaaatacaa gtcgaaaagg cttacgaata gaacgagaac caaaccgatc ctcaggcatg    138780
     ggagaccgac gcaaaaacgc ccgcgtcatc agcgggcgat gccgaggtcc tgcagttcgc    138840
     ggctggacat acggccgagt tcgctaacgg tctgacggaa cttgcgccag ttattgaaag    138900
     agcgtgctac gttcataata atcctctttc ctgagggctg atgatgtcag caaccttgct    138960
     cggctctggc gtcgtttcga tgatcggaat ataggcgttt caatcgattt aaaacagtgc    139020
     caatctctca cctcacccat gcgtccgacg cgttagttcc gcatattcag caagagatga    139080
     tcatttcttg agcactgaaa cgatcgaacg tcgtcgggtg cttgttcagc ggattggcat    139140
     ccggatagtg atggttctcc gtttgtgaag cagctttatt gcaaacgtcg atcggggggc    139200
     gttgtcctga gcggtaaaat ggcggctacg ccgccaccga tactgcacgc ctcttcctta    139260
     aaacccagaa tgcagcgacc aacagaacga ttgccacgag agagaggatc acagttaata    139320
     tgtagggctg aacgcgagca agaaacggca ctggtccacc agtgcgagcg atagccacat    139380
     ccgcgagcgt aacctttgtt gccggattgc cgaaattcat gagcacgtag ttggagacat    139440
     cgacgatctg ctgatcagtc aaaggcgtga cataggactg cgcaccgaag ccgggcatga    139500
     gcacctgctt gccggccgtt tcgcgatcga cgccataaag aatggtcgcc acgagattgg    139560
     caggctgact ggcaccggtc gcgctgttgt gaaagagcga cggataggca tggttttcgc    139620
     taccagcgcc atcgatccgg tggcagcttg cgcaatagcc gctgtagagc tgcgccccgt    139680
     tgcgaagact attgtgctcg gtctgcgaat aggcgccccg aatgctgctc tcggaactga    139740
     ctgctgcgcc gtactcatgt gcggcgcgcg tgtcgcccgg gtcgcgaatg gctggaacgc    139800
     tcttgaggta ggacgccaga gcatgcaggt cggcgtccgg cagatattgc aagctgttct    139860
     gaacggcctc cgccatgccg cccgctgcct ggttcttgcc atccgcatga ccgtcgcgaa    139920
     aatactggac aagttcatcg gtgctccaac cgccgatgcc gctcaccgga tcagatgtga    139980
     tattgggtgc ataccaggga ccgacggcgc caccggcaag atagctgccg gcactttccc    140040
     ccatcagcaa gccgcgcggc gaatgacagg agctgcagtg acctagtgca cctgccagat    140100
     aggcgccgcg attgatctcc tcggttttgc ttgggtccgg ctgaaatgga acttttgtgg    140160
     aatagagcag gttccagaac atcatcgaga aacggatatt gaacgggaat ggcaagtccg    140220
     tctgattggc tgccttgtca tcgacaggct ccacgccgtt catgaaatac gcatagagcg    140280
     catgcatgtc agcatcggtg atctcggcat aggcggtata cggcatggct ggatagagat    140340
     gaccgccgtc tttgcggatt cccttgcgca ctgcccgatc gaagtcgtct tcggtgtagt    140400
     tgcctatgcc tgccgtcttt gagggcgtga tgttggtgga gtagatggtg ccgagcggtg    140460
     aaacgatcgg atacccgccg gcgaaaggtc tattgctatg gggtacggtg tggcaggcca    140520
     tgcaatcggc ggcggtcgcg atccccctgc ccttttcgac aagtgcttgt ggatcgctga    140580
     tctgggcccc agccttccca actaccagaa tggctgcgga aagggcgagc aggatgactg    140640
     caccccgttt tgcgggacta ttttgcttga agatctttcg catggctcaa gccctcagcg    140700
     atttggaaat gtcgtcggca gccttgatgc cgagagccgc catggtgagc gtactgttga    140760
     ccacgcttgc agacgggatt gctccgccgc ctgggatcca gagattggcg tggtcatgcg    140820
     cacggcaatt accgtcgaca accgaatcct tagggtcgct gcccatgatg cagccgccca    140880
     tgatatggtt gttggcgtta agtgccgtgg taacgtgaaa atcgctggcg ttgaaaagct    140940
     tgccgatatc ctccaactgc ttgacggccg catcgtagcc tttgtgaaca tagtccccga    141000
     cgtcgtaata gacgtccggg caaggtatgc catgcgggtc gagccgcgac ttgctgagcg    141060
     ttacccggtt cttcggatct ggaagaggct caaggctgat cgacagatcg acgccatgcg    141120
     tcgtaaggcg gcgaatttcg gcgtcgagcg ccgggcctac aaggcccttt ttcagcgcca    141180
     ccgacgttgc ggttgtgacc tgagtgatat tgttcaggat catcttgttt gccgaatatt    141240
     ccgaacgaaa cgcaccgtcg cgcggcccaa cgatacaact gctttgcgcc ggtccacgtc    141300
     caatccacag cggctccggc gcttgaaaga agcaatgaaa gccggagtgg tccatcatgt    141360
     tgcggccgac ctggtcggag ctgtttgcga tgccggcagg attgcgatcg ttagcggcag    141420
     ccaagagcag gcgcggcgat tcaagcgcgt tgcaggctat cacgaacgta tcggcggtga    141480
     ccttgtgcga ttgatgctgg ccatcgtacc aatgcaccgc cgtcacgcgg ttattttcat    141540
     ccgtatcgat cttgtagaca accgcttcgg ccagcacaga ggcgcccttg gcttccgccg    141600
     cctgcacgga atgaatggca ttgtacatcg ccccgatcgg acagatcggc tggcaattat    141660
     tgttgccgca acaggtcgga cgaccgttcc aaggccgtgt gctgcgggcc tgcggaatcg    141720
     gtaccgaacg atagccatgc gcattgacaa tttcggcaaa gcgcttgtcg ccatagctcc    141780
     agggcaccat gtccatcggg tagggtttgc tgcgctctga cggcgattgc agcattggat    141840
     cgttggggcc ggcgaccccc atcgcttctt ccgcccgaca gtaatagggc tcgagctcat    141900
     cgtaggagat cggccagtcc cgtccgacac cataggcggt gcgcattttc aggtcgaccg    141960
     gcagatgccg ccagctggat gcggcccaat gccaggtcgt gccgccaaca gttttgagat    142020
     agccctgttt gaaacccttg ccgtctgggc cagacagttc gacatagttg ttttccggcc    142080
     aatagagcgg cgcaggcgcc attttcgatt gcggatagag cccttgaaag tcagaccctg    142140
     cgcggttctt gaacggcatg ttgcgccagt tctccacggc ctggccccgc tctatgcgca    142200
     gcccggcgtc cagtagcagt accgcgtaac cttccccggc aagctgctct gcaatcaggg    142260
     cgccgaccac gccggagccg acaatcgcca cgtcagcctt ggcatcgcca tttgtgaaaa    142320
     cgggagattt catcgtcaaa gcactttcgg atagttgttg ggcatggtgg tgatttcagg    142380
     gggcagaccg gtccaccaca aaggcccctt gttgcagtag gtgggcacgg tcagaccatc    142440
     agcaacgggc cggtacatca gcgcctcggc gtaggagacg accacgggcc ccttcgctgt    142500
     ttcaacggtg ccggtgtacc atgcggtaat gatagcggtc agagtgtcgc caagcccaat    142560
     ggcagatgcc gcagccttca gggcatccgg cgagcccgtt tgccgaacga gcggtacaat    142620
     ctgagccagg cggccttcaa agcccgcatc atcggcttgc agcgctgcat aaatccgatc    142680
     cgccgtcatc ggcgagagat cagacttccc ggtgatcgcg tgagaaacgt cgaggaagcc    142740
     ggagagtccg cgagtcggcg ccgccgactg ggcgcttgcc ggttgccatg caaacccggc    142800
     aaaagagaaa gcggcgcccg caagaagcgc gcgtcgagtg atcggcggca cggtggaaat    142860
     tttgatggaa ttgcctcgcc ctgccaaaag cgggccatcc tgagacttca ctgtcatggt    142920
     catttcctgt gagaacggat cggccgggct ccaagacgag cggtcgtccc taaaggcacg    142980
     aattatccct actcccgccg caggttgaag cggacggggt caatatcacc attttcgttt    143040
     tgatatttag atcgatctaa gtcaagttca ttttgcgtga aattttgcta tcaacttcgc    143100
     gatgcgctaa gcgccgtcgt tcagggcctt gaaactgcat ggatcaatgt cagtctacta    143160
     acttaccctt gaggagccca tttggcctcg gatgacaaaa gaaaacagcg ggtgacactg    143220
     attgacgtgg cgcgcgaagc aggtgtgtcg cgagcgacag catcgcttgt catccgcaat    143280
     agcccactcg ccgcggtcaa aacgcgcgag cgtgtggaag cggcgatagc gcgattgggc    143340
     tacgtccgca atctcaccgc cgctcgcctc agggccagcc aaacaagaat ggtcgggctt    143400
     atcgttccca acctgaccaa tccattcttc gcagagttgc tgtcgggagt ggaagagatc    143460
     atcgacgccg ccgggttgat cgttatcctt gccaacagcc atgatagtgc ttgccggcaa    143520
     agtgcgctga tgcacagaat gcgcgaacac ggcgtagatg gcattatcct atgccccgcc    143580
     tcggatacca cgggcgattt tcttgatgac cagcgcgaat ggcaactctc cgtcgttcaa    143640
     gttttgcgtc atatcacgcg atcggtcgac tatgtgggcg tcgactacgc cggtggcatg    143700
     aacagtgccg tagactatct cgtctcgctt ggacatcaac gcatcgcatt cgccatccag    143760
     ggcgggctcc actctgcatt tgaagagcgt tcggttgcct tcgatcgcgc aatgtcgcga    143820
     aacaatttga atgcggggct tattgtccgt gttccggaaa ccttggcgga gatagcgcag    143880
     accgcggtgc ctcttctctt tgccgggatg accttgccga ctgcaaccat ctgcttcaac    143940
     gacatcgttg caatggggct gtccagtggg ctgtatgacc ataatatccg ggtcggccat    144000
     gaccattcca ttatcggttt tgaccacgtc aggaatggcg aggctatgcg gccacgtctg    144060
     acatcggtct cgacctattc ggacgtcgtc ggtcgcagag cggctcaaag gcttatggca    144120
     agactggaga accccgacgg agaggtcgaa tgggacgtca tcagaacaga tttatacgtc    144180
     ggcgattcct gcgggccggc cttgaattcc tgactcgaaa actgaaggac caatcgtcga    144240
     tctcgacgct ttgatacgac acggatctga tttgatcaca tctcgggcgt ccggcccgtt    144300
     ggcgacgaat gtgaagaccc ccggtgacgg gtgatcggtt cgaaaagtca acgcgataga    144360
     agcgtgtgat atttcgccaa ccatcctctg gtaggcgacg tcttggttat caatttgtcc    144420
     ggccgaacgc ggtagtgctg agacaccatc gcggccagtg gcgcgatggg ggcaatctgc    144480
     atcgcctccc gggcgagttg cgggctaaag ccggactgcg atgacggtgt cgttccatca    144540
     ttcgcaactg tagctttcgc ggctcccaat ggagccggtg tggttccaga caggctctcg    144600
     cggatagtca cagagcggca ttgtcacatt gccatttgcc gatcgcacgt ctatgcggct    144660
     tggcgctttc ccttcttcaa cccaacgacg caaggctatg aacaattcat cccggcccgt    144720
     tgccggctga ggcaaaggca ctttggcaac atctgttggc tggcctgtta caggatcaac    144780
     ggagccagct cgcgcaaacg tcccgtcatg agcaagaccc gggatcataa agagccgata    144840
     gaattctttg agcctcgttg ttccacccat gctggcggaa gcgcgattaa agtaattcag    144900
     gctgccctgc ggcatgatga gatcatcatt ccatccatga taagttatca attttgcctt    144960
     agaattccga aatgccctta agtctgggtc atccgtgttg atattcgaga acggtccctg    145020
     caggagaagg ccaagagcgt aggcatcggc caagctccca taatcaagca tcttccatcg    145080
     atccatccct ttgccgctag gagtatcggg aagcaggccg gcttgggcat agcgtgcatc    145140
     ctgaagttcc aacgccacca ttgtcgaggc gatgggaaat ggtttctctc ccgcaagccg    145200
     cgccaaagac gtgcctcgcg ttaaccccca ccataaatgg ttgccgctga gcattgcact    145260
     catcccattg tccatcttgg gatcgatata cgaaccatcc gacgactgcc caaaccagat    145320
     gcgatttacg gcttcagcct gggtcagcgt gatacatgtg gctgggtcac ccttgcccgg    145380
     ggtttcattg aggatttcac tgctgcagag aacattgata tcgtgacttg ggtcataacg    145440
     gcattgggtc ggatcgagca ggaatccaag ctccttaccc ccacattgag ccgttgctgc    145500
     cgcactcgtt gcgtttaact tagctatatc gatgggacca gcgaacatct tttgcattac    145560
     aagctgagga tagagctcgg cggtgatgaa acgagtccag tttattgccg gcgcgccggc    145620
     caggatgcca tcgaaatcat cgggatattt ctgagccagt ttcaaaccct ggcggccacc    145680
     agtcgaaaaa ccatcccaat aggcgtaaag ctgaggcttg ccataatagg cagcagccag    145740
     atctttcgtc ttcacggcca gttcgtggag gctgcgctcc gcgaaatcgt gccaaagcac    145800
     cgtatttatt cctccatcct catccagcgc gaatgatccg tcggacgtcg tttgacccaa    145860
     atgaccgtga tcggacgagc ttacgacata tcccttcgcc accgcagcca atgttatcgg    145920
     atcagcccgt ccggcgttgc cgatgcggtc cgttttgctt tggtaaccgc ccgcgaaacc    145980
     tccgctgccc gtgaccctta tgatccgatt ccacgcgtcc ggtgatggca accaaacctc    146040
     gatgccaatc ccatccgaag tggatttcag gccggcagtg ccagctttgc cagggccaac    146100
     cagtagcttg accaaacaca tatcaacagg agcttcagga gacggttcgg gagagccgga    146160
     gaggccgact ttctcctctc gcgagaagta cttgactagc agcacccggg tatcgtcagc    146220
     cttgaatttt gacttcagcg tgtcatcgca acgcaagctc ccggcggcat gggctgggcg    146280
     tatgttggcc accattggca acatggaaag ggcaaggaaa gctagcacaa caactgcttt    146340
     cagtttcctc atgatctgtt ccttttcagt ttatgagctc acagacaagc catgcgcgct    146400
     ggtcactccg gcataagccg agcgcgttgt gctaccatcg atatcaggag ctccaaggtt    146460
     gcagcatctc gacaaagcgg tgcctttagg ctttcaccag gatatcgctc caatcctcgt    146520
     cgatccggac gctaattatg agtgcgcgat ggcagggctc ctgattgatt cccgtatttg    146580
     gcaaaatgcc tcgattgccc cggtcaggac atcgggcgcg tcgatgcacg gcaggtgccc    146640
     ggcgccaggg atattttcga aacggctacc ggcaatttgc ccggccgtcg ccgcaacgag    146700
     ttcaggtgga gtcgattggt cattactgcc tgccatgacc aaagtgggaa ccgccaatct    146760
     gcctgccgcc gcagtcaaat cagcgtcacg gagggctagg caggtgttga tatacccacg    146820
     atccgccgtg ctctcgagca tgcgcctcca ggcttcccag gctcgaggtt cgcgcatgcg    146880
     atatcccaac ggaaaccagc gggtcagtat ctgttcactg actatgggga tgccgctggt    146940
     ttcgatggcg ctgatacggt cgctccagcc cgctgctgtc ccgatctttg ttgcggtatc    147000
     gagaaggacg agcctggcaa catagtccgg acactgtgct gctgcttcca tagcaatcat    147060
     gccaccaact gaaaccccac aaaggctaac ttgcgtccag cctatgatat cgagcaggcc    147120
     gagcaaatcg gcagccagtt gtgagatcgt ataaggctgg tcggtcactt ctgacaggcc    147180
     atggccgcgc tggtcgaaaa acagcatttc aaaatcttga cccaatcttt gctcgacttc    147240
     gccccagata cgcagatccg aaccgagcga gttggcaaaa gcaatacgag gtccattgcg    147300
     acggccagat aaccgatagt gcagttgaac gctattgacg gtgatgaatg gcatgtcatt    147360
     gaactcccag atgtcgctcg agcagatcgc cgctagccgc cagttccccc ggactgccct    147420
     cgaataccag gcgccccttg gacatgatca caacacggtc cgccaccctg gagaggctgc    147480
     ggatgtcctt gtcgacgacg atcgtcgcaa tcccctccga gcggatgata tcgagcgtct    147540
     tccagatttc ctgggcgatc agcggggcaa gcccctccgt cgcctcgtcg atcaggataa    147600
     gatcgggatt ggtcatcaat gctcgtccaa tcgtcagcat ctgctgctca ccgccagaca    147660
     attgctgccc gccattgttc cgcctctgcg ccagacgcgg gaaaacagaa agcacgcgat    147720
     cgagcgtcca accctgcttg ccactacgtc caggccgggc tgccataatg agattttcta    147780
     tgacagtgag cgatccgaat acaccccttc cctccggcac aagcgcgacc ccggcgcgcg    147840
     cgatcgtctc gggaagttcc cctcgaacac tgatcccatg cagatctatg tcgccaaggg    147900
     tgcgcggcat cattcccatc aacgagcgca agaatgtcgt cttgcccatg ccattgcggc    147960
     caagcaatgc gatctgctca ccgggcctca cctgtagatc gatgccatgc agtatctggc    148020
     tgacaccgta gaagctttgc aatccttgca cattcaacag caggctcatg ccacctcctc    148080
     catctctccg agataggcgc ctctgacttt tggatcgcga cgaacgtctt cgactgagcc    148140
     ggtggcgata atgtgcccat ccgccatgac cgtcagtcgg tccgcgatgg caaacacaat    148200
     atccatgtca tgctccacga gcagcacgcc gcgccctttt ttcaaagagc ggatgacctc    148260
     cgacatgcgc tttgcctcgc catgccccat gcctgcgaga ggttcatcca gcagcacgac    148320
     gcgaggtccg gtcgccaata ccatggcaac ctcaagctga cgctgttcgc cgtggctcat    148380
     catgcgagcc ttggtctcgg cccgatcgag caggccggta tccgtcaacg cattcagggc    148440
     ctcccgttcg ttttcttcct cccgacttcg caaccgccac atggataaaa cacccggccg    148500
     agcaccctgc gcggcaagct tcacgttctc gaatacggtc cgatcttgaa aaatcgtggt    148560
     cttttgatag gaccgaccca gaccggcgcg gcagcgagca tgcggtgtat acgaggccat    148620
     atctttgcca tcgagctcga tgctgccgga tgtcggtgct agatccccgg ctagtagatt    148680
     gatcagcgag gattttccag cgccgtttgg accaatgatc gcatggattt caccctctcg    148740
     gacggagagt gagacgtcgg cgacggcgac gagaccgccg aagcgcttcg tcagtccttc    148800
     cacaacgaga agctcctttg tcatagctta cctcccaccg ccacaggctg cggtaacttg    148860
     cggcgaaaga atgcctcggt ccccgagaga cgcaaaagat cctgaaggcc accgggaacg    148920
     aagagcacga gcatgatgat gatgagcccg taatacagct tccattcttc gacatagatt    148980
     ttcagcaggt cttcaaggcc gaccaggaga atcgcgccga aaagggggcc ggcaacgcgg    149040
     cgagtaccac ccagcaccac catgacaagt gcggtcgccg acaagtgcca tccaagcatc    149100
     tgaggtgcca caaagccgaa ctgtgcggcc gacagatagc cggcaattcc tgccatcacg    149160
     gcagaaacca caaaggcaac gagacgcacc cgaaagaccg ggatgcccag cgacaaagca    149220
     cgccgttcat tgtcccgtgc ggcggtcaga gcatcgccga agggcgtggc aagaagatgg    149280
     gttatgaggc accagcacgc gacacaggtc gagagtgcaa cgaggtagaa gacgatgggg    149340
     ttttcaagat cgagtaagac gatacttccc gcggccagca ccggcttgac gtaaagaaag    149400
     atgccgtcag atccgccacc aatgccggta tcgtgaaaaa gaaagaataa catctcgccg    149460
     aatgcgagcg tcaccatgat gaaatagatg ccgcgcgttc taagcgacaa caggccgatg    149520
     accagtgccg agaccgcgac aacggcgatc gccgctgcga gtgtgagcaa cagggacgga    149580
     acttcgtatt ccggcgttac gagaataaga gtgtagccgg caagaccgaa gaacgccgcg    149640
     tgacacaggc tgaccatgcc gccaaagccg acggacaagt taagcgccat ggcaagggtt    149700
     ccaagcatca ggactttcgc ggcgaactgc acataataac cggacacgag ccagggcaac    149760
     agcaccgccg cgccgaacat ggcgagcatc ggaatctggg cgcgagagaa cagaggggtc    149820
     atggatcaga tctcccgttt tccgagaatg ccagtcggcc gccacagcag gaccgcggcc    149880
     atgagcacat agatgagcat acccgaaaat tcaggcagga agactttgcc gaacgtgtcg    149940
     atcaggccga tcatcaaagc accgatggcg gcgccaggaa ctgaaccgac ccctcccaac    150000
     accaccacga caaaggacag gatcaacatg ctatcgccca ttcccgggaa caccgttgag    150060
     accggcgcga taacggcacc agcgagagcg gcaagggcta ttcccaccgc aaagacgagg    150120
     cgattgacgc gatcgaaggg aattcccaac gcccgtgtca tgtcacggtt ctctgcccct    150180
     gccctgacga tcatgccgat gcgggtcttg ttgatcacaa ggaaaatgct catcgccagg    150240
     atgagacaga agacgatcaa cgcgagccga tagagaggat aggattgcat atcggtcaag    150300
     ttgattgacc ccgagagcca atccggcacg gggacggatt gcacatcgcg gccaaagagc    150360
     atttggcgaa cttcatcgat aaccaggatc agaccgaagc tgaggagcac ttgagaaagg    150420
     tgatcgcggc catagagccg cctgatgaaa aatgcctcca acaaaagccc caccacgaag    150480
     ctgacggcgg atgcgccgag aatgccgacg accagactgc cgcttgccat cgtaaaccac    150540
     caggcgagat aggctccaag catgtagaat gctccgtggg ccagattgat aacgccgaga    150600
     atgccgaaga cgagtgtcag tccgctggcg acgaggaaca gcacaagacc atattgcacg    150660
     gcgttcaaga gctgtattgc gaatgtgccg atgtccatct gcacctcccg gaaagagtga    150720
     ggtggcgggg tagccccccg ccgttcggtt acgacatgcg gcaaccacga gccgggtcgt    150780
     tcaccgcgtc accggcaatc gacacaagca tgttgcgacc ctcgcggact tctctcaaat    150840
     agatgttctg gatcggattg tgtgccgccg agaagctcag aggtccgcgc gggctgtcga    150900
     gcttggccgc ctgcatcgcc gcgaacaacg cgtcgcgggc ctgactgtcg ccacctgtcg    150960
     cggcgaggcc gacatcgagc agggcggcgg cgtcaaagcc ctgcactgca tagatatcgc    151020
     ccgtgtctcc ggtctttgcc ttgaagcctt ctaggaagga tttgttggcg ggattgtcga    151080
     gatcatctgc ataatgaagc gtcgtgcgaa taccctcggc ggatgcgcct tgcgctttca    151140
     acgtcccgtc tgtcaggaag ccggtgccgt aaagtgggat tttccccttg agcccggccg    151200
     cagcatagtc gacgacgaat ttgaccgcac cccctccggc aaagaaggcg aagacagcat    151260
     ccggcttgag ctcggcgata cgcgtgatga gtgcctgaaa ctccacttcg ggaaacggca    151320
     ccgtcagctc ctcgacgacg gtgccgcccg ccgcctcgaa gccttccttg aaggcctttg    151380
     tcatctgttg tccggcccca tagcgccagg tgatcgtcgc gacttttccg aagccttcat    151440
     cgcgcatgac cttgcccatc ggatgggccg cctgccagtt cgagaaggac gtgcgaaaga    151500
     tattgggagc gcaaagtggg ccagtggctt cgtctgcccc cgcattcggg atgatcagcg    151560
     ggcagcccgt atctcgggct accttgacca tggccatggc aacgccggaa tggacggtac    151620
     ctacgacaaa gtcgaccttg tcgcgcccga ccagcctgtt catgttatct gttgcggttt    151680
     caggtttcga ttcatcgtcg agccgaacga attcgacgcg cctgccgcca agcaatcccg    151740
     atttctgctc gacgtagagg tgaaacccgt tctcgatgaa ttgaccgagc ttggcgtatg    151800
     taccgctgaa gggaagcatg atccccactt ttagcggcgc cccctgggcg atcgctgggc    151860
     tcgccaaccc gaaagccagt ccagcggctc ctatagtggt ggtgccaaga aacgagcgac    151920
     gtgtaacggt cgtttcgaaa attcccttat tgtttgacat gttccctcct ccgttaaagt    151980
     ttgtggctca gccgtgtctc tcctcaagac actggcgcag ccgtgggatt cccggcatca    152040
     gccgctatcg ccgcctccaa ccggtaaaat cgtgccggtg agatacgaag cctcgttgga    152100
     cgccatgaac aggattgcac ccgcctgttc ctccagtgtt ccatagcgtt tcataaagct    152160
     tgattgcttg gtctgggata ccacctcgga catccatcgg cgatcgtcct cactctggtc    152220
     ttcactgttg cgcggaatgc gacgctgggg ggcctccgtc ccgcccggcg ccaccgcgtt    152280
     gacgcgaatg ccgcgctcgg cgttctccat ggcaagagcc acggttaatg cattgaccgc    152340
     tcctttcgct gccgaatagg gcacgcggtt gatgcctcgc gttgcgatcg atgaaacgtt    152400
     aacgatcact ccgccgcctg cttcgatcat caaagggagc accgcgcggc agcaccagag    152460
     cgttggaaaa agcgagcgtc gaatttccgc ctcgatctgc cgttcatcaa aatgctcgaa    152520
     gggacgcatc cagattgcgc cgccgacgtt gttgaccaga atatcggggc caccaatatg    152580
     tgcgcgcgcc tgcctaatcg cctctacagc tccctcccag gcttcaagat cggcaagaat    152640
     ggccgtagcc ttgcctcccg cagcctcgat ctccgcggca acctcacgaa cgacatccga    152700
     tcgatcgatc agcgccagcc gtgcgccttc cgcagcggcg cggattgcaa cttcgcgacc    152760
     tatcccctgg gccgatccgg tgatgaccat cgctttattc gtaaagcggt ccagtttcat    152820
     cacgcagcct ccgcggcatt gaatttctcg aaatagaacg aagccggctt cactccgata    152880
     aggtcgaagt gacggcgcac ggcctctacc atcggtggcg gaccgcagag atagacatca    152940
     ctgtctccgc cattgagatc gtccgcgccg aaatgatcag tgacgaagcc ctttcgcggg    153000
     gcattgctgt cggggtcgga gacgcagact tcgaaggtga aatttgagat ggcgtcggcg    153060
     aaggcttcaa gcttgcacac ctcgacgccg tcagcgtcgc gggtaacccc ataaagcaaa    153120
     cgtatgggtg gcgtgctccc accccttgcg ctgaggtaat caagcatcga aagaaacggc    153180
     gccaaccctg ttccacccgc aagaaaaagc gtcggccggc tcaattcccg cagataaaac    153240
     gcaccggatg gcccccgtat ggtcaggcga tcacctggca ttgctcgacc ggagagatag    153300
     cccgacatca acccgcccgg aatattgcgc acgaggaagt ccacgcgccc gccgtttaag    153360
     cgggatgaga aggaatatgc ccggctgtcc tcggtttgcg gaaccgacac ctgcacatac    153420
     tggcccggca gaaaggcgag gttgtcaggc tggtcgattt ccaatgtgaa accgatcgtc    153480
     gtatcggaca actggcggac ctcggcaaga cttgcgccga actccattgg accgctcttg    153540
     cacatcttcg atgtcgccgg aatcgacagc acgcaatcgc tttttggccg catctggcag    153600
     gttagtacat aaccttgcga ggcttcctcg tcggtcaaag catcctcgat ataggcatcc    153660
     atttcataaa agccggattc gaccctgcat ttgcacgttc cacaaacacc atcccgacag    153720
     tccatcggaa tattgaggcg cgcacggtag gccgcatcga cgagaacctc gttggggccg    153780
     cattcgacga agcgcgttac gccgtcttcg aaattcaggg caatcttggg catcgtgttt    153840
     cctcccgtga cctcagacgt ggtagacgtc gatgacgtga tggatgtaat cgttgacgag    153900
     cacgattttc tttcgcgcga tccgcatgcc gccctcgttg atctcgagcg tgtaaaagct    153960
     cgtgccgtaa tgcgtatccg tcgtcttgta gcggaaattc tgggtcatcc aattgaagcg    154020
     aacttcggcc ttctccgccg tctgctccag gatctcgaca ttcgaaatgt ggtgcagcgt    154080
     tcgcggctcc ggcaggctgg tggcgctgga tcgatccgtt cggatccgga agatccgatc    154140
     ttcaagaccc tgtttggtgg cgtaatacat taaggagatt tccgactgcg gatcctccgt    154200
     caggcggtcg tcgtcgtccc aggctggcat ccagaactcg acatgcggcg cgtaaagcgc    154260
     aagccagttg tcccagtccc gctcgtccag atagcgcgtc tcccgataga gaaactcctc    154320
     gacctgctgg cgtgaaattg tcatgacatc tcctccggca ggccgttgcc agcccgcccc    154380
     tatggcagtg cattgtttga aatgatgcgc ccctccccgg ggcgcatgaa ttatcgcgtt    154440
     ggatcgcgac caatcgcagc cccgagtgcc tttttccagt agctgtgctg gatgacgaag    154500
     agaccctcgt cttcggtctt cgctccagac aggagtggct tcaggccaat cgcctcggct    154560
     ccttcatcgg caccctcgat ccaatgtgtc gcaccgcgac tgagatcgtt ccatgcagcc    154620
     tgccgcgcct gataaccgat ctggcaggaa cgaaactcct ccagatcgtc tggcgtcgcc    154680
     atgccgctgg cattgaagaa atcctcgtac tggcggatac gccgcgcacg cgcggcaacg    154740
     ctctcgccct tcggcgcgat gcaatagatt gtaacctcgg tcttatcgac ggcaatcggc    154800
     cgatacactc ggatctgcga agagaactgg tccatgaggt agacgttcgg atagaggcac    154860
     aggttacggg acctgtcgat catccagtcg gcccaggcct ggccgaactg ttccgtcaac    154920
     tcgccgcgct tttccgcaag cggccgatcc tccgggttac cccagcgcgt ccagagcaac    154980
     aggtggccat gctcgaacga ataaaagcca ccgccctgct tggcccagga cccggcatcc    155040
     atggcgcggg tcacatcttc accggccgcc gcggcaaccg cttccttgcg atgctgcgtc    155100
     gttgcagcat agttccaatg aacggaggag acatggtagc catcggcacc attctccgtt    155160
     tgcagtttcc agttgccatc gtagacatag cttgagctgc cacgcagcac ctcaagcccg    155220
     tccggcgact gatcaacgat catatcgatg atcttccgcg cctccccgag gtgttcctcc    155280
     agcgacagta catcgggatt gagactgcca aacagaaagc cccggtagct ttcgaaacgc    155340
     gcgaccttgg tcagatcatg cgagccgttg gtgttgaatt gctcaggata acctgcccca    155400
     ttcgcgtcct tggcctttag cagcttgcca gtattcgaaa acgaccatcc atggaaagga    155460
     caggtgtagg tggacttgtt accccgctta tggcggcaga tcatcgcccc gcggtgtgag    155520
     cacgcattga ggaagcaatt gaggttgccg gccttgtccc tggagatcac gatcggctgt    155580
     cggccgatat agccggttat gtaatcattc gggttgggga tctggctctc atgagcaagg    155640
     taaatccagt tcccttccca gatgtgctcc atctcgagtt cgaacagctc cgaatccgtg    155700
     aagatgtcgc ggcggcagcg ataggaacca gtctcggcat cctcgatcac ggagccttcg    155760
     agcttctcct cgatacgccg gtcggtggga atatccagca tctttcatcc tcctcaagtg    155820
     atcgggaagg caccagctgc ctggcacctt ccattcggtt ctcaggcagc ttttgcgcgc    155880
     tcgcgctcga cgatcgtatc cgcaacgcct tcaacagcgg gcatcaggac gaaatcgaac    155940
     tcgatgaaag cgtaaggctg ctgcacctga ttctcggcca tcagcttcgg atcattgatc    156000
     cggatcacag gcggaatgag gtcgttgcgg gtgccgaagg caaagtcctc gaagaggtag    156060
     ggatcgccct caatattgat ctgtgtcgtc aggtggcgat gggccggggc ttccacgaag    156120
     aagtggatat gcgcggggcg atgaccatgc cggccaacag caaagaggag ttcttcggtc    156180
     gaaccgcccg gaggcgtgga ataaccgctc ggcatgatgg tgcgaaaccg gtagcggccc    156240
     tcggtatccg tgacgatacg gcgacgcaga ttgtagggcg cctgttgcgg atcaaagtgg    156300
     gaatagttgc caagggtatt ggcatgccag acgtcgacca ccgctccgcc cacgggtttt    156360
     ccgttttggt cgcgcacctg gccctgcatg aaaagcactt cgccttggtc cgagccatcg    156420
     tcgagccggg caaagccctg acactccgga gcacctgcta tgtaaagcgg tccctcgatg    156480
     gtacgcgagg tgccgccggc cagaccggca cgccgctctt cttcgtcgag gcgcagatcg    156540
     agaaaatgct cgaggccgat gcctggtgcg atcaggccga gttcattgtt gcggcccgca    156600
     gcgccaagat aggcgaccgc gctccagact tcgttcatac tgatgtcaag atcgtcgatg    156660
     gcctggaaca gatcgcccag aacacgattc atgatctcct tgatcctgcg atcgccgcca    156720
     tccgtatcca gtccgctcgc gcgccgcgcc agatcctgaa taacgctctt ttcgatgata    156780
     ccacttgcca taacatcctc cttttggcgt ggaagggcga tggtcgctcg cttccctata    156840
     tggtcccttt cactcgaccc ctcccgggcc gatcgtgatg cgctttgcta gctgtcgtct    156900
     tcccggagcg cggaggggtg cctgcatagt ggggccacct tgatccgcat gaagggaaat    156960
     agcggcagcg tcgacaggat ttcgtgaagt tcacccggcc cgctgacatc gaaaatgctg    157020
     atgttggcgt attggcctgc cacgcgccac agatgccgcc attttcccga ccgctggagt    157080
     tcgtgtgcac gctccttttc ggttgccttt agatccacag ccagctgatg tggcagctcg    157140
     tatggcaatt ctaccgtcat ctcgacataa aagagcatat cgtcaccccg caattctcag    157200
     gccgccagca ggcttcgcgc ctcggcgaaa gcggtcgaca gcactttcat ccagcgtaat    157260
     tccgagcccg ggaccagtcg gaatctgcaa ttcgaaatca cgaaaaacga gaggctcgat    157320
     gaggagctct tcggtgagca gcagagggcc aaaaaattcg gtgccccacg gcagatccgt    157380
     tacaccgacc agcaactgcg aggctgcaat ggtgccgact ggcccctcca gcatcgtgcc    157440
     cccatagatg cttatacctg ccgtttctgc gattgctatc accttggccg ccgcgaaaag    157500
     ccctccagct tgctcgatct tgatggagaa gacgtcggcg gcacgtgccg tcgcagcctc    157560
     aagcgcactt tccggcccga caagagcctc gtctgccatg atcgcgattg aagatgcacg    157620
     cgtgagccgc gccagcgggg cgattccggc caccggctgt tcgacaagca cacaaccggc    157680
     atccgcaagg gcatcaatcg cgccttttgc ttcccgctcg cgccatgcca tgttcacgtc    157740
     gacccgaatc gaggctgtgt ccggcagtgc tttcctgatg tcggcaacgt gacgaacgtc    157800
     ttcagcgatg ggcttgctgc cgatctttaa tttgaaatcc ttatgccggc gaagatcgag    157860
     catttgctgt gcctcatcga catcccttgc ggtatcgccc gatgcgagcg tccatgcgat    157920
     cggcaaactg tcgcgccgcc gcccgcccaa caactccgag agaggaagcc ccagtcgacg    157980
     cgcgtgacaa tcaagcagcg ctgtttcgac cgcacacttg gcgaagtggt ttcccttgat    158040
     cgccttggaa acgatgtcca tcgcagcttg cacgcgcgta gcgtcccgac cgatcagcaa    158100
     gggagcgacg tactggtcga tggtgagctt cattccctcc gggctctccg gcccgtatgc    158160
     caagccaccg atagttgtcc cttcacccgt gccttcaaaa tcgtctgaac aacggatgcg    158220
     gacgatggtc atactctgct gactcatggt gaccatcgac agcttgtgcg gtctgatagt    158280
     tggcaaatcg agtataatcg tctcgatcgc ggtaatgcga attatgccag acacaacact    158340
     tcctcccttg gtctataagg aggctagcct tcccaagaga aacagtccaa aactataaaa    158400
     gtcgaatttc ataccctgga ggtatagtaa ggtggaactg cgccagctta gatattttgt    158460
     ggccgtggca cgggaacgaa acttttcgcg tgccgcggag attctgcata tcgcccagcc    158520
     acccctcagt cggcagatcc agcaactcga agaggaattg ggtgtcgatc tcctcgatag    158580
     atcgaaaaga cctctgtcgc taacggaggc cggacggttc ctatacgagc aggccgccaa    158640
     gacacttgtg aaccttgaac acatccggga gcaaacgcgt cggatcggcc gatctcaacg    158700
     cgaaaggttt atcatcggct gcgttggttc aacactttac ggcggcattc cagacctcgt    158760
     gcgacgcatg cggatacagt ggccggagct cgacattgag ataagggaaa tgatgtcgac    158820
     tgaacaagtg accgcgctca aggaaggacg catcgacgtc ggcttcggcc gggtccggtt    158880
     taacgaccgg gaagtcgagc gactgacact tcgcgaagag cgcctagtcg tagcctttcc    158940
     gaaagggcat gtgaaatcat ttgagaaaga gcctattgcg ctcgccgagc tgcaaggtga    159000
     accattgatc gtctaccctt cagtgcctcg gccgagtttt gccgatgaaa ttctgaatct    159060
     gctgggcgag ttaagtgtca cgcctggatc ggtcgaagaa gtccgtgaaa tccaggctgc    159120
     gttgggtatg gttgccgccg gcgtgggact ttgcatcatt cccgccgcgt cacagagaca    159180
     aagaccggat gacgtttgct acagaatgat cggggacgag aaggcgacct cgcccatcat    159240
     catgagcttc cggcgctcgg acgcagacgg taaaatcaat cagatcaagc aactgatccg    159300
     tgaaatgtat gcggataatc cgccgtggct gcagttatcc aatgttcgct tgggcgaggg    159360
     ctgaaacaga ccgaccaggc ggcatataaa gcctcagcgc ttgcaacaga atgcagcggc    159420
     agtcgaagat gtgagagtaa cggtcaggaa tatgagagcg ccagataagc gctttcccgt    159480
     caaatgatac taagctgggg cttcacatca agggagagga ggccctgcta aaatgaattt    159540
     gcttagaacg agcgaaaact ctcagcccac aaccgcccaa actggagcgc aaccgcgtac    159600
     gccggtgctt ctctttatca acggtacctg gcggccagcg gcatccaccc acacgtttgc    159660
     cgacatcaac ccgacgacgc ggttgtcata tgcaacggtg gcggatggca acgtgagcga    159720
     cattgaatcg gccatcgccg ccgccaaggc cgcccagcca gcgtgggagg ctctaccgcc    159780
     ggccgctcgc tccgggtttt tctacaaggc cgctgagatc tttcagtcca gccaggaaaa    159840
     attcgtgaac gctttggtgg aagagacagg gtccggcctt gggaaggcga tgttcgaatg    159900
     ctcgctcatt ccgctggcac tccgcgaggc cgccgccctt accacacgcg ccacgggtga    159960
     aatcctgccg tccaacatac cgggcaaggt caacactatc tcacggaccg ctgcaggggt    160020
     tgtcggtgtg atctctccgt ggaatttccc cttgtatctt tcgcttcgtg gctttgtcta    160080
     tgcattggcg ctcggcaata ccgcggtcct caaaccatct gaggattcgc ctatttcggg    160140
     gggcaccata ttggcggagc ttttcgaggc cgctggtctg ccatctggcg tattcaacgt    160200
     cgtgacctgt agccgcgaca aggtaaaggc ggtggctgcg gcaatgatca acgatccgcg    160260
     cgttgcacgg atcagcttta ccggctccac ggctgttggc cgagaggtgg ccacgacttc    160320
     ggcggcgcaa ttcaaacgag tcgttcttga acttgggggc aagaacccgg tggttgttct    160380
     cgatgatgcc gatgtggatt atgccgtcaa tgtcgcattc ttttcggcct ttcttcatca    160440
     gggccagatc tgtatgtcgg ccgacaagat catcgtggcg cgcaacctct atgatagctt    160500
     cgttgagaag cttatcgcca aggtctcgat gttcgagccg ctcgaaccgt caaatcccat    160560
     ggcagtcata gctcctataa tcaacgatcg acagctcgac cggatcgaca ggctcgtcaa    160620
     gtccgcgcgt gacgccggcg ccaccattca tctcggtggc gagaagctgg gccctttcta    160680
     tcgtccgaca gtgatgaccg gtgttacgcg cgacatggat atctatcgcg aggaaatttt    160740
     cggcccggtc gctttcgtaa tgcctgccga cagcgaagag gaagccatcg ctctcgcgaa    160800
     tgatacggtt tacggccttt cgtcctcgat catcaccggc aatgccaccc gcggtcaaat    160860
     acttgccacg cagatcgaag cgggaatggt ccatgtcaac gacacatgtg ttcacgatga    160920
     gcctcactgc ccctttggtg gcatgaaagc atccggctgg gttggaaagt ggggtgcatc    160980
     cggtgcgatc gaagccttca ccgagcagag gtggatatcg gtccagacgg tgccgcgcgc    161040
     tttcccgttc tgagaaccgc tgctcgggct cggctacccc attatccggc atccaggatc    161100
     gaacagatga cacctcctgt cttttcgcgg ttcgcccgag gcgaccgttt gaacaccctt    161160
     gaagcagcgt tgtaccatgg caaagtgggc cgcaggcaat tcatgcaatt ggccatggcc    161220
     gctggcgctt ccctcacagc tgctcgcaca atggctcaag atggtggcga tgctgctatc    161280
     acgcagcttt acaatgccca caacctcaag aaagcgtacg actatattgt cgtgggcagc    161340
     ggcagtggcg gggctgtcgt cgccggccgc ctcgcgaccg aaacggatgc tgaggtgttg    161400
     ttgctggagg cagggagtac cgatcagctc aatgcggtct tgaaccccgg cctctggccg    161460
     accaacattc gttcagagcg ggattggggt tacactgcgg atccagcgga tagcgttaac    161520
     ggacgcgccc taatcctgcc gatgggcaag gttgtcggcg gaggctcttc cgtgaatgca    161580
     atggtttggg cgcggggcca caggaatgat ttcgactttt gggcgtcgga aacgggcgac    161640
     gacagctggt cctacgcttc agtgcttgag atctacaagc gaatagagga ctggcaaggc    161700
     aaaccggata cgaagcgccg cggtgatggg gggcgactgt ggatcgagcc tgctcgagat    161760
     ccgaacccca ttgctccagc gtttctcagc gcggctgaaa gcgtgggcat tcccaccttc    161820
     gaagacatga acggcgagat gatggagggc gctggtgggg ctgcgatcgc gaaccttcgc    161880
     attcgtgatg gtcgccggat caatctcgct catgactatc tttatgcggc cttgaaacgt    161940
     cccaatctaa cgctgttaac cggcgcagaa gtcctttcat tgacggtgat cggctcccgg    162000
     gtcacaggcc tgacgttcag cagaaatggc gtgactcatg cggtcgaggc caagacgagg    162060
     atgctgctgt cggcgggcgc catcaacacg cccaaacttc tgatgctttc cgggatcggc    162120
     gatgatacgg aactgtcgaa gcatggcatc aagactgccg tgaaactgcc gggcgtaggt    162180
     cggaactttc aggatcatgt tcttgtggcg ggttgcctat gggaatacaa ggtgccattg    162240
     ccgtcagcca acaatgtagc cgaagcgaca ttgttctgga aaagcgacgg ttcgctggac    162300
     acaccggatc tgcagccttt ccagatcgag gtgcctttcg cttcggaagt cacaagtccc    162360
     cagtacaatc cgccggcagg cagttggaca atcgcgcccg gcttggttcg acccaagagc    162420
     cgtggccgcg tctatctgtc gtccgccgac cccagggcga tggcccgcat cgatgcgcgg    162480
     tttatgtccg accccgctga tctgaaggca atcctgcgtg gaatcgaact ctgccgcgaa    162540
     attggaaact ccgaagcgat gaagcccttc gtaaagcgtg aaatcatgcc gggcgcactg    162600
     gataaaacag cgatggcgaa cttcgcgagg gatgctgccg gtacctactt ccacgaaagc    162660
     tgtacttgca aaatggggcg cgacgagctg tccgttgtag acggtcggct gagtgttcga    162720
     ggcgttgagg gattatccat tgctgacgct tcggtaatgc cgcgtgtctc gactggtaat    162780
     acaatggctt ctacggtcat catcggcgaa cgaatggccg atattcttct cggatgaggt    162840
     ggatcaggtc gagctggctc ggccttttcc ttcgcccgca aagtattatt gaatatacgc    162900
     ccgtacgtct gggcggagac gtttgcgaat accgcccggg gtttctcctg tcacccgccg    162960
     aaacagccga gagaaatgct ccacgctcgc aaaaccgaga tcaaatgcca cttcggtaac    163020
     gggcgtggta gcgagcaggg cgcgagcccg atggatacga cagtcattgg caaatttggc    163080
     cggcgtgacg ccaaagcgcg ccttgaaacg tcggaagaaa gtggcctcac tcatgcatgc    163140
     tatttgggcc aaatcctcga tcgcatatcg ttctcgcgga ttatcgcgga gcatttcagc    163200
     ggccacgtcg aggccagttg tgggcgaaaa cgtccgctgt tccacgagaa gttcgcgcga    163260
     ctgtgcctga aggatacgca agacgagctc ctcatgaccg agatccacaa ggacatcccg    163320
     gaacgggctc ttctcgtccc tgtagagcgt catcaatctg ttcatctgcc caaggatcgc    163380
     tagatccttc cggaaaaccg caaaacgagt ccaatccaac gaaaaccggc catcgagacc    163440
     gagccgtttc tggccctgat taacgcgttc gacaatttca tcaacctgac tgcgatctat    163500
     ttctatacat atgcattcgg ttggatcttc aggggaggct tctggaaata ggatttccaa    163560
     tggcatgcct ggagcaacga gcatggcttc gccaggcaga aaatcgaaag gcttggagcc    163620
     gttgacccgc atgatcttat gaccgcgcat catctggcag acgattggat tgggaaagca    163680
     gaggctcact tccgcaatat ggttcgtcag ataacttgat gcctcgctgg cggcgctatg    163740
     ccggaccatg cgatattcga tgagtttttc cgttacattg accatttgct cctcctccca    163800
     aaggaacctg caaatgactg tggtgctaca gcccacatat gcagttcgct agcctcctag    163860
     cttccatcct gaaggcacct gtatcaatgc catgccgggt attgttccat accttttagg    163920
     catactcatt gcgccgatta caagcgtttt gcgcagtttg gattaggcaa tcaagaattg    163980
     tgcaactgcg tcttcctgcc aagcaacgcc tgttcccggt tcttccgagg ccaacgcaaa    164040
     gccatcctgg attgtcatcc cttgcaacag aacaggaccg gcaatatcca tatgctctaa    164100
     tcggtgtgcg gttggcgatg cagccaggag atgtacactg atttcctgaa atagatggct    164160
     cgagagcggc aacccgtgct gctcggcaat cgcactggcc ttcatccatc cgcacacgcc    164220
     gccgattttc atgacgtcca ccatggccag gttgctcgcg ccggccttta cggaaagcat    164280
     catttcttca ggcccaaacc aattttcgcc catttgaacc gacgtggtca gtgctcgggt    164340
     gatttgcccg tgtccatcat aatcgtgttg gagagtaggc tcttcgatcc acgttatacc    164400
     ttcttccgca agggcgcgtc ctcgggttat ggcttcaggt accgagaggg cctgattgta    164460
     atccaccatg atttcgaact gagggccgac tgcggaccgg atcgcccgaa tgacggtgag    164520
     ctcctctgca aaggaagcat agccaatctt tgtcttgatg ccgcgaaagc ccgccttggc    164580
     ggagcgaacg gccctctcca ccgccaaagc ctctccgtcc atgctgtggc tgtcataagc    164640
     ctgaattggt cgcggctccc ctccgatcaa ccgaacgaga ggcattcgct gctctttcgc    164700
     aaacgcgtcc caggcggcca tctcgatgcc ggccagagcc atacgcatca aaccagtgta    164760
     cccgagcagg cgaaagcttc gccgaagacg ttcctcaagg gcccggggcg caacggattg    164820
     gccaatgatc gtgcccgcaa gattgtctaa cagggcgact aaaggctgta gggtcaacgg    164880
     tgcatagccg aagatgtaag catgcccgat aatgccggcg tcggtgaaca ggtcgatcag    164940
     taccaacgga gaagcagaaa ctgtaccgga cgctgttctg atcgggaact cgagagggac    165000
     gagcaccgga cgcgagcgaa tagcggtgat cttcatcatg aacgtttttc ctcgttgtgt    165060
     ctgccgaatg tcggaaccaa gaagtccgag gagagttgag cgacagaatt gcagccgata    165120
     agcgcgagtg tccgatcaat ttcagtgcgg aggatcgaca gcacgtcgtc gataccaggc    165180
     tcgcctcggg cggcaagtcc atagagggtt gcccgtccca acaggacaat cttcgcacca    165240
     agcgccaagg ccttgacgat ttcgccaccg cgtctgaaac cactgtcgat caggattggc    165300
     ttcgtcacga gtcgcgccgt ctgggaaaga acctccatgg gtgaaaggca gctatcgacc    165360
     tgccgccccc catgattgga aaggataacg ccgtcagcac caagctcaac gcacttttgt    165420
     gcgtcctccg agcgcaggat ccccttgacg aggagccgat gaggccagcg atcacgcagt    165480
     cttgccagat cttcccagct gaaactggca tccatctgcc ggctcatcag ggcggcctgg    165540
     gcttgcgggg tcgcggcggc cgcgcctctg aaattggcca gctgcgggac gcccgtcctc    165600
     atgagatcga gcgaccaagc aggatggcga agaccatcga ggatgacctt tggggtgtag    165660
     cggagcggta gaccaaagcc actgcgcatg tcgcgttccc tgtacccatt gacggtaacg    165720
     tcggtggtca gaacaagggt cttgtagcct gcggccagcg ctcggtcggt caaagagttg    165780
     gcaagatccc gatgtacaac atagagctga aaccagagtt caccgtcgca gttggacgcg    165840
     acctcttcaa ttgtcaagtt tgaggccgtg gacagaacga agggaatgcc caatcttgcc    165900
     gccgcctgag caaggagcaa atcgccattt ggccggaaaa ttccgttaag ccccgtaggg    165960
     ccgatcatga acggcaacgg ataccgctgt ccgaacaatt caacagttag atcccgccgg    166020
     ctgacgtcaa tcaatcgaga cggtttgaaa tgccagtcca ggaacacatc gcggttatgc    166080
     cgcaacccgt attcatcctc cgcgccacca tcaagatagt caaaaaccat ctttggcagg    166140
     cggcggcggg cgaggtgtcg gtagtcctcg actttgatgg attttcccat cggatcaacc    166200
     tccgtgcttg gtcaaaacct cgatcaggat aggggtatcc gaggacaggg cttccgtcag    166260
     tgcatgcttg aattcttccg catttctggc tcgatgcgcc tttacgccgt aacccgtagc    166320
     gagcgcctgg aagtcgatgt ccggcacatc gagaccggga acgttttcga ccttcaacac    166380
     tccggcaaac cagcgaagcg caccgtaggt gccatttttc atgatgataa aaatcgtggg    166440
     aatcttatat tgcgccgcgg tccacagcgc ctgaatgcca tagttggcag atccgtcgcc    166500
     aatgatggcg ataacacgcc gttctggttc tgcaagctgg acgccgacag aggcaggcat    166560
     cgcaaatcca aggccgccgg cggcggcgaa gtagtagctt ccgggctggc gcatccggag    166620
     gcgctcccaa agtgcagccg ttgttgatgt tgactcattc aggtagatag cgttttccgg    166680
     tgcaagatcg tcgagtatgt caaaaactgc ttcaggcagt agcgcgccac tgctcgctgg    166740
     tgccctttct gggcgtggca atgcctcgag atcggcgcgc gcgcccgcaa ccacgcgctc    166800
     gcaaaggcgc ttcaatacac ctccaacgtc gccaacaatt gcatcaccca tgggcgcccg    166860
     agcggcctca agagcatcac aggtcacaga gataaggctc gcgccttcgg ggagccaggc    166920
     accaggatcg tattgatgat atcgaaacac cggtgcgccg aagaccagaa taaggtcgtg    166980
     cccactcaat aggcgcgaga tcgaggcaat acccgccggc agcaatccac gaaaattctg    167040
     gtgggtcgtt gggaaaggac aacgcggcgc ggagggagca acccacaccg gagcggcgat    167100
     tttctccgcg agagtaaccg cataactgtt ggcgcgcgca gcatctacat cgggccctag    167160
     cacgatgacc ggattgcgcg ccgacgcaat cctatcgagg agcgcggcca accgatgttc    167220
     gtccggcatt ccggcggcct cgacctttcg catattgact gcatccgaga aaggcccggc    167280
     gggctgctcc caatcattgt aagggataga gagatatacc ggtcccttgg ccggaagctc    167340
     agcgatgtga tacgcacgac tgaaggcatg cggaacttcc gaggcactcg cgggctcgta    167400
     actccacttt acaagaggcc gcggaagcat cgcggcgtcg acgttggcca gcagtggctc    167460
     cgccccgatc atagcgcgtg tttgctgccc ggcggtgacg ataattgggg tatgcgagtt    167520
     ccaagcgttc gcgagagccc ccatgccgtt gcccgtgccg gctgccgaat ggagattgac    167580
     aagcgaggcg ttgcccgtcg cctgcgcgta cccgtccgcc atccccacga caactccttc    167640
     atggaggcca aggatataac ggaagtcggc cggaaagccg ttcaggaacg gcagctcatt    167700
     cgagcctggg ttgccgaaaa cggtggtcag gccaacgctc ctgagcaatt catatgttgc    167760
     ctctctgact gtcttcaaca caacctcctt cgtttgaagg cagtcaaaac taaaacaatt    167820
     attagtcaaa tcgcgattgt tttgattaca atatagattc cctctatatt gtaatcaaag    167880
     agaacgatgg agaggcaatg actgacctaa atttaatccg tgcgttcatc gcgatctacg    167940
     agacggagag tgtcagcggg gcggctgtca agctcaacct tacacaaccg tcggtgagtc    168000
     acgccttgag ccgcttgagg gatatgctgg acgatacgct cttcacccgc acccgcgacg    168060
     gcatgaagcc gacctttgta gccgaacgga tgtacggtat ttttcgatca gctctttcag    168120
     agattgaaac cgccatagcc agccggtgga gcttcgatcc gaagtcgtcc aatcaagttt    168180
     tcaaattagc attctccgac ctaggcgaaa tgacattttt gccgcacatt ttgccgcgcc    168240
     taagccagga ggcgccaaaa gtcggcatcg aggttgtcga acttgaagtc gagaaactgg    168300
     atgactggtt tgcgaccggc aaaatagatg cggcgatctt caattccaca agtgcaaaag    168360
     tgcaatctcg ctcagagccc atcttccaag agcgctacgt ttgccttgtt agcgcccggc    168420
     atccgcgaat tcgcgaccaa gtctcccttg agcaatattt atccgaaggg catatcgtcg    168480
     tttcgtccca ttccgggcat cgtcaagtcg aggatcagat tcgggcgatt ggtgcggccc    168540
     gacaggtttc cctgcgattg cctcacttca ctggccttca cgacatcgtc gcgaaaaccg    168600
     agttgctcgc gacacttcca tctcgcacgg cccacatgtt cgcgagtagc ggtatggtta    168660
     aatattgcac aattcctctt ccgatccctg aatttgaagt caggttgcat tggagagaga    168720
     cagatggcga gatcgaggct caggcctggc tacgcgagat tctgaaatca tgtctgcaag    168780
     gcctatagtc tatttcggac gaaaagaatt gatattatcc gcggtggtcg atcgagaggg    168840
     cagaacagac gccggacgtc agaggcatat atactggtgg caggcataag caaaacggcg    168900
     tcttgaaagc acaagccggc atagacttct gaatgagcat cagcatcatc ttcagagaga    168960
     gcctatcgcc accagattcc tgctgccatg ctccttgtcc ggaactcgcg gcccaggata    169020
     gttttcaagg atgaactgca gaactccata ggaaaactct ccgttggaat cctccgtctt    169080
     cggcgagaat gctcgagggt cgactgtagc cattaccaga ccctcctctt cgtgcgggat    169140
     tagatttcca atttcagctc cattgccccc atatattctg gcgtggccac cccccttggg    169200
     cacccatctg ctcgcgggga tttcctgaaa tctcgaatat gcttcgtcgc ccacgatgct    169260
     gcacgggacg attgtgacag cgccggtaat tgtcgcgtag tagcgcgccg cggcgagatt    169320
     gactgcaggg ccggcccaat tgaacccgtt ggcctccggc agtatgggcc aagcgccgat    169380
     atggatgtgt tccatctgtg actggaggat ataagtcatt tgcggatgca tatgctccca    169440
     gcaactaagc gagccaacgc gaccgatctc tgtctcgtag accctcaggc ccgacgcatc    169500
     gccgtcactc catacagttc tttcgccacc agatggacga agcttgcgac ggatttgtac    169560
     agggctgcca tctgccccga tcaaagcctg tcccatatag aggtaatcac cttccagctc    169620
     gctgtaccca agcgacacga aaattttctc acgtgcggct gcctccaata gtagccgcca    169680
     ttcctcactg cctatctgca gcgagttggc gacgtattgc ttcaaatggg ccttcttcca    169740
     ttgttccgat tcatgaccga acggataccc gggcagccat aattccggga aggcaacaag    169800
     cttggctccg gcactcgcag cttctccgat caagcggatc gtcttgtcga cgccgccttt    169860
     gagatcgagg tagaccgctt ctgcctgtac ggcggcaacc ttgaactcct ccgtcaggcg    169920
     acttcccggc aaagcatgtc cggatgcgga ttgcgccgcg tccgcagcat gcacatcctg    169980
     tgctagacga gtaagataaa gagcggcggc agatgccccc agcatttgtc gtcttgaaat    170040
     atccatttgt gttctcatgc ttttgagagg cgaactcgga ttgacaacct ttacggcagc    170100
     caatccatag ccgtcgcgtt attcgatttc tgtgtagtcc gtctcgaaag gatggacacg    170160
     ctgttgtcca ttccggttga acaggaggcg gagaacatcc gggcgagaat agtggccaac    170220
     cgggtcatag gcagctttcg ctaccccgat gaacccgagg tccacttcag catacatcac    170280
     accctcctca ttttcgggaa ttgccttggc taggggcgcg ccatcgggac cgaagatcat    170340
     cgtgaaacct ccgccttcaa gaagcagatt ctgcttcgag ggagtgttca ccagcatctc    170400
     tatcatcgac ttggagacaa gcgcacacgg cgcaagcacg tagcactgcc cttcaagcgc    170460
     ataaacctgg ctggcagcga gatttgcttc ggcgctcaat tgaaacgctg caccgcgata    170520
     gactgagaaa cttggccaac tcgcgatatg gatctgctca ttttgtgaga acattgcata    170580
     ttttgagagc ggctggatgt gttccgcgca acaaagcgca cccatgcgcc cgagttccgt    170640
     tgtgtgaacg gcgatatgcg atccgtcacc ctcgccaaag actgttcgct cagcatgggt    170700
     aggcttgagc ttgcgacggt tggcaatgat ttcacctttg tcgctgaaga tcgcctgagc    170760
     gatgtatagg cttccgcctg cccgttccgt gaaacccatg acaacgtgga tagagttgac    170820
     cgtggccgcc tcgcgcagtc gctcgtagtg cgcgtcgccg acttccatag cgttggcgaa    170880
     gtatctgcca acaaactgca ttccccaagc cggcgaatcc agccagatcc accaagggta    170940
     gccgggaagc cagacttccg ggaaggcaat aagcgaggcg ccgttccggg cggcttcctc    171000
     aatgagagag attgccttgt cgacaccctt cgcgatatcc agaaattccg gtgctgcttg    171060
     cacagcagca actttgtacg ctattttgac catgtggccc tctctttgct ccccttgacc    171120
     ctataggcat cgcataacgg actgcggagc gcttggtcat gagggccgca atccttgtct    171180
     cacatggcca tctggattgc tgcggcacgt ttcttgctta gtattgagat gctcgtgaca    171240
     gcagtcacat gagtgccgtg agtttgcagg gatgattcag gacgcgaata cgctatcggc    171300
     gtggagagaa cagctctggt cgacttacgt tcgacttgag agcaagagcg atgcgcgcga    171360
     tttttatggg agagtcgtcg agtttattcc cggaacccat agtctaagcc ttgtggactc    171420
     gacgagccaa ttgacagagc gcacgaggca tcacgtccgc accgatcatc aggaggtcgt    171480
     gctggttgca ttccagttgg caggtcaggg attcgtcacg caagatgacc gtgagtctaa    171540
     gacgatacca ggccaattcg cattctacga aagtgggcgg ccctattccc tctccttcga    171600
     ggggcctttc aaacagctgg tgctgcgcgt gaatcgggac aaattcctat ccaggcttcc    171660
     ggggctcggc aatctcacgg cgcgcacatt tgaagccagg cacggttgtg gcgccgtagc    171720
     actcgatttc ctacgcagtc tcgccgctcg cggccccggt atttgtgatg ctcagcttgc    171780
     gttgatggag cgtgtagcga gcgatcttgt tgccggaagc atactatctt tgacaaccgc    171840
     cgtttcccct cgtcgggccg ttctcgagcg acttcgaacc cgtattatcg aagaagtcag    171900
     ggatccatcc ttcgacccat tggacatggc gacgattgcc gggatgtctt cacgttcgtt    171960
     gcgccgtctc tgtgctgaaa atggtacgtc cccggggcaa ttgatactgc aaacgcgact    172020
     gcaaggtgtg aaggatgatc tctcgactgg caccaacgcg aaaagaaccg tcagtgacat    172080
     cgccttgagc tggggattca acgacatgag ccacttcaat cattccttca aagcagcata    172140
     cggaatccca ccctcaagga tgcgcatctc aaactagaca gaatctcagc tgtcgtttca    172200
     caggagatgc aaacccaagt gtccagattg cctctgggcg tacgacggcc cttgcatccc    172260
     ccagcacgac ggcaggggga gcgatctgtc tgacctaatc acgatcctca caagagccta    172320
     ttgctcttac tgagccaact cggtcgctgc ctcatcgata aggcctgcga cctcgacaga    172380
     ctttgatata agcgacgcat gacttgcctt taaggtaatg accttccggg cattcaggcg    172440
     cgccgacatc gccacctgat tttcgggcgc aatcatccgg tcctcgctag atatttgata    172500
     ccaggacggc ttcttcttcc aggccggggc ggtgacggca tctccaaagg tactggccag    172560
     cggcgccttt tgggttgccg ccataacgaa accctcttcg ggcgtcatat cctggcagaa    172620
     gctttcatgg agcctatcgg ccttgagcca gaggtagcca tcgctgtccg gctcgatatt    172680
     ggccattgcc gcgggagggt gctgctgagt gatgccgccc ggactttcgc cggcgtcggg    172740
     cgcgaaggcg gcgatataga caagccccgc cacattcggc tgatctccga tttccgttat    172800
     gaccgcgccg ccatatgaat ggcccaccaa caagacaggc cctttctgtt gggccaccat    172860
     tttgcgtgtg cgttcggcgt cctcggccag agacgtcaat ggcagttcga cggcgtgaat    172920
     ggactgatgg cccttgcgcg ccaactcgag gaccactttg ccccaatgcg ccgctccacc    172980
     ccagaaaccg tgcaccagaa tgatcgtggg ttcatttgtc aaaattctct cctgttatcc    173040
     tgaaagaggg cgatacgatc cgtaaacgat gagccgcaaa tggccagaat ggaaatgacg    173100
     agatcccttc cccaccttat agaaacattg actgcagcca gcacgaagta tccggtgacg    173160
     tccgatggga ttcgaaactc ttggcatttc ggtcgcattt ccctgattcc acaaaaaatg    173220
     aacgacggct gcggcttgcg gatcaacctc ccagcctgct gttgccgtct gcgacgatca    173280
     gccgtatttc cgattgcagg acgaatgata ttatcgtcaa tgtcattatt gactgcattc    173340
     aatatagata cattttcttt attgattcca tatagcatag tgacgtctgg catcgccacg    173400
     cggcaagatc gagcggactt tcgagccccg caacaaggga cgctgtctat tggaagcgac    173460
     aacaatgagc gcgcaatgta taggaacgat catccctcgg gcaccttcac ccctggtctt    173520
     cgtcacatcg aagacgctcg ccgataattt caacgtcaag gtcgacgcga cccggaagca    173580
     cccagcgtcc tctagcgagg agactgcgcc atctggcgaa gatcggatgt atcctgcttg    173640
     cgcttcggcg atattcaacg ataggcgccc atgtttggac taacggcact cgaactcgcc    173700
     cgaattcaat tcggctttac gatttcgttt catattatct tcccggcgat caccatcggt    173760
     cttgcgagct atctggccgt cctggaaggt ctctggctct ggaagaaaga cgcggtctat    173820
     cgcgacctct atcatttctg gtcgcagatt ttcgccgtga atttcgccat gggcgtcgtg    173880
     tcgggcctgg taatggccta tcagttcgga acgaactgga gttacttttc cgctttcgcc    173940
     ggaagcatca ccggaccgct tctgacctat gaagtgctga cagccttttt tcttgaagca    174000
     gggtttctcg gcgtcatgct cttcggttgg aacaaggtcg gaccgggcct gcattttctg    174060
     gcgacgatca tggtcgccat cggaacactg atttcgacga cctggattct cgcatccaac    174120
     agctggatgc agacaccgca aggcttcgag attgtcgacg ggcgggttat tcccgtcgac    174180
     tggctgaagg ttatcttcaa cccctccttt ccctaccgcc tcgcccacat gacggttgcg    174240
     gcctatctcg cgaccgctct gttcgtggcc gcctcgggcg cctggcacgt gctgaacggt    174300
     cgcgcgaccg ccgcaacgcg caccatgttg tccatggctc tgtggatggt gctgatcgtc    174360
     gcaccgctgc aaatcgcgat cggtgatgct catggtctca acacactcga gcatcaaccg    174420
     gcaaaaatcg cggcgatgga aggccactgg gagaacaagc caggcgaaag cgttccactc    174480
     atcctgttcg gctggccgga catgcaggcg gaaatgacgc gttacgccgt tgagatcccc    174540
     taccttggca gcctcatcct gacgcatgac ctgaatggcc ggatcccggg gctcaaggaa    174600
     tttgcgccag aggatcggcc gaattccacc atcgtcttct ggagcttccg gatcatggtc    174660
     ggccttggaa tgctcatgct tcttctcggc gtgagcggcc tttggatccg gtggcgcaaa    174720
     cggttgttcg atactccctg gttcctacgt tttgccatat tgatgggacc gacggggctg    174780
     atcgccattt tggccggctg gtttaccacg gagatcgggc gccagccctg gatcgtctat    174840
     ggagtcatgc ggacgaagga tgcggtttcc aatcattcgg cgttgacgct atcgacgacg    174900
     ctggtcgtct ttatcgtaat gtacgtcgct gtcttcggca ccggcatcag ttacatgctc    174960
     aaactcgtcg ccaagggccc ccagcctcat cacgacgacg gccatggtcc cgatgaggat    175020
     gggcagtcca ggcgtcctgc ccggccgcta tcggccgcgc ccgacgatat cgatccgaca    175080
     atcgcgccac gttcctgaat aatggaggct tgaagccaat gggaatagac ctgcctcttc    175140
     tctgggcgat catcatcggg ttcggcctga tgatgtacgt gatcatggac ggcttcgacc    175200
     tcggtatcgg cattctgttt cccttcgtgc gcgatcgtga cgatcgcgac acaatggtca    175260
     acaccgtggc accagtttgg gatggaaacg aaacatggct cgttctcggc ggagccgcgc    175320
     tcatggcggc ctttccgctg gcctatgcgg tgatcctgag cgcgctctat ctgccgcttt    175380
     tcctgatgct ggccggactg atctggcgcg gtgtcgcttt cgagtttcga ttcaaggcgg    175440
     acgatgccca caagcctttc tgggataagg catttgcgtg gggatcgttt atcgcggcct    175500
     tttcgcaagg ggtagccctt ggcgccttca tcacgggctt tcccgtcgaa aacaacgcgt    175560
     tcactggcgg ggcattggat ttcctgacac cgttcagcct gttcaccggt gccggcgtcg    175620
     tcattgccta tgcgctgctt ggctccactt ggctgatcat gaagaccgag ggcgatcttc    175680
     aaaaacggat ggtgaagctg gtccgtccag tgacgattat tcttcttggc gtgatcggca    175740
     tcgtcagtct gtggacgccg cttgcatacc ccgctgtggc tctgcgctgg ttctccatgc    175800
     ccaacctgtt atttttctcg ccggtgccac tgctggttct catcacgacg gcggcgatcc    175860
     tcagcgtcct gcgccgcgat ccgcatgccg ccccctttat cctggcattg ctgctgctgt    175920
     tccttggcta tagcgggctt gcgatcagtg tctggcccaa tatcatcccg ccgggcattt    175980
     cgatttggac agccgccgct cctccggaaa gcatgggttt cacgctggtc ggcgcgctct    176040
     tcgtcatccc gttcatcctg gcttatacgg catggtccta ctacgtcttt cgcgggaaag    176100
     tgaaaaccgg ggagggatat cactgatgac agaccgggcg actcgcgcaa acacgtcatg    176160
     gctgcgccgg ataggctggc tcgttttgat ctgggccttt agcgtaatgt ccttggccgt    176220
     cgctgcggca ttttttcggt tgctcatggg tttcgccggg ctcacgcttt gagagcaact    176280
     ggcttaccct gttctggaac gctgcagtta gacactgaag actgttcagg gggctgtaaa    176340
     cagtttcgga cggtgttttg ccttaagcca cgaacgaagc ggaaccggca tccaaacttt    176400
     ggaaagcgat tctagtgatc ggtatatggg catccggggg catttttcag gattacctga    176460
     gcgtagtcgc cctcgcgcaa tccaccaaca tagacccagc gggaggaaaa acgctcgatg    176520
     gccggtctct tcacgccgta gtccctcgcc cgccgaagtg cgtcctcggg cgaacagctg    176580
     tcgttggaac gaggcacatc gctccaggtc gccggtggct catagcgagg ccgccgctcc    176640
     cagggcggcg gcggagcatc tgcagaaccc catccatcgc cccagacctg ggcagcagcc    176700
     ggctcaatcg cggctatcga tgaaccgatg actaggagac cgatcaaagt agctttcatg    176760
     aaaatactgg acatctggcc tctccttcaa gcactgagac ccgagttgtg acgtcacgat    176820
     tattcggatt ctcaagagag tagataccgg aagtacatat tttgctgcgt tcgattttat    176880
     gcacttttat tgtggagtag tgaaccgcgc cggcaaaccc ggcgcagttc agtcgaggaa    176940
     tctggcggtc tcaagggtac gctgcgcgag gtatcggctc atccgtgccc ggtgcttgtg    177000
     ggtgtagtca cggcgaagca ggaactgatc atgccactga agatcaagct cgaacaggcc    177060
     aagggcttca gcctctacat gctgaaagcc gtcatcaacg gtcgcggcga cgaggtcgtg    177120
     gaactcgcca agaccaatct cagactctga ttggagagcg gctcgtgacg ggaatggatt    177180
     tcgccaggca tgtggccttc gtattgcgct gctcggctgc ggcgacattc tcctacatgc    177240
     tggcatcggc tatcggcttg ccacacccgg tatgggcggc aatgacgggg atcatcgtct    177300
     cccaggaaaa gctcaccgaa acacgcagcg ccacggcctg gcggctgggc ggcaccgtga    177360
     tcggcatcgt cgccgctgtt gccattggca gtcttgccgc cccactcggc gccgatgtcg    177420
     caatccagat cgcccttgcc gtcggactct gcgccatcgt cgcccgccgc tatccggcgc    177480
     tcagggtctg catgtggacg gggcctatcg tgtttctgac ggcgagcccg gatatgccca    177540
     tcctcaccac cggcctctat cgcggcggcg aagttcttct cggcggcctg ctcggtgccg    177600
     cattgcatac gatagcggaa gcggtgattg gacgcatgtt tggccaaata gagcctaatt    177660
     ctatcgatcc gccggcgaaa cagccatgac gctggggctc ctcccaaacg cctacccgcc    177720
     tccacaatga cctcctctct tccgtttgcg tttccacgcg ggcaaccaat gacacgaatg    177780
     atgaacacgc gctcatcata gccgccatca aaacagaaat atgccgccgc caataatgtg    177840
     gtatgctgcc tttaggttcc cagagtacca cgtcatcctt actcaatcag cacttggaca    177900
     agcgtcgaat gcgtgggagt agaggcttgc ttgtaggcca cgctgtagag atactgacta    177960
     caacatcggc gagctcttcg actaccgcca ccgcttccaa gcgtgatatg gtcgcaaaca    178020
     agcgagctgc gcgtttgggc caaaactagg cccataaccg tcgcattgat gatcgcagcg    178080
     tgctagggga tgcctttagc gcgctttgcg aagcctgtga tcagtggttg acggattatc    178140
     agctgcacca caacaactga aagacaatga tagtagctgc gcgcacctcg atgccgagca    178200
     acaaagggta ttctgtcgac tgtttcgaag cgctgttgcg cgtctggaag aggtatgggg    178260
     atgctttctt tccggatgcc tattgatcag catgttggaa gttgtaagca ggagtggtca    178320
     tccgtcgtgg ccaaagccac tatcaatccg ccaagacgta gatttcgaca aaaggatctg    178380
     catttggatc gcctcgaatg cgaccgcatg ttcatcgcag tcatcgacac cggcagcttt    178440
     gcggcagccg ccacgcgtct cggcacgagc gcggggcagg cttcaaaact tgtatcgcgg    178500
     cttgaagcaa acctgggcgt gcagttgatc atgcgcacga cgcgagctct atcgctgtcg    178560
     gaagccgggc gggcatacta cgagcggata aagactctgc tcgaggagtt tgatgatctt    178620
     gatgcgtcgg tgcgtaacgc ctcgggagtg ccgtcgggca ggctgcggat cactgcaccg    178680
     ctcacgtttg gcactactca gctggcctcg gtgctgatcc agtttgcaac agcctttccg    178740
     gacatccagc tggatgtcag cttctccgac cgaatcgtca atctcgtaga cgaagggttt    178800
     gacgcagcga tccgcatcgg ccgagcggaa gacagcagtc ttatagcacg caaattatgc    178860
     gccataagag ttgtgctcgt tgccgccccc tcctatctgg atgggcgtgg aatgccggcc    178920
     gaaccggcgc atctagcgca ccacgactgc atcatcgaca caaattttcg ggatccactc    178980
     acctggcggt tcaaacacca cgctgatccg cagccgattc tggctgacgt ccatggtcgt    179040
     atccagttct ccaacgccga ggcttgcgtt gcggcggccg aagccgggct cggcatcgcc    179100
     cgtgcaccaa gcttcgtcgc cggcgcaaga ctacgggcgg gtgcggtcag gccagtgctc    179160
     agcgacttcg aagacgaacc ccgaggcctt tatgccgtct atccgcccgg tcggcatctg    179220
     gcgttgaaag tacgggttct cgtcgatttc ctggccaacg cctttcgcgg gcaaccgact    179280
     tgggacaaga actggccgtg attgattcca atttggaagc aaatattatc tcgtgggccg    179340
     gataatcatc gatctggaaa tggggcatat cggtaggcag gaattcaccc ctaacagacg    179400
     agacaccatc atgatcgata accgcaccgc cccttatgct gtcctcattc tgcgactggc    179460
     acttggactg ctcttccttg ctcatgccgg cttgaagatt ttcgtcttca cccctgccgg    179520
     tacggccggg ttcttcgtct ccctcggcct gccgggttgg ctcgcctatg tcaccatcgt    179580
     atgggaactg gctggcgcag tcgcgctcat cctgggcatc tggccgcgtc tagcagctat    179640
     agccgtcatc cccatcctgc ttggcgcgat ctccagcgtt caccttgctg ctggcttctt    179700
     cttcaccaat ccgaacggcg gctgggaatt cccgggcttc tggattgttg ccctgatcgt    179760
     tctggcattg agcggtgatg gcgcactggc gctccgcccc acccctaccc gcaagtaacc    179820
     cgcagccaca gaccaaacat cggagaaccg cgatgagcac gatcaagaac cctgcggtcg    179880
     gcatcggaaa agtcagtctc accgtccagg acctcgatcg agtgagcagc ttttaccaac    179940
     aggcggtcgg ccttcacctg cttcgtggtg atgcatcgac ggtcgagctt ggtgtcgaag    180000
     gcaacacgct tctcgagctt cgccgcgatt cttcggcgcg gcggcgttcg ccgcgcgagg    180060
     ccgggctgtt tcacacggcc tttctgctgc cctcccgcgc tgatctcggc cgctggatga    180120
     aacaagcgat ggagacgcgc ccgccaatcg tgggcgcctc cgaccacagt gtcagcgaag    180180
     cgctctatct ttccgatccg gagggcaacg gcgtggagat ctatgccgac cggccactgc    180240
     tttcttggca gtggaaagac ggactggtcc atatgccaag cgaccagctc gatattgaca    180300
     gcgtgctcgc cgcggccggc agcggccgct ggacaggctt tccggaggga tcaaaggtcg    180360
     gccatgtgca tttgcaggtg ggggcgatcc ccgatgccga ggccttctat agcgagatac    180420
     ttgggttcgc catcacatcg cgctatcccg gcgggacgtt ctacggagct ggcggatacc    180480
     atcactatct ggcaaccaac atttggaaca gccgcggcgc ggtcgtacgc aattacccca    180540
     gcaccggcct tgccgatatc gaaatcctcg cagatcccga ctctacggca tcgatcggcg    180600
     accggtcggc cgcgcggaat ataccagcca acagcacgcc gcaggggctc gccctgcgcg    180660
     acccctgggg cacagagatc accatcgtca cgccgaccgc acagaccatt taggagttca    180720
     gccatgcttg tagacggaaa atggacggct gactggcatc cggtacaggc gaccgatgcc    180780
     aagggtggct tcgtgcgaca gatttcgggc tttcgcaact ggattacccc cgacggcagc    180840
     gccgggccgg ccggcgaagg cggcttcaaa gccgaagccg ggcgctacca cctctatgtt    180900
     ggcttgatct gtccctgggc gtctcgaacc ctgatcggcc gcgcgctgaa gaaacttggc    180960
     gagactatct ccgtctccgt cgtcgaaccc gcactttccg aacagggttg gcagttcggc    181020
     gactatccgg gcgcagagcg cgacttacag aatggtgcca cctacctcca cgagatttat    181080
     acaaccgccg atccgcatta caccggccgc gcgaccgtgc ctgtcctttg ggacaaggaa    181140
     cgccgcacca tcgtcaacaa cgagtccgcg gatattctgc ggatgctgaa ctcgggcttc    181200
     ggaccgctcg ccgatgacac tgtcgatctt tatccggaag atctgcgtgt cgacatcgac    181260
     gcattgaacg atcgcatcta tccgcggctc aacaacggcg tctaccgcac gggttttgcg    181320
     acgacgcagc ttgcctatga agaagccttt gctgaagtct tcgccatgct cgatgagctc    181380
     gagacccgtc tggatgaccg tgggccgttc ctgttcggtg agaggttgac cgaagccgat    181440
     gtgcgcctgt tcgtcaccct catacgtttc gacgccgcct atcacggcct gttcaaatgc    181500
     aatctgcgcc ggcttgccga ctatgcccac ctcagccact atctcgaccg gattctatgc    181560
     gtccccggca tccgcgaaac ggtgaatatc gatcacatca aacgcggcta ctactccatc    181620
     aaagcgctca atccgaccgg tatcgttccc gtcggcccgc agctaccctt tgcaatttca    181680
     tagaggaagc accgatgtct gcgctcgcag cgaatatgct tgttatcatg cttcatggtg    181740
     tcggctccag cggcagcgac ctcgcgccgc ttgccaacac atggaaggac agcctgccgg    181800
     gcgccgtctt cgcctcgccg aacgcaccca gccgctcgag cttcggctca ggatatcagt    181860
     ggttcagcgt cgccggcgtc accgaagaca atcgcagcac gcgcattata gaggcgcgta    181920
     ccgccttcga tacgacgatc tcggcgatca tcgaagaaaa cggcttttcc gatcggctca    181980
     atcgcgtcgt ttttgtcggg ttttcgcaag gcacgatcat ggcgctcgac gcgattgcct    182040
     cggggcgctg gccggtcggt gcggtcgtcg gcttctccgg ccgtcttgcc tcgccgctgc    182100
     cgcttcaggc cgccgtctcg acgccggttc tgctcgtgca tggcagcgct gatgcggtga    182160
     tcccggcagc ggagacaacc aaggccgccg ccctcttgca gtcacaaggc gtcaacgtgg    182220
     aaaccatgat gatacccgcg cttggccaca caatttccgc caatggcgcg gcgcgcggcg    182280
     ccacgttcct ggcttcggcc atggcaaaat agaaaagaga cgacggtcgt ggagattggt    182340
     ctttacacat tcggtgatct tccgctcgga tcccgcggcc ccgcggcatc cagccgtcgc    182400
     ctgtcggaga tcatcgaggc ggcaaagctt gcggatcagg cgggcttgag tgtcttcggc    182460
     atcggcgagc atcatcgcct cgactataca atctcggtgc ccgtggccgt catgggcgcg    182520
     attgccgcag tgaccaagaa tattcgcatc accacggcgg ttaccatttt atcgtcatcc    182580
     gatccggtaa gcattttcga agaattggca acgatcgacc tgctgtccgc tggccgcggc    182640
     gaactgaccc tcggacgcgg cgcattcatc gagtcctttc cactgtttgg ctacgatctc    182700
     agcgattacg acgcgctcta cgaagaaaag cttgcgctac tgctgaagat cgctgccagc    182760
     gacgaagtaa cgcggcgcgg gcggtttcgc gctcgacaag tccgagatcg ctccacgccc    182820
     ctatgtcgac cgtcctccga tctgggtcgg cgcctgcggg acacccgaca gcgtcgtacg    182880
     ggcgggcaag gcgggcgagc cgctcaacct tgccaatatc ggtggggaac cggcgcgctt    182940
     ccgtccgttc atcgatcttt accgccgcag cttccgccat gccggtcatg atccggctgg    183000
     catcaaagtc ggcatatcaa gccatctgca tgtccagaag gatagccagc gtgcgcgtga    183060
     cgaattctat ccgcattatg cgagctatat cggccacaat ctgccgaacg gtgacaacag    183120
     ttggaaagtc tctcgcaaag actacgagcg ccttgccggc tccaaaggcg cactcttcgt    183180
     cgacaagatt ctatacgaat acgagatgtt ccgccacgat cgttttatgg cgcagatcga    183240
     tatagccctc ccccgttcaa ggcccataga gcgtattagg tttgctcgtc ttcgtggtca    183300
     gccgcagggg ctcactcgat actggtcttt cattgccatc tccctccgcg tttgtgatgg    183360
     cagactaggg ttacctgcaa acggaaaaat gagtcaacta acggcggcat ccaacagaaa    183420
     caccgctcgt cgataaaact ggtttcagac cgattccgct cggtgtctct tgaatgatgt    183480
     ccacagacac caatacgcag atcgcgatcg aaaatgacaa cggaaaatca tcatgattaa    183540
     catacaggtc ggttgaccga cctgtaaata tgtgatggaa ctgccctcat cgtacttttt    183600
     ggaggaggac gcgatgaatc aatcaaatag catacgtcat ttgccgggtg agactgcgcc    183660
     cgagcgcaat attcggctta ccggtcaaca tgtcggcgct ctgttcgtgg ctcgctacat    183720
     cgccgcgcta gttggcatct acatagcctt aataactccc gcttctgtca cacttgcgat    183780
     caggattggg cagatcgatc cagagggaaa ggctagctcc ctggcattcg tcgcaagtat    183840
     cggtgccgcc gctgcgctgt tctcgaaccc gatttttgga atgctaagcg atcgttcaac    183900
     gtctcgcttg gggcaacgcc gtcccttcat attctggggc tttgtgatcg gggtcttggc    183960
     aattttcgcc atcggagtcg cgccttcgat tccgcttatt gcgcttggtt gggcaatagc    184020
     gcagatcgcc ttcaatgcat cgattgcagc gaccatcgcc gtgcttcccg aacgggtacc    184080
     ggcgaccctg cgcgggcgtg tctccggatt tatgggtatg acgggccaat tggcagtagt    184140
     cacaggggtg ttccttatcc aactggcagg gacccgaggt gcaggaatgt tcatttggcc    184200
     agctgtgctt gggggtgtgc ttgtgctgcc gtttcttttg acgcttcgcg aggtccagcg    184260
     tctacccggc gaagtgccga atgtaaccgt tagaagcgtt ttaggtgctc tgtggattaa    184320
     cccgttccaa catcgagact ttggtttggt ctgggctggt aggtttctcg cctggacagc    184380
     gctctatctg ctaaccacgt ataagaccta tttcttgatc gaccacctcg gttattcaac    184440
     tgagactgtg gcgccaattc tcacgacagc aatgtttgtg ctcgctgttg cggtcgctgt    184500
     ctcgagtatc ggcggtgggt tgctctcgga ttattttggc cgccgaaagc cgctggttgt    184560
     actcgcgtcg gtttttttcg tggtcgcgat gctcgtggtg gcctttgccc acaatgtcga    184620
     gatgttcctg atcggcatag tgatcgcggg acttgggaac ggtctctact tcggggtcga    184680
     ctatgctctc gtttcggagg ttatccccga tcgggaaaac tcggcgggca agagcatggg    184740
     tgtattcaac ctatcgagca ctatcccgca aaccattgcc ccgattattg ctcccgcact    184800
     cttgcgcatc aatgccgaag gctccgacgg aaattacacc tcgttgtacc tctgcgcagc    184860
     cgcattcgcg ctaataagcg cggtctttat ccaattcatc aaaggtgcga aatgaccgat    184920
     ttggccactg aaacgctccg actggatgac aaagataatg aagctttgtc cctgaccact    184980
     ggtgccgatt actggacgac gacaaatgct ccaagttacg gaatccgatc catgcgtctt    185040
     gccgacgggc cgcatggact gcgtgttcaa gatgatgaga atccggacca tctcgggctt    185100
     gaacgcagtg cgcaggcaac atgttttcct ccagcggtga cactcgcgtc ttcgtgggac    185160
     atcgacctta tcgaagcagt cggcaatgct ctgggaaggg aggcccgtgc tgcgggcgtg    185220
     aacgttgtgc ttggaccggg actgaatatc aaacggagcc ctttgtgcgg gagaaacttt    185280
     gagtattact cagaggatcc ccttcttgcg ggtgttctcg cgggagcggc cgcacgcggc    185340
     ctgcaggctc aaggtgtcgc tgcatgcctc aagcattttg cggtcaacaa tcaagagact    185400
     gatcgtctca gagtgagtgc gaatatcgat gagcgccctc ttagagaaat ttatctgcga    185460
     gcttttcaaa tcgctcttga agagtccgca gcctggtcgg tgatgtcttc atataatcgc    185520
     atcaatggag tgtttgcctc acaaaaccat tggctgctga cggacctact tcgcaatgaa    185580
     tggggcttcg atggcgtaat gatatcggac tggggcgcag ttcgtgatcc ggtagacgca    185640
     tttaaagcgg gtcttgactt gcgtatgcct ggtcgtccgg acgataaccg catacgccag    185700
     gcttgggctc gcggagaaat tgatgctgtc ttgttggatc aaactgtggg caggatgcgc    185760
     ctcctttgcg accgcacttc aatagcagca cctgcggtcg atgtggatcg caacgatcat    185820
     cataaactcg tccagaaggc cgccgctgaa tccgcagtgc ttctttcaaa cgatggtgtt    185880
     ctgccattgg ctctgaagcc aggtattagg atcgcagtcg ttggtgaact ggcgcggcaa    185940
     ccgagatatc agggtgccgg cagttcgcgt gtcaatgcaa tcaaggttgt aagcagtctg    186000
     gacgccttgt ctgcgagggt ccacaaggca ggcgcggaac tcgaattcgc gagtggttac    186060
     acgctctcag gctcaagcga tcacgcattg attgatgagg ctattgaatt ggcgcaacgc    186120
     tccgacgttg ttatcttgtt tatgggactg cccggtgaat ttgaagcgga aggccgggac    186180
     agaacaacga tccaactacc agcaaatcag acggcgctta tcagtgcctt acaaggcaca    186240
     aaatccaaag tcgttgtcgc tctgagtaat ggctcggtcg ttacaacctc ctcgtggcga    186300
     aacggtgtga acgcgatagt ggagttctgg cttacgggtc aggcgcatgg cgatacagta    186360
     gctgatgtgc tgctgggcgt tgtaaatccg agcggaaagc ttgcggaaac ggtgccaatc    186420
     cgtctggaag atacaccagc ttttctgagt tttccaggcg agcatcagaa cgtggattac    186480
     ggtgaaggca tctatgtcgg ctaccgctac tatgatgccc gtagcattga cgttgactac    186540
     ccgttcggtc acggattgtc gtacacgact tttgaatatt ctggcctgga gatactcgtt    186600
     cggcctttgt ccgatgtcgt cgccttcgat gcgaaaatca ggatccacaa caccggcgaa    186660
     cgttttggtc atgaagtcgt tcagctatac gttcaggatc tccagaccga aatcacgaca    186720
     cctccgcgcg aattgcgagg ctggaaaaag atcggcttgg cgcctggtga agaagcgacc    186780
     gtggaaatag cggtcactag ggagcaactg tcacattggc atactccgaa caagtgctgg    186840
     gtatatcctg gcagtgacct aatcgtatgc gttggcggct cgtccagaga tctaccacta    186900
     aagaaaacgg tcacaatccc gggggaagcg atctcgctga agctcgacga atgggcaact    186960
     ttcggcgaat ggctcgatga cccgaaacta gggctcaagc tccgcgaact catcgaggcg    187020
     cgcggcgggc tcaagggccg tatggcagat cttctagcag acgagggtgg ggggcgagat    187080
     gcggtgcgcg ccgtcccact ggcgaccata gtcgaatttc caggtgtccc tgttgccctt    187140
     gacgatctca gaatactctc aagcagcctg acgggtgcga acgacggaag tcgatcgccg    187200
     ggcacaaggc tttagaatgc cccttctttg gtcttggctc cgtcaccaaa ccgagttgac    187260
     ctcgtcacta tgtattcttc tttgaagagc ctgccgaggc aatgtgcctg ggggaacggc    187320
     gcgaggtcaa taatgtagcc tttcgattgc ggagcttatg cctttgcctt acacgatggc    187380
     ccaaagtcgt tgtacaagga gtaaaaccca tgccacgagc gttaaaaaat gccgaacagg    187440
     gggagcgaac tagggcggcg atcctggcat ctgcaatcga actttttggt gagaaaggat    187500
     atagggctac gtcagtgagc cagatcgcca agcgggcggg ggtagtacag tcggcgttac    187560
     atcaccactt cggggcaaaa gagcaactcc tcgatgcggc tcttaaattg cattatccat    187620
     cttctgtcgc aagacccgat atgcaagctg tggcgacagg caggaccgag ttcgtagatg    187680
     aaatgatgga ggcggctcgg cgcaatattt ccgatcgaca cctcgtccgc ttcttctcgg    187740
     tgatgaccgg ggaatctcta acgcgagaac atcctgctca ccaattcttt gtgaaccgat    187800
     atgacattgc gcgcgatggc ttcacggacg ccattgctca ggcaaagagt atcacaaacg    187860
     ataccggtcg tgcgcaagtt tcccttctcg tatccatcct ttttgctaca tccgacgggc    187920
     tgcagatgca gtggcttcga aacccatcca tcgattttgt cgccgggcta gaacgcgtgg    187980
     caaagatggt aggtgaaggt atacaggcgc taagacaggg gtgaattgca ggccaagagc    188040
     catctgaatg ttcgggttcc accgcgtaga cgcatgcttc aagcaacaac gccatggtaa    188100
     acatggccaa atcgttttcc catttatcat cgtagcaacg gttcatcact gacggcgatt    188160
     gatcgccgtc gtaatccttg gattcgttga ggtgaactat cacaattatt tggtgaattt    188220
     gaagattcat agttttgcac gaatgccgga accaatggtc gcctgaggta atctgaggtt    188280
     gggacaacgg cattcaattg tgaattccag cgaccagcag aaggaggtcg gcggtgttgc    188340
     gttcctattc ctgacgctca cgggaaaatg gtgacatcgc tcgcggccta gtgcgttatc    188400
     ggccgaatga cagacgaaat ggccgctcgg atcgtcgcaa agctcaatca ggtggcgaaa    188460
     ctaatttcta tatcggtgag caatagcgca cgagactgcg tccacaccaa cggtctgcca    188520
     gatccatcgt cacagtattt tctgcgcaga cggcaaccat cgactaagtt ttagtcacgt    188580
     cgccctagga ttaggccgtt ccgggcaagg ctccattctc ccgcataatc aaggccgcaa    188640
     gttcggctcg gtttgagcag cccttctttt ccattgcctt gttaaggtgt gttcgcaccg    188700
     tggaaaagcc gatgttcagc atgtcacaga tctcacgatc gcgacagccg cgtgcaacga    188760
     gaaaggcgat ctgccgctca cgtggtgtca aattttcgaa acgctccatg ccgttggcca    188820
     tcgccttctt caagaaaggg gagatggtgt cgagaagcat tttttcccgt tcactgaaat    188880
     ccgggctctt cgcagatcgc cacagacgga agtcgcccag gtcacgatcg ccttcaaaca    188940
     agaatacatt gattccgtga tgaagtccgt cacgctttag gaaatcatta tagaattcgg    189000
     tccggatcaa ctcgttatat gggttgactt cctcgatcaa ggtcgcctta cgcttttcgc    189060
     gtagcttgaa ggtatgcgga tcgcgaaact gataataccg ctcatagttc ctgatgttct    189120
     ccggatccat gttgtggatc agaccctttt caaaccggcg caaccgatcg ttccagatgt    189180
     aagacgcggc aaagtccgct cgcaccagtt tgacgatatc ttcgaagacg gctgtgcgag    189240
     cctctacatc attatcaaga cgcgacaggc gcgcaacaat atcgccgaag agacgtagct    189300
     cttccgatgt gacgtcccga atatatgttt ccatcttgcc gttctcgcgt tcgatgatgg    189360
     ccatgcagga atcgtgccag agtctgctgc tattgagcgc ataagtgccc gacgcatcga    189420
     tatttttgcc gatagccggg gcatcttgca ggtgcattct tatccaaccc tattacaagg    189480
     agagcgcaat gaacaccgac aaattccccg tcagcctcat cgggcttccc tatctgatgg    189540
     gttcgcgtgg ccccaatctg ggataccaga tggcgcaggg tccccgcata ctgctcgctc    189600
     cggagaaagc gccggcagcg atgcaggagt tcttttccga cgtcgaaacg gtcatgatcg    189660
     aggacgcaga cgagccaaac attgcgttta cgggtggaga ctaccgactc ctcccggttg    189720
     gcgaccagat gtctcgcgtt cttgtccaaa acattcgtct cgctcaggaa gttaagggag    189780
     cacgcgaacg tgggcgcatc cccatcgctt gcgtaggcgc ttgttcggct gcgctcggaa    189840
     tggtcggtgg cgttggagaa accgaaggcg agatcggtat gatctggctc gatgcccatg    189900
     gagacgcaca aacgcccgat acgtccgaga atgggtttat cgagggcatg ccggtcacca    189960
     caatcgcagg taaatgctgg cctcgatacc gccgcaagat cccgggcttt cgcgagatcg    190020
     acgaaagccg cataatcact atcggtctga gcgagatgtt cacgcccacc gcgcgccgat    190080
     ctgcgaaaga cgcccttggc accctcgtgc acaaactggt tattgaggag cttggcttcg    190140
     aggaggcact gacccgtgcg ctggataacc tcgcgtcaaa gtgtggcaag gtcttcatcc    190200
     atttcgatac ggacgtgctg gatccaaccg tccttcgggc caatacgcac gccgcaaacg    190260
     gaggcttgac ggatgaacag tgcaaaacgg cattccgcct tattggcgaa cggttcgaaa    190320
     tccttgccgt aagcttcgcg tcctacgatc cggttgtcga tgaacgcggc ccgcaggtac    190380
     tcgtgccgct tctcgtcgct gcggcaagag cagcggcgga aggccgtgcg cgacaaggca    190440
     gctcttcgtg agcacgccaa tttcactcat cggccttcct tatgttttcg ggcggcgcga    190500
     tgcctcgcca cgaaatgcga tggcactagg cccgaaggag ttactctcgc accagaccct    190560
     tctgagcgct ctatccgaag gcggttgcga tcttgccgtc gaattgattg aggatgtgga    190620
     tgatcccgcg ccggatgaaa cggcgggcta tttcgacgcc aatgttgcgg ggctttttgc    190680
     cggcgaccag atgagccgtc ttcaagtgca gaccgcgcgg cttgcgcgcg ctgtccgcta    190740
     cgcagtgtct gccgaccgga tgccactggt ggcaaacggc ggctgcactt gcgcacttgg    190800
     aatggttgcg ggcctcgcag cgatcggtga aatcggaatg gtgtggtttg acgcgcatga    190860
     tgacgcggaa acgcccgaaa cctcgacaag cggccttgtc gaggggatgc ccgtctcgat    190920
     gatcaccggg cgatgttggc aggctttctg ccaccagatc ccggggttcg agcctatccc    190980
     ggctgatcgt attctaacga ttggccttca tgagaagtac gaacataagc cagaccgagg    191040
     attgaagtcg cccggaagcg tagtcacgcc ggccatcgtc aaaagcaagg gttacgatgg    191100
     cgcgatcatc gaggcactgg cggatctcag gacacgttgt tctaaggtgt acgttcacgt    191160
     agatgtcgac gttctggacc catccgttct gaaatcgagc aatcatgccg cagaaggtgg    191220
     cttgtctgcc gaacaacttg catatgcgtt ggacgctatc gcagacagct tcgagatcgt    191280
     cggcctggat ttcagctcct tcgacccgac aatcgatccc catggcgtcc acacacttgt    191340
     cccgttgctt gttcatgcag cgtcagcatc gacgcgaagc cggatacacc ggaaccattg    191400
     ccctggctga gatggaatgg gaggggacat cccctcccat tccatctcac gccaaccaga    191460
     cggtacgcag gctgtataat gcagagtcta ccgtgtaggg cacgaggcct ttcacattcg    191520
     cacgatagcc gttcaaggtg ttggcaaaac cccacacgat gtttcctccg cgctcatact    191580
     cgatctgccg catctttgcg atgatatcac agcgcttcgt tatgtcggcg gtcgccatgg    191640
     cctgcttgtg caggtcgatg aactcggcat cattccagtg cgacgtgttg aacgtgccag    191700
     tcggaagcag gctgcgcgtt gcgaccgcga gatatgtgtc cgacaggaag tcgacaccga    191760
     aggaccactg gccgtatttc gcgagatagg ctccaacttc cacgaccttc acgttgatcg    191820
     tgacgccggc tgcctttgct tgctccgcga agacctgcgc gcactcgatc attccggcgg    191880
     ttccgttgac ggtcaccatt tcaatcgtca ggtccgactt cccagcctcc ttgagcagtt    191940
     cctttgcctt ggcgatatcc tgcttgcgtt gcgggagcgt ggactcgcca caaggcgcga    192000
     tcgtccgacc agccatgtcg ttgccaatcg tgccatagcc ggcgagtgca atttttacca    192060
     tctgctctcg gttggcgatc agtttcatcg ccatgcggac cttcggatca tcgaaaggcg    192120
     cgatgtcggt gcgcatatag atgggaatcg acatcgccga cggattgttc agcagcttca    192180
     agctgggatc ggctgaaatg acccgcgcct gggcgaaggg cattgtatat gtgatctcga    192240
     cttgaccgcc gcgtagcgca ttgatcgctg cggtattgtc gttgattacg gagatgacga    192300
     gctgatcgac ccatgccggc tcgcggaaat atccgtcgaa acggtcgaat acggattctt    192360
     gacctggggt aaacgagaca tactcgaatg ggccggttcc tacgggcgcc gccgggtcga    192420
     aatcgcgggg taccatcttc agatagcggt tcgcccacac ttcggagaac aatccattcg    192480
     gagccgcgag cataaacctc accgtgaggt catcgatctt ttcgaccttt gtcgggtcta    192540
     taaagctgat aagggcggct cctttggacg gatgctcctt gtcaaggatc cgctttaccg    192600
     aatagatgac gtcgtcggct gtaaagtcct ttccagcatg agtcttgacg ccagagcgaa    192660
     ggttaagcgt ccactcggtc gcatcaccgt ttggagtaaa ggactccgcc aggacgaagc    192720
     caacactggc gtccggcttg aattcgcaaa gcccgtcaaa cagattgcag aagcgtacga    192780
     tgtccgaaat ctggccctgt gttcgatgcg gatcaagtga atcggcactt cctcccggta    192840
     cggcgacgcg cataattccg cccgtcttgc gcgcctcgct ctgcgcaatg gctgccgttg    192900
     agatcaacga tgatgctaga acgccggctg ccccaatcgc gacagaagtc cgtaggagct    192960
     gtcgccggga gactgatagc atgctggtaa acttcgtatc gtttgacatg tgagaccttt    193020
     ctggcgttcc ccgagaattc aaaatgtgcg atgtcttgat taaagggcgc tgcgctccgc    193080
     ggtatcgaca ctaatgacga cctccttttg agagcgcagc ttgcgactct ttcaggcgag    193140
     ttcgagcgta ttggccaaaa ggctcttggt gtacgcagcc gaggggcggc tcaatacgct    193200
     ctcgcttgag ccgatttcga caatctcacc cttgtcgagc accgccacgc tatccgccag    193260
     gcttcgcacc actccgagat tatgcgtaac gaacaccagg ctcagtccat cggacataag    193320
     cgatcgaagg agctcaacga tcgcagcctg tactgagacg tccaaagccg aggtaatctc    193380
     gtcgcagatc atgacgtcgg gggacgcaag cagcgcccgc gcaatcgcga cacgttgctt    193440
     ctcgcctccc gacagttcgt tcgggaacct atctatatgg gcggatctca gttcaacccg    193500
     ttccagcgct gctttgatct ggcggtcgcg attttggtca tctgaggttt ggaagtggcc    193560
     tatggggact gctaggtttc cgccgatcgt cttcctaggg ttcaacgagc cataggggtt    193620
     ctgaaaaacg tactgaagct tgcgccgatc atcgggagaa cgatgcgctg ccgactggga    193680
     aagccttcgt ccctcaagga cgatctcacc cttccagtcg ctatgcaacc cgatcatgca    193740
     ccgcgaaaac gtcgtcttgc cactgccgga ttcacctacg accgcaagac actcaccccg    193800
     cgaaagcgtc atcgaaacgt cccgtagcac agtccggtca ccgtagcgcg ccgaaagcga    193860
     gaggacttcg agcaccttgt cattttcgag tattctgttc accacgaaaa ggggagccgt    193920
     tttggcctga ccatcgatct cgtccgccca atggcatgca acctcatggt tcgcagccga    193980
     cttgctcgaa agcggcggcg cgacagcgca gacagcggtc gcgtgaggac agcgggcgcg    194040
     aaagacgcag ccgtgctccc gatcgcgaag cgggggtgcc attccatcga ttgccctgag    194100
     cttgcgagcc tcccgcatcg agggtacggc gtcgagaagc gagcgcgtgt atgggtgcgc    194160
     gggtctggca aacacatcgc ccttgcttcc tgcctcaacg atgcgcccgg cgtaaagaac    194220
     catcaccttg tcggcaatat gtgcgacgac ggccaggtca tgggagacgt aaagggtcgc    194280
     gataccatgg gcttggcaaa gccgcgtcat catggccagc acatccgcct gcgtcgatac    194340
     gtccaagcct gtcgtaggtt catccatgat gaccagacgc ggacgcggtg cgaccgccat    194400
     tgcaatcgcg acgcgctgca actgaccacc cgatagctga gcaggatatc tgctgaggaa    194460
     ttccggtgtc gcagccagac cgacttcgga cataagctcg gccattctcg ccttcgcgac    194520
     atgcggagac agcgcgtccc ggccccgcat cagtccctcg acaagctgct cgcctatttt    194580
     tatcgccgga ttcaaagatg ccgatggatc ctgcggtaca taggttatga gctttccacg    194640
     aacctcattc ctggcgcgag gcgacatggt catcaggtcg gtgccatcga cgaatattcg    194700
     actttcagtc tgaatggcgg tcccgggctt ggaaaagccg agcagggaaa gcgagatggt    194760
     cgtcttgcct gagccggatt ctccgacgag gcccaacact tcaccggcag caatctcgaa    194820
     gttcacatcc ttgacgatcg gaagaccggt tgcagttgca tcaaccctca ggtttcgaat    194880
     tctgatcacg gtcagtcctt cccactatcg gttcggccga gagaacgaag cacagcttcg    194940
     gcgaagatat ttccgccgat cgtgaagaca gcaatggcgg cgattggagc gataactgcc    195000
     cagggttgaa tggagagcgc attgcggttt tcgttgatca tgacgcccca atccgccgca    195060
     ggaggctgaa tgccgtagcc gaggaaactc aggccggcga ggagcgagat ggaccacatc    195120
     aggcgcaagc ctgcctcgac gagaagtggt gtcgcgacat tcggcaggat ctgcgtggcg    195180
     attatccgtg gtccggacaa gccaatagcc cgacagtatt ggacgtattc gagattcacg    195240
     accgagaggg ccgcgcccct gataacgcgt gagacgctcg gagcctgtga aacgccgacc    195300
     aagatcacaa gcagggcctt tcctggaccc acgacggtca cgataagcag aacaaaaatt    195360
     acgctcggga aggccagctt aacatccacg aggcgcatca gaagaatatc cgtccaaccc    195420
     ttgtagaagg cgcaagacag cccgatcaga gcccccagaa cgagacccag tgcacttgcg    195480
     ctgagtgaca tccatacgag gctggaaccg ccattgagga agcgggaata gacatcgcgt    195540
     ccgagaaaat ccatgccgaa cggtgagccg tactgaggca cgtcgaaggg catcccgact    195600
     agttcggttg ccccatatgg tgctaagaat gggccgaaga ccgcaaccgc ggcgacaagg    195660
     atcatcaacc cgagaccgac gcttgttctt gccgaacgga aaactctttg caccgcgatc    195720
     ctgcggggct ttgattcgac gtcgaccacg gtgatttcct tgctcatttt aggcgcctcg    195780
     gctgggtgga gtgagaagcg cagccgcaag gtccgcgatc atgttcgaaa gaagaaaagt    195840
     ggatgcgatg accagaacga tgaattgcac gaccggaata tcacggtttc ctactgcgtc    195900
     ggtcagtgcc gtgcccatgc cgggatagcc gaagacatat tccacaacga caataccgcc    195960
     gacagacaag gcaaagacgt tcgccgctgc ctggattgcg gggactgccg cgttcggcag    196020
     cgcgtggcgg aaaagaattc tgttcgaaga tattcccttg agccgggcga actggacgta    196080
     atccgaggcg agaacatcaa tcatggcccc gcgaacgagg cggtatagat acgttgtctg    196140
     cagcaggaag agcgtcgtga ccggcagcac atatgcgcca agctggtcgt agaacggttt    196200
     ggtcggcgac aaaagcgaga ccgctggcac gatatgaaag atgttggtgc taaagaccac    196260
     gaccagcagc agtccgagca cgaattctgg aagcgcgttc acgccaagcg acgccgccat    196320
     tgctgcgcgg tcgaaccatt tgtctttgcg gtttgccgtg acgaccccta gcagaacgga    196380
     gaatggcaac gtcagtgcca tggacatcac gacgaggaca aacgagttcg caacgcgcgg    196440
     cccgacaagg tctgcgacag cgcgattcga cgcggcggaa accccgagat ctccatgcag    196500
     aagtgacgtc acccagtgga gatattgctc agcaggggga agattgagcc cgagctggac    196560
     gcgcaaagcc tctacctgtt cggcaccagc gtccttgccg aggatcgttc tggcaacatc    196620
     gccgggcaac ccctgcgtcg ccatgaagat cagaatggat accaagacga gcgtgatgag    196680
     gctcaagcca atccgtcgac agatcagccc cgcctgcttt gaagcaatgc tcattaaaat    196740
     tgctctccca gatattttca cccatcacag cctacggaag ccaccagcta tcgccatcga    196800
     cataaataac gatgtggtgt gatccaggtg ataggatgga tcacaccgct aaagttgaag    196860
     atagagctga aaactcacca cgaccggaac ggtcggccca cttgtgaaga ccgcatcgga    196920
     tcgatgtatt ccctgcgctg atcgctgcaa ttggcacaga cgtcagatgg tcagccagcc    196980
     ttgtatttcg gctcgcgtca tcttgcccac gctctgctgg agaaccgcct cgccatgatc    197040
     aagcaccgaa atctggtctc cgatgctttc gaccaaaccg aggctctgct ccacaagcac    197100
     gaccgctgca cccgccgcct ttctagtatt gattagctga gcgatgcgga ccacattctc    197160
     atactgaacc ccttcagtag gttcatccag caggacaaga gcccgctcct cggcgagtgt    197220
     acgcgataga gaaagcagct tcttctcacc accggaaagc gtgccggcct tctgtgacag    197280
     ccgctctttc agccgtggaa atgtctccag ataaagctcg aagtgcttca agctccgact    197340
     gtcgcgcatc agggtgaggt tttccgcgac cgtcagttca tcgaacacga ccttatcttg    197400
     aggggcataa gacagtccca tcttgacacg ctcggacatg gaaatcgaat aaaagtccct    197460
     gccttggaaa acgatctcgc cggatgcggg tctgatcgct ccagccagca gcttcagaag    197520
     cgtggacttt ccgaccccat tgcgaccgac aacgcaatgc acttctcctg cccggaaacc    197580
     agccgagaag tcacgcagga cgatcccaga gccataacca ccggagagtt tgttgaccgt    197640
     caaaatctcc agacagttca tcgctgacct cctacgtaaa cgttacgcac gtcatcattg    197700
     gcccggacct cttcgatcgt gcctttggcc agaaagcgcc cctggtgaaa gacgttgacc    197760
     gtatcggcca acgcctcgac cagagccatg tcatgctcga cgacaacgat cgtcatgccc    197820
     gtcttcgctc tgatccattt ggcgaggtca atgacggcga acgtctcgtc ttgagatagc    197880
     ccagcgcagg gctcgtccaa cagcagcagc cgaggctctg tcaaaaggac catcgacaac    197940
     tcaaggatct ggcgctgacc atgcgaaagg tcagaggcca acttcgcgtc ctgtgcgagg    198000
     aactcgaagc ggcgtttcaa ctcggcaagc aaggggctgt tccactgcca aagcctgcgg    198060
     ttcaacaggt cgacagtgga agcgcgttta ctccaaagac cgagagacag attctcgcgg    198120
     atggttagcg ttggaaatac cgtgggagct tggaattttc ttgacacgcc cgcgagtgta    198180
     agagccgcgg gtgtcgcctt gcgtatcggt ttgccatcaa gggaaagtgc gccgccagaa    198240
     agcgggagaa gaccggtcag agcattgaag gatgatgact ttccggcgcc attcgggccg    198300
     atgatgcagg ttgtcttgcc ttgctctgcg aagaagttca ggccgttcag gatctgcacc    198360
     gatcccattt tgaccgaaat accttgcagt tggcatgaca gagccgacct ttcgcctttt    198420
     aaacaagggg cttcgacaga catgggcaag ttcgtaaccg acgcgcttgt cgggatgatt    198480
     ccggccaatc ctttcggaaa ccgcaaaacg acaacgatga agacaagcgc cagaacaagc    198540
     tcccaccagt ccaccctgtc tcgcaattcc gagctaagca gtccgaccac aagtgcaccg    198600
     acaagcggcc cgaacacgga catgcgccct ccaacggcaa cgtagacaag aaggctgccg    198660
     caaaatgcga aaccgctcag atccggtgtg acgatgccct gctgctgcgc atagatgaca    198720
     ccacccagac cagcgcagaa acctgagacc gcgaacgcaa gggccttgag cagggccgtg    198780
     tcaaatccca ggaactgcat gcggcgctcg tccgcagcta ccgccttcca gacggttccg    198840
     agaggtgcag atatcagcca tacgtaaccc gcgcatacga caagggttgc ggctccgacg    198900
     agagcatatt gctctataat tccggagatc ccgggcaagg gaggcacgcc gaggagacca    198960
     ttgaagcctc cggttacact cgaccagcct atagcgatct gccctccggc aagagccagc    199020
     gcgagcgtta ccatcgagaa agatgtcgcg ttgcccgtct ggcctttgaa aacaccaaag    199080
     gcaattatga aggcgatcac catgggaatc agggcgcata gaaacgctgc gggccatgca    199140
     aggcccgaac catcaagtac gatgaagacg ttcgccgcga gataggcaga tatcgccata    199200
     tagagaccgt ggccaagcga cagggttccg ctcagacccc aggcgagccc cagtccggta    199260
     gccacgatac cgtatgtcag atagagcgac acctcatagg cccacaggtc gccagccagg    199320
     agtggcaaga ggatcattgc cgtcgcgagg acggcgagat tacgcacggc tgaagagacc    199380
     acgaggacgt ctccatagga agataatagc gattgcaagg acgaccagat aggccatgga    199440
     tgggctgagt tgcgtggcga ggatgctctg cgagccgccg attgcgactg ccccactcaa    199500
     caaccctgcg atggtgccat aaccaccaac aacgagtgaa aagaacgaat tcacgaccag    199560
     cagaattccc atcgagggct caaccgggac ggttggtgcg atgagaactc ccgcgatccc    199620
     agcggcagct gaactgaaga cgaaggtctg agtagatagc cggctggagt tgatgccgac    199680
     ggcttgcgcg agaacgggat tggataccat tgccctgata cggagcgccg tcgaggtgcg    199740
     cagataccag atagcaacga aaaccagcac cagaaatgca caggacatca cgaagagacg    199800
     ccagccaggg aaagtggagc cgaacaggtt cacagtccca gcgatgggga gatcgacact    199860
     ctgatagccg ttaccccaca gtagctttac gatttctcga atcgccatgc cgaggcccca    199920
     tgtcccaaga agggtggcaa aaccatcgta tttgagcggt cgaatgatca gtcgctctgc    199980
     caagaacccc aaggcaccac acacgacgaa agcgagcgga acggccaaga aataggaaag    200040
     ctccagatgt tgaacactca gcccgcaata tgcgccgacc ataaccattt caccgtgagc    200100
     gatattgaga actccgagca atcccataga gactgccagc cccagcgtca ggatcgccaa    200160
     gaccagtacg tcatatccca ggttgagaga gagcgtcatc atttgaggtc gcccgccgtt    200220
     agttgcagct ctgcccggtc tggatatcct tgaaggtctc tatgacttca aaatccgttc    200280
     cgctgcattt cgcgaggtac atgattttcg ctgtgtgacg gttcttcacc gtcatcatgc    200340
     cggatggcgt attgaagctt gtatgttctg ccgcagcgtc gaagtccttg gctgataccg    200400
     atttcgcctt ttcgacgacg gccttggcca ttgcgagccc gtcatagacc gactttgcta    200460
     tcgtgttttg gatcgctggc gtaccgctgg aggtcttggc gataccggcg atgaatgcct    200520
     tgttttcggg caaatcgagc ttggcgaagt agcccatgca tgaatagagg ttgtcggatg    200580
     cttccttgcc gataccaagt aaagtatttt cctcaagcag gcaggacatg cgcagaatgt    200640
     tggccgacag accaaagttg gcaaaggtcc ggttgaagtt cacattgtca ccgccgacca    200700
     gggtctggag aacgatagca ggtgatgcag cacggatttt ctcgatggag ctctcgaatt    200760
     tgtttgcagc gccgaccgga taatactcct cgccaacgat ggtgccgccg agacgtttga    200820
     ccgcagcctt taccgcgtca ttcgtcgcac gcggccatac gtagtcgttg ccgatgagat    200880
     agaacgactt gccgccagct cgcttgacga gtgactcgat cgacgcaccg acctgttgtt    200940
     cgggggtttc tccgaggaaa taagtgaagg gtgcgcaatc gcccccttcg aaaaccggcg    201000
     tgtagatgta gggaaccttg cctctgatcg cggcttcgat tgcctgtcgg accgcgctat    201060
     cgtgcgagcc tacgatgata tcgaccgact tcccgatcac catgcgcgtt gctgtcttgg    201120
     cgacctcggc gggtgctgct ccaccatcgg caatggtcaa ttcgagcggg cgtcccatga    201180
     tgccgcctga cgcgttgatc tgcgccgcag catagtctgc agctgcccta ctagaggcgc    201240
     cgaacaggga tgcgccaccg gacagagtga tgaagaccgc gatccggata gggtcggcgg    201300
     caaaggcaac ccgcccggct gctgcagatg ttgcgatagc ggcggagagc ttcaatatct    201360
     ggcgacgaga gattgtctgt gtcatgttct tcctctgggc ctattatggt tgtggaatgg    201420
     caggcaggct cgcttcgagc gaaagcgcga ccgcgaagag cttttcgtct ccggcgtgag    201480
     cgccctcgag tgcgaggccg attggcaagc cgttacggtc tacgccaacg ggcaaggaaa    201540
     tggttggcaa ggcgatcagg cttccgatat ccatgttccg tatgacggtc agaaaggtcg    201600
     gcacttgctc gccgtttagg tcggttgttt cgtcatcccc gattttcggc gcggtgatcg    201660
     gcgatgtcgg atacacgatg ccgtctagca gatgctctgc gaggatcttt gcgtgacctg    201720
     cggcaatctc aggtatcatc tcttcgatag cgcgattgta agcagacgaa ggaacggcct    201780
     gagccgggtc catcagaatc tttgcgaccg cagcgacatc cggcgatgcg acgctggaaa    201840
     gaagcgtttc aaccgtcaac tccgtcttcc atttttccag aaacccagtc agttccggca    201900
     cggcttcata gaatacgatt gggaatgcaa tttccctgac gagattggtg agaggaacga    201960
     gatcgatttc cacaatcgtc gcgcccgcac ccgcgagccg ggagagcgcg tgttcgcaaa    202020
     ctgtgcgaac gtcctcggcc agattgtccc agtaaaagcc ggatggcttg cccagacgaa    202080
     gggtccggat ttccgccata acggcaggct ccctttcatg cagggcgcgg tcgatgagat    202140
     ccagatcaga aacagcgcgg gcgagtggtc ccagcgtatc ccgggtatgc gacaaaggaa    202200
     ggaccccatg ccctgaccat cgccccgtgg tggggcgata tccgaagacc ccgttgaagg    202260
     aagccggaac ccgaacggaa ccacctgtgt cgctgccgat acccgccggc accaggcgac    202320
     cgcccactgc cgcgcctgtt ccgccggacg agccggcagg cacacgtgtc gtgtcgaaag    202380
     gattacgaac cggcccccca aatgtattgt tcgaggttcc accgaaagcc agttcatgca    202440
     tggtattctt gccaaaagga atggcaccgg ccgccttaag ctttgccgcg accgtagcat    202500
     cttgcgcggg ctcgaaattc tgcaatgctg gcgtgttcgc cctcatcggc atgccgacac    202560
     aagcgatgtt gtccttgaga gaaatcggca acccatggag gataggtaga ggaccatccg    202620
     cgtctttacg ccgagcatca cagtctcgcg cagtcgacaa tatttgttca cgatcgaggt    202680
     gggcgaatgc gttgagttcc cggagcgcgt ctgcgcggtc aagaagggag gaaacaagct    202740
     ccaccgatgt gatgttaccc ttttcgagca acgcgtttgc ctcggttagg gtgagcttcc    202800
     aaagcgccat tttctgcatc tccagctaag tctttttcag caaagcagat gcggggctcg    202860
     tgaagcatcg acatttctgc cgatctcatg gtgtcggtcg agcggccatc aattttcaaa    202920
     atttctttga aaaaggtcag cgctcgatgc cgattcacgc cgatggatca aaatagttcg    202980
     ccgcgaccgg atatgatcat gcgggcccct tgcctttatt ttagggaaga aggcgtctgt    203040
     aaatctaggg gttatccacg ttgctgccct gatccatgcc gatcgtttcg gtattctatc    203100
     cgcttgggca cttgcgatcg caacctgatg atgagcgatg cgaccgcaaa atcctgtttt    203160
     ggccgggact aaatcagaag ggcggcgttg ccaagcttgc caggaaaaag ctggtcgccg    203220
     ccctggcgcc ctcctacagc gtaatcttgt tgccgcagcc aagccgatgc tcatgctact    203280
     cccggaatgt agaaataaat tccctctcac tcaataaaaa gagcggaata ttagattggc    203340
     tttgcgccac acccatataa aatgccgata actatcagtg cgaacgtcca tgccttatgt    203400
     cagaagacca agggatcgca gcagagagac ttctcattcc tgccgatggt gaaaccatag    203460
     gcatgacgaa ggtgcacttg tccgcaccgg gctgagaagc aggcaaaatg cgaaaactca    203520
     tgcgggacag attcgcttcg ccacgatgac ggcagaggcc acctccacaa aaccgatgcc    203580
     tcccggtcct tcgctgatcc agcgcggtgg taccggaatt tcgtgcagat attcggtcac    203640
     agtgctgacg ccaaccgtgt gatggaagaa agcaaacatc ggtgcgtcgt tggtggaatc    203700
     gccgacgtag agcactgcgt ttcgttcgct atcaatgtcc agaccatagc gctcgaacaa    203760
     gacgcggcgg gccatggcca atttgtcata gccgccgagc cagccgagaa tccagagatt    203820
     gttgacggtg acatccacgc cctctttacg cagttccgcg acaatatcgg cctcggtctg    203880
     tgcgtctccc gagcgtgcga aagcgatact ggtttggcgg aaggattgat cctcggcaaa    203940
     aatggcggaa gtaacagtct tgcgtactcg atcgccgatc tgtgccaacc gacctgcgac    204000
     gatggcacgc tcctcaccgc gatgccagaa cgagcgccga atgccatggc cgccagcctc    204060
     gcgctcgaag aagaagccgc cgttttcgcc aatgacaccg tcgacaggcc acatacgagc    204120
     catctggtcg caccagccgg ccggagccgc agttacggga acgacgatga cgccggcatc    204180
     ttgcagcctt tccagtgcct cgtaggtgca agcggcgagc cggcctcgat aggtcaaggt    204240
     ctcgtccatg tcggtcagga cgaagcggac gtcctggaat gtcgaggctg cggcttgatt    204300
     tagagggttc atgctgttct cggtttctgc gcttggagcg gcaggctcgc gccgtcagtt    204360
     tctgctattg gctgttgatc aaataatccc agaaaatgcc cctgaccatg ctggaacgat    204420
     gcgaaagttg ccattctaaa aacaaccgca tgcagcaccc ggctggtgca gggtgccagg    204480
     cgaataagag cacgatcttt ttcatagaca ccgccgaagc cacagatgcc atcgttcgtt    204540
     tcggttgatt gaatcagaaa cacatatatt ctacaaattt agtaggaaat tgaaattctc    204600
     ttctcagctc cgcgacttaa atcgcagcga tgccctttgc caatcgcgat ccttctcggg    204660
     aaaatatcct cgttggcatc cccataagag tgctgccaag cgatgttgga gtgaaatcag    204720
     gaaggaaacg cgaatggcat ttcgcccatt gcatgatcgt gtcgtcataa ggcgactcga    204780
     aagcgaggag aagacgcggg gtggcatcat catcccggac accgccaagg aaaagcccca    204840
     ggagggcgcc gtggtcgccg tgggcccggg actgcgcgat gagagcggca agctggcgcc    204900
     tctcgacgtc aaggccggtg accgcgtgct tttcggcaag tggtccggca ccgagatcaa    204960
     gatcgacggg gaagacctgc tgatcgtcaa agaagccgac atcctcggcg ttgtggccta    205020
     acacggccct ttaggaagga aatcatccat ggctgccaag gaagtcaaat tctccaccga    205080
     tgcccgccag cgcctgttgc gcggcgtcga tattctcgcc gatgccgtga aggtgacgct    205140
     gggaccgaag ggccgcaatg tcgtcatcga aaaatccttc ggcgcgcccc gcatcaccaa    205200
     ggacggcgtt tccgtcgcca aggagatcga gcttgaggac aaattcgaaa atctcggcgc    205260
     ccagcttttg cgtgaagttg cctccaagac caacgatctc gccggtgacg gcaccacgac    205320
     ggcaaccgtg ctcgcgcaag ccatcgttcg cgaaggcgcc aaggcggtcg ctgccggcct    205380
     gaacccgcag gacctgaagc gcggcatcga tcttgccgcc accgaagcca tccgcagcat    205440
     caaggaacgc tcccgaaagg tcgcctcctc cgaagaggtc gcgcaggtgg gcacgatctc    205500
     ggccaatggc gagagcgaga tcggcaagct gatcgccgaa gccgtccaga gggtcggcaa    205560
     tgaaggcgtc atcaccgtcg aagaggcaaa gagcttcgaa acggaacttg atgtcgttga    205620
     ggggctgcag ttcgaccggg gctatctctc cccctatttc gtcaccaatg ccgaaaagct    205680
     gatcgtggaa ttcgaggatg cctacatcct gctccatgag aagaagctgg cgactctcca    205740
     gcccctgctg ccactgctgg aagccgtggt tcagaccggc aggccgctgc tgatcatcgc    205800
     cgaggacgtc gaaggcgagg cgctggcgac gctggtcgtc aacaaactgc gcggtggcct    205860
     gaaaatcgca gccgtcaagg cgcccggttt cggcgaccgc cgcaaggcgc tgctcgagga    205920
     catcgcgatc gtcaccggcg gccaggtcgt ctcggaagac atcggcatca agcttgaaaa    205980
     tgtcacgctc gatcagcttg gccgcgccaa gaagatccgc atcgacaagg agaccacgac    206040
     ggttgtcgac ggtgccggcg agaaggccga aattgccgcc cgcgtgcaac agatcaagac    206100
     gcagatcgaa gacaccagtt ccgactacga tcgcgagaag ctgcaggagc gcgtcgcaaa    206160
     actggccggt ggcgttgccg tcatccgtgt cggcggctcg accgaaatcg aggtcaagga    206220
     aaagaaggat cgcgtcgacg atgcactgaa cgcgacacgc gccgcgattg aagaagggat    206280
     cgtgccgggc ggcggtgttg cgctgcttcg ggcaaaaact gcggtgaacg ccctgaagaa    206340
     cgacaatccc gatatccagg ccgggatcca cattctccag aaggcgcttg aagccccgat    206400
     ccggcagatc gccgaaaatg ccggtgtcga aggctctatc gtcgtcggaa aggtgctcga    206460
     gagcaactcg ccgaccttcg gcttcaatgc gcagacggag aaatatgtcg acctcctcca    206520
     ggaaggtatt gtcgatccga ccaaggtggt tcgcaccgcg ctccaggatg ccgcctccgt    206580
     tgcgggcctt ttggtgacga ccgaggcgct gattgccgaa gtgcccaagg agaaaacgcc    206640
     gactccggcg gcacccggcg gtggcttcga ctattaaggc cacctatgcg acgcgtcacc    206700
     ggcgggaccg ccgtcggtgg cgcatccagc gcactggcta tgatgcgctc gacgcattgc    206760
     tagtgcggct gcaccgtcgc aaggccgaac tgttgcgcgt gctggagcgg ccggaaatcc    206820
     cgctgcacac taacgcgtcg gagaacgatc tgcgaacctt cgttacaaag cgaaagatct    206880
     ccggcggcac gatgagccgg gacggtcggg ttgcgcgtga cacgatgctc ggcctcatga    206940
     agacgtgcaa aaagctcaag ctttcctttt ggcactatct cggcgatcgg cttgggatca    207000
     gcggaaaaat tatcccaccg ctggcgggcc ttgttgcggc aaaggtctga tggacgtgat    207060
     cgtcatctcg ctccggtcga gactacgtcg cctgtcaacc cgaatctgtc aatcggttcg    207120
     cctccacaca tatgaccacc catcaagttt tgcgtcggtc gctttcatca gcaatgcctc    207180
     tggaacgaac tgatcgcgca gaaggccaat cttttccaga acccgacggc tagcgtcatg    207240
     ggctacggcg catgttgtat ggacactgga cagatgcgat tgctcactaa cccaacgcat    207300
     tacggctaga ccggcttccg tcgcgagacc ttttccccaa aaggcgggcc cgagcccgta    207360
     gtgaatctcc gcactgtccc cctccataaa catcaggaag aggccgatcg gtctatgact    207420
     gctgcggtcg ataatgctcc agacgaaacg gtcgctattc gtccaattgc tttctcccca    207480
     cgcattgatc acagcttcag ttcgggactg cgcgggatgc gggcctcgcg ttaaaaatcg    207540
     cgaggccttg ctgtttcctg tatattccat gaaaacgccc gctgcgtgct ccgcacgggc    207600
     agcacgcaat agaagacggt cggtcgagaa ttcgatcggc ggtgattttg gcatctcgaa    207660
     gagtgctccg aatctttgaa agctctgaca acttaatttt atccggcgaa gggccattgc    207720
     tcaatgactg caaatggcgc gatccagtca aagacttgtc tgtctgcaac gtgaaccgta    207780
     gacgatctat cgatcacggc gaagacaacg gatcgggatc gtgtccgatg cccacccgtc    207840
     agatggaagt cacgtcagcg accgcgactg cataacagtt tggcactgcc ctcggatttg    207900
     ccccagttac tccagttagt gcgtggggca aaaggggtgg cggcggtgcg ttttcgggat    207960
     gatgaagacg ggcattgagt tagctgtgca taaagatctg cctagaatcg gaaggcggcg    208020
     gtgggcgatt ccgccggcgg gcaaatcatg attctttctc gtcatgggga agaagccgct    208080
     accgtccgtt gtgcatgttg agacgctgtc gcttgtggct atgcgccggc tcgttggtgg    208140
     ccttgtcgga gagctgcaca cgttgaaggc cgaggtcgca gcactgcgat ctgagaacga    208200
     agccttgcgg caagacgttg ccgagttccg gttggagaat gccaacctta aggttgagaa    208260
     ccagcaactg cgcgacgaga tcgcacggct ggagaagctg ccccgcggtc ccaagcgtga    208320
     caagaaccgg gttacccgca tggtgacgct gaacgctggc tgacgcctca gggcaagttg    208380
     attgctgccc cttgccagac ggtgttgccg cggctttggt cgaacttacg ttggatctat    208440
     ctggcgctac atgtgcaggg acaggtgacc acactgcgcc tgacagtgac cctcactagc    208500
     attggcatcg agatctcgaa gcggcaggtc gtccggcttc tcaccactga gcttgagcgg    208560
     ttcgtcgagg aagacaacgc aattctccat accgggcgca acgcctacac tacccagatc    208620
     ggtggcgagc gcttttccgc cttccgcacg agcttttcca aatcgcggct caacttcctt    208680
     tcaatcctga aagcgggcca tcagaattat atcctcaacg acgaggcgat gaactggttg    208740
     cggacacagg gcgccgagca ggcgatcgta gagaagctca agaccaggcc cacgactgac    208800
     caggttgcct tcctggagta tttgaccggc agagacatcg atatcttcga ccggcaacct    208860
     atgtgcttgc ttgtcgaagc cggtagctgg ggcatgatcc gccatcatgg cctgctcggc    208920
     aacacggtca ttgtctccga cgatgccggc cagttccgcg tcggcagtcg cgccttgtgc    208980
     tggatccatt gcgagcgttt gttacaaaaa ctaatgccgg cgaagcgaag agaggtgcga    209040
     cgcggcgaat tgatccgcga cctcgtctgg cgcttctaca aggcactcaa gacctggaag    209100
     ctaaagccgt caccgcaggc agcccacgca ttccgtcgca gattcgatcg catcttctcc    209160
     tcacgcaccg gctatgacgt tctcgacaaa cggctggtgc gcttgcaccg gcgtcggcat    209220
     gagcttctca aagttcttga gcatcccgat attccgcttc ataccaatgc gtcggagaac    209280
     gacctgcgga ccttcgtcac caagcgaaag atctccgagg gcaccatgag ctttaacggc    209340
     cgtatcgctc gcgacaccat gctcggcctg atgaagacct gccagaagct cggcatctca    209400
     ttctatgtct atcttggtga tcggcttggt ttggacggcg atcgatcaaa aatgccgcgt    209460
     ctggccgaat tagtagctat cccgaactga tagtctatcc ctttggcacg aaaaatatgc    209520
     cattcaacac cggcgatcac ttccacgacg ttttccgagt gttggacgct tcccttgtct    209580
     tcctcctttg caagcagtag atcggtaaga gttaatgaac cacagacgtg atttctttat    209640
     agaacttgcc agcagaattg ttgccttgga gggccgcctg atagtcgcca tcgatggagt    209700
     ggacggttcc gggaaaacta ccttcgctga cgaattggct ccagtactta cccaaaaagg    209760
     ccgccctgtt gtacaagcta gcgttgatgg atttcacaat accaaggcga tccgctatcg    209820
     tctcggtcgg aatgatcccg aaggcttctt cctggactcg cataattacc aaagtttgca    209880
     ccgctttctg cttggtccct tccgggctgg cgcaaacacg gtggatactg cccgctacga    209940
     tcacgctgcc gaccacgaaa tctcgtagcc aaaagcagtc gagccttcgg ctgtccttct    210000
     gatcgatggg atttttctgc atcgggatga gttgtctaat ctatgggatt tcagcgtatt    210060
     cctgtccgtt ccgttttcgg tttcctatgc ccgaatggcc gtccgggatg gttctaaccc    210120
     cgatcccatg gctcaggaaa acaggcgcta ctacgagggc cagaaaatct atcttcggaa    210180
     ttgcaagcca gaagcgcgtg cgaccgtcat cgtcgataac tcgccaaatg aaaaaccaaa    210240
     actcgtacag gcaccggccg gacacgtggc tcgcaaaggc ccccaatgac gtccatctgg    210300
     cgatcgacta ccccggcgtc gtgtcttcgg cggcgccacc ccttttgtcg ctttcagcta    210360
     gcgatttcaa acgtcaaaat gtcatgagct ggctgggtgt agccgctata atgagccttg    210420
     atttcagcta aggatttcac tttaggcttg gaattacaaa agcggtcggg agccttggat    210480
     agaggttttt atcgtagtac cccttccaat ttacaattat gggatcgacg ttttgcgtac    210540
     gatatgagag ttccctcgcc tccgctcagg cgctgatcca tgtggatgca aaatcgccgg    210600
     aaatcccggc ggcgtccgtg atagcgtcga tcacccgttt gttgaggaga gaaaccccct    210660
     cggcagttca tcagggctaa atcaaactag cagactgtcc ggtgaacggg ggcactccat    210720
     ccgcatggat taccggttga agcggacgcc gatctttgaa ctgcgaagtt agctgcggca    210780
     aggggcatga ccctcaggca ttccaaatcg tcgtgcagtt gtgatgatgg tcggtcgtga    210840
     ggtccgttga gtgtcgatgg tcgtcgcaaa ctggggctgg aaacatgtgc gtcttcgatt    210900
     gcgtaattca aagcagagaa aaggaggcca catcaagcgc cgggcggcaa acattggtcg    210960
     ccaccagccc ggaggcaacg cccacgggtt ccgtccggac gtcaaccagt cggcacctct    211020
     gtgtaattcg gcatctttcg cgagtggctt tccaccagga gatcacgaaa gctctggttt    211080
     tcttcgcggg aatgagggta tgatccactc acagcgcctt ttcgagttcc ggcagcgcct    211140
     cgaagagatc ggcgacgagg ccatagtcgg cgatctggaa gatcggggct tcttcgtcct    211200
     tgttgatggc aacgatgacc ttactgtcct tcatgccggc cagatgctgg atggcgccgg    211260
     agatgccgca ggcgatgtag agctgcggtg cgaccacctt gccagtctga cccacctgcc    211320
     agtcgttcgg cgcgtagccg gcatcgacgg ccgcgcgcga tgcgccgacg gcggcaccga    211380
     gcttgtcggc gacgggaagg atgacttcgc ggaacttctc ggcggaacca agcgcacgac    211440
     caccggagat gatgatcttc gccgaggtca gttccggacg gtcggatgag gacagcgcat    211500
     cactgacgaa gctggaaaga ccgggattgg caaccgcggc gatcgcctcg acggcagctg    211560
     agccgccttc cggggcagat gcgaaggacg ccgtgcgaac ggtgatcacc ttcttcgcat    211620
     cgctcgactg caccgtctga atggcattgc cggcatagat cgggcgctta aaggtatcgg    211680
     cggagacgac ctcggtgatc tcagagatct gggcgacgtc gagcaaggct gcgacacgcg    211740
     gcagcacgtt cttgccgacc gacgtggcgg ccgtgatgat ggtgtcgtag cttgcggcca    211800
     gcgatacgat cagatcggcc agtggttcgg cgaggttgtt ggccagctcg tcgctttcgg    211860
     ccagcagcac cttggagacg ccggcaagct ttgcagcggc atcggcggca gccttggcac    211920
     ccttaccggc gacaaggata tgcacgtcgc caccaatctt ggcggcagcc gtcagcgtct    211980
     tcgcggtctg gtcggaaagg ctttgattgt cgtggtcagc cagaagaaga atggccatga    212040
     tgattgtctc cctttcctgt ccttagagca cgccggcttc ggtcttgagc ttctcgacga    212100
     gttcggcgac cgaacccacc ttgatgcctg ccttgcggcc ggacggctct tccgtcttca    212160
     gcactttcag acgcggctcg gtcgagacgc cgaagtctgc tgggctcttc ttgtcgagcg    212220
     gcttcttctt cgccttcatg atattgggca gcgaggcata gcgcggctcg ttgaggcgca    212280
     ggtccgtggt gacaacggcc ggaagcttga tctcgatggt ctgcaggccg ccatcgactt    212340
     cgcgggtcac ggttgccttg ccgtcaccga tctcgatctt cgaggcgaag gtcgcctgtg    212400
     ccgagcccag gagggctgcc agcatctggc cggtctggtt gctatcgtca tcgatcgcct    212460
     gcttgccgac aatgatcagg cctggctgtt cggcgtctgc tacacccttc aggatcttgg    212520
     cgacggccag cggttcgacg gcatcatcgg tctcgaccag gatcgcccgg tcggcgccca    212580
     tggcgagtgc agtgcgcagc gtctcttcag ccttggcagg cccgatcgag acgaccacga    212640
     cttcctcagc cttgccggct tccttcagcc gcagcgcttc ctcgaccgag atctcgtcga    212700
     acgggttcat cgacatcttg acgttggcaa gctcaacgcc agtcccatcc ggcttcacac    212760
     ggatcttcac gttgtaatca actacccgct tcacggggac cagaatcttc atgagcataa    212820
     tccttgtcgc ggcattccca ggcaattttc ttatttaaca aactggagta gcgagttaat    212880
     cgactggttg gcatcgccgt agaacatacg ggtgttttcc ttgtagaaaa gcgggttctc    212940
     aatgcccgaa tagcctgtgc cttgaccgcg tttggagacg aagacctgct ttgccttcca    213000
     gacctcaagc accggcatgc ctgatatcgg cgagttcggg tcttcctggg ccgccggatt    213060
     gacgatgtcg ttcgacccga tgacgatgac gacgtcggtt tcgtgaaagt cgtcgttgat    213120
     ctcgtccatc tcgagcacga tgtcgtaagg caccttggct tcggcgagca atacgttcat    213180
     gtggcccggt agacggcctg caactggatg aatggcgaag cgcacggtct tgccggcggc    213240
     gcgcagtttg cgggtgagtt cggaaaccgc ttgttgggct tgggcgactg ccatgccgta    213300
     acctggcacg atgatgacgc tgtcggcgtc gttaagggct gcagcgacac cgtctgtatc    213360
     gatggcgatc tgttcgccga tgatctccat ctgcggtcca gtggtggccc cgaagccgcc    213420
     gaggatgacc gagacgaagg agcggttcat tgccttgcac atgatatagg agaggatcgc    213480
     gcccgacgag ccgaccagtg caccggtgac gatcagaagg tcgttgccga gcgaaaaacc    213540
     gatcgccgcc gcggcccagc cggaatagga gttcagcata gacactacca ccggcatgtc    213600
     ggcgccgccg atccccatga tcagatggta accgatgaag aacgccagga ccatcatcag    213660
     gatcaaggtc caggcgccgt caccattcac atgcatcagg agcaggatca atgaggcggt    213720
     cgccgaagcg gcattgagga aatgaccacc cggtagcttc ttcgccttgc cgtccagctt    213780
     gccggcgagc ttaccgaagg cgacgaccga accggtgaag gtgatcgcgc cgatgaagac    213840
     gccgaggaac acttcgacct tcaggatgga aagctctgct ggcgtcttat gcgcgaggat    213900
     cccagcgaag ccgtcgagtg ctgcgcgggc cgcctcatcc agaccagcca cgcggccggc    213960
     cgcgatatcg gcattgaagc cgatgaacac ggcggcaaga ccgacgaacg aatgcagggc    214020
     ggcaacaagt tgcggcatct cggtcatctg cacccggctt gccacatagg tgccaagcac    214080
     tgcgccaccg ccgatcatca gaagaatgat gaaccagttc ccgacactag aaccgaacac    214140
     ggtggcaatc acggcgagcg ccatgccgac gatgccatac cagacggcac gcttagcgct    214200
     ctcctggccg gatagtcccc cgagcgacag gatgaagaga actgcggctg cgatataggc    214260
     cgccgataca ataccgattg tcattttgag ttccccctac ccactcagga cttctggaac    214320
     atggcaagca tgcgccgtgt gacgaggaag ccgccggcga tgttgatggt cgcgatcagt    214380
     atcgaaaggg ccgccagcac taccaccagc caatggtcgg agccgatctg caggagcgca    214440
     cccaagatga cgatgccgga gatcgcattg gtcacggcca tcagtggcgt gtgcagcgaa    214500
     tgggacacat tccagatcac ctgaaaaccg acaaagcagg ccagcatgaa gacgacgaaa    214560
     tggctcgtga agttggccgg cgcataggca ccgatgagca gaagaagagc ggtaccgccg    214620
     gcaagcagga aagcttggtt cttggtctgc gccttgaagg cgaccgcctc ctttgcccgt    214680
     ctctcctccg gtgtcggctc tttcaccttt tccttgggtt tctgcgcggc gatcgcccgg    214740
     atcttgggag gcggcggtgg ataggtgatc tcgccctgat acgccaccgt cgcgccgcgg    214800
     atgacgtcgt cttccatgtt gtggacgagc ttgccatcct tgccgggcgt caggtccgtc    214860
     agcatgtggc ggatgttggt ggcataaagc gtcgaggact gggctgccat ccggctcgga    214920
     aagtccgtgt agccgatgac gatcacgcca ttatcggaaa cgacccgctg atcggcgaca    214980
     gtgaggtcgc agttgccacc gcgttcggcc gcaagatcga cgatcaccga accgggcttc    215040
     attgccgcca ccatatcggc aagccacagt tttggcgcgt cacgaccagg aatcaacgcc    215100
     gtagtgatga cgatgtcgat ctcgggcgcc aactctctga acctggcgag ttgcttctcg    215160
     cggaattccg gcgatgacgg cgccgcataa ccgccggttg ccgccccctc ctctgcctgg    215220
     tcgtcgaagt cgagatagac aaactccgcc ccaatcgact cgatctgttc ggcgacttcc    215280
     ggccttacgt cgaacgcata ggtgatcgca ccgagcgatg tcgccgtgcc gatcgccgca    215340
     agacctgcga cgcccgcacc gatcaccagc accttggctg gtggcacctt gcccgcggcg    215400
     gtcacctggc cggtaaagaa gcgcccgaaa ttggtgccgg cctcgatcac cgcacggtag    215460
     ccggctatat tggccatcga cgacaacgcg tccatcttct gggcgcgaga gatccgcggc    215520
     accatgtcca tggcgatgac actggcgccg gtcgcgttgg cctgctccag aagctccttg    215580
     ttctgtgctg ggtagaagaa tgaaatcaga atcttaccgg acgagagcca atcgacttcc    215640
     gtcatttcgg gtggccggac cttcacgatg acgtccgcgc tggcatagag gagttctttg    215700
     ctgtcgatca cctcaatgcc ggcttcacga taggtctcat ctggaaaacc cgctgccgtg    215760
     ccagcgccgg cttcaatcac acattcatag cccatcctgt gcaattgtat tgcgctgtcg    215820
     ggggtcattg cgacccgtgc ctcgccagcg tggatctcct taggcgaacc gattttcaag    215880
     tgtttttcct cgcaagaatt atcaatgaga tcacaacgcg cgatcccagc atttgaagga    215940
     atagggctgc ccggaagccg cgggtagttt gcgacatgcc gttgcgccat atcagaatta    216000
     ggaactacag cgcatcaacc agcacgctct ggcaacagaa gctcttcgtt gttccgagga    216060
     aggtcattga tggcgactgg caagacgctg ccgttgacca tgacggcacc cgcgttggcc    216120
     ggctccagaa cggagggatg atctcgcgac gcctgacagc cgcatccgcc ggtcgcgata    216180
     cgaattcctt acgcaacctc aaacgcgcat gagttttcac caggccgctt atcatactta    216240
     agttcatccc cccggagtct gttctcggtc aaatgtgcga ttttcgcgcc gctaaatcag    216300
     cgacctcacg ggacggtagc agccggggcc aaatgaactc aaatctatat tgttcagtag    216360
     tgctatccat gaaatggatt attacttgga actatatcag aatggctgtg tccggcgccc    216420
     tattaaactt aggggcagat ctccaatcgt tgcgccaaga ctgcgaagcc atttggcgtc    216480
     ggtcgcggct tcaaaagttt cttgcgcttt gagcctggct tcctttgaaa tttttgcagc    216540
     gcctatccca ctggcgctcg gctctctcca ggcaatattt tggttagaac gctttggtac    216600
     gcgtcgatgt atccatcgaa gcgatttcat gaattcattt attcaatttg ttaaatatgg    216660
     ctacttcgtt catcgatgaa gacactgatc ttggttcgag ggcacccaat tttcatcagc    216720
     catctaccgg gaacgcctct ccagggccgc gaaagaggag gaggcttttg gcagggtttc    216780
     tcaatgaaac tacattacaa gtagggaaga agaagtgggg tgatctgcaa tgatctgtgg    216840
     ggggagcggg aggtatgcgc tctgcggatt tgaggcgaga attggagttc ttcagcgtct    216900
     tcgctctcgc cggtgccgct tgtgctgcag tcgagcaggc attcgctctt aactgaccaa    216960
     tgccgagcct ttgccgctct gccatcacag tctaagcacc tcgttcggcc aaagtactag    217020
     gtccgtgaag gacggcagtc caggcccgag catcgtttcg ggacaggcac cgtctctgtg    217080
     gcatcgccgc agcattagag atcttagaga tctatgcgtc aggcttcccg cttgacggag    217140
     gaacgcaaaa cgaggttccg cagcggctgg gaacagtttt tcagcaaatg acatgggtgg    217200
     gagcagccaa cgcgctgcgt ctcctcgtgg gagtgcgact ttgggaggag atcgtcggaa    217260
     tggaaattca atctagtaga gtcagactga gaaaatggaa gctcttgaac gttggcgtcg    217320
     tggtaattat ggcaccgcta gcactggccg ggcaatcatg ggcacaatca cccgggccgg    217380
     acaaggcacc ttggttgaag tcgctctcgg atattggaat tgacgtgcgc ggcctatacg    217440
     cagtgggagg ctttgcgact gttacgggcg gtgctgaaga gggaaaactt ggtattggtt    217500
     cgctaatgat aactcatgtg gatttcgact tgggcaagat cattggctgg agtggcacta    217560
     agattaagac agagttcact atgtatccga ttaactatcc gaaagacgga gaatacttct    217620
     cccagtacgc gggcagtttc ttaggaggag agcagtaccc gactcatgat gccgatttcc    217680
     aaccatggct ttcacagctg accctcgaac atgatttcgg aaatggtctt aaactcgagt    217740
     tcggcaagac aaccatgcag cgttattttt ttccaaacgt atgcggcatg gacatactct    217800
     gccccgaccc gatcatcaaa tgggatagcc aattacctcc gcccgacgct ggaaccctag    217860
     gctttgttgc gtcctatgaa gcgcgcgacg atttaacctt tcgcttcgga gctcagcaac    217920
     tacgtgacat cgacgcgctg tttgccgatc acggctggaa cgccttttca actacgggtc    217980
     acacaggaat attctatatt ggcggggtca ggtaccagaa caacgttaat cctgtcgatc    218040
     tcgaactcgc tgggtggtat gccgacacac cgctagtgga cgcctatacc ggagaagcgc    218100
     acactggcac tgcgggctta cagttaaagt ggagcaagac tatttggtcg gaggaggacg    218160
     gtggtcgccc ggaaggtctg gctgtattcg gagcgcttgg cgactcgttc gatgaaaccc    218220
     gcccgatcga ttggtccgca acgctcggtc ttcgttggga gaacccttac gaaagcccaa    218280
     gcggcgagtg gggcatctca cagatttccg caaaagcaat ttatgccagg atcggcgaat    218340
     cgacactctt ggctcaacgt gagcagcggg tcgcttccgg cggacaaaga gttctcggga    218400
     atccgaatca atggcgtctt tcactagaca tgatcacaac ggtaggcaaa cacgttttcg    218460
     tccaatcctc ccttcaatat gtcatcaacc cagacagctc acagtcgcga acatcggagc    218520
     tgccaaaaga tggcataatc gcaggcacta tgataaatta cgtcttctga aggtctaatc    218580
     gctccaagct cgtttcgcct gaggcttggc gaccgtcacg tccggattga acgtttaaac    218640
     aatggtccgc ttctcggcgg tcgccagcga tgtcgacgca ccggttgtta tttctatcct    218700
     aggattgcgg cggttataat agccccatta cctcactcac ttattgagtg gaaatcgtat    218760
     ccgcagtttt ttgagaccat cccaaacagc gaatggatcc gtcacacgag gctgtaggat    218820
     gcctatccag ctaacgtata tatagcgagc tatttcttgt ggtccacaag atgagtgaat    218880
     ccaacatttg agctgcggcg tcttcatgga tagccttcgc tgcaaacctt ccgcctgcca    218940
     agatctcctg tgcataggcg atgttcactc cttcgtacac gggaatcatt cttagacagt    219000
     cgagaacagg cttcaacatc tgcaccgctc tcgttcctgc tgcgataccg ccatagctaa    219060
     tgaagcccgc aggcttgaac ttccactcct cgtgaaggaa atcgagagcg ttcttcagcg    219120
     cgccaggaaa gctatgatta tactccggag ttacgaagac gatggcgtca gccctttcta    219180
     cgatacggct ccattgccgg gtatgctcgt gctcatattt tcggtttctg gggtgatgcg    219240
     gctcatcaaa attggggagg gcgagttcgc gcaggtcagc gatctcgacg ctgaatcggc    219300
     cgtccagttc ggcgcgttcg gcagcccagg ccgtcaacgg ataaccaatt ctcgttggtc    219360
     tcgtgctgca ggcaacgatc agtagatgat gcatttgaaa tatccttggc attggatgaa    219420
     ggtgattgat gcggggtcaa aaagcccagc aggctatggg ccatgccgaa ctggccgacc    219480
     gcataccaaa gcgccagagc cgccgtgatg aatatgccct gcgaaatcgc gccgccatac    219540
     tggcgcctga catggcaagt gccgattgta tgcggcgcct ccggctttgc ccgagcgtcg    219600
     atggacggga tcgttcgtcg actgccggat caggtcggga agctcgtcac ggagccacac    219660
     gcgcagcttc gcgaacttat cggatgccgc gaaggcagta cgcctcggat ggggctcgtt    219720
     gatctcgatc atcgtgttga tccgccccag cctggcagag aagatggcga tccggtccga    219780
     cagcagcacc gcctcgccga ggctgtacgc cacgaaaacg atcgtctcgc catccggctc    219840
     agtaattcga aaagatcttg ccgagaatca ttcgagtctg ctcgtcgatt gccgtgaaca    219900
     gttcgtccat gaggatgatg ggcgtatcga ggctgagggc gcgggccagc gacgcccact    219960
     gccgcgtgcc gccgaaaagc tggcgcggga aatgcccggc aaaaccggca acgccgaccg    220020
     cattgagcgc ccgttcctcg gcttcggtgg cgacgacatc cctgaatttc agcgcgaccc    220080
     ggatggatat tgtccttgat gttcagccgg ggaaacaacg tatgttcctg aaaagagtaa    220140
     gcgaccttat ccggtatcgg cccggtgacg gacgggccct cgacattgat cctcccttta    220200
     gtcggcctag caaggctgct gaacatgtcg agcagtgtgg tcttgccgcc gccgctctga    220260
     tcgatcaacg tcagcatctc cccttggctc atctccaggt cggccacgtc cagcgtctgg    220320
     atataaccgt ccgtcccttc ctgctcatag gcatgagata catcaaccgt ctgcattccc    220380
     gaactgttta tcgtcgctga gttcatattg ggtccttccg tccagtttct gtacggcaat    220440
     tttattggtt gaacaaccgt ccaatttggt gcaacataat tttgctactg gtcgtgaata    220500
     ccgcccgcgc ttacggagga aatcatggat attcaacctg ggtggctccg cctcatcggc    220560
     gcagttgtgg cattgactgt tgtcttgtcg ataaccccgg cgcaggcggc caaaacgtgt    220620
     tgggtgggga aagcgtcgtc gtcttttgcg ttatctctcg gtcgtgcttg tcggcatggg    220680
     gtttttgcct gctctgaggc ggcgctgtga cgagaccttc gccgaggaag gtcgaccgtg    220740
     acaaccggcg cgtcaggctt tcggacaacc caccacgctt ccgcaatcgc aacgatagag    220800
     gatcatgcca tgccgaccac cactgacggt acggaactcg ttgccgcact tcgccaacag    220860
     ctatccgtca acgatccctt ccttggaaag gcgagcccgg ctgaattcga ggccggcagc    220920
     atactgtggc cgggtgaccg ctggtcgagc atcgagcgcg tcttcgtgac cgaggcgaat    220980
     ggccggaggc tcgaggaata ccggtacacc ccggctgcgg gcgatcgcgg cgtgctgccc    221040
     gtcgcgttca tgttcgatct caccggcgaa aaacaggtga tcgtctattc cgaccaccac    221100
     ctcgtcgacg accgggtgcc tattctcccg aaggtcacgg ataatcatcc gtggcgttca    221160
     gaagacgacg ttctgttcac ctatttcagc gcgctgaacc gcaaccgcct ggaggaagtc    221220
     ctcgaccagt tcgagacgga cggctatttc cggcattcca acgacgagac ttgtcgcgga    221280
     cgcgatgaat tgcgtattga tttcaccaag atgatgggct cgaccggcat ccgcatcgac    221340
     tattgccgct tcaccgatga cggtaccact tgcgccgccg aggcctatat gccgtccgga    221400
     cgcccggccg tcgcggtcta cgagcgtgga cgtcacggca agctcaaggc tatccgcatc    221460
     tacctgtgag gcatcgatgg cacagcttgt ctctctgatc ggcgttccgc acgatcccac    221520
     cctcccgatc gccgcccggc tgaggcctga cggcaaggct ccgcctggcg cgatcccggc    221580
     gctggattgc ttcgaggagc ttcgccggga actggaaaag gccagacccg acgccctcgt    221640
     catagtcggc agcgatcacc tgaaccagtg gttcttcaat aacatggcgc cgttcacgat    221700
     cggcaagccg gagcggttga aaggaccctt cccctcggaa atccgttcct ggggattgga    221760
     gagttgcgac cttccggtcc atggcggcct cgcccggcat atgctgaaac acggttatga    221820
     ggagggcatc gatttcgcgt tttcggacga gttcatcgcg gaccattcct tcacgatccc    221880
     ggtcaacttc cttcggcccg agcaagacct tcctgtcgta ccggccttcg tgaacctgct    221940
     cgcgccgccg gtcccgcccg gccggcgttt cgtagatgtc ggccgtgcca tgcggtcggg    222000
     gatcgagagc tttgcaggtg gggagcgcgt ggcactgatt gtcaccggtc atatgtcgaa    222060
     cagcgtcggc ggcccgggca tgctcaacaa catgaccgag ccggaaaccg actgggaccg    222120
     tgccatgtgg gcgcgcatcg aggcgaatga tgtcgacgcg atcctgcagc attccacatg    222180
     ggaccggctc tacgccgccg gcaacggtac gccgggcttc ctggcctatc ttctggcctt    222240
     cggtgcagcc tcgcgggcac cgccgaccta tcgccgcctg atcgcgacga cggcgcagcc    222300
     tgcctgcgca ttccttgcct gggatgaggc tgcacttgac ggaggacggg catgagccgc    222360
     tacgaactga acaaggcgct gtggaactat gcccgcgagc cggatttcaa atcgcggttc    222420
     gatgcggatg ccgcttcggc cgtcgcgacg cggtcattgt cggacgcgga gcgttcggcc    222480
     ctgactgacc gggatatccg tgccatcttc gaactcggcg cgcatccctt ccttctctac    222540
     tccttcgcga tcgcctcgaa cggcggttgg tgcatggaga tgatgaagga atatgtctcc    222600
     cggctccaag gcttgacgcc gggcgacata gaaacctgac acttagggaa acttgcctat    222660
     ttcgtcctca cgtcttccgt cgatcggcgg aagaggaagg tcagcaggaa ccagaccagg    222720
     cgcggcgtca gcatctttaa ggcgttgcga gcctcttccg gcgaaagttt cgccgtcatc    222780
     ggcatcgtgc cgaagatctt gcccttcacc agcaggaaat tgccgtcccg gtcgatcgcc    222840
     gagacgttca tcagttcctt cttcgcgctg tcgacgatcc ggatgctggc gggcttcttg    222900
     acggtctcgt tcatcgcttg ctagccctca tctcttaatg gctttgtcga agtcgatgcc    222960
     gagttcatcg aacatcttga tcgcggtcgc gcggccggcc ccgtagacgc caccacccgg    223020
     atgcatgaac ggcccgacca gatagagccg ttcggcgccc gggacagtat attggccgag    223080
     atccggtgtc gggcggtgtc ctaccgtctg gtacatgaac ggcgcgcagc catgcatgtc    223140
     gccattgaca aagctgtttg gcgacgagcg ctccatatcg agcggcgacc agctggtgcg    223200
     ggcgatgatg ttgtcgtcgg tcaggttgga tatgaacttg cggtaccagg agaggttctt    223260
     gtcggcttcc tgttctttga tctcatccca gtaggccgca cccttcccct cgatcgcata    223320
     gggcgccatg gtgatggcgt ggaaaatgcc ggcgccggcc ggagcgcggc ttggatcggc    223380
     atgggtttcg tcgccgccgc cgagcagcgg gcgtggcggg atgcgcttgc ggcgaaggtg    223440
     atcgaagtcg tcgagcagtt ccgacagccg atcgaaagtg aaatattcta gcatcgtcgc    223500
     cttggtgatc tcctcgccgg cgtaatattt ggtccgttcc ttgaggtcgt agtggctgac    223560
     gaacaggctc tgcgtcgacg tattgacccg gttcgcgcgg cgatagatcg ttgggtccag    223620
     ccccttgacg aacgtctcca gccggtgtgg atggatggcg ccgatgacgc cgtcgcgcgc    223680
     caaaaattcc tcgccgtcga tcattttgac gccggtcgcg cggccgccgc tgatgaggat    223740
     ctgcgccact tcggcattgg tgcgaatctc gccgccattc gcctcgatcg agcgcaccag    223800
     cgcgtcggtc aagccgccgg aaccgccgat cggctgcgaa acgccgaacg tgtggatgat    223860
     gccaggcatc agatagatgc ccatgccggt gccgagttcg tcgggaagct gcaggttttc    223920
     ggtgacgagc ttgaggaggt ggattttcac ccggtcgtcc tcgaaggcgt ggtctataat    223980
     gtcgagcgac gaacggctca tggcatcgag gatgtcgcgg ccttcgtccg aggagtcgag    224040
     catcgccatg aacggcccgt atggcagcgg cggcgaatag aggcctgaca tgaacatcgg    224100
     catcatcgcc atcgatcgct cggcgaacat gcggtaggtg tccgcgtcct tctcgctgaa    224160
     cctggcgatc tcggcgcagg cacggtcgag atccttgtag gtgatcaggg tctcgttgcc    224220
     cggaaagatc gaggcatagg gcacatcgga atagttgtaa gtaagcccat gcttgccgat    224280
     cagcccgagt tcgtcgtcgg tgatcagcgg gttgccctgg atcataatat ggcaggacga    224340
     atgcaggtcg tggcggtagc caggcgtgtt gatctcgcgc gtcaccacgc cgccgccgac    224400
     gaagtcctgg cgctccagga taagcacctt cttgccggcc tttgccagat aggccgcggt    224460
     ggtcaggccg ttatgtccag cccccatcac cacgatgtcg tatgtcgcca taaattcctc    224520
     ccttggtcga tcgaccaagg tttagacagc tgaccaagat cttggaagaa ggtacaattt    224580
     tgttcccagg tcggggcaaa agaaaaggcg ccgaaacggc gccttccgat gttacaattg    224640
     aaggaaatcc ttcacatttc ggtaaacgtc tcgccgatcc agtcggcaat gtagtcgcgc    224700
     aggatcgtgc cgttgtcggc gccgcaatgc tccagctcga aatccgcctt ggtggtgata    224760
     tgcagctcgc gcttggcgct gttgacagcc tggtcgtaac tctggtgcgc atattcgacc    224820
     gggatctggc ggtcgccgcc gccgtgcgtg atgaggaaag gggcttcgat cttctcgacc    224880
     acaccgttga ggtccatcgc cggcgcccag accatgaaat cctcgatcgt cttcttgccg    224940
     aagacccaca tcacatggtc ccagtaatgc ggcaccggcc ggtcgccttc gcgagcttga    225000
     cggcgttttt gcatctcgcc ccagttatga ttggcgccca tgacggcgca gagcgcgaaa    225060
     cgcttttcga aagcggcggc gcgtggcgcg aaatagccgc cgagcgacag gccgaacatg    225120
     ccgatgcgct tcggatcgac gtccttgcgg gtcagcagat aatcgaccgc agggcttgcc    225180
     caggcttcgg catcgtggcg cccgacgaga ccgttcagcc gcagggcagc gcccgttccg    225240
     ggctggtcga tgacgagggt cgagacgccg cgggcggcga acgcggccgg attgccggcg    225300
     ctgaagatct gctctttcat ggaatcgagg ccgttgcagg ataccagcac gggtgcggga    225360
     cgcccatcaa tcggcttggc cgggacgaac agcgccggaa acgacgatcc ttgataggga    225420
     atatcgatga attcgacgcc gagtccctgc agttcaacac cacggcggaa catctctagg    225480
     cccttgcggt aagcttccca gcgcggcgca taatcgcgcg actgcatgcg ttctgcagcc    225540
     agcagatagc ccgctgcgcg ttggtacttg atgccggcgg aaagcttgcg gcccttttcc    225600
     tcgtcggcca tgccgttgtc gatcacctga tgcgcgacat ttacccacga atcaaaaaac    225660
     aatgccgtcc cggtatcctc gccacgggcc gcggcttcgc ggatcgggcg gcaggcttcg    225720
     tcgatctcac caatattgcc gccgcacatc agcgccagat tcgtcgagag attccagacg    225780
     tagtttccgg gaaatggttc gaacatgctg ggttcctcct gcgttagatg ctcgactaat    225840
     tggtcaaccg accaatattg tcaagcttac cttgcttgct ttgcccatct tagatcgcaa    225900
     ctggctgtcc gatccgcaag agttgctgtg tctttcaaac aggcggttga catcgccaac    225960
     gataataatt tatttggtcg accaaccaat atttatgtga gcaattgcga cgggagaatg    226020
     gcaatgcgga ttggcgtgac aggtgcaggc gggttcgtcg gtagcgccct cgtttcagtg    226080
     ctcgccaagg gaggtttgaa ggacgcgggt ttgggcgtgg aactcgttgc gatcgatgcc    226140
     cagctgccca catccctgcc ggaagccact gaacgtgccg aaggagatct taccgatatc    226200
     ggttttttgg agcagacctt ctcgcggcct ttcgacgttt tctaccatct cgcggctatc    226260
     ccgggcggcg cggcggcgcg agattacgat ctcggctggc gtgtgaatgt cgaagcatca    226320
     gtcgcggtgc tgaacaggct ggcgctgcag gaaaaaccgg cgcgcttcgt attcgcctca    226380
     tcgatcggcg tcttcggcat tccgctgccg actgacaagg ttaacgacca gaccctgcca    226440
     ctgccaacca tgagttacgg cgctcagaag ctgatagtcg aggcgcttgt agccgatttc    226500
     tggcgccgag ggctgatcga cggtctagcc gtccgcctac ccgggatcat cgcccgtccc    226560
     cgcgtcaggg gcggccatct ctctgcctat atgagcgaca tcctgcacgc cctgcgcgcc    226620
     ggagaacctt tcttgtgccc cgtcgcgtcg gatgcgacgt catggttcat gtcgcgcgcc    226680
     cgctgcgtcg agaacctgat ccatgcgggc agcctgcccg ccgagcgcgt tggtacgcgc    226740
     cgtgccttca atcttcctgc cctgacgttg tcgatgcgtg ccctggtgga tggcgccgcg    226800
     ggtcatttcg ggccgcaggt ccagtcgctg gtcacttacg aacccaacga ggcgctgcag    226860
     gcgcagttcg gatcctatcc cgcgctcctg acgccaatcg ccgacgagct cggctttacc    226920
     catgacggtg atgcgaaaat gctcgtcgca cgggctctcg acctttccga tcagacttct    226980
     cagcgaggtg ctgcatgagc cgcaatgtcc gacgcgtcgt caccggccat gacagccggg    227040
     gaaaagccat cgtcctccag gacggcgaac cgcctctcgt catccgcagc cccatccagg    227100
     ccggactggc gttccacgaa atctggaaca cgagcgagat gccgcaacag attgcggcgg    227160
     atttcgacga gccgaccctg ctgcattcta gcacggcgcc acccaagcgc ggtacggtga    227220
     tccgggtcgt cgacctaccg ccggagggac cggacggacc ggtattcgac aaggaacagt    227280
     cgcgggagct gttctcagcc gtggggctgg cggagaacgc cgaaaggcac aagccgggcc    227340
     ggcatccgct gatgcaccgc accgagtcca tcgactacgg gatcgtactg ttcggagaga    227400
     tcgtcctgct gctcgacgac agcgaggttc acctgaagca cggcgacgtg gtcgtgcagc    227460
     ggggaacagt gcatgcctgg accaaccgct ccgatcacat ctgccgtatg gctttcatcc    227520
     tcaccgacgg cgagttcgaa gaggagctga cgcgcgcgct cgacgagcac gacgctcgca    227580
     tagcggccga atgatgctgg ccggctctct ccccacgaca cctggcttcc ggctcgacac    227640
     gcgccacgcc ctggtgaccg gcgcggggcg cggcctcggc cttgccgctg ccgttgcgct    227700
     cgccgaggct ggtgcaatgg tgacgctggt ggcacggacc acgggggaaa tcgaagatgc    227760
     cacagccgcc cttcgcgaac ggggcctgag agccagagcc cgtgccgtgg acgtgacgga    227820
     tacacaggcc gtggaagcgc tgctcgcggg agaggtgccg ttcgatatcc tggtcaacaa    227880
     tgccggcact aacaagccgg gtccgttcgt cgacgtgagc gaggaaaaat acgacctcgt    227940
     catggggctc aacgtgcgct cggccttctt cacgtcgcag gccttcgcgc ggcggctgat    228000
     cgccgaacaa cgaccgggcg tcatcatcaa catgacctcg cagatggggc atgtcggtgc    228060
     agcccgccgg acgatctatt gcgcatctaa gcacgcgctc gaagggctga cgaaagcgct    228120
     cgctatcgag cttgcggagc acggcatccg cgtcaacagc gtggcaccga ccttcatcga    228180
     gaccccgatg acaaagcctt ttttcgaaga cgaggaattc cggcggcaga cgctctcgaa    228240
     gatcaagctc gggcgcatcg gcacggtcga ggatatcatg ggcgcgatcg tttacctggc    228300
     ctctgatgcg gcggcactgg tgacgggaac gtcccttcta gtggatggcg gctggaccgc    228360
     cgaataaacg ccgcgttgcg cggctggatg aggaaactat gatccggtat ctaaagaagg    228420
     gtggcaatgc cgccgaatct gccgaggctg accgcaaggt tcgccagacc gtcgaggcca    228480
     tcctggagga cgtcaccacg cgcggcgatg cagcggtccg cgacctttcg gtgaagtttg    228540
     acaagtggac gcccgaaagc ttccgcctga caaaggaaga gatagacgcg cttgtcgcca    228600
     acgttccggt gcaagtcatc tccgacatcc gttttgcgca ggcccagatc cgacgttttg    228660
     ccgaagccca gcttgcctcg atgaaggaga tcgaggtgga gaccctgccg ggcatccggc    228720
     ttgggcaccg ccacgtgccg atggaaagcg tcggctgcta cattcccggc ggacgttacc    228780
     cgatggtcgc atcggcgcat atgagcgtgc tgaccgccaa ggtcgccggc gtgaagcgcg    228840
     tcatcgcctg cacgccgcct ttgaacggcg caccgccggc cgcgacgatc gccgccatgg    228900
     cgctcgccgg cgcggatgaa atctatgtgc tcggcggcat ccaggccgtt gcggccatgg    228960
     gcatcggcac cgaaatgatt aagcccgtcg acatgctcgt cggccccggc aatgcgttcg    229020
     tcgccgaagc caaacgccag ctttacggca aggtcggcat cgacctcttc gccggcccga    229080
     ccgagacgct ggtcattgcc gacgacacgg tcgacgccga aatctgcgca accgaccttc    229140
     ttggccaggc ggaacatggc ccgacctcgc cggctgtgct gttaacgacc tcgaagcgta    229200
     tcgcagacca gatcgaggac gagatccagc ggcagctttc gcgcctgccg accgccgaca    229260
     tcgcctcggt ctcctggcgc gattacggcg aagtcatcct ctgcgacacg gatgaggaac    229320
     tgctggccga ggccgatcgc atcgcctccg aacacgtgca ggtcatgact gcgaacccgc    229380
     gctggttcct ggagaacatg cacaattacg gcgcgctgtt cctcgggcca cggaccaacg    229440
     ttgcctatgg cgacaaggta atcggcacca accacacgct gccgaccaag cgcgcggcgc    229500
     gctacacggg cggcctctgg gtcgggaaat ttctgaagac ctgcacctac caggaagtga    229560
     cgaccgatgc agcttcggca ctaattggcg aatattgctc gcggttgtgt accatcgaga    229620
     atttcgcggg ccacaaggag caagccgata tccgcgtgcg ccgctacggc ggctgaaacg    229680
     atagcgtcct tgcgcaccac tcagaggcac gcaaggacgt tctgaaccat cgaggctccg    229740
     cgtcgagctt tccgaaaacc gacaccggtt ttcgggccga tgttatggag ggaggagaaa    229800
     ttatgaagct tgcgacaatt ccgaacggga cccgcgacgg agagttggtc gtcgtgtcgt    229860
     ccgatctttc ccgggccgtc tccgcacggg tcatcgcccc gaacctcttg accgcattcg    229920
     aggattggtc cgccgccgaa cccaagctgc gaacgctcgc cgaggatctg gcggccggcc    229980
     gcgccgggga gaccttcgcc ttcgaccagt cgatagtgct gtcccccctg ccgcggtcgt    230040
     tccagtggat cgacggctcg tgctttaaga accatctcta cctgatggca agggcgacgg    230100
     gacgtgaccc ggaaatcgag atgaactcgc ccttcccgtt gatgtaccaa ggcatgtcag    230160
     acgatttcta tcggccgcat ggcgatatcc cgctcccccg cgaggaagac aatatcgact    230220
     tcgaggctga agtgggcatc gtgctcgacg aagtcccgat gggaacgacg gccgccgagg    230280
     caccgaaata cgtcaagctg gtgcttctca tcaatgacgt ttcctgccgc gcctatgtga    230340
     agcgggagat cacggtcggc ttcggctgga tgaacgccaa gccttcgacc gccttctcgc    230400
     cggttgcgat cacgcccgac gaactggggg cggcatggac cggcaaggtc gaactgccga    230460
     tccgaatcga gtggaacggc gagcgcttcg gcgaaccgaa cggtcgggaa atgtccttct    230520
     ccttctacga tctgatcgaa cacgctgccc gcacccgcaa gcttgccgcc ggcacgatct    230580
     tcggctccgg cactgtctcc aacagtgatt tcaagaatgt cggttcggcc tgcattgccg    230640
     agcgccggtc gatcgaaatg ctggagcatg gggagcaccg gaccagtttc atgaagttcg    230700
     gcgaccgcgt ccggatcgag atgatcgacg ccggcggaaa atccatcttc ggagcgatcg    230760
     accagacagt ggtcgaatac cggaaggtct tctgaaatgg gggccggctt gtttcccgat    230820
     ctgaagcccc accatgtcgg tattagcgtc tgcaacctgg acgaggcgat tgccttctgg    230880
     tcagaaatct tcggcttcga actcgacttc acggccgaat tgaagccaat ccgcaccaca    230940
     atcgcattcc tgaagcgcga cgggttcagg atcgaactct ttgaaaaata cggcgcctcg    231000
     gcggttccgg aagagcggct gaagcccaat accgatcttc tcgtgcaggg caccaagcac    231060
     atcgccttca gtgtcgagaa cgttcaggac gcggccgaaa agctgcatgc acggggcgtc    231120
     cgcatcgtcg gcatcatgcg cggccacggc acgccgatgc agcacgagga cgccccccac    231180
     ctcgacggca cgaagcagcc ggcgatggcg ctgttcttcc tggatgactc caacgtgcta    231240
     gtggaaatca tccgccggtc cgacttcgcc gactgatagc cgctggttga gcccttctgc    231300
     taagcgtgcc ataaggcagc gttctggagg agcagcgagt ggacgacgtt tcgggaaacc    231360
     aacacggcca agagagaggc aaccagacgg gaggtcgttt gagcgcggtg ggcagagcca    231420
     agatcgaggg tcttgccaag gccctgaagg tgccggcgga tgaactcgca tcgctgccgg    231480
     ccggcgccat tctcagtgga ctcgtccacc gcatggatag ccacgaccat gatcgggaag    231540
     cgccggtgcg cgaggtgatg gcgaggctcg gcgaccgctg gtcgcatctc atcctgctca    231600
     tcctctcggc aggcaccttc cggcatgcta ccctgcgccg cctgatcgcg gcgatttctt    231660
     cggaaaaggc gatttcccag cgcatgctga cgctcaggct tcgcgcgctc gaaagggatg    231720
     gaatggtggt ccgggctatc acgccaacgg ttccgcctcg cgtcgattat tcgctgacgc    231780
     cgctgggggc cgaattcgtc aacctgacga acggactgct ccgctggatc gagcagcacg    231840
     atgcggaaat ccaggaaaat cgccgcaggt tcgaagcgga cggcggctga ccgccgcccg    231900
     ccgggcttgg gagcatcaga cgaaaagcgt ggtctttgcc atgttctcgg ccgcatggga    231960
     catgtccacc ggcgggaaac tttcatgcat cgaatgcggc atcttgaggt tcttgtagta    232020
     gacgttcgaa ccctgcgctg gcgtccaacg aaccgtttcg aaatccggct cgtaattgtg    232080
     gtagccgccg gaattcagct cgatgcgcat gccgcccggt tcgcggcagt agagatagtc    232140
     ctgctcgccc ataccatgcc ggccgggacc gaattcgatg gcgatatcgg catcgagcag    232200
     cacgtcggcg gcgcggcgca gttcctcgcg ctggtcgacc caataggcga tgtggttgac    232260
     ccgccctagg gctcccgaga aatcggcgac gaggcccatg tcatgggaac gttcgcagac    232320
     cgtggtcatg ccgaacacga cgaattcgcc gaaattggct tccggatcgg cgacggttgc    232380
     ttccatatag cggtggccga gcgtttcgcg ataccagtta gcatcttttt cggggttggc    232440
     ggtggcaatc gtcacatggt ctatcgaccg gacagcgacg ccgcgcggct ggaagcgctg    232500
     cgggcggttc gggaagatcg gtgcctgtgc tacgctcggc tggaaacggg tgacgtccca    232560
     aaacagatga tgctcgtggc cgccggggcc gcgataacgg aaggtctttc catgtccggc    232620
     attgccctca gtccagccaa gccctgctcc ggcggcctcg atgcgcttgg cggccagttc    232680
     aagctgttcc ggcccctgcg cgcgccagcc gatatggctc aagcccggtt ccttgccctc    232740
     gacaagttcg aggctgtggt agaagccctc gccccagccg cgcaaaaaga ccgatccgcc    232800
     ggcgcgacct gattcctcca ttccgagcac attcttgtag aagctcaacg aggcttcgat    232860
     cttcggcgtc gttaccttca catgggcaag ttgggaaata tagcgttcgt acatcgtgct    232920
     cctccagggg tcgggccacg caatgcggcc ttccaaaact ctttctttga tattagaatc    232980
     aaaattctaa ttcaagtcaa aaattggtcg gtcgaccaat tgaggaatgt gatggattat    233040
     ccgactcggg caccgcgcca gaaacgcagt cgcaactcgc tggaaaagct gatgacggct    233100
     ggcgtcgacc tccttgaaga aaaggggttc gaaggcctct cgatcgccga actaagcatc    233160
     cgatctggtg tgtcgatcgg atcgatctac caacgctttg aggggaagga cgccctcttc    233220
     gcctcgcttc aggaggaaat cctaaagcgt atagatgccg aacagtcgga cctgtttcgt    233280
     cgtatcgatt ccagcctgcc cgacgatcgg ttggtggtgg aagcggttgg gcgccttgcg    233340
     atcttctttc agcagaatga agggctgctg aagatcatga tcttgcgcgg cgcagtggac    233400
     gaggatacga ggcgccgagg ttcgcgctcc agtatacagc ttgctctggc gtttgaatct    233460
     ttcctgctct catcgatccg ccggttcggg catgcgcagc cagaagtcgc agcggacgtc    233520
     tgcttccgta tcgtctatgc cacattcacg cgccgcataa tgtcgggctc aaccttcgag    233580
     tccgagactg ttctctcctg ggagacgtta ggcgatgaag tggcgcatgt ctgcgcttcc    233640
     tacttgcttt ccccgcctct gggcagtgtt tgagggaaca tttctgttcc tccttgtcaa    233700
     gaacgggacg ccgaggctta gtcagccgac caaaattggg agggaccgta tggaacgagt    233760
     gctaaaaggc atgactgcga tcgtcacagg cggcgcgggc ggaatcggca cggccacaag    233820
     ccgtgtgctg gccgaccgtg gtgcgagggt cgttgttgcg gacatcgatg gggatcgggc    233880
     ccgcgccacg gccgacgcaa tcaacgcgga cggcggtact gctctgggaa ttcatgtcga    233940
     catcggcgat gaagcgagcg tcaaagaaat gttcggcgcc accctggcgg cctttggccg    234000
     cctcgacatt ctcgacaaca atgctgcatt gctaacgtcc gactatgcgc agcgcgatct    234060
     cgacatcgcg cgcatggaga cggaagtttg ggatcgcaca ttccaggtca atacccgcgg    234120
     cacgatgatc tgctgccgtg aggcgctgca gatcatggaa gaccaggggt cgggcgtcat    234180
     catcaatact gcatccaatc tggctcttca gggtaacctc atccaggcgg cctatagcgc    234240
     atccaaagcg gcggtgatcc agctgacacg ctccatcgcg acctcccacg gcaagcgggg    234300
     tatccgttgc aacgcggtgc tgcccggctt gacagcttca aaagcggcgc tcgacaatct    234360
     cccgagccga ctgcgcgaga tcgtcgagga ggaaacactg acaccgtatc tcggtgaccc    234420
     gatggacatc gcctacacgg ttgccttcct cgtctcgcgc gaagcgcgat acattactgg    234480
     acagaccatc gtcgccgatg gcggcacatc cgtccatatc cccggatatg cacgcttcaa    234540
     tgaactattt agcggagccg aatgatgaac agtattaaaa ataggggcaa gctttctgac    234600
     cggctgaagg acaaggtggc catcgtaacg ggcgcgggca gcggtatcgg acaaggctgc    234660
     gcgctgatgt tcgccagaca cggagcgcgc gtcgttgccg ttgatatcga tgaagacgcc    234720
     gtggagacga cacgcgcgca gatcgatgca gaaggtctcg accttacacc acgacaggcg    234780
     gatctcacga aaccatctga tgtggccgcg ctggtcgatg gcgtagcgac ggagttcggc    234840
     ggtgtcgata tcctccttaa cgccgcagcg gtcgcggatt ttgtttggat cgaggacatg    234900
     gattatgagc gacattggcg ccgtacgctg actggcgagc tcgacaccgt ctttctaatg    234960
     tgcaaagcgg tttggcctca tttgagtgcc cgctccggcg gagcgattat caacttcggt    235020
     tccgccaacg cctatgtcgc actcaagaac tcccctgctc tggcgcatac cgccgggaaa    235080
     ggcggcgtac tggccatgac gcgccagctc gcaatggaag gcgcgccgca tggcatccgc    235140
     gccaactcaa tctcgccggg catgatcgtg accgcagcga ctagaccggt gttggacaga    235200
     ccggaattgc tagccgccgt gcaggagaag cttatggtcg ggcgcctcgg tcagccagac    235260
     gacatcgcct gggccgccgt ctatcttgcc tcggatgagg cggcatacgt aacgggcgct    235320
     gatttcagga tagatggcgg cgcactcgct tggtgaagcg gtgcgcattt gggattatgc    235380
     atccgaaatg agcgtcccgc catcgacgac caagttatgg ccggtgacga aagcaccggc    235440
     ccgcgctgcc agaaaaaccg ctgcgccagc gatttcgcga gcttcgccaa cccgcctgag    235500
     cggcgtcttc tcaaggcgcc gctgaagacc ttcctcgttg gaaagaatgg gcgtggcgaa    235560
     gtccgttcga atcagacctg gcgagatggc attggcgcga acattgtact ctccgagctc    235620
     aacggcgagg ttgcgagcgt gttgcgccaa ggcggccttg gagagggaat agaccccaat    235680
     ccgtgcattt ccacgcagcc ccgaaagact ggaggtcaat atgaccacgc cgtcccgacg    235740
     cgccgccatc ccaggagtta cccggttggt caactgtacc acgcttcgca gattaattcg    235800
     catgatcgca tcatattcat cgtcactggc cgccgccatc ggcccgaaat gcgggttgat    235860
     cccggcattg cagacgagga tattaatcgg gccgagctgc cgttccgtct tggcgaccag    235920
     gcggtccagt tcgccatcga cgccgacgtc gcaggggatt cccaaggcat tcagcccgga    235980
     cccacttagc cgaccggccg caagggcgat accctctgcg tcattggaac agatcgccac    236040
     cgcagcgccc gcctgcgcca tttcctcggc gatggcaagg ccgatgccgc gatgggcacc    236100
     ggtgatcagc gcgacttttc cggaaaggtc gaacagggat gacgccatat gacaccaaaa    236160
     attgatcggt cgaccaacca aaacatcatc agactattgc tgtcaaatcc tttaagcggg    236220
     atcggccttt cgccttcttc agcgcagaaa ggccttcgag accgcaaacg ctgaacttca    236280
     ataagacatt gtaggcttcg ccgagatcgt ctgcggaaac cttgccgcca gacaaagagt    236340
     caatccgccg gttcttagac agcgtttgaa gcatcgccac cagcgcgagc gaaaatccac    236400
     gcatcaacag aggtctcgtg acatccggca atgtcgtggc aagcttttcc aggaaaagct    236460
     cggcagtcga atcgaagttt tcatgcagta ggtccagcca gcggtttgtt tgtccaagct    236520
     gcgccaagat ctgcagatag gcgggccaac ctctcccacc ttcaatcatc ttctcgaaca    236580
     acggacgcat aaaggcatcg agaatagtct cagttgtgag cttcgccgat gcttcgagct    236640
     ttgccaggcg ttctcggcgc atctcaccta ggacgttggc acggcgcgca acgatatcgg    236700
     cgaagagttt gtccttcgtg ccgaaatgat agctcgcaag tgcaagggtc acctgcgctt    236760
     cctgggtgat ttcccgcaaa gatgcggtgt cgaacgtgcg ttctccaatg agcgcctctg    236820
     ctgcatccag aatcttatcg cgagtgttat ccggtgatgt cgcggatttt cgttgccgcc    236880
     ttttgggcgg accagcttct tctgccaata tattcgtcgt ggccacgtag agcagctcct    236940
     atcgttttgg gttttcgccc attcttcgct gaactcaatt atctccgatt tttctcagac    237000
     tcaaacactt tactaaattt ggtcggtcga ctaaacaaaa aacatcagga ggatttgatg    237060
     gctaccatag agaaagtttt gattgtcggc gggggaattt caggcctctg ccttgcgatt    237120
     gcgctccgcg aacggaatat tgaggttgat atcgccgaga taaagaccga atggacggtg    237180
     tatggagtcg gtatcattca gcagtctaac gtcgtgcgtg ctatggctga cctcggcatc    237240
     gttgacaaat acctcgccgc cgccttccct ttcgaacagc cttgcatcta tgctcccgac    237300
     ggaagcctcg cagctaagct tcccgctctt cgcttggccg gcccaaacta tcccgccaat    237360
     ctgggcgttt cgcggctggc tctgcatcag gtgctgacgc aggaggccca ggagagaaac    237420
     gccagggttc acctcggcct gacgctgaaa ggcttggatc aggacgagca ggaggttagc    237480
     gtaacgttct ccgacggctc cgttgagcga tacgatctcg tcgttggggc ggacggcgtc    237540
     tactccaggg ttaggatgct actctttggc gatcgctata caccccgcta taccggtcag    237600
     gccgtatggc ggcacaattt tccacgcccg aaggagatgg accacctgtg cgccttcccc    237660
     acccccaatg gcaatgcggg gctctgcccg ctttccgatg atcttatgta catgttcgtg    237720
     acctcctccg agcctggcaa tccatatcac cgcgaggaag atctaccggg tctcatgcgc    237780
     gaccgcctca aggggtatgg tggcatcatc ggcgaacttc gggaaacgat ccacgacccg    237840
     aaggaaatcg tctatcggcc gatggaggtg ctgttcgtcg aagaaccctg gcacaagggg    237900
     cgtgtggtgc tcatcggcga tgcagcgcat gcgacgacgc cacatctggc gcagggcgcc    237960
     ggccttgcga ttgaggatgc ggtcgtgctt gcagacgagc tgaatacgaa accaacgatc    238020
     gaggtggcac tccaacgttt ccacgagcga cgctacgatc gctgcaagac tatctgcgaa    238080
     gggtcgatcc aggtggggga atgggagctc aatcattcgc ccgaggccga ccacaagggc    238140
     atgctgctca agatgattac tcttgccgcc caacccatct gagaaagcgg gaaccgtcat    238200
     gaaagtcgcg cttgtcggcg ccaccggtaa cgccggctcg cgcatcctaa atgaactact    238260
     cgatcgtggg cacaaggtga cagcgattgt gcgtcggtcg gatcgagtgc cgatccaccc    238320
     gagcatcgtc gcaatcggta cggatgggtc ggaaaatgct ctcgccgccg cgatcaaggg    238380
     caataatgcg gttgtcagtt ccgtccgctt tgtcgacctt gcaccagaag tcctgatcgc    238440
     agccgtaaag aaatcgggtg tcaagcgata cgtggtggta ggtggcgctg gtagcctgct    238500
     tcaccctgac ggaatcgagg aggcacggcg tccggaattt ccagaggcgt tccgaccgaa    238560
     ttcgctacgt ggcggcgacc ttctcacact gcttcgccaa acgcctgagc ttgagtggac    238620
     ctttatctct ccgccgcgca tatttcgtcc tggagaacgg accggaaaat tccgttatgg    238680
     aaaggatcac atgctgatga cggatgatgg catgccgact tccatttcct ttgaggattt    238740
     tgcactggga ttggctaatg aactagaaaa tccccagcac gtgcgcgagc gctttaccat    238800
     tggctactga tcaaaaattg aagagttatc gtggccggcg ccgtcaaatt acaaatcttc    238860
     aaggatcttt ctcctgaaaa ctgtgttcag tgtgggagga cgaatttttc agctcttagc    238920
     agcctcgttt aagggtgctg catgtgagca aagccgcttc agtttaggtg gcacagtcgc    238980
     ctatggtgcg cgcatgtatc agatgtacat atgcacgacc ttgcacggcg cgcttgcttc    239040
     ctcgcaagca gctatcctgc ctgtgtccac taacagggta gtcttggcgt ccgtgtaatc    239100
     aacacacctg tggcagcttg gcttgtttgg ccccacaacc aagctgcggc agtgcgaaag    239160
     acttatgaag ccttgtcaca tttgatcgat ccattctccc tgcccgggat ctgtatttcg    239220
     tacatcagcg tccatgctgg ctgaacatta tgccatgcgc gcttccgaag cactcggcta    239280
     tttctctgtc tcgtcgaagt tagatgcccg agccgcgtga atttccggta gttttcctat    239340
     gatccactga gccaaatgct cgatctcgtc aatgaacgag cgtccgagcg gcgaaaggct    239400
     gtaactaatg cgtatcggag cctcattttc gatcgtcctt atgatcaagc cgttgtgatg    239460
     taacttcttg agcttcaggg taagtatacg ctgcgagatc ccgtcggtaa cgccgatcgc    239520
     acccaccaat ctgtggagaa tcgaatatcg aaatgggcca tcgcgcagca cgagcaagat    239580
     catgctgctc cattgatcgg ccgccaggga tgcaaattcg cggacaggat catccggctg    239640
     gcagcccgtg tccgccatgc cggtcacata gctgcgaatg ttggaaacgc gatcgtttct    239700
     tgtcgctccc cctcgtccga gattgagtat cttttcgacc tctccaagga ctcgatcagc    239760
     gttataggcg cggggcactt cggatatcct tgcccgacat tgcgctcaag attacatgcc    239820
     gtcgctcctc taaattcacg ccacgtccac gaacatcaac gtgcgttggt ttcattatct    239880
     ccactcttgc gtcatctcac acactcctcc aaatattaat ccccggacgg tcgctccatt    239940
     caatagctga tactcgatga atacggacaa tcgttccgag acttgcgaca tgaaatcttc    240000
     catgaagacg accgtcagaa caagcgaata attggccgcg caaaagcaag cgcgttcgaa    240060
     gggtaaacat accagaaaca taccagggag gaagccaaga cgcgtgctag aggcaaacgg    240120
     cacctagcaa attccatccg ctatagaaca ctacgtcggc gccgaacact gcacacgatt    240180
     ggcggcctat cctgattttc ctgcttccaa ctaaccaaat ggatgagcta tgcttcaagc    240240
     ttctgttgtc acagaccagc cgaagaccca cacggctttt tacaaagaga cagtaacatc    240300
     agtcaagcat tggacggaga acctgttctc gttcagaact acgcgcgacc caggcttgcg    240360
     gttcgtaacc ggccagtttg tcatgctggg cctgacggtg aacggaaaac cattgcttcg    240420
     tgcctattct attgccagtc cttctcacgc aagcgagctc gagttctact cgattaaagt    240480
     gcctgatggg ccactgacat cgcggttacg aaaaatccgg gagggtgatg aggttttagt    240540
     cggccgtaag cccaccggta ccctcgtact tgatgggctc aatccagggc gcaatctgtt    240600
     cctcgtgagc acgggaacag ggctagcgcc ttttatcggc cttgcccagg attccgaaac    240660
     ctatgaccgt ttcgataagg tcgttatatc gcataccgta cgccaggttg cggatctcaa    240720
     ctaccgcgag ctactctgcg aggcgttgca gagtgacgaa tatctgggcg aactggttac    240780
     agcaaaactc acctattacc cgtctgtgac gcgggagccg ttcaggaacc agggtcgaat    240840
     cacagatctc atccagtcgg gcaaaatctt ctcagacctg aagctgccgg tattcgaccc    240900
     ggcttgtgac cgtgtgatgc tctgcggcgg gccgtccgtg ctcggcgacc tcaagactat    240960
     tctccaggcg cgcggcttca aggaaggcag tgtttccaat cccggcgaat tcgttctcga    241020
     gcgggcattc gtggaagcct gaatggttgg acgtggctca aaggtcaagc gcgttcttcc    241080
     atcaccttcg ctgcgcctgt ggttgcttgg ggagcgtaac aagccgctct tgtgagcgac    241140
     tctcaatatc gattgctgtg ccagcaacgg cagtatcggc tttcacgctg cctgtctggc    241200
     agaatgagga aaggccttag ctcaaggacc agaccagtct cgccgtggag cgattgaagg    241260
     cgcctgttgc gccgatagag gtcctgataa aattccgatc tgcttgaggc gcttgttcgc    241320
     cctgaactgg ggacgatagt gacccccttg aaaactgccc tttgcattag gcaaggaaat    241380
     gtaaatccca gagaaatcct gtgaacgagt gccgatgtca cggcgttggg aagtcgcagc    241440
     acttcacagg cacaagccgg cgccggctgt cagggctccg agggaggagg ccgtcgcttt    241500
     cacaacggca tcgccacgcg acgatccttt gcccctcgat gacttcccca aagttaatac    241560
     aggatcgaga acgactcaac gcagctcgtc gaggatgctc gctgtttgta ggcgggtcca    241620
     gccgtatgcg gctgtcagag ggcgtccgaa ggcattcgga tcagtgggac agatcttctg    241680
     gactagcgga tctttcggct ctctcagtgt cggcttccgc tttctccttg agctgcccac    241740
     cgcctccaag tggcgaacgc tcaaacttct tgacccacat tgctacggat caaggaaccg    241800
     tcgacatact cgatcttaag ccaagtggaa gcctacatca aagatcgcgc caaaccagcc    241860
     aatcgaagat ttccactatc agatcaatat gatggggctt ctctaataag gcccaccgat    241920
     gcgtcggcaa caatcgacgc gccggcgcta aagatccggc aacgaacatt aatgtaggtg    241980
     aaacacatca gtgccgcgcc ttgagagatg gtcctcaaat gctatcctct cgcggcaatg    242040
     ggagttgcgc gtcaccgata ccacttcggc gggaggccgg cgatggcttt gtttcaatca    242100
     gccatcggca agtgaatatt tcggcgatgc atagaacggc aggcagatgc agcgaagagg    242160
     ctcgtcggct accccggagg gaggaacgct tttgaaacat cgatccccat tattaggttg    242220
     tgaattgagc tttgcttccg gtctggctag ctcgccaggt gggtcattgc acggcgcggg    242280
     cgcggttcga atacgaccaa cgcaaccggg gcattcgttt tgtctgacaa aaccagcgcg    242340
     gtgtttgcat acttgcccct ctaatatgct cggaaatcca aatgacgttt gttgtgacgg    242400
     aaaactgcat caagtgcaaa tttcaggatt gcgtcgaagc atgcccggtg aactgttttc    242460
     acgaggggcc gaacttcctc gtaatcaatc catcggaatg catcgattgc ggcgtctgcg    242520
     aaccagtatg ccccgccgag gcgatctacc cgctcgaaga acttccggta gagcaagcag    242580
     cctttgcggc attaaattcc gaactggcgg ccgaatggcc tgtgatcacc atcaaaggac    242640
     ctcctcccgc ggatgccagc atctgggacg gcaagcgagg gaaactctcc ttgctagagc    242700
     gctaatgtgt ccacgcagtc aatgcgcaac actacccgac gctagccgtc ttgctggcgc    242760
     taaacaaagt tggaggactt aaacatgata gaatcaacat cacaagatgg cttccggtgg    242820
     cgggtcctgc ttgcaattgc agtttcctct gtgtgcgccg gcatggtcat tatgtccttc    242880
     gcaccgttga tcggtgacgt cgcaaaagac ctcaacgtgg acctaggaac ggcgtccttc    242940
     ggcctcatcg gcgtcaccat gttcgtttct gctgtcggga tcgggctgct cggcttttgg    243000
     atcaacaaga ttggtatttt tcgggttata atcgcaggtc agcttttgat cttgctctca    243060
     aacgccgcga tcccaatgat tggtggtcag ttggcatctc tagtgctgat aagagtcctt    243120
     caaggtcttg gaagcgccgc cttgacggtc gccatatccc ccgccctggc tctgtggttc    243180
     ccccgcgagg aaatgggcag agccatgggt cttcaatcgg tcggaatggc tgtcggcatc    243240
     atactcggtc tgaacgcagg cccggtcttg tcacaaatgc tgggaggctg gcagctgggt    243300
     gtcgggcttc tgtcgttcgt accattgttg gcattgttga tcacagtacc aatcgcaata    243360
     gcatcgcaca gccatagccg ggccgccgta gcggaagcac gcgaccacga aaccacgcct    243420
     acctccgatt tcctccgcgt gcccgcgttt tgggttggct tgattgcctt gtgtctatgt    243480
     tattgggtgg gtctcgcctt caatggtctc agccctggat acctggcggt cgatcccccc    243540
     acgggtgccg gttatgggtc acagggtgct ggtaggctta tgctcctctt cacgctagca    243600
     ggggttgccg gcccgccgtt aggaggcttt cttatcgaca aactcttcga ggggcggagc    243660
     agcccgctgg tggccattgg atgggtgttg ggagccgttt gctataccgc catcctattt    243720
     tcgccagtgc atagcaatag cgtcgttctt ggtgccgtcc tcctgggtgc cggactagcc    243780
     aatcctttca tcaacgtcac gctgatgagc tatgcggcca aagtctttcc tccccatgtc    243840
     gttggaaagg tgtgcgggct ttggctttca ctatctttcc ttgctggcgc cggcggcgtc    243900
     atggcttgct caatcacttt gagcgccacc ggaagctata cgtcgcccat attgatcatc    243960
     ggcatcggta gcttaatcgg tctcgcaaca gtgccatttt ttaagcagcc ctcaccgcat    244020
     gagcgggttg ctgcactgtg atcctctcct cataacaatc aattggaatc aaaaaatgca    244080
     gacgattgaa gcagacgtgg tcataattgg cggcggtggc actggattgc cggcagcact    244140
     gactacgatt gaaggaggca ttaagcgcgt aatcctggta gagaaacgac gcgcccttgg    244200
     tggaaatgcc tcaatggcgg gagggttcct cttcgccgcg gagagcaagc gccagaagga    244260
     agtcaacggc gagatggacc gggacgctgt ctttaaggag acgatggctt tccatcattt    244320
     tgatcggatc aaacctcgtc tcctgcgtgt cttcatcgac aagtctgccg agaccatcga    244380
     gtggctggag gacaggggcg ccgccttcaa gtttggccat gttgaaagta tggctgtaca    244440
     tattttggag ggcatgaaag ccccagttgg cggatttagc cgcgttatcc gcctccttgg    244500
     tgacaagttt cagaaagaag gtgggcagct ccttctcaac accgctgcgg aacgcatcgt    244560
     ctgtagtgaa gatggaaaaa tccagaaagt aatagcaaaa aataagaacg ccgaaactgt    244620
     cgagatttca acaaattgcg tgatactggg tagcggtgga ttcaccggca accgggaact    244680
     tctcaagcga tattttcccg accattacga cgatgtttac tggacggatt ctgttcccaa    244740
     catgggagaa ggtatccaga tggcaactga cgcgggagct ggtcttgacg atcgttgcac    244800
     gttggtcagg gagacgacct acagcttcga aactaaaaaa agcatgccga accgcgcagg    244860
     aatggagccg cgaagcatat gggtgaacaa ccgaggtgag cgttttgcgg acgaatcaat    244920
     ttatatggac aatatggcaa caaatgctct ggtagctcaa ccgggcatgc taggtttcgc    244980
     cctcttcgat aacgatctca ttgattacat ggtcaagaat ccgagtcctg tgttaggccc    245040
     cgaccctgtc agtatcagag atatctttga gctggaagcg cagaccggtg agtggtgtgc    245100
     agtcgccaat acttttgacc agctggcatc ttggatgggt gccgatcgtg aagtcctcaa    245160
     agcaacaatc gaagaataca atggcttttg cgagagcggt cgtgatgcac tctttgcaaa    245220
     ggacaagcgg catctgttcc cgttgctcaa agcacccttc tatgcgctaa aatttaggcc    245280
     gctgatggtc gaaaccgtcg gccccgtgca gattaatgaa aagatgcaag tcctcgataa    245340
     actcgggagc atcgtgccgg gtttttttgc aggcggcgcg atcaccggtg gctggcaagg    245400
     caatgactac catttgtttg gatcagcgct tggatgggcg atcaattcgg ggcgcatagc    245460
     tggtgagaac gcaatccgct ttcttcaaga aaagtgattg gagttcatag cttgcagtcg    245520
     ctctggcttg ctgattatcc gagctttacg ccgaatgatc agcataaacc tcggttaccc    245580
     acttcgtcca gcccatcgcc gcttcgtcac tggacggcgg acgttccact ttattgtcga    245640
     tatgaacttc taaggagatt aacaatgcag acgacgcaat cgcgcctcat catccccgcc    245700
     ggcgagcggg ccctcgcgat gtgggaagtg caaaacctga tgagccggca cgaatattac    245760
     cacgcggccg gcatgaacct ggaggaagtc gatgcccttt gggtagcgcg tcacggtccc    245820
     aatgccacga cagccacttt tgccagcccg gtttgggtga tgaacggcat cgaaacgatc    245880
     cgtcgtgctt atggcgagga gaaccaacgc aatcgcgaaa aagcgctcaa ggcgctcgcg    245940
     gggatcgatc tgaagattaa ggacgttccc gaaaattatg gggccggcca cgaatgggcc    246000
     atgcacacca gcaccactcc agtgattgag gttgccggcg acggcgagac cgccaaaggc    246060
     gtttggtatt cgccggggtt agggctcgaa accaagttca aagggggcaa gatcggcctc    246120
     aacgccagta tgttctggga aaaatatgct ggcgacttta tcaacgagga tggcgtctgg    246180
     aagatctggc acctccagat ggcctacgac ttggttcctg ggttgccgca ggagatggtt    246240
     gacccgatca tgctggctct tggtgatatg gcggataccg ggccagtcga ggcggcccgc    246300
     gaagccggtg aacgcatgag cggagcgctg ccccccggct tctcccagcc ggtctattcc    246360
     tatccggtgt acagccccca gcgccctggg atcatgtatc cccgcctgcc tgagccttac    246420
     tatacgttca gcgagacctt ctcctactgc aacagcagat agcgcgcaga ccggcagttg    246480
     agaaccctcc caagcaaaga aagtcactgt gatcgcagcc cgcggagctg cgatcaaccg    246540
     tcgcgtgaac tggcccaaaa ctatcgaccc gcaactgccg ttgcgggtaa gcgttttcgc    246600
     caagtcagtc aatccggccg ctcgtctggc agtgacggta gcggacgtgg acatcgcctg    246660
     aacatgcctg gcgagccttg gcgaccggta ataatattac tgcactgcca cgaatggccg    246720
     agaatggctg gggagtgagg agaaagccat gcgatttcag aggctcgatc tcaatttgct    246780
     cgtcgtactt aatgctctac tcagcgagcg cagcgtcagc ctcgccgccg aacgcatctg    246840
     tctgtcgcag tcagcgacct caagcgcgct gggccgactc cgcgaatatt tcggtgacga    246900
     cctgctgatc gtcaaggggc gccagatgat actgaccaca cgcgccgtat ccctcgtaga    246960
     gccagtgcgc gcggtcctcg agcagattcg aatgacgatc tcggttacgc cacctttcga    247020
     tccagcggta tcggatcgcg cgatctcgat aatggcgtct gactatatta ctgaagtgct    247080
     gctcgcctcg gcaatcaacc aaatggcagt tgaggcaccg aacatgcgct tcgatatccg    247140
     tccactcgat tgccatttgg ttgagaccct cgagcgaggc ttaaccgacc tgttagtcac    247200
     gatcgactat gccatctcgc cggatcaccc gagtgatatc cttttcgagg acgattatgt    247260
     tgtggtcggc tggtcgggga accgggcgat gaaggggccg atgacgaagg acctctattt    247320
     tgctctcggc catgtcaccg cgcgattcgg gcaaggccgc gtttcggcct tcgaggattg    247380
     gtttgtgcgg cgcaacaaat tgcagcgtcg ggttgaggtg gtcacgccga ccttcctgtc    247440
     gctgccgggc ctcgtcgtcg gctcgagccg gatcgccacc atgcaccggc gcctagctac    247500
     ccgcatggct gaccacatgc cgctaaccat ccgcgaagta cccttcgaca ttccacggat    247560
     tcgtgaggcc gttcagtggc acgtctcaaa caacaacgac aaggcaatcc gctgggtcgt    247620
     cgcgcgcctt aaggctatgg cgttagccga acccggcact tccgtaccgt acacgcagat    247680
     aactcatggg gtcgaccgca cctcgcacga tgagatcatc gccgagtttc agactcatgc    247740
     tgctcaaggt ggcaaagtga actaggctca agacctatta aatgacttgc ctcggctcgc    247800
     gctccttgat tcactgggat cgaaaggaga tgctttgatg agtgacttga tactcctgtc    247860
     aaaggcgcaa atgcgccgga tcgaacccta ttttccactg tcgcacgggg tgccacgcgt    247920
     tgatgatcag ctcatcttga gcggcattat cttcgtcttg cgcaatgggt tgcgatggcg    247980
     cgatgcgccg agagaatatg gcccacacaa gacgatctat aaccgcttca tccgctggag    248040
     caggctcggc gtattcaatc ggattttggc tgaactgact gccaagcgcg gcaggccgga    248100
     gcagttgatg atcgatgcta cccacttgaa ggcccatcgc actgcagcca gtctgctaaa    248160
     aaaggggatg ttcccagacg tatcggacgc accaatggtg gcctgaactc gaagctgcac    248220
     gcggtctgcg atgatcatgg tcggccgctg atcctgcttt tgagcgaggg gcagatgagc    248280
     gattaaaaat gtgccgcacg gatgattgaa gcctttccaa aggccaagac cttgctggcc    248340
     gacaagggtt acgacgccga ttggtttcga gatgccctgg cggagcgcaa gatcaccgcc    248400
     tgcattcctt caagagcaaa ccgcaaggtc gcgatccctc atgattcggc gctctacaaa    248460
     aagcgccaca agatcgaaaa catgttcggc aggttaaaag actgacggcg aattcacacc    248520
     agatatgatc gctgcgccca tactttcttc tcaagcatat gtatcgctgc agccgtcatc    248580
     ttctggtttt gatttaacga gtcctgagcc taactagctc gtggccgcac gaaatgcatc    248640
     aaggtgccag ttgcttgcca agccccagga attctttctt ttcatcgctg acaccgacgt    248700
     tatcgcggtg cgccgtccca aatgtactcg ttcgaagccg gcacgcgcgg aattaagccg    248760
     aaccgcgcca aagccacatt cattttatac cagacgttgc gattgaaggt tcccacgaac    248820
     ggcactatgg gccgcgtgtc gatgaagttg gaagggaggc gcgtctgcag gcggtcaacc    248880
     tgtcgaacca atgtctggtt gctattggca tcggcgtagg ctcggagcat agcctcatta    248940
     aaggctttta acgtgttcgg gttctcctcg gcccattgcc gggcagtcgc gtaaagcacg    249000
     gccggcgtgc cttccagcgg ccgaatcaca tccggaagtt cccggaagcc tcgagctttc    249060
     gccaaggtat agaaaaaccc aacgggaaac gtggcgtcta cctgcccgcg ctcggcgctt    249120
     tccacaacag catcgaaggg caagttaacg agcgccacgt ccttttgcgt cagtccggcg    249180
     ccatcgagcg ccagcaacgt tgccaatccc tgtgggctgg caatcccagg caggccgatg    249240
     cgtttgcctt tgagatccgc gagagtgcga atagggctgt cgaccttcac catcagacct    249300
     gtcgtcgcgg gatcatcgtg cgcctctgcc ccaagcacgg caacgacggg aacgccgttg    249360
     gccgccgccg cgacgagtgg cacagcgcct gtcataacga tttctacctg acccgccatc    249420
     gcctgggcga tgttctgatc gggtccccca cctattgcga tctcgacaac aagtcccctc    249480
     tccttgaagt agccgcgctc aagcgcgaca taaagtggct gaaacgcccc taccggcgcc    249540
     cgcagcagac ggatggtctt ttcctgggca ccagcaggcg atccctcaag cgctaccagc    249600
     accgatagca ggatgaacaa agctattgat gccgaacggc ataatgaacg ttgaaacatg    249660
     tagtcctccc tacgacctgg atccaggcta gccaattcgg ccgctgccac gtgctaagtc    249720
     ttgattttac ttaggggcac cttcccagac taattcagac atggtcggcg tcctcgggat    249780
     aaacccaaac ttggtcatgt ccttcactgc tgcctcccat ttgtcacgct ggaagccggc    249840
     aacgaacgga gcgatatatc gagtgttgat ataatcgggg ggcattttgg tttgggcact    249900
     gtcgacagcc cgcacggctt caggatgttt attgccatag tcgtaggcct tttgcatggc    249960
     ttcgttgaag gctgtgagag tttccttgtt cttgccgacc caatccctgc tcgacgcgaa    250020
     aattaccgcc ggagtgccct ggatttcctg gtagacctct ttgagttcgc caaaaccttt    250080
     ggattgggca agagaaaaga acaagccgat cggagcgatt gcgtcgacat tgcccttttc    250140
     ggcgctctcg atcatcgcgt cgaacggcag gctgaccaat gcgacatcct tcttagtcat    250200
     gccgactttt tccagtgcac ggtagatcat caatccctgc gtactctgaa tgcctggcat    250260
     gccgatcctt ttgcccttca ggtccgccag cgtcttgatc gagctgcctg gaggcgtcat    250320
     taggccggtg gtggctacct cgccctgatc ctgggtgtta agaaccgcat agacaggaag    250380
     cccttgggct gctgccgcaa cgaggtcgaa agaaccgctc atgataatat cagcctgccc    250440
     tgcctgaagc tgggcgatat tctggctggg cgcaccaccc accatcacct cgaccttcaa    250500
     acccttctcc ttgaagtagc cctgctggtc agcgatatac agtccctgga atgtgccaac    250560
     tggcgaacgc agtacccgca ccacattttc ctcagcaatc gccgacgacg ctggcaacgc    250620
     ggtaatcgag gctccagtga gcataagagc gactatccgc cgcctgttca ttaaaatcgc    250680
     agtcatcggt tctctcctcc catataacat tgcgatcgat tggcctactt ggggcgcttg    250740
     cgaatctgct tgaggatccg gcttcgatat tccgagaaaa gtggttgtgc cttcgtgctg    250800
     atctggtccc gttcgacacc gagccggatg tcgacagtat cgatcacagt cgccggatgt    250860
     ccggagagta caatgacccg gtcggcgaga tagacggctt cgtcgatgtc atgcgtaacg    250920
     acgatgacac tgatgcccag ccgccggcgc agatcaagca ccaagtcttc cagctcgaaa    250980
     cgggtctgcg catcgagcga gccaaaaggt tcgtccatga gaaggatgtg cgcatcataa    251040
     gcgagcgcgc gagcgattgc cacacgttgc tgcatgccgc ctgaaagttc ccacggataa    251100
     cgttgcataa cgctcggtaa tcccaccgcc gccaggcact cctccgcccg ccgcagacgc    251160
     tcggccctgg gcacgccctt tccctgcaag ggaaaggcca cattctcccc ggaacgcatc    251220
     catggcatga gtgacccccg atagtcctgg aaaacgagac caatttccgc gagtggcgaa    251280
     gttactttct cggcgcccac ccgcacctcg cccgcagtgg gggaagtcag tccagaaagg    251340
     catctcagga gcgttgtctt acccgcgccc gacgggccta cgatgcagat gaattcgccg    251400
     ggatccacct gcaaactgag gttttcgagc actttgagcg cattttcccc ttgcccataa    251460
     actttcgtca agccggccac aacgagcggc ttgacggctg ggctagcggc cgaaccaacc    251520
     ttactcatgt agttcattcc ttcctccccg gaggctattg tcacttcggt gccgaccgat    251580
     tggtatcgcg gaaataccag ccaagtacgc gtcgctcgac ctgtagaaat actccgctca    251640
     ataggtagcc tattatgccg actagaatcg tgccggccca tgcctgccgt gttgcaaatc    251700
     tggtgcttgc ttcggtgatg tagaagccga ccccggcgtc ggcgccaaag aattcactga    251760
     tgaccatcag aaccagggca accgcgaggg ccactcggat gcccgccatg atttgaggca    251820
     tcgcagccgg taaagccacg cggaagacga cgagatgggt gggaatccta taagctcggg    251880
     cagtatcgcg cactgcgagt gatgtgccac gaacaccatc gatggtattg agcagaattg    251940
     gccagaagca gccgagtgca atgatgaaga ttttgggtgt agcaccaacc cccagcgcga    252000
     tgatgacgat aggcacaatg gacgcgggtg gaaccgcgcg gaagaaattg agggtcggct    252060
     gggttatctg ccgcatggta tcaaattcgc ctatgaggag gccgaaacta atccctagca    252120
     ttgttgcgat ggcaagacct gctgcgaggt tgctaaggct gatgcagaca taacctaaca    252180
     gcggtccagc gatcaggtcg gtccacagcg cactcaagat ttcgctaagc gggggaaagt    252240
     aataggactg agagccttca gagatccacc accagccgca gatgagcagc acgggcaacc    252300
     agagctgaga cagtagcgaa agcacccaat ccaggatcga gagaaggatc gtttccatgg    252360
     ctcactccac cttggagcgg atgtgccaat gcagcagccg cgcttcagct aggtcccaaa    252420
     gcagcgtgat caccacgccc agaagccccg cataaatgat ataggcatag gtggtggggg    252480
     tctcgttgta agatcgtgac agtgcaattt cgcgcccaat tccgggcgtc acgctaacga    252540
     tctcgacccc gacggctacc aggatcgaaa ctgtggttgc gatacgcaag cctgtcgcaa    252600
     tgaaaggacc ggcggcagga agcagcactt taaagaaacg cagatgggga ggtatgcgga    252660
     agctgcgcac agtgtccacg atcgttgggt caagatttcg cgcgccatag atagtttgga    252720
     gcaaaatcgg aaagaagcag gcgattccga ttgccacgac cttcattgtt tgcgtcgcac    252780
     cgaacagcaa tacgaagacc ggcagaagtg cgatgaccgg aaaagagcgt ccaaagtcaa    252840
     cgagcatgcg tgtcgcgacc tccagtttcg gaaacatgcc gatgaggatg ccaatgggaa    252900
     tggccagcaa cgccgcgata agcaatccac gaactgcatc ataaaccgtg gcgccaaaac    252960
     cgacgaggaa ttccggtcgc gcgagaaccg caaagaactg acgtcccaca tcaatcaccg    253020
     gcggcaggac cgattctaca agattgagcg cgttggcgcc ggcccatagc gctaaaatgc    253080
     cgatgcccac gagaatttgc atggaacgga gtctcgctat ccttgtcatg cagcccctct    253140
     ttgccgctcg ccccagtaga taagtggtag accggggata ggcgatcgaa aataaggaat    253200
     gcgatgtcca cgtagacttc cgagatacac cgtccggagg tctggaccac cgaaagtcag    253260
     actggccatc caaggagcaa tcgtcccagt cgcggcagcc atgagttcgg gcgtgacttg    253320
     tccgtcatgc cacgctgcat ccagcgcggc tgtcgctttt gggtttccat catcgaggat    253380
     gaccagcacc tcaccctccg gcgtcacggc aatcagccga tccgccatga tcaaggtgct    253440
     ccagaggttc ccgcaggtat caaaagctat cccatcgcag aagccgccga cgttttcggg    253500
     cccgtgagtt gcacgtggac caagttcacc gtctggtagg acgcggaagc gggaaatgcg    253560
     ccgcttggtg gtttcggcca cgtagagata atcctcagcg agatcgaacc ggagttcatt    253620
     cgtgccgcaa aggccgtccg caacaatgcg cgcgccgcgc tcgtctatca cagcaatgta    253680
     tccgtcatgg ctcatcgttt cgacgtgacg ggtccaaggg accattctgg tggtcacggt    253740
     gagccatagg cgcccgtgcg tgtcccgggt cacgaagttc gccttgccca cgggctcgcc    253800
     atcgatattg tcgacgaggg tacgggtccg tccgtctctc gtcatcaatt cgagagaatc    253860
     atttccgaaa ttcgcgatca ggaagtttcc ttccttatca aaggccaatc cattcgggag    253920
     gctgccgatt gtattgacat accggtcctc aaacgatgaa ctctcgttgc gtgcagtggt    253980
     cgattgaagc acgagcctct ggcttccgtc gggatcaatc cgcattatgc caccacgccc    254040
     atcggcactc cagagtgtgc cgttaggttc ggcgagaatg cattccgggc gctgcaggcc    254100
     ttcaccgata taacgaatac tgccccggtc gacctgccat tccttgagag agttgaacgc    254160
     cacttagttg gcctccctca cgagcgaacc ctcaacatgc gtccgaccat tagaatgatt    254220
     agtcaaaatc cccatcaagt caccctccat atgattggtc gtacgaccaa gataaggtca    254280
     gaaatccacc aattgtcaag cctgacgaag gatgcatccg atcctgcaga tgaaagagct    254340
     gtgggcattc actgcagtca actatgatga ccttttaaac ctttcaaata gcatgaccta    254400
     gcgtccgttg aacagggaat cggaatttga atgacagacg cagcttgcct tcgaatcaga    254460
     aggcattgat gtcacgtgta ttaagcgatg atcttcgcag cggtgttctt gcggcgtcgg    254520
     caggcggaat gtctgcacgc gctgcggcgt tgcgatttga gattgggatt tcgattgcct    254580
     ggatcgctag tgcacgacag ggccgatgac tgtggccaaa caaggccgac gttctggctg    254640
     caggctggat gcgcatggct tgccatcctg ctcgagcgag aagctaccat gcgccaacag    254700
     aagcgcttcg aagcccgcgc cagagttgcc atactgcgcc atgatccgca gatcgagaat    254760
     gccgactttc gcgccgcacg tggtctcgac cgcaacctgt tcatgatgct tgccggctgc    254820
     ggctggatcc gcaaatcaca gtctgctcat caccgggccg gccggggtcg gcaagagttg    254880
     gcttcggcca taaagcatgc cgcgaagatt tctccgtcgc ctaccaccgg gttcgcccgc    254940
     tattcgcaac acttgccctt gcacgaggcg atgggcgata tggccggatc ctcaaatcgc    255000
     tggccaagtc cgatctgctt atccttgatg attggggacc ggaaaagctc aacgatgatc    255060
     agcggcgcga tcttctcgag atcatcaaag accgctacga gcgtcgatcg agatcgtcac    255120
     cagtccggtg cccctggatc gctggtggga aataatagca aaccctacgc tcgccgatgc    255180
     catcctggat cgcctcgttc acaatgccta tcgcatcgat ctcaccggtg aaagcatacg    255240
     aaaacagcgt tcgccaggag cgcccgaaac atcccacgct tgaccaaaaa caaaactcaa    255300
     tccaaacatc caacagaccc aggatcagtc cgacaaatgg ccggcttcat cggaatacgc    255360
     agtgcaccgc cttgtcttca ttggaaacgt ccgtgaacac caagatggtc tggctgcgcc    255420
     gacgctgccg gcacggcgaa cgattgcaga tggacgctcc gttcggccat tggggaacat    255480
     agacctccat cgtcgccctg ctctgtcacg gtctgaccgc accatgcgct gctgccacaa    255540
     ccttcgaagc ctcggctcca tctgcaatct cttcagcata accgaatgct ggaactattt    255600
     cacggccgca ggatatgcat cagattaatc gtatgctcta gcacagggtc gggccttgcg    255660
     cgaaatcgac ctagccatac agcaaacagt tcgttcaatc acgaataatg ctctcgacca    255720
     tttcgagtaa cgcctcccgg tcgtccggcg tccgggtgac tgccgagcga gagagaaagc    255780
     cttcataaag aacgcacaat gttcgcgccg tgtggggcga acggcccgag aagcgcgaac    255840
     agatggcctc aatttccgtt ctcagctttt ccttgtgatc tcgcgccagc gtcgcaaggc    255900
     ttggcacgtt gctgtattct gccagcatca tgatgaaggc gcagccgcga aagccatggc    255960
     gctgtacccg atccgccaga tctttgaata ttgccaagat ctgatcgcgg ggggcatcat    256020
     gaaccgtgac aaccttgaag aagtttcgca tcgcagcctc gtgccttgct ctgacataag    256080
     cttcgatcag gctctccttc gatcggaagt ttctataaaa gctgtccttc gatacgccgc    256140
     tttcttcaat caggcgattg atgccgaccg catgtatgcc gtgttgatag aatagccggt    256200
     cggctgtctc gataattttc tcccgcaagc tcttttccat atcgatccct gaatttctta    256260
     tggctatttc cacgactagt tggtttcgct tcggtttcca ccttgggcaa ggttgccctc    256320
     aacggcacgg aaagtcgcgc tagagtccca aaattcttct gacatacact gatggcattt    256380
     ccaaccatga gcggtcgaag ggtcattaat ctaattaaat cgatagcttt agtggattat    256440
     ttctgggatc aagtttctca tgcctctata agcagacaat tctgtacgat tgccgtcgtt    256500
     tcattaccga gtaaaatcta gtttgcaaga acgagcaagc cgtccggata gaagacgccg    256560
     cagctgcagg atgttcaccg tgcgggaaca caagcgagaa ggtttagtaa tgcagtcaac    256620
     acgtcgtagt ttcgttaagc tattgtcgag cggtgtcttt ttgcctgcta ccacaaccgt    256680
     cggctttttg cgtgtaccga acgcatttgc ggcagagcag aacgtgctct caatagccca    256740
     aggcaacgat atcctgtctc tcgaccctgc cgaccatggc aacaacagca cggaatcggc    256800
     gctcgtcaac atctacgatt atctggtgac gaaggacttt tcgggtgaaa cgctggtgtt    256860
     cacgccgaac cttgcaaagt catggtcgac aagcgatcag gtgcgctggg tactcaacct    256920
     ccgcgatgac gttcgctggc atgatggaag caagttcacc gccaatgatg tcaagttcac    256980
     cgtcgagcgg acgcagggcg acccgaagct gaagagcgcg aacaagttct cttccgtgaa    257040
     ggccgtgaag gtcattgacg attacacact gcaaatcgag acgaagtatc ccaatccgct    257100
     gctcctccac tcttttgtcg gcaatggcgc tggccttcta ccgaagctgg ctttcgaggc    257160
     ggcgggcgac aaggacgtgt tcttccgcaa tcccgtggga accggcccgt accggttcaa    257220
     ggaatggcgc aaggccgacc ggctatttct ggaaaagaac gccgactggt ggggcggtca    257280
     gccgaagtgg gactctgtgg tcgtgcgggc cattcccgaa accgcaacgc gcgtttcgga    257340
     attcatcacc ggcggcgtcg atatcgcggt gaacattccg cctgaagaca tcgaacgcat    257400
     caaggcgaac aagggcacaa gggttatttc cttcgacatc gcacgcaacc tcgccctgca    257460
     tgttcggact ggagaaaaat gggtcaccca cgatccgcgt gtgcgcgaag cgatcgacct    257520
     tgccatcgac cgcaatacga tcgcccagca ggtggtcaac ggttacggct cgcccacacg    257580
     cggtttcttc ccgaagaaaa ttccgggttc gaaccccgaa ctgagcgcca acctacccta    257640
     tgatccggag aaggctcgca cgctgctgcg ggaggccggc aaggaaggtg cggcgatcaa    257700
     actcagcacc ccgagcggcc gctatgtaaa ggatcgggaa atttcagaga cagttgtcgg    257760
     ctatctggaa gatgccggct tccggccgca gctcgaagtc cttgactgga ccatctacaa    257820
     cagtcgtctg accgccgatg gttttggcga gctctatctt tggggaatgg ggtcctacac    257880
     cgacggctcc tcgctgttcc aggacgactt caagcgtcat tatgattgga cgaacgctga    257940
     attcaatagc ctgcgggaaa aggcgcgcaa tccgggcagt gaggacgcgc ggcttgcgat    258000
     cctgcgccgg gcgcaggaaa tcgtcgccga ccagcgcgtc cgcatcggct taatctatcc    258060
     gcagtcgatc tacggcgtga acgaccgcat aaaattcgac ggccgcttcg acgagatgat    258120
     ctttgccgag gatgtggttc cggtatgagc tcgcgttacc tgttgcgctc gctggttcaa    258180
     gtcgttccga tcctctacat cgtctcgctg atcgtcttca tcctcgtcta tctgacagga    258240
     gatccttcag cgctattggt gccggaggat gcgactgaag cggaccggtt ggcgctggtg    258300
     gcggcgtggg gtctcgatca gccatggtac gtgcaatatc tagcctacat gcggaatata    258360
     ttgagcggta atttcggcgt ctcctaccga tatggaacgg aggcacttcc catcgtgctg    258420
     gagcgcattc ctgcgaccct gctcctgacc gcaggcgcgc tggtggtggc catcgccatt    258480
     gccgtgccga gcggcatcgt cgccgcgctg aagcatggca cgcccgccga cgtcatcgtc    258540
     tccggaattt cggttctcgg aaaagctatg ccgacgttct gggtcggcat catgctggtg    258600
     ctgatcttcg gcgtctggct gcgcgtgctt cctgtatcgg gcggcggcag ctttgcgcat    258660
     ctcatcttgc ccgccgtaac acttggaacc ggctttgcgg cggacctcac caagcttatc    258720
     cgctccagta tgctggaagt tcttggccgc gactacattc gcacggcgcg ggccaaaggt    258780
     attcccaacc gggtgatcgt gttcaaacac gttttgcgca acgcccttat tccagcgctg    258840
     accatgacct cgctgcacgt aatcgctctt ctaggcggcg cactcgtcac tgaaactgtg    258900
     ttcgcctggc cggggctcgg cctgctcgtg gtcaacgcaa tctataccaa agacatggcg    258960
     gtcatccaga tcgcggtctt cgtcatcacg ctgatgacgc tcttcgtcaa cttcgcgact    259020
     gatctgctct accgagcaat cgatccgcgc atcaaactgt aggtgtagat caatgaccct    259080
     tcaagacacc gccggcttgg agacgacccc aggcaggatt gtcgccgggt tgcgttcgct    259140
     tctcaccagc cgtagcggct gtgtcggcgt cctgatcctc ggcatcatcg tcctcgcggc    259200
     gctttttgcc gattatctgc cgctgccaag cccacgccag cgcaatctca acttgaaatt    259260
     cgcaccgcct atctgggcgg caggaggatt atccggctat tggcttggca cagacggtca    259320
     ggggcgggac gttctcgcac gcgtcatcta cggtgcgaga acatcgctca tcgtcggtct    259380
     tgcggcggtc gcgttttcgg ggatcgtggg cctggtgcta gggcttgtcg ctggctatcg    259440
     cggcgggctg ctcgacgccg tgctgatgcg agtgatcgac gcgatgctgg cgatcccaac    259500
     catgctgttc atgctggtgg tggcgctcgt agcgggaagc ggcatgttac cactcgtcag    259560
     cgtgattgcc gtcaccaatt gggtggttta tgcgcggctc gtgcgcgctg aggtgcttca    259620
     catcaaagag ctggaattcg tcagcgccgc ccgtatcggc ggcgtctgcc aggtgcggat    259680
     tcttcttcgg catatcctgc cgaacacgat ttcggccttc atcgtgatcg ccacgctcaa    259740
     catcggctcg gtcattctcg cggaatcctc cctgagtttc ctcggtttcg gcatccagcc    259800
     tcccgaagtt tcctgggggc agatgctcag cgacgggcgt cagtctctcg ccacaagctg    259860
     gtgggtcgca accttccccg gcgtggcgct gaccctgacg gtgttcagca tcatcctgat    259920
     cggcgactgg ctgcgcgact atctggaccc gaggatgcca tgaccggatc tgatttcccc    259980
     attcccatcc tgcgttatcg caatgccggg ataagccttg ctaaacgcaa cggcgaacac    260040
     agcctcgttc gcggcgtgga cctcgatgtg tttccgaacg agatcgtcgc gctggtcggt    260100
     gaatccggta gcggcaagac gctgaccgcg ctcagcgtgc tcggccttct gcccaaaggg    260160
     gcatccttcc gcgctgacat cgcgatggtg aatggcaaag atataacgcg actgaacaat    260220
     cgtggttggc gggatctgcg cggctcggag gtaggaatcg tctttcaaga gccgctttca    260280
     tctctcaacc cggttttgac catcggcgat cagattggcg aggttctgct ttacaagaaa    260340
     ggcctcgccc gaaaagtgcg agaggatcgc gcggcggaac tgctcgatct catggggatt    260400
     cccacttccc gcagcgttct cggcgaatat ccgcaccagc tttccggcgg catgcgccag    260460
     cgggtcatgc tcgccatcgc catggcgggc gagccacgcc tgctgatcgc tgatgaaccc    260520
     acgaccgcac tggacaacgc cattcagcac caggtgctgg aactcctggt cgaaacggcg    260580
     gcacgcacgc gtattggcct gttgttcatt acccacgatc tttccgtcgt cgcgcaaatc    260640
     gccgaccgcg tcgcggttat gaaggatggt tcgctagtgg aaagtgcgcc cgtgggcgcc    260700
     gttttcgcgc agccgcaaca cgcttatacg cgccgtctgg tttcgttggc accgcgtgtt    260760
     cccgccgtgg tcaagcacgg cccgccgctt gccgcgcact tggagcgcgt cgaacagaac    260820
     cgaccgacga aagacgtgcc actgcttgag gttcgcgatc tggtcaagcg ctatatgcca    260880
     accggcggac ggttgacccg cgccagcggt tcggtggcgc tggatggagt ttccgctcga    260940
     atatggccgg gaaaaacgct cggtctcgtc gggcagtcgg gcagcggcaa gtcttccctt    261000
     gcccgcgtca tcaccggatt gatcgctccc gatgcgggca gcgtgcggtt cgaaggcgag    261060
     gatatattct cgaatgcggg acgagaggca acccgccggg ggcgcgacgt ccagatgatc    261120
     ttccaggacc cgttttcctc gctcaatccg cgcatgaaga ttgccgacgt cgtgaccgag    261180
     cccatggtgg cgcaccggct tctggcggga aaaagcgttg aggatgccgc agtcgagctg    261240
     ctgcaaacgg taggtctgcc cgccggtttc gcacgccgct acccgcacga gctttcgggt    261300
     ggccagcgcc aacgcgtcgg cattgcacgt tcgctcggcg tacgtcccaa gctgctcgtc    261360
     tgcgatgaac ctgtgtcggc gctcgacgtt tccgtgcagg cagaaattct cgccctgttc    261420
     aagacgctgc aaccgctttt cggcctaact tatctcttca tcgcccacgg tctcgacagt    261480
     atctactcgg tcagccacca cgtcgcggtc atgcaatcgg gcaagatcgt ggagtatgga    261540
     ttgcgcgacg aggttttcgg cgatccgcaa cacccctaca cccgttcact tctcgccgcg    261600
     atgctggatt ccgatccgaa atccagccgt ttccgctcgc atcggcgggc agtctgagcg    261660
     catgttttca agactctggc cataaggatc gttcctatgt cttcccgctc ccaaaacctg    261720
     ccaactcgga gaatccggct cggatatttt caccagccgg tcggacggca tccttctgcg    261780
     tggcgtcgtc cagatgcaga ggggcatcca gaagatgtcg catgggcgat ccgtgtcgct    261840
     aaaaaggttg aagctgggct tttcgatgtg ttcttcttgg cggatggcct cgtcggccca    261900
     aatccgcatg agcagggcaa ggccggcgga ttggagccat tgactctgct tgccgcgctt    261960
     gccgcatcca ccatcaacat tggtctggtg gggaccattt ccaccacctt ttccgaaccg    262020
     ttcaatgtgg ctcgaatgct cgcctcgctc gatcacatta gcggtgggcg aagcggctgg    262080
     aacgtcgtga cctcgcagtc ggatcgcgcg gcccagaatt ttgggaaaga gcgcctactc    262140
     gatcacgccg aacgctacgc gcggtcggcc gaatttgtgg atgtcgtgaa gaaactgtgg    262200
     gacagttggg atgacggcgc gctggtgctg gacaaggggc gcggcgcttt catcgagccc    262260
     gcacgcattc gcgagatcaa tcacaagggt cgctttttct cggttcgcgg tccgcttaat    262320
     gtttcccgcc caccccaggg tcatccagta atcttccagg ccggctcctc cggcgatggc    262380
     atcacgcttg ctgcgacgaa ggccgatata gccttcaccg cgcaggatac gatcgaggat    262440
     gccttgtcgt atcgggacgc actgcgcgca gccgccaccg tggccgtacc gggctcgcca    262500
     ggccctctgg tctttcccgg cgtcatgccc gtggtgggac ggacccatag cgaggccgtc    262560
     gagaaatttg cggctcttca ggagaatacg gatattacag cgggcatccg ccagctttcc    262620
     ggtcgctggg ggtatgacct ctccggatac gatctcgacg gaccggtgcc ggaaccccgc    262680
     gccaatattc acggtcaaag ccgtgtgcag cttctgctga aaaaagccca taccgaaggc    262740
     tacaggttgc gtgacctggc ggcgctggcg atcgcctcgc acgggcatcg catcatcgtc    262800
     ggctcgttcg aggaagtagc cgacgatctg caacactggt tcaacagtgg cgcggcggat    262860
     ggcttcaata tcattcccgc atccatgccg gatggcgtcg acgatttcgt cgagctcgtg    262920
     attcccgaac tgcagcgtcg tggactctac cgtactgcct acgaagcgaa aactttaaga    262980
     gggctgcttg gcctcccctc cccgcggcag ccaggtgggg atcaatcggc acagaacacc    263040
     actagcgcca cggcagcttg atggtgtgcc aatccgggct gaccacattg ttcaaatcgt    263100
     agtcgcagga gagatcgcat ggcaagaatt tacaacgact tatcggagct tatcgggaat    263160
     accccgctcc tcgatttgca gaggataaga aaaatcacaa acgttcagtc tcgtatcctc    263220
     gccaaaatcg aatatctgaa ccccgccggc agcatcaagg accgtaccgc ttggtctatt    263280
     atcaaggagg ctgaaaagag cggcaggttg aaaccgggcg atttgctagt cgacatcacc    263340
     agcggcaata cagggattgg ccttgccgcg gtggcggcgt cccggggata tcgtaccaaa    263400
     ttctaccttc gcgatatcat cagtccggac aaaatcaaca tcctgcgcca atttggcgcg    263460
     gaggtcgtgt tggtcgacaa caatgaattt ctggttccag acggaattta cgctgtgctg    263520
     gacagagtaa gaagagagaa tcccgaggca ttctttactg atcagcggac caatccagcc    263580
     aatccactca ttcacgcgga gacgaccggt ccggagatct ggcaagatac cggcggggcg    263640
     atcgacatat tggtcggtac ggtcggcaca ggcgggacga taagcggctc tggccggttc    263700
     ctcaaggagc gaaaaccgga actgcaagtg gtcgtctgcg aaccgacacc ggattccgtg    263760
     cccacgaaag acaatcctca tgcggaggcg atcgaaggag ttcataaggt taccggggtg    263820
     aacgagactc atctgccaga gacttatgac agcaccgtcg tcgatgaagt gattgctgtc    263880
     acgaccgctc aagcgcgaga aacggcgctt ttggtcgcaa gggaggaagg ccttctggtc    263940
     ggaacatcct ccggtgctgc ggtttccgcc gcgttggttc tggcagcgcg gtcgcaaaac    264000
     gccggaaaga acatcgtcgt gatcatcccc gacagcggag agagatatct ctcttccgct    264060
     cgcgttgcag cggaagggta agcactggaa gcatcgaaac gcttcacgaa caacactcag    264120
     cctcgacggg tatctctaga atttatcgaa atctgacacc gttcgcaaat ctagggcgct    264180
     tggagcccaa catgaaaggg acagaacatg ctgttaagcc gccgcacttt tactaagctg    264240
     ctctatagtg gcatttttgc cgcttacggg tttatcggtc tttcgggaat agaggacgca    264300
     agcgctgacg agaccaaaag gacgtcagga ggcgaaatca ccttccttct gggcagcctc    264360
     gatagcggat ggggtttgaa cgagaaggtc gacatttaca ccggccaggt atgggggcaa    264420
     atcgccgaca aactcgttca tgtagatgaa gctggcaagc ccaccccctg gatcgcggag    264480
     agctgggagg cgaatgccga tcaatcccag ttcgtacttc atctaaagaa gggagtcacg    264540
     ttctcggacg gcgcgcgcct tgacgccgca gccgttgccg cgaacatcga gatatgggcc    264600
     aagggtgacc ccagtcgagg tatcgggcgg ctcggattgt tcccctcgtc aacctatatt    264660
     gggaccgatg tggtcgacga tcacacagtg cgcgtaaaat tttcgacgcc gacgttgagc    264720
     ttcctgccga cgctcggtta ccacaagact ttattgcggg cgccaacaag cctcaacctt    264780
     ccggccaacg agctcggtga cctcagcaag cagatcggca gcggcccgtt cgtcgtcgaa    264840
     tcctggcacg aaaacgacaa tgtcgtgctt cgcaagcgcc ccgattacaa ctggggaccc    264900
     gtggcgatcg atcattcggg tcctgcaagc ctcgacagga tcaccttcaa ggtcgtcaag    264960
     gaagcagcct tgcgcggcgc ggcgcttgag gccggacagg ccgatgtcgc tctcaatatt    265020
     cccccccagg aactggcagg cttgcggaaa aaaggcttta ccgtcatcgc cccaaccagt    265080
     ctgggtttcg tcagcggctt ccgcgtcaat accaaggcgc cgtatttcgc ggaagcggcc    265140
     gtacggcagg caatacaatc cgggataaac cggcaggaga ttttggacac ggtgtttact    265200
     ccagactgga agccggccaa gagcttcatc gaagcaaacg tgccggaagt agctgatttc    265260
     cgcgacatac ttgcctatga tcccgcaaaa tcccggcgat tgcttgacga agccggctgg    265320
     acggtcggcg acgacggtgt gcgggcaagg aacggcgaga agctacgctt caatatctat    265380
     gctagcccat gggtgagcac gtccaagccg gtggatgaag tgatcgttca gcagttgcgg    265440
     gaaatcggca ttgcggcgac gcttaatgtg gtggatgtcc ccaccttcaa tgcacgcgtg    265500
     agagataacg acaccgtacc gctcgttgaa gtcagtcgca gctttctcga tgcgggcgtc    265560
     gttggccgcg tcctgaccga cctgcaggat ggcgacaact ggttcaacta cggtcagacg    265620
     aatgagacac tgaacaattt caccaaagcc atcgatgaat ccgtcgacta cgggaagcgc    265680
     gcgaacgtcc ttcgtgaggt ccagaagcat gtgctggaac agggactatt cattcccact    265740
     acgcagctca ttcagcggct cttcgtgcag tcgcccaagc tgcatggcga cgtctatagc    265800
     ggcgccgcct acccgttata ctacggtgcc tggttggaca actgatacgc cgacaaggcg    265860
     ccggacattc gcccggcgcc ttcatcctcc gcacaggaca cggacttcga tgagcacttc    265920
     caattatttg ggctacgctt tgcaacggtt ggcgcaggca ctggttgtcg tcgcgctggc    265980
     ctacatattg acatttctga tcattaacgt gctaccgggt gatccgatct ccaatatgct    266040
     gctggacccg gaaaacggtt tttctcggca ggacgtcgcg ccgattatcg cctattacgg    266100
     tctggacaaa ccgatttcgg cgcaactctg gatagcgctg tcgcgtttcg ttacgggcga    266160
     tctaggaata tccctccgct ccagtctgcc tgtgtccgga cttgtgctcg acgcgttgcc    266220
     atccacgctt attctggcag caagcgcgct ttccgtcgcg ttggtgctgg cctttcttat    266280
     cgctctcgcc tctcaaaacc tgccgcgaaa atacggtcag ggccttgtac ggctgctgcc    266340
     tgcggcatca ctctctattc cgagcttcat cataggcatc tttctcattc aggtcttcgc    266400
     cttccagttc ggcctgttcc ggattaccaa tcccgatacc tttgcagcga ccgcatttgc    266460
     ggctttagct ttgggcgtgc cggtttccgc gcagatcgcc gaggtgcttg ttaccaatct    266520
     cgatcatgag gcaagacagg agtatttttc ggtagcccgc tcgcgcagcc tcagccgtat    266580
     cgaactgttc acctaccacc agctccgacc gtcttccctt ccgctgatta cgatgatcgc    266640
     gcttgccgtg ggagaattac ttggagggtc attagtcacg gaagccatat tcggccgatc    266700
     cggtatcggc tctctcgtgc agggtgcggt ttccatgcag gactatccgg tcattcaggc    266760
     ggtcgtttcg ctcgccgcca ccgtgttcgt cgccgttaat ctgctcgctg atcttgcata    266820
     tccgctgctg gatcctcgat tgcgtgccga tcgacgcggg cagacttctc ttaacgaagc    266880
     cgaggtcgcc ccagaatgac attctaccaa tttgagagcc gtagttcgag tcgctcggac    266940
     gctcttcccg tttcggtgat tgtctccttc gcgttgttgg caaccatcat tgcctggtcg    267000
     ctggcgcccg ggcttttcac cagccaggat ccttatatcg gtgatacctc gcagaaactt    267060
     ctgtcgcctg gtctgcgaca ctggtttggc accgaccatc tcgggcgcga tgttttcgcg    267120
     cgcgtcgtgt ttgggtcgtg gtcatccgtc accagcgctg gtatcgcggt tgtgattggg    267180
     cttgtcttcg gcggcctcct gggcctggtc agcggtttcg tcggtgggta cgcggatgtc    267240
     atcgtcgctc ggcttgttga tgttctgctg gccattccga actttctgct agctgtggtg    267300
     atcgtcagct ccttcggctt tcagaccgtc aatgtcgcca tcgcaacggg ggcttcctcg    267360
     gtggccgtgt ttgcgcggct gatgcgcgcc gaagctctga agacccggac ctcgatcttc    267420
     gtggaagcgt ccggtctcct gggcggctca aagtggcata ttctcttgcg ccatgtgctg    267480
     ccgaatgcct atcgctcggt actggcgctc gccgtactgc aattcggcgc ctcaattctc    267540
     gtgatcgcga gtctcgcctt ccttggctac ggcgatccgc cgcctgccgc agactggggc    267600
     gtattggtgt caaacggcaa ggattatccg agttcgccct ggctggtctt tgcacctgcg    267660
     tcggtgatcg tcgtgaccgt gctttcaatc aaccgtctca gccgttggct gcggcaatcg    267720
     tactgagtgg gccggatttg tcatagccat gctgcacctt tccgaaaaat cgcatctcct    267780
     gacggtcgaa aatctctctg taacctatgg ccacgatgcc gtggtcgatc aggcgagctt    267840
     caccctgcgg cggagccgcg cgctcgcgct catcggcgaa tccggctccg gcaaatccac    267900
     gatcgccaag gcggtgctcg gccttttgcc cgagaccgcg aaaacatccg gaaagatcgg    267960
     cttcaaggga agcgatctgc tccgcctgaa cgactatacg tggcgaccgc tgcgtgggcg    268020
     tgccatcggc ttcgtgccgc aggacccgca gaacgcgctc aatccggtgc gcaccatcgg    268080
     cgcgcaggct catgaggccg cgcgcctgct aaatcttccc gaccgcgcgg ccgagcgggc    268140
     cgcgatccat gaaatattcg agctggtcgg cttgggtgaa cctgagcgga tctaccgctc    268200
     ctatccccac cagctttcgg gcggcatgtt gcagcgggtg ctgatcgggc ttgcggtgtt    268260
     gccgaagcct gacctgatcg tggcagacga gccgacctcg gcgctggatg tgaccatcca    268320
     gaaacgcatt ctcgatcttc tttcgacact gcgcgcctcg ctcgatctca gcctcttgct    268380
     gattacccac gatctcgcca tcgcggcgga acgggcggag gatgtggtgg tgttgaaaaa    268440
     cggaaaggtg caggaggcag gtctttcccg gcatgtcttt cttacgcccg cttccgatta    268500
     tgcccgcagg ttgcaggccg acgtgccatc gctcaaccca tttcgcttcc gcaccgagga    268560
     gcgccgcgcc agaagcggca agggtgcgga aacgcagata caggtgcaat ccgtctcaag    268620
     agcgttcgac gtcgacggca accaggtcca cgcgctaaaa ggcgtttcct tttccgtcga    268680
     tagtggcagc acccacgcgc tcgtcggcga atccggatcg ggcaagacca cgctcgcgcg    268740
     cctgctgctc gggctcgata caccggatag cggcgcgata acggtggccg ggcaaaaggt    268800
     ccatggccgc tccgccggtg cgttgcgcga ccttcggcgc gatttgcaac tggtctacca    268860
     gaaccccttc acctcgctcg atcccacatg gcgggtgaag aacatcgttc gcgagccgct    268920
     cgaccgttac ggcatcggca cacccgccga ccgcgaccgg cgcgtgttcg aaaccatccg    268980
     cgccgtcggt ctgggcgagg attttctgga aaggcggccg gccgcgcttt cgggcgggca    269040
     gcggcaaagg gttgccattg cgcgggcgct ggtcgtgcag cccaaggtgc tcgttctgga    269100
     tgagccgacc tccgcgctcg atgtcagcgt gcaggcaggt attgtcgagg cgttgttcga    269160
     actgcagcag cggttcggat tgacctacat cttcgtgtcg cacgacctat ccctaatccg    269220
     tcaggtcgcc gatacggttt cggtgctcca gcacggtcgc cttgttgaag acgggccggt    269280
     cgaccgtgtt ttcgaagctc cttcagggcc ttacacccgg gcgctgcttg cctcgatccc    269340
     cgcgccccct tcccccactt cccaccgccc gtggtaaccc gttaaaggag aaaactatca    269400
     tgcctaccgc tcgtgaccgc atcgttcttg tcgctttttc cgatccgaac gctttccatc    269460
     agggtaatcc ggctcgccag cgcgatcctg accgcttcac catcgatcaa ttcattgccc    269520
     atgcgaaact cgcggaaagg gcgggcttcg atgcgatttt caagccagat tttcttggcc    269580
     ttgatccgct caagggcgat gtgcggccac gcgccggctt cgagccgctg acgctgcttg    269640
     cagcattatc gcagcatacc aaacgtatgg gtctgatcgt aacggaatcg acctcctata    269700
     ccgagccgta taacgttgcg cgttacttta cgtctttgga caatctttcc ggtggcaggg    269760
     cggcgtggaa tgtcgtcacc tcttattatg gcgaggaaaa cttcggagac ggcacactcc    269820
     ttccgctgag tgaacgctac cgcaaggcgg acgaatacct tcgcgtcgcc taccggctct    269880
     ggaacggctg gaaagaaggc tccacggcct atacctcgga agggcaccgc ttcaacggcg    269940
     atcttatcga gcagacggat ttcgagggag attatttcaa agttcggcag ccgctggata    270000
     ttccgccggg accgcagcgc cggcccgtca tcgttcaggc gggcgcttcc gatgaggggc    270060
     tagatttcgc ggctcgtcac gccgagatcg tgtttaccgc gacgcccgac atcgaagccg    270120
     gcaaagcctt ctacgaggac ctgaagcgca gggcggtctc gcacgcgcgc gacgccgatc    270180
     atgtcaagat attgccgggc ctcaatattt tcatcgcacc gacgactgaa caggcgcagg    270240
     agatctatag tagccagttc accgacagga atttgctgaa gtatcgcgac aagatcacac    270300
     gagaggcgcc gctcttccgg cttggcgact tgaacctcga ccaaccgatt ccagaaagcg    270360
     ctattccgag cgaagaggaa ctgaaccagg tggagcgacg acgcagccgt ggtctgctgc    270420
     tgcgccgcta cttggcgcaa ccgggtgcga cgctgcgtca ggttctgtcg ggcatctatg    270480
     aattcggtca tctgacgctg attggcacgc cacaatcggt cgccgaggag attgcccttt    270540
     ggttcgaaca aggagcgtgt gatggcttcg tatttaaggg aggcaattcc tttgcatccg    270600
     ttgccgagga ggtaattccc attcttcgta ccaagggcgt cttcaaggat ccggtttcga    270660
     ccggtttgac cttcaggcag acactttttg gcattgcaaa tggacggaca acctgaaact    270720
     cgatggttta gctagctcgt tcattgaatg cgtcgccctg catcgtcaaa gaagtgcaag    270780
     tccttacaag ggagcgtaat tttcgcccgc gtccgtccaa ccactgctat ctcgttctgc    270840
     gtgaagatct taaaaggcag atcgtgcatt cgaaggtgaa ggataaagcc aaggcctgtg    270900
     ggctccacaa ggtctacatt ggcctccatt ccgtctgaat cagaaagaac gacatgttca    270960
     ggccgaattc caaccgtgag cttggcacct gagctgagcg ggagtggtct ttccaagctc    271020
     acttgtgtgc cgtcaggtag cgtcactgca tagctatcga tttccgaaac gtaggtcgcg    271080
     tccagaaaat tcattcccgg cgagccgatg aagctcgcca cgaacagatt ggcaggcgtt    271140
     cgatatagat cgagcgggct cccaacctgt tgcaccttac cgtcgttcat cgcaacgatc    271200
     cgatccgcaa gcgtcatggc ttcgatctga tcgtgtgtca catacacgga tgtggcggtt    271260
     aactgcttgt gcaagcgttt gatttctgac cgcatttgct cgcgtagacg ggcatccaga    271320
     ttggaaagcg gttcatcgaa aagaaatgcc tggggcgagc gaacaattgc acggcccatc    271380
     gccacacgct gccgctggcc gccggagagt gccttcggtc ggcgctgcag caaggcatca    271440
     agccccaagg tctttgcggc accggaaatt gccgtggcta tgcgttcttt gggcgtcttt    271500
     cgcaggcgga ggctgtaact catgttatcc gcgactgaca tatgcgggta cagcgcataa    271560
     gactgaaaca ccatcgcgat gttacgatcc ttgggcggaa gttcatttac cagcgtgtcg    271620
     ccgatctgaa tgccgcccgc ggagatgtct tccagtcccg cgatcatccg aagaagcgtg    271680
     gacttgccgc acccggatgg gccaaccagt acaatgaatt cgccatcggc aattttgagg    271740
     tcgatctcat gaaggaccgt gtggtgccca taggatttcc ggactttgtt gatagtgata    271800
     gatgccatgt gaaaatcctt cagcctttca cggcgccggc ggtaaggccc tgaacgaggt    271860
     aacgttgaat aacgaggaag aagacgccca ccggtaccaa tgccataaca gcggcagcca    271920
     tcatctgacc gaagtcgaca gagaatttgg agacgaaggt cagcagtcca accgggaacg    271980
     tcgacatctg gttttgcgaa atcagcatga gtgccagtag cagctcgctc caggcggccg    272040
     tgaagacgaa gccaagcgtc gcggcaatcc ccggcaaggt aagcggaacg atgatctgcc    272100
     ggaacgctac aaatctggtt gctccatcga gcatcgctgc ttcttcgaga tccttgggga    272160
     taccatcgaa gaacgactgc ataagaaatg tagcaaacgg aagattgaag gcggagtaca    272220
     gaatgacgag gccgaacaga ctgttcgtca gccccatcga agagaacatt ttgaaaatgg    272280
     gtgcgaccag catcgacagc gggaacatct gcgtcagcaa catcaagaca acgatgacgg    272340
     tcttgccggc gaacgcaaag cgcgacatcg cgtagccagc caacgcggca agtacggtga    272400
     cacataccgc agtgccaagc gaaacgatca aactgttcag gaaaaacgtc gggaattcgc    272460
     tattgatgag cacgaagaga tagtgctcca gtgtcgtgcg cgacggccac atccgaacgc    272520
     cttcggtgta gagaaggtcg gttggggtga ctgagacctt gacgagccaa aacaccggaa    272580
     acagcgaaaa gaaaagatag ggtaaaagag ccaggcggtg aagaagggcg ccaaaccgtt    272640
     tcgatttcat ggatcaatgc tccttcataa gagttcggcg cagcgcaatg atgagcgcgg    272700
     cgtagatgga taaaagcaag atcagaacga cagcgacggc cgaggcataa ccaaagtcga    272760
     gacgtttgaa ggcgatcgta aaaatgtagc tagcgaggat ctgggtatga tctgccggcc    272820
     caccgttggt catgaccacg atcaagtctg caaaattggc aatccagatg gtgcgcagca    272880
     aaacagtgat agcgattgtt ggcgccaaga agggaactgt gattgaccaa aaccgctgga    272940
     gaggtgaagc gccgtcaatg gatgctgctt catagagatc gcggggtatc gattgcagcg    273000
     ctgccagaag cgtaatcgca aagaatggaa ttccgcccca cacgttcgcg actattggac    273060
     cccacatcgc gatggtagga tcggaaagaa tgttttccgg cgatgagagg atgcccaaag    273120
     cggccatcca gtgcggcaaa ggcccaacca ccgggttgaa caaccatgcc caagttaacc    273180
     ccatgagaaa cgacggtaca gcccagggta ggaaaataag cgcttgtacc aagcctagtc    273240
     ccatgaaccg cttatcaagc aacagcgcga gcagcagacc gaacgagaac tggaaaatga    273300
     cggatgccat tgtccaccat acagtattga acaacgctcc ataaaacgtt ttgtctccat    273360
     agatttcgcg gaagtggtcg agaccgatgt aaccgcccga gaatgggttc aggagctgga    273420
     catcttgaaa ggcgtaggag acacccagca ccaacggaac caaaatcaac gcaaggatga    273480
     ggaatacggc cggcgcggtg taaagatagg gttcgagccg gcgaaacggc ttgatcttgg    273540
     aaatggcggt catgcggaat tcaagccttg tgctgggaaa aggaagcctg ccaactcccc    273600
     aatggcatcg cgcgatggaa gtcggacctt tggcgccaag agcgaaggaa tctgctcttg    273660
     ccaagctggt gggcgacttt tttgctgagg gagccagata ctcgcgaacc caggtctcac    273720
     gtatacccgg ctctcctgtt accgaaagat ctgaagcgtt acttcttgct taagaacttt    273780
     tgctgcgact tcgtcatgta atccgcccaa gtatctgcaa gttgacttgg cgtgatttcc    273840
     cccagcagag cttgctggga cgacttgaga gcaagtacgt ccttgaagta ggcaaattct    273900
     tcaagataag tcggcatttt catcggcgtt atattcgggt ctgccaactc agcaaaccag    273960
     cccttgaact tgtccgatgc gtagaaaggg tccttttgcg ccgacttcaa aatcggtagc    274020
     gtccccaccc gcttgttcca ttccatgtta ccttctggcc cctcgagagt ggccatcagc    274080
     ttccaggcaa gatctttttg cttgctggcg gccatgatcg accagccaac atagccaatt    274140
     gtcgggaaag ccttgccgtc cggacccttt ggcatcgatg tcacaccaaa gtcttcagcc    274200
     ttcatccggt cagcgatcgc gatcaatgcg tccgggtcct ggtccagcat cgcgcaggtg    274260
     cccgaataga aaccggcaac gacttcattg aagccccagt tcacactgtc tttcggcgca    274320
     tcgccattct tgtagaggtt aaccacccag ctgagacctt tcttccaacc ttcattgttc    274380
     aaggtggaag taccgtcttt gtcgaagaag tccgaggaac ccgccatcga ggcgccaaac    274440
     atcatccagc cattgagacc gcccggaccg ccacgaaggc agtaaccaga ctttccagtc    274500
     gtcttggtga tcttatcgga attggcgaca aactcttcca tcgtcttcgg aggattggcg    274560
     atgccggcct gctcaaacag ccttttgttg tagaagagcg cgcgcagata aaggccatac    274620
     gggagcatat acgcggtgtt cttcacgtcg cgtccaagct caagcgcgcg atcggttaga    274680
     tcggacgtgt attgccattt ggccagatag ggttcgaggc tttcgagctg tccgttgttg    274740
     gcataaagcg acagccagtt gtccggcatt tccacaatgt cgggtacatc gccggctgaa    274800
     accattgttg caaatttctg aaacgcttca ctccacggca gggagatgat ttctacggtc    274860
     gttccgggat tggccgcttc gaattttgcg acgattgact tcaatgtcac tgtacgctca    274920
     gggcttgtca gtacctcgac gagccgaagc ttggtgtctg cgagcgcgct accggccatg    274980
     aggccgagca tgactgctgc ggtgataatc cttttcatta cgtacccctc atttgttgtt    275040
     tttgtcgtgt cgctaccagc atcgcgccga agccaatcga tggctggatg catttatgaa    275100
     cgattgtcga caacagtcaa tcgccaatat ttcttgcgat gcgatttgaa acgaattaat    275160
     gaagcacctg cggccgcagc ggtccgcatc ttcgcccaca caacagcctt ccaaacgaat    275220
     aggtgttcta tgcaaattcc gccccttaag gtccgtggcg cttcctttcg cgatactctc    275280
     ggccgtgagg cgcttcttcg gggcgtcaat cttggcggcg attgcaaact tccctatccc    275340
     tacggtggca ccaacttccc tactgatttc tcagatcatc gcgcggtcag tttcgtcggt    275400
     aggccattcc cgctcgatga agcagacgaa cacttgtcgc ggctacgcca ctggggcttc    275460
     aacgcgctgc ggcttctcac gacttgggaa gccattgagc atgccggcgc tggtcaatat    275520
     gacgaagatt acctcgacta tttcgaacag gtgtgccgca aggcgggaga atatggcctc    275580
     tacgtctttg ttgatctgca tgaggatgca tggagccgta tgacgggagg cagcggtgct    275640
     cccggttgga cattcgaggc cgcaggattg gatttcaccc gtttccattc agccggcctg    275700
     tcgcatgtga tgcagctgaa gtatgactac gtcgagggcg gacgccagga caattatccg    275760
     cagatgacct ggggctccaa tcatcgcttg tcacctggcg gcatcatgtg gaccctgttc    275820
     ttcacgggaa agatcttcac gccggagttc acgatcgagg gagttaatgt ccaggattat    275880
     ctgcagtcac attatgtcgg agcactgaac gcagtcgcaa agcgcattgc cgacatgccc    275940
     aatgtcttgg gcttcgatac gttgaatgag ccggtgcccg gttggatagg ccggccgctg    276000
     agctatcgcc accttcgccc gacgacgatg aacccggcca acccgcgcat cggcctcgcg    276060
     atgtcgccac tagacaatct gcttgcggcg caggggatcc cggtgtctgt gccgaagatt    276120
     ctgcgcgacc cgaagaccgg cgccttttcc gtcggctctg aagagatcgt caatccggac    276180
     ggtgtctcga tctggctccc cggccacaca tgcccatttg aagctgccgg cgcctaccgc    276240
     ctcaacggta cgaaggccga ggttctggac gagacgtttt tctgtgtatc gcggggacgc    276300
     gtgctgtccg ccgcaaatga cgcctacggt ccgctcttcc aggccgtctc ggaaacgacc    276360
     cacgtgatca atccccgctg gtcaattttc gctgaactcg agccatacag cgcatttgtc    276420
     ggcggccctt tccctgacaa catgccggaa ggcgcagtta atgcgagcca ttggtatgac    276480
     agctcaacgc tttacacaaa aaccttcagc tctgaatcag cgttcgattt cacggccggt    276540
     aaaatgctct atggacgcga tgccatcaaa gccagctacg tgaagcagtt acgcgatgtc    276600
     gccactctgt cgaacacgtt cgggccaacc ggcgctccga cgctaatcgg cgagttcggt    276660
     attccgttcg atctcgatgg cggcgcggcc ttcgaaacat ggcgcaccgg cgaccgcagt    276720
     cagacgccct ggcagcccca tatcgacgct ttgaccctga tgtacgaggc gttcgacgaa    276780
     ctcttgctgc atgtgacgct ctggaactac accgcttcca atcgcaatga ccttgcgatc    276840
     ggcgatggct ggaaccaaga agacctttct attttttcgc gggatcagca ggagcatccg    276900
     gacgatccag attcgggcgg ccgtgcgttg ctgggcttct gccgcccctt tgttcgcctt    276960
     gcacaaggca atctcatacg aatggcattc gatgccagcg catgccgctt taccgcggaa    277020
     atcgaggtcg atgccgtcgt tccggcagaa acagaaatct acctgccgca gcttcatttc    277080
     gggaagcatc cgatcatcga ggtcagtggc gtggatagtg accttcgctt cgatttggaa    277140
     agacaatgcg ccttcatcca aagccgcgaa aacggttccc ttgcgattac cgtgcaacac    277200
     acgcccgcac cataatgttt tgaattcaat cgttggcgtc tcataggcgc cgacggattt    277260
     aggcacgtaa aggtttaaaa aagcattgaa atcaccttat cgacgaatgc cgacaatagc    277320
     catgcaaacc gccccatgct atagtaaaga ttgagtccgt gtgcctgagc ccggacatta    277380
     tggagtttca tcgatggatc gaatttcaat atctccggtc gttaaaatgc cggtcgaggc    277440
     gcaggctacg gatgccttgc gggatgctat cgtcaacggt gccattccag ccggcgagcg    277500
     catcactgaa attcagcttt cggatcagtt gaacctttcc cgcgcgaccg tcagaagcgc    277560
     actgcatcag ttggccaagg aagggctcct gacgctcgtt ccctatacgg ggtggagcgt    277620
     gatctcgatg acctccgcag acgtttggga gctttacaca ttgcgttcgg ctgtcgagcg    277680
     gcttgctgct caactgctgg ccggcgccat cgacacggcc gcttcggcca agatcgaaga    277740
     ggcttttgaa gcgcttgcgc gcgcgtgcaa gaaaggcgac cggcctggaa tcgccgtagc    277800
     ggatttctcg cttcataaga cgatcatcga tctgacgaac cacagtcggt tgattgccca    277860
     atatggtctt atcgagcagc agatccgcat gtatattcgc tcgagtgacg cgctggtgcc    277920
     aagttccgat gcaatcataa ggcagcaccg gcctatcgtg gatgcaatca tccgtgggga    277980
     tgctgatgag gccggcactc tttccgagca gcataatctc acggaaggta aaaagctgtc    278040
     ggatcatctg aaggatttgg aagtcgcaca agaaagtgcg gcgaaagctg tcagcgttgg    278100
     cggaaagaag cgcaaagcgc ctctctccag atagaaattc tctatatcag catcatcaat    278160
     atctcggtat tgccggtttc ggcctcgcta tcagcggtga ccgcaaacct ccgcaagcgt    278220
     cgcttccaat tcggttagca ggcgagcggc atctgcgcgt gaaaatacga gaggcggtcg    278280
     aatcttcaac gtattggcat ggaatccggt cgcggagatc agaacgcgac gttcgcgcaa    278340
     gccatttgtc accgcgagtg ctgtggcgga atccggtatc ttcgtcgtcc tgtccttgac    278400
     gaactcgaca ccgatataga ggcccgcacc gcggatgtca ccgatcgcct cgtagcgtgt    278460
     ggcaagatcg cgtaggccat cccggacaat tgcccccacc tccttggcat tcgattgcag    278520
     cttctcttct cgcattacat ccaacgtcgc ctgtgccgcc gcgatcgcaa ctgtgtttcc    278580
     accaaacgta ttgaagtaac gcatgtcgga accgaatttt tcgacaaaac gcggggcaag    278640
     cgcaatggca gccacgggat agccgttccc catgggtttg cccatcgtta cgatatcagg    278700
     cgtcacgccg tgacgctggt atccccagaa ccgatcgccc gaccgaccaa atccagcctg    278760
     tacctcgtcg gcgatgaaca ggcctcctgc tcttcgcacc acttcagcaa taggcgccag    278820
     aagtccaacg ggatctgcgt agataccgtc ggacgaaaac agcgagtctg cgtagaaggc    278880
     cgcaagtccg tcgccgtgtc cctccaggtc atcgatctgc ttttgtactt cgccagcaag    278940
     ccacgcgccc atttcctgtg gagcaatacg ataagaatca ggcgtgggaa tccgtcggac    279000
     ccaggtgcca agtggcgact tcgggccaag cgacggcgaa aagcctgccg tcataaaaga    279060
     attgccatga taggcctcgg acgtgatgat gacgccattc cggccagtgt ggtgacaggc    279120
     cagacgtaag gcaagatcgt tcgcctcaga gccggtgcag gtgaacatta tatgttcgat    279180
     attgtcttca aaggtcggca agatggatgc cgcatattcg agaatgccat cctgcagata    279240
     gcgcgtgtgc gtgcacaggg tttcgagttg acggtggata gcttcaacga ccttcgggtg    279300
     cgaatgcccg accgagggca cgttattgta ggcatcaagg tagtcgttgc cggcgctgtc    279360
     atatagcttg ctgccagaac cgcgagcgat ctcgacagga tgggcgtaca tcaatctgta    279420
     ggccggcccg aggaacttgg cccggcgctc aacgatatcg cgtgtcttag cgtcgagctt    279480
     gccaaggttc gcaggatcga agccgttgac catggtgtaa gcaggctttg tagcggtcat    279540
     ttgatatcct caattttcga cgggctttgc ggcctcatgc cggatatgag ccagttgttc    279600
     agtcttgtgg tggtcgcccg acgagtacca tcttcagatc attcacgttc gttccggtgt    279660
     tcccggttgt gatgatgtgg ccagtccgtt cgagcaaatt cgtgacgtcg tgatcgcgaa    279720
     gagcaatatg gagatcgaac ccttgcagcc tcattgtccc agctgtggac ccgtccacga    279780
     gaccaccagc atgcggggtt ggtccatcgg tgccatctgt atcgatgcca agcgcaacca    279840
     cattttcata cccgtcgagt tcaagcgcgg cagcaacagc gaactcctgg ttcggcccac    279900
     cgaggccggc tttgctgctg atcgtgacag tcgtctctcc gccgccgatc aagacgcaag    279960
     gcatgggtag cggtcggcct gttgcaagaa tctcgcgtgc aatcgcggcg aacgtcttgc    280020
     ccagactgct gctttcgccc tcgaacaagg ttgacagaat gatgggatgg aagccggcgt    280080
     tgcgcgctgc atcggccgcg cccgcacatg ctgcatccgt ggtcacgatc agctcatctt    280140
     gacggacaat atgggcaaga tcagcggaag tggttgagcg ctcggccgct gactgtttac    280200
     gcagatgccg aaccactgaa aatggaactc tattccacaa atcgtactta tcgagagtgg    280260
     cgcaagcgtc ttcgaaagac gacgtgtcat gcaccgaggg gcaagtaata tattcgagtc    280320
     gctcgccaat tacgtcagaa acagtcaggt tcaccagttg agtgcctgcc ggaaggtcgc    280380
     ggacgagtcg gccacccttc actttgctga tatgctttcg aacggcattg acttcgatga    280440
     tgttggctcc gcaccccaag agcacccggt ttgtctctgc tttgtcctcc agcgaaatcc    280500
     cctcggcggg cgatacgaac agcgacgaag acccaccagt gaagcacgcg atgacgatat    280560
     cccctgcctg cacttcgcgc agcagcgaaa cagtccgctc ggctgcatcc cacgaagcag    280620
     ccgtcggtac tggatgatct gcgagcagca tgtcgatatg atttaagctg cccagttgcc    280680
     cacgtttgca gacgatcaaa cctttatgga tgcggctgcc gagcacgtca tcaagaactt    280740
     gcgcaatcgg ataggtcgcc ttacccgcgc caatgacaaa gatccgctgt tctggcgaca    280800
     gtctgtactc gcggtctgcg atgtgaagcg cattcccaaa aaaattaaca gcgcggcggg    280860
     cagccgtgcc cggatcggcc gcagcaattc cagcctctgc gatatcgaga gcataccggc    280920
     gaagcaccgc gtccccactt tgcaaaagga tcccgcgatt ccgaatatat ttggcggggg    280980
     tcaggcctaa ggaagcccct tgtgtcagcg acattgaagt gccgttcgtc gctgcgtttg    281040
     caggttccat gtcagtcgat ccgtgtgatt gtcctgtgcg ctatattgcc gattggcgac    281100
     aatcgtgcaa gtgcgtttaa tctaactccc caaaatgaag gaccttaaat gttaagatat    281160
     ggaaataccc tcgccggcga ttgcgcgagc gtccaaggca agaaagcgtg tgataagcct    281220
     tggtgcatcg atcgcggcgt ggactgattc cgatcttcta tgttgttggc tatgctgtgg    281280
     cggcgcagta gcggacagat ttcgggcgtg cgcacgccaa catgcgattg agagccgcgc    281340
     agcccaggcc aacctctgtc tattgcgctg cgaatgatcg tgccctcagc cgccttccaa    281400
     tgatcgactt gtatctaccg atagcggtct caacgaggga ccgcttgccg taaccggtgg    281460
     cggcctgcca attcatccgg ccgtcattgt tgactgccgc gatatgtcgc tcccgctggc    281520
     tgggaggttc cgtatcggct cgctcgaccg cgttggcgcg cggcggaatg atcacgacag    281580
     caccggcgct gtgtttgttg acggcggcat aagtcggctt gccgtcatac gcaccatcgg    281640
     ctgtgaactg gctgattgag gtgtcgatct gatcgagcag cacctccacc tgcgaggcat    281700
     cgccggtctc ccggtcagtc agggcgtgcg caatgatctc accgctatcg gcatccagcg    281760
     ccagatgcag ttttcgccag ctccgccgcg atctggcgcc gtgcttttcc tccgaccact    281820
     ggccagcacc gtagacttca agccctgtgc tgtcgataag gacgtgcaca ggtccttctg    281880
     ctgaaatgga acggccttgt cggcgatcag ccgagcgcca catgcttgcc cggcggctca    281940
     gtgtcgtgtg atcgggtacc gcgagatcca gctccatcag ctgcagcacc gatgccagca    282000
     agccctcggt ttggcgcagt cgcaggccaa acaccaagcc cagcgtcaga gcggtctcga    282060
     tcgccagatc ggaatagcac ggctggccac ctcgggtcac ccgcttcggc gcttgccaag    282120
     acgacaacgc ttccccagcc acccacagcg tcaggctgcc gcgtcggcga aggcgtgcct    282180
     catattcccg ccaattcgtc accttgaact tcatcttgcc gatgcgatgg cggcgggcag    282240
     cgttatgttt gaaaggcatg aaaatgaaca gccgactatt tctatcgccg ttccactaca    282300
     gcaccaccgc taacgatccg tgcaccatgt gtagacgccc gtttggcaag aggaatcttt    282360
     ggtcggcatt tgcgcgtcgt cgggtgctga catgtgtccg gcctgtgatg cggctttctg    282420
     acatgtgtag acgcccgtat ggtgttcgca ggccaggtcc aaatcaacgc cgcgtgctct    282480
     tgaggcactt tggtgcacac tggttttccg gaccccgtct cacgaccgtt gcgccatacc    282540
     ttccgctgac ctctctcgct gcgacgtcct cgcggttacg tttggcttat gccgtcgtaa    282600
     ccggagctct gtagacctcg ccctttgcca tgagggccca gacgatacgc gccatcttgt    282660
     tggccagcgc gaccctcacc agcatcggtg gtttatgcgc gagcatcttc gccaaccacg    282720
     atcccggggc cgctcccttg cgggcacgcc acacgaccac gctattggcg cccatgatca    282780
     ggagccgccg cagggatcgc tccctcatct tcgtcgtgga cccgaggcgg tgtttgcccc    282840
     ccgtcgaatg ttgtcgcggg acaagcccca gccatgcggc gaagtcccgc ccgcgctgaa    282900
     atgtttccgg cggcggtgcc gaagccacga gtgccgaggc aatcagtggc cctacaccag    282960
     ggatcgtcat caaccgtcgt gcagtctcat cttcccgtgc ccggcgcacg atctccgcgt    283020
     ccagcgcctg gatctgatcg ttcagttgcg acaacattgc cgtcagaaac cggagcgatg    283080
     cgcgcgctgt ttggggaagc gccgtctgtg ggtcctcgac tatcgcaatc agttttgcag    283140
     catatgtcga tccctccgga gcaacctctc cgaattccgc cagatggcca cgcagcgcat    283200
     tgattgtctg ggtccgctgt cggatcagga gatcacgggt acgcaacacg actgccactc    283260
     cttgcgcctc ttcactcttc accgccacaa agtgcatcgt cggtcgttgt gcagcctcgc    283320
     agatcgcttc ggcatctgcc atgtcgttct tttggcgctt gacgaaaggc ttgacatagg    283380
     ccggaggaat catgcggacc tcgtgtccca gacggccaat ctcgcgagcc cagaaatggg    283440
     agctcccgca ggcttccatg gtaacgagac aatgtggctg gcgagcaaag aattccaaga    283500
     cctgccgacg ccgcagttgc ttgcgaaaca caacagcccc tgatgcatcc gctccatgga    283560
     tctgaaatac agtcttcgcc agatccaaac caattgtacg aacttcgctc atgatgccca    283620
     gctccaatgt aggttcaaac aatcccactt tgccacacat ctgggccgtc gcgggcgtct    283680
     acatcatcaa cgcccatgat cgccaaagta tgccgccagc agatcgcgcg tctgctcgcc    283740
     atcataggcg ccatctgcaa cgaagcgggc aacggggctg tcgatcagat cgagaagttt    283800
     tggcaatgcg gtcggatcac cgatctcatc ggtggtcagt tcgcagcaga cgatctcgcc    283860
     gctgatcaga tcaagcccga gacgtaattt ccgccaccgc ttgcgactgg ccttggcgtc    283920
     atgctttgtt tcaagccact ctccggcccc gacgatcttc aggccggtgc cgtcgacgac    283980
     cagatgaacc ggtccctggt ctcccagacg aggctttgtc ggcggcaagg tcaatccctt    284040
     gcttcggcgc gatagagttg agaaatcagg taccaggaca tcgaggtcca tcagtgccgc    284100
     cacgctacgc atcaggcact gagtttgccg aagaggcagg ccgtagacga cgcgcaaggt    284160
     caggcacagt gtgatcgcca gatccgaata tttctgctgt ccaccgcgcg aaatgtgccg    284220
     ggatcccgac cagagacatt gcacttcctc gttcacccaa accgtcaaat caccacgtcg    284280
     ccgcaagttc tcgttatagg cggcccagtt cgttacccga tgcttctgac tggcaatctt    284340
     gtgtcggcgg gcacagttga atttatgcgg catatccgaa atcctgaaga cgatgtgctt    284400
     ccaaatgtca gccggcaatc gacccatgca acaaggcctc ccaaaataac gaaaggtgtc    284460
     gtcaaacaga aaaggccccg gcaagttctg ccgaggcccc ttcgtcggcc cgggagggac    284520
     ggctacgtta tgctgttgat agcttacttc tgaaggaact ctgcggcgtt ctccttcgtg    284580
     acgtatgtcc acggcacgga gtagagcttg tcggtcccgt tgccccatgc catctgcgga    284640
     tacttcttcc agcactcggc gagtggctga taggagtcac cgataacccg gcgcaaagcg    284700
     atatcgaccg ccccctgggc ctgagtctga gcatcctggc ggatcgacag gatcatgtcc    284760
     ccgctctgga ccgcgcgaac ggcgtcggtc acgccatcga taccgacgac cggaattgtc    284820
     ttcggatcaa tgcctgcggc tttcatggcg gcaatcgcgc caagacccat ttcgtcgttc    284880
     tgagcgagaa caccgttgat cttgccctta tgggaggtca gccagttctg cattagcacc    284940
     atggcttcag aacgcgacca gttggccgtc ttgcgctcga gaacagtgat gtccttgttg    285000
     gcgtcgaggg ccttcttgtt gccttcggta cgcagttcct gtccgaggtt accttccggc    285060
     ccgataagaa ccacgatatt gcccttgtcg ccgatggcct tgaacaacgt ctcggcctcg    285120
     tactgcccag cagcaacgtc gtccgagcca ataaaggaaa cgagctcgtc gctcttcgcc    285180
     ggaccattcg atccgaccac cggaagattt ttcagggcgg ccttgtggat aacgcccttg    285240
     gcagcgtagc tgtcgatggg aatgtaaatt gcgacatcat agtgctgcgt cgccatcagg    285300
     tcgaactgcg atgcctgcgt ggcgtgatcg tagttcccgt cgaagacggt cagctcggca    285360
     atgccgttgg caaacgcggg gtgcttcttg atctccgcgg cccagatctg cgcgtactca    285420
     ttcttgagac cgtagacagc cgcgccgacc ttgacaggct tgtctgcggc gaagccgact    285480
     ttcccagcga tgggcagcag accagctcca ccgatgatcg cgagggtggt tcttctggtg    285540
     atattcattt ctctcctcca tttcgcacgg agccaagggc gtgcgcttcc ctgttgatga    285600
     actctgggtg tggtgagggg tcaggctggt ccgagttacc tcgtccgagc cctgacggtg    285660
     tccaggaaca cggcgaaaac gattaccagg cccttgatga tctgcttgtt gccggagtcg    285720
     accgaaagca ggtcgaggcc attgttaatg acgccaatta agagtgcgcc aaggatcgtt    285780
     ccaccaatgc cgcctcgccc tccggccagg ctggtaccgc cgatgacgac agctgcgata    285840
     gcgtcaagct catagccaag cccggcttgc agcgaggctg acgtggcgcg ggatgtgaag    285900
     atgataccgg atagccccgc gcagatacca ctgatcaaat atacggagaa cttgatgagg    285960
     ccgacattta caccagcggt ccgagcacca cgttcgttgc ctccaaccgc ataaacgtaa    286020
     cgtccaaagc gcgtatactt gagtgcgatg tagccgatca aagcgaccaa tgcgaaaagg    286080
     tagactgaga tctggattcc gccgatctgc ccgtttccga gaagcatgaa gtcgtcggat    286140
     aggtcagaga tctgggagcc atggttgtac acctgcgtaa taccgcgcgc tgcactgagc    286200
     atcccgaggg tcacgataaa tggcggaatg cggcttgagg ccgagatgat ggcgccgttg    286260
     gtggctccag caaggcctcc cactgcaagc ccgacaatga ctgcggctgt aacacccaag    286320
     tccatgcccg agttcgtgac tacacttgcg gcgacgatgc ctgccagcgc tagcacggag    286380
     ccgactgaaa gatcgattcc ggccgccaga atgacgaatg tcagcccgac cgccatgatg    286440
     ccgttgatag agacctgagc gaggatattt ccgatgttgt cccaagtggc gaaatacggg    286500
     ctggcaaatg cgaggaagac gcagagtatc gcgaatccga atgcgatacc gaagcgggaa    286560
     accagattga cgacgatggt atggctgact tgaggcatgt tgaatttccc gttcttagga    286620
     tgcgagatgc aggagcgctt catgacttgc gtcagtgcca gccagttccc cagctatcct    286680
     gcctcgacgg aagacgatga tcctgtcggc gacctgtagg atctcgtcga gttccgagga    286740
     cacgacgagt gccgtgcgcc cctcggaaac gaagtttcgc aggaaagtgt agatcgcctg    286800
     cttggatccc tcgtcgatgc cgcgtgtggg ttcgtcgcaa agaagtattc tcggatcggt    286860
     gacgaggcac ctggaaagga ccaccttctg ttgattgcct ccggatagtg tctcgacatc    286920
     gtcttcagct gatcccattt tcagagagaa ggccgacgcc atcttcgcaa cgatgcgctt    286980
     ctctcgccct cgccggacaa aacctccgat cgagttttcc tttagagagg aaagggaaat    287040
     gttctcgcga attggacggc agagaatgag gcccgtgtcc ttccggtcct ccgtcgcgaa    287100
     ggccagacgc tttgctatgg cgtcgctcgg cgaatgaatc gtgactgatt gcccttcaat    287160
     cttcagagac ccggtttcat gcttggtcac gccgaacagc gcatcgagaa actcactgcg    287220
     ccccgcaccc atgagaccaa agagaccgac gatctcccgt tcgcgtagct gcaggctgat    287280
     gttttcgaac acaccttccc ggccgtagtt ttccacctcg atgatgggac tgccgggttc    287340
     ccggtgatca cctttttcgc gacgaactgt cttgccgacg atcagcctga cgagttcctc    287400
     tctgtcgata tccgcgagct ttccagcttc gacgaattcg ccatcccgga aaactgtata    287460
     ctcttccgca atccggaaca gctcgctgag gcggtgggag acgtaaatga tccccactcc    287520
     ctgctgtgtc agagaacgga tcgcatcaaa gagaatgtcg gtctccgcct caccaatagc    287580
     agacgtgggt tcatccataa tcagaattcg gctctcctgg ctgatggcct ttgcaatctc    287640
     caccagctgc atcttggaaa gcgaaaggct tccgacaaca gcccgggcgt cgatcgcgaa    287700
     cttaagacga tccaggagag cctgcgcctc acgaaacatc cgggcatagt ccactatccc    287760
     cgagcgggtg ggttcccgcc caagaaagat gttctcggca acagttgcct ccagaagcgg    287820
     gctgagctct tgggtaatga tggcgatgcc cgctgcgagc gcatcgcgcg ggttgtggaa    287880
     atcgaccgcg accccgtcca gcaggatttc tccatgatcg ggtttagtca tccccatcag    287940
     aatgctgaga aacgtcgtct tgcctgcgcc gttgcctcca cagagcgcat gcaccgaacc    288000
     tgctcgcagc ttcaatgcgc catgcttcag cgccgttaca gatccgtacg tcttcccaat    288060
     gttccgagca agcagaaggt aatcgccccc cgcatcgtta ttggcagcaa tggtttccaa    288120
     gggctggttc atggaccgac acctcctcct agcgttgctc ctcggagggc ttgattagat    288180
     gaacttcaaa tggtccgcaa gcaatttgtt ggttctcggc gcaaattagt tttatctccc    288240
     gcattgcagc atctgatgat gcccaataaa cgcaccttct tctgcaagaa ttgcccaaat    288300
     agctctcttt ttggatattt acaggtcaaa attatcgctg cattgcacaa aatttatttg    288360
     ttgcctttcc aaacgaattg atctacctca gtcgtcattc ggcacccgca ttggaggaaa    288420
     agcactatgc gtcgcttagg tattcactcg ttcgtttgga caggcggtca gactcaagag    288480
     ggcctcgaga tggccctaaa caagactgcg gagcacggct accggacgat tgagttcgcc    288540
     tatctgcgcc cggaaaaatt caatctcgac aagctggcga agctcgcaca gtctttggac    288600
     gtggagatcg gcgttacgat gggattgtcc cacgcaaccg acgtatccag cgaggacgag    288660
     gctgcagtct ctgcgggcaa gaaggtcctg tcggacgcaa tccgcgcagt gcgtgacatc    288720
     ggcggaaaca agctgggcgg gattctctac tctgcccaca cgaagtacgg ccgtgcgccc    288780
     actaaaaagg gttgggacaa cagcgtagcg gcgatcgcag ccagcgggga gatcgcgaag    288840
     ggatccaacg tcgatctcgt tctggagatc gtcaaccgct tcgagaccaa tctcctgaac    288900
     acggcggcgc agggtctcaa gttcatcgag gaaactggtt ccgaccacgt tcgcctgcac    288960
     ctggatacgt tccacatgaa catcgaggaa gcgaacccgg ccgcagctat ccggctagca    289020
     ggagacaaga tcggctactt ccacattggt gagagcaacc gcggctacct cggtgacggc    289080
     acgatcaact ttgatctgat cttcgacgcc ctgctcgata tcgactacaa gcgtgacgtt    289140
     gtattcgaga gcttctcgac ggctattgtc gacgagggac tatcactcgc ctgcgcgatc    289200
     tggcgcgaca cctggacaga caacgacccg ctggcggcac atgccaagcg ctacatcgag    289260
     ctgcgctacg aagaagccaa gcgccgccgc gcaactaacg cacgcccctg ataatccttc    289320
     tcacggcctg ccccgcatgc ttaggcttgg gcaggccgaa atgaagggaa tcgagcatga    289380
     atgaaaccgt gaccgctggt agctccccac gcaagatccg acagaacaac atcgttgctg    289440
     ctctgcagac gctgtatgtg catagatgcc tgagccgcgc ggaattagcc aggaagctgg    289500
     gcatgaatcg ctcgtcgtcc ggtgagatag tcagcgacct taccagcggc gggtacattc    289560
     gcgaggcaga cgatgtctcg cgtgccggag gcttgcagtc ccgcgcgggc cgccccggca    289620
     tcatgctaga gataattccg gacgcggcgt acttcgtcgg agtcgaactt ggtgtcgagc    289680
     acatttcaac tgccgtcatc gacttgactg gcgatgtccg tgcgtgccga aagattgcct    289740
     ttgatactcc ctcgtcttca cctgaagagg caatgaaacg cggcgtcgac cttgcgttgg    289800
     acgcaatgcc aaaagacatg gtcgctcgtt gccgcggact tggaatctcg acgcccgcgc    289860
     atatacgctc cgatggcgta gtcagtctgg cgcctatcat cgggtggcgc gatatccccc    289920
     ttgccgatct cggccgctcg gtgtttccgg ccaacgttcc gatcgttatc gagaacgacg    289980
     cgaatgcctt tgccatcggc gacagttaca ggcacgggac atccggtgtc accctcttcc    290040
     tcttaatgga gactggcgtc ggtggcggca tcatgatcga tggcaagctc tttcgaggcg    290100
     gccacgggct ggctggggag atcgggcata ccctggtgcc cggcagcggc ggtcagaagt    290160
     tcgagcagct cataggtcga gaactcattt tgcgtcagta ccgggaagcg actggccgag    290220
     ctgacgcgga actgcaagag ttgatcgacg aggttcggga ccgtgtaccg gatgccgtca    290280
     acattgctga aaaatggtcc cgtcaccttg catatgcgct tctgcaggcg tgtcgcctga    290340
     tcgatccgga caggatcgtt ctcggcggtt ccgtagcctc cctttatcca atggtcgccg    290400
     cccgtgtcgc atcacatatg gcagaaggac aagtcatcgc gtttccgtcg cccgatatcg    290460
     tcgtcgacga cgacgctgac ttcggatcgg cattcggtgc agcctgcatt ttgcaccagc    290520
     gtttcctgtc gctcgagaac gaagaattcg gtggagacga cagcatccct tcaccctcat    290580
     catatccata gagagaacga aaatgaccgc cactcccgca ctcgctcccg acagactcgg    290640
     accgacagta tgtgtcggtg aaatcctcgt ggagatagtg gccacgacgc cgggagatgg    290700
     tttcttggac gcccagcctc tggtcggacc atttccgagc ggggcgccag cgatctttat    290760
     ttcccagtgc ggacgttttg gcggatccgc ggctatggtc ggcgcggttg gtgacgatga    290820
     cttcggccga gtgaacaccg agcgtctcag ccgggatgga gtcgatgttt cctgcattga    290880
     agtcgattcc gactatccga cagggaccgc attcgtacgc tatcgccgtg acggagctcg    290940
     cgacttcgtc ttcaacatcg cgaaatcagc cgcagcccgg tttgaatgga cacagcaggt    291000
     agaagaactg ttcaagcgca gcggacacct gcacgtgatg ggttcagccc tctccgtacc    291060
     aaacgcaagc actgtgatcg agcgggccat tgaactcgtc aaggcacgcg gcggctccgt    291120
     ttctgtcgat ccgaacgtcc gaaaagaact gaaactcgac gaggaaacaa gccgccgctt    291180
     cgaacgggtc gtcgccgccg cggatctcct gcttccgtcc ggcgaggagc tggaacgcgc    291240
     tgctggcgtt gagggtgaag acaatgcaat tcggcgcctt ctcgaaatcg gcgtgaaaga    291300
     aatcgttctg aagcgcggct ccgaaggtgc aacctatttc ggtcgggatg gcgtgcgtgt    291360
     cgatgttccc gcttttgtcg tcgaggaaat cgaccctact ggagccggag actgctttgg    291420
     tggcgcgtat cttactgctc gccgccttgg actggaacca gcagaagcgc tcgtctacgg    291480
     aaacgccgcc ggagcgcgca acgtcactgt ccgcggcccc atggagggcg cgggcactcg    291540
     ggcggagctc gacgccttca tcgattcaac ggaaaggcgg gcgtgatgtc tgtgaatctc    291600
     tccgaactcg ctcgaaacag aaccgcgggc ggccctgcaa ttggtgttac atccgtctgc    291660
     tccgcgcatc cgttggtgct tcgcgcggcc ttgcgatacg gacgcgataa aagcagcacg    291720
     gttctgatcg aagcgacttg caaccaggtg aaccacctcg gtggctacac cgggatgacc    291780
     ccatccgact tcgcggcgct cgtcttcgag attgcggacg acgaacaatg ccctcgcgag    291840
     ctcattgtac tggggggcga ccaccttggc cccaatccct ggcgggacct ccccgccgaa    291900
     gcggccctgg ctgaggcgat gaaaatggtc agcgcatatg tcgaggccgg atttcgaaaa    291960
     atccatcttg acgcttcgat gggctgcaag ggcgagcccg cagcactgga cgacgagacg    292020
     actgcacacc gtgcggcccg cctcgcctct gcagccgaag aggccgcgag cagagttggt    292080
     ggtggcaagc cgatatacat catcggcact gaggttccgc cgcccggagg cgcggatcat    292140
     gctctgagcg ctatcgagcc taccgcggcc tcggcagctc gcaagacaat cgatgtccat    292200
     cgcaaagtat ttgcggatgc aggccttggt gatgccttca ctcgcgccat cggactcgtg    292260
     gtgcagccgg gcgtcgagtt cggcaaccat aacgtgatcg tctacaaccg cagtagaatc    292320
     gatgatctca gagcagtgct cgacgctgaa ccacagtttg tcttcgaagc gcactccacc    292380
     gattaccaag gcgggaagcc gctaagggag ttggtggagg atggttttcc gatcctgaag    292440
     gtcggaccgg aactgacatt tgtccttcgg gaagcgctct atgctctgga cctgatcgca    292500
     tcagaccttc tgcccgcgta tggacagcgt ccactgtatt ccgccatgga agctctgctc    292560
     atcgcgcagc catcgaactg gagtcgccac taccacggaa ccgacgctga aaaacgttgg    292620
     cttcgacact actccctttc ggatcgcatc cgatactatt gggcgacgcc ggaagcacgc    292680
     gacgccgtag gctttctctt tgaaagcctg gagggtgtga cgatcccaat gccgctaatg    292740
     tggcagcaca tgccagcggc catgtctttc gctgacgcgc cactcactcc cgaagaactg    292800
     gttatgtggc ggatcactaa aagcctagcg gactacgact acgggtgtac cggaagtgtg    292860
     cacgacgtcg ctgattgacc ttaacttttc taacgatcca aggaggaaga aatgcagcat    292920
     ctaactggca aggttgccgc tgtaacagga gcggcatcgg gaatcggtct cgcatcgacg    292980
     gaagccctca tcgccgaagg cgcgaccgtc gtattggtcg atcgtgacga gaaagccctt    293040
     ggggctgtct gcgcccggct gggcgaacga gcggttccgc tcacgctgga cctgcttaac    293100
     cccgaaaagt gtgctggcct gctcgacggc atcctgagca aggctgggaa gctcgatatc    293160
     ttccatgcga acgccggaac ctacatcggc ggcgatctcg tggacgcgaa cctcgatgcc    293220
     attgatcgaa tgctcaatct caacgttaac gtcgttatga agaacgtccg cagcgtcatt    293280
     ccacacatga tcgagcgcgg cagcggcgac atcatcatta cgagctccgt cgccggacac    293340
     accgcagtgc cgtgggagcc tgtctactcc gcctccaagt gggcgatgac ctccttcacc    293400
     caaactatgc gtcgccaact gctgaagagc ggcatccgag taggctcgat atcccccggt    293460
     cccgtcgtca gcgccctgct tgcggattgg ccagaagaaa acttgcgcaa agcgaaggaa    293520
     gccggcgcgc tcatcgagcc gaaggaggtc gcggacgcgg tggtcttcat gctgacgagg    293580
     cctcgcaacg tgaccattcg cgatatcgtg atcctaccaa gttcctttga catctgaggc    293640
     cgacagatgg cctacttgga aaagtttcgt cttgagggtg agcgagctgt ggtaactggc    293700
     ggcgggcggg gccatcggac tttgctgcgt tgaggcgctg gcggaagcgg gagcttccgt    293760
     cgtcgtcgtt gaacgatgcg aggccgacgc ccaagacgcg attaagctcc gcgacaaagg    293820
     ctatgatatc gaagtgcgga tcggtgacat caccgtcccc ggcaggatgg aagatatcgc    293880
     cagtgagctt gccgattctg gtcagcccgc gacaatcctc gtcaacaacg ccaggatcgg    293940
     gcagagcggc atcgcggccg aagacctgca ggacgccgac tggcttcgta tgatggatgt    294000
     caatgtgaac ggggttttct ggtgctcgcg tgcctttggc cgccacatgg tttccatggg    294060
     caagggcgcg attgtcaatc tcggctccat gtcgggtatc acatgcaaca ggccccagcc    294120
     acagacatcg tacaatgtcg cgaaagccgc ggtgcatcat ctcacgcggt ctctggctgc    294180
     cgaatgggca cagcacggta tagagtgaac gctgtcgctc cgacctacat cgagaccccg    294240
     atggtggcgg tagtcgaagc gaacaaggcc cgtattccga tctggctggc ggatacgccg    294300
     atgggcagaa tgggcatgcc cgaggaagtt gccagtgctg tcctcttcct ggcatcgcca    294360
     gccgcaagtc tgatgaccgg gtcgatcgtt accgtcgatg gcggtttcac gtgctggtaa    294420
     gctggatctt ctggggccct cacacgcgtc agggccccag aagccagcga tctcttgccg    294480
     accgaacggg cgatgccact tagtctcagg ggcaacacac gacgtatcaa acgaacgata    294540
     tctgtcattc ggctgcatac ctttgcgatc gttgcgatgg cggcttgtgg gtacgccttt    294600
     accgtccagg acacagctgc atcgaacgcc gagagtcaga cgcgctttct tcaaggcctt    294660
     gttgcgggga tcggcttcat cggaggcggc gtgattatat tatgcggcgt gattatatta    294720
     taaagaatag agccaacctg agaggcgtgg tcacgaccgc cagcatcagg aacacgagtg    294780
     cgataggcgc tgccatcgct ttccagcgcg aggagatcac aatggtactg agcgcgatca    294840
     atttcctcac actcttggtc ttccacgccg caaggagata agcaacaaaa attggaacgc    294900
     gaattcgggg cgcatccact gccccctaaa tttggtgaac caacaagcca ccggagaatg    294960
     agctcgcaat caaacgttgg tagtcttgta cggcctgccg cccaggaaga gtagcgctgt    295020
     tcgtatgagt tatgaccacg actgatgccc cagcagcttc cgcagcatgt attcccgtat    295080
     cagcatcttc gaaaacaagg catcgagcgg gatcgacaga gagaagcttg gtgccggcaa    295140
     ggaacgggtc cggctttggc tttcctttgg tcacgtcttc cgcagcaatg atggcctccg    295200
     gtctaggcaa tccggctgca gcgatacgcc taagcgcgag ttccattggc gcagacgtta    295260
     cgaccgccca cttgccgcta gggagcgcct gcaggaactc gatcgctcct gggataggaa    295320
     caacgccgtc aaggtccgca agctcgcgct cggtaatctc agccgccgcc ttctcccgat    295380
     cgatgccgaa gcttcggaga tcagccatgg tgtcttcaac ccggtgacca tgatagggag    295440
     gggtcggaat cccgttctcc tcggcccacc tgccccaaac tcgttcggac gcagcgctgg    295500
     agtctagtag cgttccgtcc atgtcgaaca ggaacgcatc aaaagatttg gattcgatcg    295560
     gatcgtacaa cgacagtgtc tctcttagct gatttttgag gaattgcgaa aagctgtaga    295620
     ctactgaagc gcgagctttg acagcccacg gtaaggagta ttcgttcaaa tggtgatagg    295680
     caccgcatcg actccgcctg aaaacagtct ttggtgcatc aggcaggcag cgccataagc    295740
     ggctccctcg ccccctcgcc ccgacacctc gatgcggggc ttaggaagcc cttgaatcaa    295800
     ggccacatcc aggtagtggt cgacttggct ggcaacatgg ttatagatcg gcgcaaccga    295860
     gccccccagc acaatgaccg cgggatcgaa gaacttgatg atttgcgcga ccccatagct    295920
     caatgcgtca gcccaaattg tggcagcctt gacggcgcca tcgtgcttcg ccgctatcga    295980
     ggaaagcaaa tgatcgagat ctcgcggacc gccaaactct tcgtaaagat cgagcaccgc    296040
     gtccttaccg atgagcgttt ccagttcacc agagatacca cgccggacct gccgctgcgg    296100
     cagggaaacg gagagatgtc cgaattcacc agcgaaacca tgcgcgcctc gaaataggtg    296160
     accgccgatg acaatcgctc cgcctacccc gttttcgata ttgagataaa gcgtaggagg    296220
     tctgtgggtg cttccggcga catagctttc acctatcgca aaggcgttcg cgtcgttctc    296280
     ggacaccact tcaatcggga acggaagctt gtcctgcagc attcgagtca ccggaacatc    296340
     tcgccatccg agcattggcg cattgcgaac cacgccgtct gtgtccagga gcgccggaag    296400
     ggtgagacac gtcccgcgca ggcgggcaac gcgtttcgct ggtactattt ccgcggcaag    296460
     ttcggccgct ctggccatca cggcactcgg accgagggaa gcgcagtcaa attgaactga    296520
     ttttcgcgaa accacgttgg cggagagatc gatcaaaact gcgctcaacc gatcgattcc    296580
     gatctcgatg ccaaggaaga aagcgccctc ttcagagagt ttgacaagta taccggggcg    296640
     tcccgttcgc ccctcgtcgg cagggcgtat cgattccgca ccttcgtcga ccagcccttg    296700
     agacatcagc gaggcaacga tgttaccgat cgaggaacgg ttaagaccga cattacgggc    296760
     aaggtctgcc ctgctcatcc cgcctttggc gaacaagacg ttgagagcat cgatttcgtt    296820
     gcgaattctt atcgtctgcg gcttgttcat ctgaccttcc agtaggagga cgcttcggaa    296880
     agcgtcctcc tgagtcaatt tagttgccag ccaggacctt gtcgacattg tcggaagtca    296940
     cggcaagcca cggaacgtag tagtgttctt ccttgccgcc attccacgcg agcttaccac    297000
     cattcgtgtc ccagaccttt gcacgcggct tgtaggtgtc gccgacgagc ttgctcagag    297060
     cgagatcaat cgcgccctgc gactgtccgc ttgcgtcctg aaggatggac atggtctgct    297120
     cgccgcgctt cacggcttca agcgcatcct tgataccatc gacgcctgct actggaagct    297180
     tcttcgggtc caagccatga ttgcggatgc cttcaatcgc gccgaccgcc atctcgtcgt    297240
     tctcggctag gacgccctgg acctgatcac cgtgagaagt gagaaagttt tccatcaaag    297300
     tgattgcttc cgcgcgcgac cagttcgccg tgttctgctc aaggatggtg acgcccgagt    297360
     tctgcttgag cacgttgttg atgccctcaa ggcgctgaac ctgtgctgac tgaccaagca    297420
     tgccctccaa gacgaccacc ttggcgtcct tgcctgcctt gtcgatcaca gcctttgcca    297480
     acatctcgcc cgcttcgacg tcgttggagt tgatgtaggc atcatagagc tcggtcttcg    297540
     acactacagt gttcgaacca aagaccggaa tgccggcggc tttcgcgcgt tcgatcggct    297600
     cgttgcccgc atcgatatcg accgggatga agatgatagc atcgtatttc tcagtgatcg    297660
     cagtgtcgaa cagattggac tgcgtcagca cgtcttggcg accgtcgagg acagtgagtg    297720
     tcgctgtgcc gtcagcaaga gccgggtgag actttgcagc atcggcccaa aggacgttgt    297780
     actctgtgtt caggctttgc acgatcgctg cgatcttgaa tgtctttgcg taggccgggg    297840
     cgcctgtaag cgcggtaccg agaaggcaaa ggacggtcgt cgcgcccagc agggcacgtt    297900
     tggtcatgtt cattttggac ttcctccact attggcgcgg cactcgccgc gccttcaaga    297960
     caagctgcta ttcgccccga gatctggagc ggtcgatcag caccgcgagg acgatgatcg    298020
     aacccttgat gatctgctgg taatacgaag acacacccat cagatcgaga ccgttgctga    298080
     tcatgccgat gatcagcacc cctacgagcg tgtagccgat acggccgacg ccacccgtga    298140
     gacttgttcc gccaataacc accgccgcga ttgcatcgag ctcatagccg atgcctgcct    298200
     gtggcagagc ggacgtcgtg cgcgccgtga gcatgacacc tgcaagtcct gccaacgcgc    298260
     ccatgatgac gtaaacggaa aagatgatcc cagaggtgtt gataccactg gtcttggcgc    298320
     tacgcggatt accgccgact gcgtaaatac ggcgtccgta gatcgagtag cggagcacca    298380
     cggccgagat cgcgaaaacg atggcgaaga tgatgactgg cactggcatg ccgaagagga    298440
     gaccttggcc tagccagcgg aaatctgtgc tgagattcgg gatcggtcgg ccgccgctga    298500
     aaagcaaagt tgcgccacga gccacactta gcatccccag ggttgttacg aacgccggaa    298560
     ccctgaagtg agcggtcagc gtgccgttca ctacgccgca gatcgcaccg acccctaagc    298620
     cagctacaac cccgacgaat ggattcaatg cgtccggtcc ggtgacgaga ctcgccgcaa    298680
     cagcccctga gagcgcaagt atggagccga tcgataggtc gatgcctgct gtcaggatga    298740
     cgaaggtcat accaactgca agcaccccgt tgattgaaac ctgccgcaga acgttcaaga    298800
     gattgtttgc agacaggaag ttcggtgacg ccaccgaaag aatgacgaac agaagaacaa    298860
     acgagatcac gatgccgtag cgtgcgattg tcgacgccac gttcccatcc cgtttagcaa    298920
     gagtagcggt ggtcattgat ttctcctcca cgacctgacg tccgacttac gacgccagat    298980
     ggactagggt ttcctgggtg gcgtccggtc cggacacctc gcccgcaata cggccacgct    299040
     ggaacacgat gatacggtcg gcgttgctga ggatttcggg aatttcggac gagatcatga    299100
     ggacggcatt cccgcgttgt acgaagttct cgagaaatgc gtagatctct cgttttgccc    299160
     cctcgtcgac gccgcgtgtg ggctcgtcgc agatcaaaac tctgggattc gtgtcgacgc    299220
     aacgggccag aactactttc tgctggttgc cgccgctcaa ggattggacg ggcaggtccg    299280
     gcgaagccgt cttgatggaa aaccgcttca cgtgcccgcc gacgctcttc gcctcttcgg    299340
     cccgatccat gaagccgcgc ctcgcgtagt gcgggaggtt ggcgacggtg atgttgtggg    299400
     ctaccgacgc agtcagcgag aggcctgtct gtttgcggtc ctcggtgacc agcgagatac    299460
     ctgcgcggat tgaatccgct ggcgtcttca ggtcagcagg ctgtccgtcg ataaggattt    299520
     cgccgctgtc gcgtttctcg gtcccgtaga gggcattgac gaactcgctg cggcccgaac    299580
     ccagcagacc gtagagacca acgatctccc ctgcgtgcaa ggtaacgtcg atatcgctga    299640
     acttccctcc agacgagaac ccgcgtgctt ccaagagcgg cttggcgtta tcgaacgatt    299700
     tcgcctcgcg acggtgatcg agaagatcgc gcccgactat tgagcggatc aaacctttcc    299760
     tgtctatctg tgaaatcgcg ccaccttcta cataccgacc gtcgcggaat accgtgtagt    299820
     catcggcgat ctcgaaaatc tccgtgagac gatgcgaaac gtagacgatc ccgacgccgt    299880
     cggcggtcaa tctccggatc gcgtcgaaga gcatctgggt ctcgcgctct ccaatcgctg    299940
     acgtgggctc atccatgatc agaatgtcgc tcttgcggct gatcgccttg gtgatctcca    300000
     caagctgaga ctgcgctaca gaaaggtccc ttaagcgcgc gtgggcaggt atatcgaacc    300060
     tcagccgcgc caatatctct tccgcatccg cgatcatctt ccgatcatcg acgaagaacc    300120
     gaccccggcg ctgctcccgt ccgagataga ggttctcagc gaccgtcatg tccaggaaag    300180
     ggctgagttc ctgcgtgatg atggcaatgc cgttatccaa cgcatcagag ggagttgcga    300240
     aatcgacttc cgtacccttt atagccaccg ttccggcgtc gcgccgaaga agccccatga    300300
     gtatgccgag gaaggtcgac tttccggcgc cgttgccgcc acaaagtgcg tttactgtcc    300360
     cagcgcgaag tgcgatctgg ccgtcgataa gggcggcaac cttgttgaaa ctcttcgtga    300420
     cgtccgaggc ccgcaggaga gtgtgtgcag cgccctcgcc aggaattacc tggctggctt    300480
     cgatcgtttc catgcttcct cccacaaatt ctcgttcgcc gaaaccgagc ggattagccg    300540
     atctcgtcgt ggatttgtca ttcatcgttg actgcggagg acgtccttta gtctccccgc    300600
     attgaatccg ggtgtcgtgt accgatcacc ctctcttcat aatatatttg tatgttgtca    300660
     caacaaacaa acatgtcaac taaatttacg ctcgaccttg ggttttcgac tggcaacggg    300720
     gcatacggcg gccgacacca gcacctagac gagtgctgat gttcgacgtc gatagcattt    300780
     ggacaaaggt tttcccgggc atttgacgag cagccacgca tgacgtgccg aaacgatacg    300840
     ggactgaggc gcgaaatgga acctggcccc aagctttgga cgacttaaag aagcgagtca    300900
     tccgggcttt ggtgcatcga tcgtggcgta aagggatttc gctctttgat gttgcggcta    300960
     tgtcgtgcct gctttgcacc ggacagattt cgggcgtgcg catgccagca tgcgattgag    301020
     gacggcgcag ccgatggcag cttccgtttg ctgcgcgccg aatgagcgtg cccgtagtca    301080
     gtgtccgatg atcgacttgt agcgaccgat cgcagtcgag gcgagcgccc gcttgccata    301140
     gccggtcgca gcttgccatt tcatcctccc attgatgttg attgccgcga tgtgtcgatc    301200
     gcgctggctg gacggatcgg cgcccggccg ctccaccgcg ttggcccgag gtggaatgac    301260
     aacggcagca tgggcgctgt gcctggcaac gccatcgtac gtcgggctgc cgtcatgtgc    301320
     accatccgcc gtgaactgac ggataggtgc gtcaatctgg tcgagcaacg gctctacctg    301380
     cgaggcgtcg ctggtatcct ggtccgtcat gacgtgagcg atgatatcgc cactgtcggc    301440
     atccagcgcc aagtgtagtt tacgccagcc ccgccgggat ttggcaccgt gcttttgctc    301500
     caaccactgg cccgcgccgt agatcttgag ccccgtgctg tcgatgaaga cgtgaacggg    301560
     ccccttgatg tgagcgctgc ggctttcccg gcttctcggc catcgctgtt tgtttgcccg    301620
     acggctcagc gtcgtatgat cgggaacggc gagatccagt cccatcaact gcaacaccga    301680
     tgccagaagg ccttccgtct ggcgcagatg caggccgaac actattcccg gcatcagagt    301740
     agtctctatc gccagatccg agtagcgcgg ctgcccacca cgcgtcgtcc gcttcgccgc    301800
     ttgccacgcc gacaccgcgt cctgcgtcat ccatagcgtc agacttcctc ggcggcgaag    301860
     tccggcctcg tattcagccc agttcggaac cttgaacttc accttgctga tatgatgacg    301920
     gcggacggca ttgtgtttaa aaggcatcgt cgctggagac cggttattgc gctggccgaa    301980
     cccctacgcc aacgccatta acgatccgcg cacaaaggct ccttcatgcc acaacgcgat    302040
     gctctgatgc cgtggcgccg gatcatcgac aacgccaccc ttggcctgga ggttcaagga    302100
     gcgagcagag cggaagcacg gaagcgcgtg ctgccactgc tcgaccagtt cggcctcaag    302160
     gggtttgaga accattaccc tgcacaattg tccggcggca tgcgacaacg tgtggcccta    302220
     ttgcgcacgg tggttcatga gcgaaagatg cttctgcttg atgaaccgtt cggtgccctc    302280
     gatgcgttga cccggacctc catgcaacgt tggctggaag gcatgtggga acgccatcga    302340
     tggaccgccc tcctaatcac acatgatatc cgcgaggcca tttacctgtc cgaccggatc    302400
     tacatgctgt ctcagcgtcc agcccaggtc gtgcgggaga tccgtgtgct tttaccccgc    302460
     cgccgaaatt tcagcgactt gaactctccc gcggcaacaa gaatcgaggc ggacctgctg    302520
     gaggctctga tcgggcctga taccgcggag cagtcgcccg tggcagacca ggattttgca    302580
     accccaatac caaccagaca ttattgaaag gacattgcat gttcgcccta acccgtcgca    302640
     gcgccctaat gctggccgtt tccactttcg ccacgatcac cgcaccttcc gccttcgctg    302700
     ccgatgtaaa agcggtaaaa gtagccctcg actggacgcc gaatacgaac cacatcggcc    302760
     tctacgtcgc tcaggccaag ggatatttca aggattctgg actggatgtg acgatcctgc    302820
     cctacacgga cgcagctgca ggcactctcg tcagcaatca ggtggccgac tttgggatcg    302880
     atgacatcgg tgcctacagc caacgcgctg ccggcgccga cgtcaaagcc gtctatgcca    302940
     tcgtccaggc cgagaccggc cgactgatcg gctccgccta ccgcactgat atcaagagcc    303000
     cgaaagatct cgacggactg acctatagcg gcttcggtag cgcttgagag aacacgctgg    303060
     tttccagcat catccagaat gcaggcggca agggcacttt caagaccatg acgctcggca    303120
     catccgccta tgaggccctc gctaatagat cggtggactt cacgctggaa atattgacct    303180
     gggagggtgt tcaagcggaa ctttccggtg caaagctcaa ggaattcaaa tacagcgact    303240
     tcggcgttcc cgagcaatac acgacggtga tcgtctccag cgatgcttac ctgaaaggca    303300
     atcccgatac cgcgaaggct ttcctcgccg ccgtgcggaa gggctatgct tttgccgccg    303360
     acattctcat tgccgccaat ccggatgtat tgaccgaccg agccctggtt catgcttcgt    303420
     ctaagctgct ctcggacgaa cactaccttc gcggccaaga tggcgcgatc ggcacattcg    303480
     accgaaacaa ggtagctgcc gttggtgact atctcttcaa ggcaggcatc ctgctcgatc    303540
     aaaatggcaa gccgctcacc accgagcccg acttttcaac ctatgttagc aacgactacc    303600
     tgccggtgaa ttgatatcga taggggcttg cggcttcttg cttgcctttc ttacgaaatg    303660
     tcctcagctt cccgtcctta ccgaagacgg atgctgcgga tatttaagcc caagattttc    303720
     tctgagcgtc cgtccctcgt attcattccg gaagcgacct cggcggcgca attcaggcaa    303780
     gaccagctct atgaaatccc caaggccgcc cggcgcgatg ggaggcatga tgttgaagcc    303840
     gtcggcgccg taattgtcga agcgctcctc catcacgtcg gcaatgtatg ccggcgtgcc    303900
     tacaacctgc cagtgaccac gggcgccggc gatgcggagg taaagctggc ggatggtaag    303960
     tttttcacga cgcgccagat cgataataag agcctggcgg cttttggtgc cgttggtttc    304020
     gggaagatct ggaaacggcc cgtcgatcgg atagcccgac agatcgaagc cacccgagaa    304080
     ccgggacaac agatcaaggc ccacttctgg ctggatgagt tcctgcaaag cctcgaactt    304140
     ctcttccgcc tccgactggg tacgtccgac gaccgggaaa actccaggaa ggatcttgag    304200
     atcgtcgtcg gaccgaccgt attttttcaa acgacccttc acatcggcat agtaactcgc    304260
     cgcctcttcg agggtcagtt gcgccgcgaa gaccacatcg gccgttcgag cggccagctc    304320
     tctccccgcc tccgacgcac ccgcctgaac caatacggga tgtccttgcg gtgatcgggg    304380
     aacgttcagt ggtccgcgta cgttgaaatg acggccctta tgatcgagca aatgaacctt    304440
     gtctgcgtgg aaatagtgtc cagcctccct gtcgcggata aaggcatcgt cttcccagct    304500
     attccaaagc ccgacgacga catccgcaaa ctcctccgcg cggtcgtagc gatcagcatg    304560
     caggatctgc ccttccccgc caaaattaag cgcggccttc ggatccggcg aggtgacgag    304620
     attccagccg gcccggccac cgcttaagcg atcgagcgaa gcgaattgac gggcaaggtt    304680
     gaacggttct gtgaagctcg ccgatgccgt ggcaatcaaa ccgatattgc tcgtcaccgc    304740
     cgccaaggcc gaaagcagcg tgatcggttc gaagggatag accccgctgt gggcctttcg    304800
     gctggcagcc tccagattct ccagccgcac ttcaaggcta tcggcgagga acaccgcgtc    304860
     gaactttgca tcctcggcca gccgagcaag ttggatgtaa tcggaaagct cagtattctg    304920
     aatggatgca ggatgccgcc atgcgccaac gtggtggccg gtaaacagca gaaaggcacc    304980
     gagcttaaat tggtctctac gctttgccat caatatctcg ctaaggtctt gcgggggtct    305040
     tcggctggtt gcggcggctg caacaccgcg tccagcaact gacgtgtgta gggatgtttg    305100
     ggacgggcga agatcgtcgg gctgtcagcc tcttcaacga tcatcccgcc cttcagcaca    305160
     atggtccggt cgcaaatgtt gctgacgacg ttgagatcat ggctgatgaa cagatagctc    305220
     atctcaagat cccgcctgag ctcagcgagc agacccagaa ttgaggcctg aatggaaacg    305280
     tccagcgatg ccgtcggctc gtcgagaatg agcagaagcg gctccacagc aatggcacgc    305340
     gcaataccca cgcgggcttt ctggccgccc gacaactgat gcggcaaacg cgtaagcagc    305400
     gcacgcggca actgcacctg gtcggccagc ttttcaacgc gttcacgcag agcttcaccc    305460
     ttgaggccct tgagacgcct catcggatcg gcaatggtcg cgaagaccga catatgcggc    305520
     ggcaagctgt cggtcggatc ctggaaaacc aactggatgc cggcccggta tggggatcga    305580
     tggaaatctc gagccggaat agtaccaata tcggcgccac cgaaatcgat cttcccagcg    305640
     gtagggtcgg caagccgcgc gacgagcctg gctatcgtgc tcttgcccga tcccgattca    305700
     ccgacgagac caacactctc gttctgaccg accgcaaacg aaacatcccc gacggcggta    305760
     cgtccagaga agtccttacc gagatcctga accctgagaa gcggagtctc tgctctcgcg    305820
     atcgctgcct ctacgaccag gagttttggc gtggcctcta ttagagtcct ggtataggcg    305880
     tgactgggtg ctgaaaagat ttcttgcgtg gaaccggctt caaccacttt gccatgccgc    305940
     atgaccgcga tcctgtcgca atagtttcca gcaagtgcca gatcatgcgt gatcaggatg    306000
     agtgccattc cccgctcaac aacgatctcg ttcagcagct tcatcaccgc cttctgggtg    306060
     gtcacatcaa gcccagtggt cggctcgtcg gcgatgagca attgcggctc gcatgcaatg    306120
     gccatggcta tcatcgctcg ttggcacatg ccgccggaga gttgatgtgg ataggcccga    306180
     gcctgcttga tcggatcgct aaagtgcacg gattcgagaa gttcaactgc ccgctcaagc    306240
     gcctcctgtc gcttcatttt acgatgtgac aggatcgcat cagcaatctg ctcgccgatc    306300
     cgcattatgg ggttgagtgc tgctcttgca ttctggaata cggccgagac gacggtacca    306360
     cgaacctgac gaagccttcg ttccgacgta tgaacgatgt cttcgccgtt gatcaggatg    306420
     cttccgcccg tcacaagcgc gctggacgga agcagcccga gcacggccat tgcggccgtc    306480
     gtcttgcccg agccgctttc tcccacaatg ccgagctttt ccccacgctc gacggtaagc    306540
     gataggtcgg acaggcccac cgcagatccg cgcggtgtgg aaaattgaag cgtcaggtca    306600
     cttattgtca gcagcggcat ggtcattggc gcttccgtgg atcgaggaag tcacgcatcg    306660
     cgtcaccgag caggttgaaa ctcagtacgg caagcatcaa cgccgcgcct ggaaatgcca    306720
     ccagccacca attgccgctc ggaatatatt gggcgccctc ggcaaccatg atgccccact    306780
     ccggtgtcgg cggctgaacg cccaatccga ggaaggaaag ggcggcggcg ttgagaatgg    306840
     cccagcccag attgatggaa atctgaacca tcatcactgg caaaatattc ggcatcagga    306900
     agaataggat gatccggacg cggccattgc cggaaaggcg ggccgcctcg acccagccgg    306960
     cgtctcgccg cgcattgacc tcggagcgag caacccgaac gtagaagggc agattgatcg    307020
     cggccgtagc atagataatg ttcgcaactc cggttccaac cgcggcgatc agcaacatgg    307080
     cgaggacgaa aagcgggaaa gccatcagca tgtccaccac ccgcccgacc agcttatccg    307140
     gccagccgcc caaataaccg acaaacgcac caacgaccga cccgatgaga aaggaaagca    307200
     ggacagccga catcgcgatc agcatatcga gccgcgtggc gaccagaagc cgcgatagaa    307260
     catcgcgacc aatctgatcg gtgccagccc aatgttgcca actgggcggc tgaagcgtat    307320
     cggtgacgct cgactgcaac gggttgtaag gcgcgatgga aggaccgaag atcgcaacaa    307380
     acacaagcaa tgcaacgcac aaaccggcca actgagtggt cgtgccgatc gaactcatga    307440
     cccttctttg ttcttcaatg acgctcatga cagcgatacc cgtggatcac tgagactggc    307500
     gaggatgtcg atgatgaggt ttacgagcag gtagagtatt gcgaccaaca ggacaaatcc    307560
     ctgtacgggt gcatagtcgc ccgccatcaa tgcatcgacc gcataggcag aaatgccagg    307620
     ccacgcgaag actttctcga tgacgacgct gccaccgata agcgcggaga tcgtcgtgct    307680
     gagaacagca agtaccggca acaacgcatt ccgaaggccg tagacaaaca caatacgtga    307740
     tgaggataga ccgagggacc tagccgttcg gatgaagtcg ctgttcatga ctgcgagcat    307800
     agaggcacgc gtgatacgcg cgagaggcgg gaccgcgaag aatgtcagtg tcaaaacagg    307860
     caatattaac tggttgagcg cggcggcgaa ggcctccaaa tctctggcaa gaaaagcgtc    307920
     gatgagaatg aagccggtca ctgcgggcgg cgcgaccacg aacatatcga gcctccccgt    307980
     cggagctgga gcccaaccgg cgagataata aaagaaatag atcagcagga gaccggtgac    308040
     aaaggcgggc aggcttatcc agaccgtaca gatgagacga acgacgtgat cgatccatga    308100
     atctggctta agggcggcga tggtccccag aactacgccg atcaccaccg ccaccatgaa    308160
     gcttgggaca ataagttcga gggaagcagg cagccggtcg gcgagatccg ccagcacagg    308220
     tctaccagtc aacaaggagc gaccaagatt gcctttgctg agatccacca ggtagaggcc    308280
     gaattgctcc ggcagcgagc gatctagccc caattgttgt cgaagcgccg caatttcttg    308340
     ctcccccgcc gccggcgaag aagcaaacaa tgcggccgga tcacccggta gcacgcgcag    308400
     caccacgaag atcagcacga gaattccgaa caatgccggc agggccatca gaagccgatg    308460
     caggatcatg cgccatggtc cgttcgtgat catctcggat gccgctttca actcgtccgc    308520
     gcaaggtcgc gcggatccac caaattgtgg aaccatgtgg tgaacccccc aatggacgcg    308580
     gcagtgacca cttcctgggt aggccgccaa agcaagatcg cgggcgcctc ttggtacacg    308640
     aggctgatca gcctctttgc gtaagctgca tatttctccg gatcggtttc gaagcgggcc    308700
     ttgggcaaga tctctgaaac ctccgcattg tcccattgcg acaggttcca acgctggccg    308760
     cccaggaaga agatgcggaa gaagtagtcc gcagccggaa acattgaaaa ggaacggtcg    308820
     atcatcagcg gcaagcgctt gttgctggtg gcctcagccc attgcgcgtc cggaagcggc    308880
     tcgatttcaa tggtaatgcc gaccttggcc agagcttcct gcaggagcgc ggctggcgaa    308940
     gcggcaaaag ccgccttgtt ggtattgtag tgaagcttgg tggtgaagcc gttcggataa    309000
     ccggccgcgg ccagctggcg cttggcttcc tccacgtcag tcctccacgg cagggcctgt    309060
     ggataatcgg ccgtatccgg ctccttttcc cacttggcgc cgaatagcgg tgcgccttga    309120
     ccggatgcgc cgatggcaaa gagaacgtcg tacggcaccg ccagagagat cgccttgcgc    309180
     actctcacat catcaaaagg ggcctgcttg gtattgaaga taagataagc gataccgcct    309240
     ggcataggct cggcaatcgt cttgaccgcc tcgttttttc gtaaggtcgc aaaggtttca    309300
     ggcagcaggt tcagcgtgat atcggcatca ccacgcgaaa tcaggttggc gcgtgtcgcg    309360
     gcctccggaa tcgtctggat gatgaccctg ggaaaggccg gcaacgtgct gctcttccaa    309420
     ccatcgtgcc gtaccagaac cagttgttgg ccctgcttgt agctctggac tttgtaggcc    309480
     ccgccgccgg cggtattgtt ttgaagccaa gcttcgcccc aaggctgatc agccggaacg    309540
     ttttcacgaa cgagtttcga attgtagatc ggcgcgaaca tcgacgccaa attcggcaac    309600
     accaaccggt ccgctttttc cagtttgatt tggaatgtca atggatcgac gacagagaac    309660
     tgcttgggat ccgtaagcga accggtttgc agctgcgcgc ggcctgtgac gttggcaacg    309720
     actgcacggt cgagggacca cttcacatct tccgcggtca ccggccggcc atcatggaag    309780
     gtcgcttcgg accgcaagtg gaatgtatac gtcaagccat cctggctcac atcgtagcgc    309840
     tccgccagct caccgcgaat attgttgtag tcgaatacat agctgccctt gttgtcggtc    309900
     ggggcacgat cgaaacggac aagccggtca tatatgctcg ctccaagcac caccgaatcc    309960
     gccgacgcgc cgacgcctat tgggtcgagt gtgttgaatg cgccgccggt gatgtaccgc    310020
     agggtatcgt tgtgggattc cgcaagggca tggccgccgc tgcccagata tagaagcggc    310080
     aatgatgctc ctgctagttt gatgagattt ctcctgctca actcggtcat aagaaacaga    310140
     tccctctttc ggaaatttaa tgtgtaattg cagatgacgt gtgtgctggc gctccgtgat    310200
     tttgcagcgg aactggcagc ccgaaatggt cgcgcaatgt gcgacctgta tagtgcgtac    310260
     ggaaaatgcc cttggcgcgc agcagcggca caacctcgtc cacgaaggtc gttaagccgt    310320
     ccggcagcac atccggcatc aggttgaacc cgtcggccgc cccggctacg aaccaggctt    310380
     cgatatcatc ggcgatcgcc ttcggagttc ccaccaggaa acggtgaccg atactgcctc    310440
     caaggcggcg gataagctgc cgggcagtca gattgtccct acgcgcggct gtcagcgtgg    310500
     cacctgcaaa ggtgcggtca ccattggcgg gcatctcgat gtcgtctggc agcggcttgt    310560
     cgagatgcaa gcggccgacg tcaatcctga aaagaacggc caagcggtcg agcgcggtgt    310620
     tttccggata gagtccccag agctcctcct ctcggcgctt tacctctgtt tcggtcgagc    310680
     cgatcagggt tgacagacca ggcaggatca agatcgggcc gctgcgccca tagccaagta    310740
     cacgccggcg gacatcggcg gcgaactctg tcccctcgtc gatggtctgt gcgatcgaaa    310800
     agatcgcttc ggcgtgcttg gccgcgagat cgcgtccgtc gtcggaaccg cctgcctgca    310860
     gcaagaccgg atatccctgc tgcgagcgcg gcaagctcag agggccttgg acactgtaat    310920
     agtcgtcctt atgggcaatg ggatgaaccc ggtcggtatc gatgaagagg cccgtcgcct    310980
     tgtcgccgac gaaggcaccc tcctcccagc tatcccacag cttcttgacc acctgcgtga    311040
     atgcatccgc ccgttgatag cgttcatgat gggggggctg ttgatcgtaa ccgaaattgc    311100
     gggcggcaga agcgtctgcg gttgtgacca cattccaacc gcagcgtcca tggctggagt    311160
     gatccaggct cagtaggcgg cgcgccagat tgtagggatc attgaacgtc gtcgatgcgg    311220
     tggcaatgag cccgattttc tcggtgacga cggccatggc tgccagaacg actgtaggtt    311280
     ccagcgcttg gtaaggcctg gaacgtggca gacccgccat gaccggaata tcagccataa    311340
     agacagcatc aaacgttccg cgttcggcag tcctggcgat cgcgaggaag tggtcaatgt    311400
     caagaaaggc ggcgggatta cttgccgacg cccgccaagc cgcaccatgg aagcccgaat    311460
     taagggcgtt gacattcaga tggagttcac gcttggtcat gggcttccgc ttggttgatg    311520
     cggttcgatg tcgacatctc ccgcaagttg gtctgctgct tcttgccgca gatcgttcag    311580
     aagaagccgt tgtccggtag cggcgtgctg tgcaactcga gtgctccgac ggccagagcc    311640
     ttgtacgatg cggggttgtg ggaaataagc gtgcggatat tgcgccaatg tcgatcaaga    311700
     ttttctgcac ggctggttgc agacgcgccg ccgacgtcga atatcgagct ggcggcgcga    311760
     agggccagac cgtcgaccac gactttcgcc ttgcttgcgg ctagagctgc cgcatgcgcc    311820
     tcgtcatccg ctcgcttgcc gcttcccacg actgcatcga ccgcatcgag agcgtccgcc    311880
     gccgccagaa caatggcctc tgccgcaaag gcagcgctgg aaatttctcc cagcgtctga    311940
     agaaggatcg gatcttgcgt cggttccggc gtcggggcgt gggcaaaacc acgtttcctg    312000
     cgcgcgatga ggtccttggc ctcggcggcc gctgcgcgga caacgcccgc ggcgatcgcg    312060
     gtgacgataa gatgcccgag tgtcgtcgaa tatgcgggac gatacccttc ctccggcgcg    312120
     tccgggaaga tctcctcatc atgagcgacg acatccttga ggaaggtcga ccccgacccg    312180
     gtcagccgct ggccgatacc atcccaatcg tcttcgatcg tcactccctt ccgatcggtg    312240
     ggaagtatga ccgaagcttt gggaccgtct tcccacgcgg cgcgaacaag gatgtggtcc    312300
     gaatacaagc taccagtact gtaacacttg gcgccattga cccttaaacc cgacggctcc    312360
     cgggagatcg tcgtggacac cagtcccgca ccgacggtta cgcccagttc gcctgcggca    312420
     aggccgaaga tcgagccgcc agcgacaagc ttcgtccatt tctcgctgtt tgcgacgcgc    312480
     ggttgggcaa aaagctcgac gaaacaaaag tggttacgca ggatatgagc aacgttagga    312540
     tcggccgcag ccagctctac gacgaaggcc agcagctgcc tgaaacttgc acctgcccca    312600
     cctgcagaaa ggggcaggcg gatcgcgcct atcctgttct gccggatgag ggcgaccacg    312660
     tcaaagggaa gctgcctgtt gcggtcacgt tccgaggcac ccgctttgac gtgctcgaga    312720
     aaacgttcga gctccggcga attcaagaca acgggaagag gaaattctga gtgggcacgc    312780
     gcagcaaggg tcatcgctct atcaatcagc tttcgggtga cgactacctg cgccatgatc    312840
     cagggaaagc ctagcaaatt cattttaatt tctatagttt ttatggatta ttattggcga    312900
     cctccggatc gtatgcccgg tgtcgatacg tgacagttga tgtcgaacgt tctgctcatc    312960
     cagtggcact cacgcttgac ggcatattcg tgcagcgccg gatctggttg cgtattttcg    313020
     attacttacg cggcaggttt gagcgcgtgt cgcagtatcg gcgcttcccg ctggatataa    313080
     gcccatagtc gatttgaaat cggaccctgt ggttggtcgc ggcggcgcgc caccaccaat    313140
     tcctcggtcc ggcctggcag atgccggcca gcaatagatt gtaggcgtcc atcacgcagc    313200
     tcttcctcaa tcagaaaacc aggcatgtgg ccccatccca ggccttgcag gataatttcc    313260
     ttcttcattc cctggtcggg caccatgcat tgcggcgcac cttcgatcat gaagtaatcc    313320
     tgctgcgggg aatgacgagc cgtgtcgcgg atgacgcatt gagtgaacgt atgcatctga    313380
     tccggcgtga tcggctgctt gatgcgcttc ggcagaaagc ccggcgccac gacaggaatg    313440
     aagggcacgt tgcacaggtc aacccattcc gcccgtgagt cgctcttctc gacccaatgc    313500
     aggatcagat cggcttcacc gtcaatcaga cgctcccacg gccctcctac tgcttcgaag    313560
     tgcagatgca gacgcgtgcc ggggcactgg gcgaagaatc gcccgagcag ccccaacacc    313620
     tccggccgag gacacagatc gccgatcacg acatggatat cggtttcctc gcccattgat    313680
     aactgggcgg catgggcacg caagccttcc agttcgcgca acagcgattg tgcccggcgg    313740
     tggaatgata gtcccgcatc ggtagcgcgc acgcgatacc cgctacgatc cagaagaaca    313800
     aggccgagct gtcgctccag cttggcgacc gcggcgaaca ccgccgggtg ggagcgatgc    313860
     agcatggccg ccgcaggctg aaagccgccc gagcggacga cagcatcgaa gcattgcaga    313920
     tcgtgtagcg tgaattcggc catgtcagat ttttctacag agattgtccc atctttgtaa    313980
     tatcactaaa agcaccccac ggctacgatc tctctcatcg ttactccaaa atgaaagtct    314040
     cctctccatg actgagttga atttcgtaac cgtcggcgac ggcacccgca tcgcttatcg    314100
     tttcgatggc gatgccggca agccggtgct ggtgctgtca aactccatcg ccacaacgtt    314160
     gcatatgtgg gatgggcaga tcgaggattt gtcgaagcat ctccaagtgc tgcgatacga    314220
     ctttcgcggt catggcgggt caagtacacc ggccggagcc tattcgctcg accggcttgg    314280
     ccgcgatgtc atcgagatgc tcgatgcgct cggcgtcaaa cgcgcccact ttctcggctt    314340
     gtcactgggc ggcatggtcg gccaatggct cggcgtgcgc gcgcccgagc gcatcgatcg    314400
     cttggttctc tgcaacacct catcccatct cgggccggca agctatatcg aggagcggat    314460
     cgtcgcaacg ctgcaggcgc cggacatggc ccagaacgcc gaggcgttcc tggcaaactg    314520
     tttccccgcc gccatggtcg cggccaatgg ccccatcatc gaggaatttc gcgccatgct    314580
     gctgagtatt gatcggcagg gcctggcggg cctgttcgcg gcggtccgcg attccgacct    314640
     tcgccgcatc gtgacgctgg tctcgccgcc gaccctggtg atcgccggac ggtacgacac    314700
     ggtgacggct ctcagccaca gcgagcagat tgccgcgtcc gtacaaggcg cggagctggt    314760
     cgtgctgccg gcggtgcatc tttcgaatgt cgaatatccc gtcgagttca ttgaagccgt    314820
     gcttgacttc cttcgataat ccaacacgcg ataccgtgcg gtccactgtt caatcggggc    314880
     tttcggccaa tggccaagat gaaggtggcc gcacttcacg ccccgaatgg cgagcgcact    314940
     ctcgcgcagc tatcttctcg tgcagattct ctgcgccaca attggcgcca gcgtgacgct    315000
     cagccatgca cggccgtcga tcaggatcaa gcattctgac aatgctatcg cgaaccaccc    315060
     aggcacaaga tttggcgcga tcgtcgttgg cgagcgtttt accccaatgg gaaatgtcta    315120
     gtccggatat cggccgtcaa atgccctcaa acaataatca tcaaatgagt aaattgtttc    315180
     attcggagcg atatcattaa agtaatatac ctattctata gatttgaaat acataagttg    315240
     gaaatgcccg gggccaattg atcctcccaa tcgtcaatgc cccgggttgg ggacgtacac    315300
     tttcaggagc aatttcatgc aagctatttt taatgtgcgg cggcgcatca ccaccgctgc    315360
     agcagcaacg atgatcgcag ctgcgacatt gctgcctaac atggccaatg caggatcgac    315420
     attggacaaa atcaaggagc ggggcgtcat caaggttggt gttgggacga caccgggctt    315480
     ctttacaccg gacagcagcg gccgctggca gggcttcttc gtcgattttg gacgtgccct    315540
     ggctgtgacc attttcaaca acccggataa agtcgaattt accaactcgt cgccgcagca    315600
     gcgcctgcct gcacttcagg caggtgaatt cgacattctg ctctccggtg tcacggagac    315660
     catcacccgc gcattcaagc tcggcttcca cttcggtcca gttgtctttt acgacggcca    315720
     gggcctgttg gtacgcaagg atcttggcgt cacgaagggc gcggatctgg acggggcgac    315780
     gatcggcatt cagagcggaa cgaccggcga gctgaacatc gcagactttt tccgcaagac    315840
     cggtaagaag ttcactcctg taacgattga agaaaccgca gagttcacca aagcgctgga    315900
     ttcaggtcgt gtcgacgcac tgacgcagga ttcgacagac cttgcggcaa aacgtacgca    315960
     gcttaagaag ccggacgact atgtcttgct gcccgaacga ctttccaagg agccccttgc    316020
     acctgccatc cgcgcgggtg acgaccaatg gctggaaatc gtcaactgga cgatctacgc    316080
     gacgatccag gctgaggaat tcggtatcac caaagacaac gtcgatacct tcctcaaaag    316140
     tgacgatccc gccattcagc gcttcctcgg cgtcgatccc tctcttggtc aggcgattgg    316200
     tctcgatccg aaatttgcct acaacatcat caaggcggtc ggcaattacg gggagatatt    316260
     cgagcgcaat gtcggcaagg gtacgcccct caatttcgat cgcggtctta accagctctg    316320
     gacgaagggc ggtctgatct actcgccacc tttccgctga gccgggttca atgaatgagc    316380
     tgaggatgcg ttctcatccc atagggccgg gcttttcgaa gcgcggcctt cttcgccgtt    316440
     tgcgcctttg gctcggacct gcacccgcgg cgcaattcgc aattcttcta gtctgctgca    316500
     ctgtgctttg gtattttggc atcaacatag ccgccaccat gcgcagactt ggcattgaac    316560
     caggatttgc cttcttatcg cagcgcgcca attttgaaat cggcgagagc ctgatcgctt    316620
     attcttcagc agacagctat gggcgagccc tgcttgccgg gcttgtcaat actatctatg    316680
     tggccgtcct tggctgtatc ctgtctacgg cacttggcac cgcactcggc attgcgcagc    316740
     tcacccgcaa tctggtcctg acatccttcg ttcgctccta tgtggagatc tttcgcaaca    316800
     caccactgtt gctgcagctc tttctctgga gtgcgatctt tcaaaacctt ccggccgcca    316860
     ggaacgcaat aaaactagcc ggcgcctttc tcagcaatcg cggcctttac gttccaaaac    316920
     tcctcctggc tggggacgct ccggttgcga gcaccgcgct gtctgtcttg tgtggattga    316980
     tcgtggtgat cgcattgcga cgcctcctgc ttggcagacc cttttatgct acccagatca    317040
     gcttggcggc aatcattgct gcctcagcga ccttctggct ttcgggtggc ggcatcgatc    317100
     tcgacctgcc gacaaaaggc gggttcaaca tcactggcgg actatctctc agtccggaat    317160
     tcgcagggct gcttgccggt ttggtcttca attccgcagc gaccgttgct gagatcgtgc    317220
     gcggtggaat ccagtcggtg cagaacgggc aatgggaagc agcccgctcg cttggcctgc    317280
     gccccggtca tatcatgcgc ttgatcgttc tgccgcaagc attgcgggtg attacccctt    317340
     tgatgacgtc gagctatctc gatttgacga aaaattcgag cctggcggtg gcgatcggct    317400
     ttccagacct ggtgaatgtc gccaacacga ctgcgaatac gacgggacag acgcttgaag    317460
     cgattgcaat tatcgcaggg gcttatctgt cactcaatct cgccgtctcc ctagcaatga    317520
     atcttttcaa tagccgcatt gttcaaatag aaggtcgacg gtgatgagtg aattgcagat    317580
     cggcctgtct aaatggcggc ggcgacccgt tacaaagggc ctcctcgata accgatcgaa    317640
     cacgatcata acaatttgca gccttgcaat cctggtttgg atggtcaccc ccttgctgcg    317700
     ctgggcaggt cgcgccgcaa tatggagtgg caccggcagc gactgcagcg tcgaaggcgc    317760
     tggcgcatgc tgggcattta tcgccgcgaa gttcagattc attatttttg ggttttatcc    317820
     gcccgcgttg cagtggcggc cggcactcgc gatgttctgc atttgcgtgc tgctctctat    317880
     ctccgccaat ccgcgatact ggggctccaa gctcctgata tcctggcctg ttgttatcct    317940
     gctcttgtgg ctcctcatgg caggcatcct cgttgcgccg ccaattccca cgaatcaatg    318000
     gggaggactt ccaatcaccc tcatcgtctc agtaatcggc cttgccaccg cctttccgat    318060
     cgccctgctt ctcgcgttgg cgcgccgttc atcgatgggc atcctgcgca cgcttgcggt    318120
     ggcgttcatc gaatgtttgc gaggtattcc gctcattgca gtgctataca tcgccatgct    318180
     gatcataccg atggcgcttc cgagcgaggc gaccctcgac aagctcctgc gcgctcagat    318240
     tggcatcacg ctgttcgtct cggcctatct ggccgaggtc atccgggctg gtttgcaatc    318300
     gatccccgca gggcaactcg aggccgccta ctccctgggc tttggatact ggcgcaccac    318360
     ccaactcgtc gttctgccgc aggcattgag ggcagttatt ccggcaatcg tcaatctctc    318420
     gataggaatt ctgctcaaca cctcactcct tgccgtcatc ggcatttccg atctgctgaa    318480
     taccgggaag attgcagcga ccgatcccgt gtggcttggc ttttacactg aagcctttgt    318540
     attcaccggc gcgatctatt tcgcgatcag cttcgtcgca tcgcgctaca gtctttggct    318600
     cgaacgccgg cttgcagcgg gcagaaatca ctaacgtttc aatgcgtcag agcaatgccg    318660
     atggtgcagc acgccaggtc ctgtcaagct tttgctcaga tctccgaaca gcttcatcac    318720
     accatcgatt tgggcggaag gtgagcatgc aggccgaatt tctcgatcat ggtcaatctg    318780
     aaaagcactc gctccccgag aaaggtgatc ttgtaggtca aatatgcgat tctacttccg    318840
     tgatttgaaa ggactatagc agagcgtcgc gttgccgctg accacgcgac gctgaacaga    318900
     tgggtcgaaa gatatcgccc ttgattgcct gccgggcgag catcgcaaat ccgtaaccaa    318960
     tcgctcctga tggcgacgat caccgacact tctgaccgca tcttcaagcg ctcctcggct    319020
     aatgttccag tgtcgtcatg gcttttgaaa cttcaggata aagcgatcgc tttcgccgat    319080
     tgcctcgtat ttaccgtggt cctgagcgcc aagtttatag gtcggcggta gcgtccacac    319140
     cccggcggga taatccttgg tgtccttggg attggcattg acctcggagc tgccaacgaa    319200
     tttgaacccg gcggcctcgg caaaacctat agcgacgtcc tggcggacat agccagactt    319260
     ggcgagcgga tcctgcggtt cgccgggctt tcctctgtgt tcctcaaccc cgagtacgcc    319320
     acccggcttg agcgccttat agaatgcggt gaaggcgtcc gctgtcgtgc ctgccgccat    319380
     ccagttgtgg atgttgcgga aggtcagcac aaaatccgcg cttcctgccg gggcgattgc    319440
     atgcttgttt gcggcaaact ccgtgacctc gaccctgtcg tagtcggcgg gatcggcagc    319500
     aagcttggcc gccagcgcgg cattgtcctt ctgtacttcg gcggaagcgg agtccttctc    319560
     gccattggcc gcaatatatc ggcccttctg ctttagatag ggaccaagga tctcggtcca    319620
     gtagccacca gcaccaggca ggatttcgac gacaacactg tctggtttga cgccaaagaa    319680
     ggtcaggacc tcaccgggat ggcgatattt gtcgcgcacg ctgtttggct gcgagcgttg    319740
     agagtcaccg atcagactct gaagcgccgg atcgacgctt tgcgaatacg cgggcgaggt    319800
     gcaaaaagca ctgaccaaaa tcccaagaca ggcgatagtt ttcaaagcaa ttcgtctact    319860
     tagaaacata caatcattcc cttatgaagt tggcagggga tagtcgcact cagtcggtgg    319920
     gctcgtgatg tcaacaaacg gccgatcgac gttagaagac tgatcgaagt cgcggccctt    319980
     gaacgtcaag caactacgga tttgcgaacc actcgcacca atcaaccgat acagaaaagt    320040
     tgcgctatcc cttcatgggc aaagtgcatc acaaatcaga tcaatgtgga agcttgaatc    320100
     cgattaacta cgacacactt caaaaggaag gcgttggtga ggctgcttgg aggtgcccgc    320160
     gcaacgtctc tgtttcgtac tcgtgacggt acaagcctcg cctacgcaga atcggcacga    320220
     gttcgtcgac gatcaccgcg agcccatcga tcaagcgatc cggctgcaga ttgaagccgt    320280
     cgatggcgcc agcatggaac caatcctcaa tgtgatcggc gagttgctcg ggcgtgccga    320340
     cgaacccggc atggcccgag ccgatatacc gcgtctgctt gaggtactcg cgcacggtgg    320400
     ggttggtctt gcggatctgc gtaatgatcg attcgcgaaa gccgatacta cctagaaaag    320460
     tctgggtgtc cttgagaggg ccgaggacgt cctcaggaaa ccgctcatcg agttcaagtt    320520
     tcgaagcgtc gtagccgatg gcctgggaca gccaggcgat cgaatatgac gccgggcctg    320580
     cgtcatggat tttatcgctg cgtcgacgcg cttcttcctc gctactgccc aggctcagca    320640
     gcaagcccgg gaggattttg atgtcgtcag gggagcggcc attgctgcgt gcaaaccctt    320700
     tgaccagacg gtagtgctcg atggcttgat tttttgtgag ttcggcggcg aagacacctt    320760
     cagccgcacg ccccgccagt gcgcgaccct gcggcgaacc gcccgcctga aagatgaccg    320820
     gatggccttg ctttgacggc gggacccgca aacggccatc gacatcaaag aactccccat    320880
     gatgatgcac gtcttggccc gtggctgccg aattccacag cgcccgcaca acgtcaacga    320940
     actcgcttgc acgttcgtag cggtcgtcgc gagagggaat atcgggcatg ccgaaattgc    321000
     gcgccgcagg cacgccgcgc gtggtgacaa cattccacgc cgcgcgacca cccgtttggt    321060
     ggtcccacga caggaggcgc tcggcaagtt cgaaggggtc attgaaggtt gacgaggcgg    321120
     tggcgaccag gcccacgcgt gaggtcgcgg cggccacatg gccccaattc accgtcggtt    321180
     caaggcggat tggattggcg tcataggccg ggtcaccgag cagtgggcca tcagcgagga    321240
     agagggcgtc gagggtgccg cgttccgcag ttttgccaag gttcgcccaa taatccgggt    321300
     caatgaagga gtcctttttc aacagcggcg tcttccatgc cgccggcaga tagccgagca    321360
     ccaacacatt gatgccgagg acaacgtgac cagatcgttt gcttgtcatg agtggtgtct    321420
     ccgttgctgt ctacaaagag acgtgcggtt gtggcaaagg gaaagcggcg cgcgctgtgg    321480
     gcggcagcgc cgctggtgcc ggcaggttga gcgcgacgcg cagggacccg ccgagcgcta    321540
     tgggagcgaa accgtcggca agccatcgct cggcggtgtc gagcaggtta cccaccgact    321600
     gctcaaggcc cgcgcgcagc acgacacccg caactgcacc tactggcggc tcctcgccca    321660
     gtgctaccac cggcaccgag cctgcagcac cgaagacgag ctcgatcgga tcgttaccac    321720
     ccaccggcgg aacgtccgcc accgttgcgg cgtaccaaga aatcaccgac gcgcctgtcg    321780
     cgggctcggg cgcgttcaac ggccccgcta tcgaaaagct gttgtcgata tcgacatgca    321840
     caatgcggtt cgactccacc aggatgccgg tctcacggtt gccgatgatc gagtcgtgcg    321900
     gccagctttg ctcaagagcg cgcaccgcgc gggctgcgtc gtaggcagtc tgagcgttga    321960
     gtggcgcacc accgccgagc cctgccccac cccaggctgg cgcgtccttt ggaccttccg    322020
     gcgcataggc atcgcgcacc ccgatcagca gtccgctgcg accacgcgac agatgggcaa    322080
     gcgaggcgac gcggcgcgca atgttgtacg ggtggtcgcg ctgcggcgac gcggtgatga    322140
     agaaacgacc gtatttcgtg gcactcgcca aggtcgcgcc gacagcactg cttgttagcg    322200
     tgaccggcgc tggcgcgctg ccatcgacac ggtctattcc gagcacgctg aacgcaaccg    322260
     ccaatgcgtc ccaccgcgac aacagcgcgc ggctttcagt gagttccact aggtgcggtc    322320
     cggcgaggcc aagcgcaagg tagggtctag tcatcgtgtc gtccccttag ttgccttggc    322380
     caccgcggcc gagacgggcg atgctcgaca ccggcgaatt gtcattgaca aggtagtcgc    322440
     cgaggatgcg tgccttgtag gcgaccgggt tgtgggacgc gagcgtgcgc gcgttccgcc    322500
     agtggcggtc gagcgcggtt tcctctgagg tcgcagaggc gccgagggcg ccgaagacat    322560
     gcgtagccgc atggaggacg ccgtcgatga tcgcgagttg cgcctgcgct acagccactt    322620
     ctccagcgat ggcgcgcttg tcgcgcaacg cgacgtcgcc ggccgcgtgg gcggccgcga    322680
     tctgatcgag cgagttggcg gcacgacgca aagcggcctc cgtcgagaaa acccgcaccg    322740
     atacctcgcc gatcacctgc agcagttgcg ggtcaagcgc cggtacctcg ttgagacctt    322800
     gcgggtagtt gcgcccacgt gacttgagcg ccgtgatacc gtcgcgcaag atcgctcgag    322860
     taatgccagt gagcacggcc agcagcgcgg tttggtagaa atgcccctgg taaactacac    322920
     gctcactcgc cggaaagaca tcaccttcgt gcgcgatggc ctcccggtag gtcgcgctgc    322980
     cgcttgccgt ggtgcgctgg ccaaaacctg gccagtcgtc agtaagcacg acgcccggtt    323040
     ggtggcgatt gaccaaggtg gtgatgagcg agccgtcttc gcccttgccg atcacgtcga    323100
     gccagtcggc atagaggcta ccggtggcat agaacttcgc gccggtgacc ttgtagtgat    323160
     cgccttcgcg agtgacggtc gtctttatgg tggcatacgt gccgttgttg gcctccgtcc    323220
     agccgccgcc aacgaactcg cggtcacgga agcgctggaa ccagcggtcg ttggtcggcg    323280
     acggccgcgc attgagacgg tcttcgatga aggccaagtg attgcgccag acatgggcga    323340
     catttgcatc agcctccgcc agcaacgcca ggaggtagta tgtctgttca agcgaggcgc    323400
     cccacccgcc aaactcctcg gctacgcgta acagagcgaa atcggcatcc ttaagccact    323460
     gcacctgctc gacaggaaag gtgcgattgc gctcacgctc gacattgccc tcggcgatac    323520
     ggtcgaatat cggctggaag cgcgccacga gggcttcttc attcgcggtg gcagggcgca    323580
     aataggtcag cgaagtcgag gcgtccactg cggtcatctt tgtactctcc ttgttagtcg    323640
     ttctgagtca ggaactgtgg gacgggggct atgcctggct tggtcggtcg cggtcgcgcg    323700
     ttctgctcat gcctggattt ttcttcgtgt tgaaaaaggt tggggatccg ccagcatgtt    323760
     cagtttcgat ttgccggatc gcgccactgg gcgacaaggt cgaccgcgag ggtcgtgacg    323820
     atgaaagcgg cggcagcaaa gatggtcgta ccaatgacga cggggaagtc gccatccagc    323880
     gcggcgccga tcgccatacg gccgacgcca tcaaggccga atatggtttc cgtcacgatt    323940
     gctccgccca tgatcgcgcc gagttccagg ccgccgagag tcaaaatggg attcaacgcc    324000
     gatttcaggg catgggagaa gtagatccgg cgctcggaaa cgcctttggc acgcgccgtt    324060
     cggatgtaat catgcccaag cacgtcaagc gtactcgccc tgacgacgcg ctgaaaaatc    324120
     ccgatttcgg caatcgcgag cgtcgcccat ggaagcagca aatgccgcgc ccattgcaac    324180
     ggatcctcgg ttagtggcac gtaaccactg ctcgggaacc aggggatgcc gtgattcgag    324240
     agctgaaaaa acaagaaata agagatcaga atgccgctca gaaaggtagg aaccgaaaga    324300
     ccggcatagg caaagaaagc aagtacgtgg tcgatgaaac ggccctgcca acgcgccgca    324360
     acaacgccgg agacaatggc gattgccatc cagatcacca acgcgccaag cgccaaagag    324420
     agcgtcacag gtgctttggc gagaataagg tctgtaacag gcgcctgctt acgaaaggaa    324480
     aacccgagag ccgggggcca gtgcatcaat cccatcggcg cgccctggat atcgggaccg    324540
     cggaacagat aataccacag ctgcaaatac cacggttcat cgaggcggag cgagcgcgca    324600
     acggcgtcga tcgtctcttg cgttgcgttg cgcggagcga gcatcgccgc aggatcgcgg    324660
     taggcgatcc gggagatgaa gaacgacagg atgagaatga tcaccagcgt cgagatcgaa    324720
     cgcaagacaa cggttgaaaa ctgttttgcc atgatctcag atccgtctgc gatgagggtc    324780
     gagtacgttc ctcaagccag cgctcaacgt attgaagccc acaaccgtca ggaacagcgc    324840
     gaggccggga ccggccagaa accagggctg attctgatag agggaggtcc gttgcgcttc    324900
     ggcgatcata ttgccccagc tgggcgttgg cgcctggatg ccgagaccga ggaaggagag    324960
     cgtcgcctcc gcgacgatgt tggcaggcag ctgcacggcc cagtaaacaa atagcgtcgg    325020
     caggatgttg ggaagaacat cgaaccagat gatgcgtgcc gatgaggcgc cgatggtgcg    325080
     cgaggcttcc accatcggac tcgtgcgcaa ttccaacacg agcccacgcg taagtcgtgc    325140
     gaaataagcc catgaaaaca aggagatgat gaggatcacc acaacgaccg gcgaaatgat    325200
     cggctggccc gttcccccgc ggttgagcga taaaaggctg agtgccgtca ccacaaaggg    325260
     aaaggacaga gcgacgtcga tgccctgcga aatgacgcga tccgttcgtc ctgcgaaaaa    325320
     accgctgacg aggccgatgg ccgtaccgat gatcatcgcg atcgttgtcg acggaatgcc    325380
     aacgataagc gaaacctgcg cgccgtagag ggttctgatc agaacgtcgc ggccgttccc    325440
     atcggctccg agaggaaatg cgagtgtcgg gccgatgggc aatcccattt catcgagcgc    325500
     cgtatcctgg aactgctcca tgggaccatg tcccagaagg tagccgactg ccggcgccag    325560
     cagcgccgcc agcaagacga agccgacgat gctggcgccg gcgcgcaccg ccctctcgcg    325620
     ccacagtcgc ttcagaaata cgatggctgg cgacgatgac tggccggaaa gaaacgaggc    325680
     ggcggcagac tgaatgcggt cagccatggc tcgcatcctc aagctccgca tatgccggca    325740
     gacgttttcg ccctggaatg gatgcgagca actggcgcgt atagtcgtgg accgggcgct    325800
     cgaagacctg ccgtgtcggg ccggtctcga cgatatgtcc cttttccagc acgatcaccc    325860
     ggtcgcaaag ttcgccaatg acgccaagat catgcgaaat gaataggaag gagactccta    325920
     gcttgtcgcg aaggcgggag agcagcgcga tgacctttgc ctgggtggtg atgtcaaggg    325980
     cggaaacggg ttcgtccgca acgatcagcg agggccggag cgctatcgct cgcgcgatag    326040
     cgacacgctg ccgttggcct ccggacaatt gcgacggcaa ccggtccaga atttcatgtg    326100
     gcagttccac gtcagtcaca agctgtttca ctttctcgcg caattccgcc ttgccgattg    326160
     cgccatgaat gacaaaagga tcggaaagaa tggcctcgat ccgccgtctt gggttgaggc    326220
     tggcataagg atcctgaaat accatctgga tggacctgcg ccgattgccc tgcagtacgc    326280
     cgccgcccgg tccgggtcgg gaataatcca ctccccgcaa gctgatcagc cccgcgtcgg    326340
     gccggtccag gccggcgatc agccgtccta tggtcgattt tccggagccg gactcaccta    326400
     cgaggccgag gatctctcct tcccctatgg tgaaggagac gccatcgagc actgaacgcg    326460
     acccgaatga acgggagata gcctgcaccg caagcagcgg gcggggcact tcccagcttc    326520
     tgcccaccgc ataaatcttc gtgccgccga ggcgcgccgc gcctaacagc tctcgggtgt    326580
     aatcctgcct gggccggaga tagatctcgg atgctggcgc tttttcgacg acgacaccgt    326640
     cacgcatgac gaccacatcg tcggcgatgt cggacacgac agcgagatca tggctggcga    326700
     aaatcagcgc ggttccgtgc tcttgctgca ggcgcttgag aagatcgaga atggctgcct    326760
     gaacggtcac gtcgagagcc gtcgtcggct cgtcggcaat gatcagtgcg gggtcgagag    326820
     cgatggcgat ggcaatcatc acccgctggc gcaggccgcc ggagagatgg cgcgggtact    326880
     ccacaagccg cgcttgcgga tcagcaatgc cgacatcgtc gagaagcgcc agaacacgct    326940
     cgcgcttttc tctgcgacct actttgcgat ggacggagat cgcctcgccg atctgctccc    327000
     caatcgtctt cagggggtgc agattactca gcggatcctg gaaaacgaaa ccgatcttcg    327060
     cgccgcgaat cctgcgcaat tccctgtcgg gcagaccgag gagctcccgg ccgcggtgca    327120
     gcacgctgcc ctccaccgcg gcggacgtgg gcaatagccc ggttgcgcca agaaggctgg    327180
     cgctcttgcc tgacccggac tcgccgacaa tggcaagtgt ctttccggcg tctatgtcga    327240
     aggaaactcc cttcaccgcc tggacgccgc caaaacgaac ccgcaaatca tctaccgaga    327300
     agacggacat tccgctgcgc cgcctagttc ttcaccgcaa tgttggtgat gtccgcctgc    327360
     actgcaagcg aagaccaaac ccattgggta atgtggtccg aggtaatggc aatcttgcgc    327420
     ttttcaaaga gtgggatcca gggcagatcg gtcgagacga tcttgtccgc cttagtccag    327480
     agcgcgtcgg cattgtctga aggataggct tcggccgcga gtttattcag ctcgggattg    327540
     ctgtagcaaa tcgcatacac gttcccggca ccacagggcg ctgcatccga gttcagccaa    327600
     ccgccgagca gcattcgcgt gctcgggcct tgccaatcgg gtgagaagct accgttcagg    327660
     aagacgtccc aacgcgattt cgggtcctga atataggcgc gccattggct ggcaggcgct    327720
     gggatcaggt tcagcgtgat gcctgcagcc gccaaatcct ccttgagagt tacggcgatt    327780
     gtctcgttct gtgcgttggt gcgatagagc gcgtcgagcg tgatgccatt agggtaaccg    327840
     gccttcgcta aaagctcttt tgcttttgcc gggtttccct tgttgccttc agttggataa    327900
     ggatcgaact gctcgtagcc ggaaatggta gaggtgatga tctgcgacag ggggacggcc    327960
     gcgattgatc cgccttgcga ttgaaccaga tgcgcgcgat tgacggcata ggagaaggcc    328020
     tggcgcactt ccggcttgcg caacgcctca ataccttcgc tggtggcatt cttctgtgcg    328080
     tttatagtaa tgaaattggc tgaaccgctg tttgtcgcat gcagataggg gctcttcttc    328140
     gatacatatt gctggatggc accgcgcggc ggggtgtcga gatagagtga gaggtcggcc    328200
     tcgccggcct ggatcttttg gacgacagcg tcttcgctgt tggcggtgaa atcgacatcg    328260
     atctcgtcaa cataggcctt tcgggcttcg tccgattccg gtttgaagtt cttggccttc    328320
     ttcaggacca gcttttgtcc ctgatcgtaa gaggcaacat aatacggccc gctcgatggc    328380
     aggttcctgc gcgattccac ggagtccggg aagtatttcg acgcaatttc agaagccacc    328440
     ggcgatacga aattcatcga aagaatattg aggaagtcgt agttcttcgt atcggaatgg    328500
     atcaccaatg tcttgtcatc cggtgcggat acgccggaaa tttggtgact gtcgatgaag    328560
     gccttgctcg ccgccaggtc cccggtcggc accttggaaa aatccttgca gtactggaca    328620
     aagcccgaca gtacgagatt gaaataattg atggccgcga cctgcttgtt ggggtcgcag    328680
     aagcgtttta tgccgtaaac aaaatcgcca gcgacgatct tgcgttcggt agagcccgaa    328740
     aagaagatgt cgtccttcag gtgaaacgta taggtcttgc catcctggct gacgtcccag    328800
     gacttggcca gatccggcac caaagtcgtg tcttccttga ggccgatcgg cgaaccagga    328860
     taggtgacga gctggcgtgt cgtcgcgcgc aaaatttccc aggaatcggt actgtagcct    328920
     gttaggggat caaacgcatc aagatctgat tcaagcgagg cgatgcgcag tgtaccacca    328980
     aatttcggct catcggcgaa gctcggagcg catagggcag tgtaaaccgc gagaaaagga    329040
     gcggcgatcc gacccgcgga tcggagaagg acggtgacat gcatggatat ttgcctcggc    329100
     tctgattgtt tcccctattg tctatagttt ttatgtatta ttgaaacgaa gcaacgtttc    329160
     aattctgcgg ccgtcgaaga aataaactgc cgaaaattgg gtttcatcgg aaaaccaatg    329220
     ccgttttgag gcacccgaca tccgatccgc ggccattcgt cgaaatcacc atctgcatgg    329280
     accgcgccgc gctggccgcc gcatggtgaa aacggagcac gattttcctc aggaaatgcg    329340
     ctttttagaa cggatcgacc acgccaagca tcatattctg ctgcataaat ctatcaaatc    329400
     tatagacatt aaatggaccg actccatggt tttcgatgga ctttcgagaa acacggcttc    329460
     ccgttttctg ggcgccctac tcgggttggc gcttgttacc agtgcggcct ttgcggaaga    329520
     caggggcggc acgctgaacc tgatcgtgca gccggagccg atctccctaa acccgggcgt    329580
     caaccgcctc gggccggcaa ccttcgtcgg cgacaaaatc tacgattcgc tcgtaagtta    329640
     cgcccagaag gatctggcgc ctatcccgcg acttgccgaa agctggactg tttcgcccga    329700
     cggcaaaacc tatacgttca agctcagggc gggcgttacc tggcatgacg gcgagccctt    329760
     tacatccaag gatgtctcct tcagctacag tgaattcctg cctgcgctgc aagcccgctc    329820
     gcgcgatctg cgcaacgaaa tcgagcgtat cgagataccg gatgatctta ccgtcgtttt    329880
     tgtcctgaaa aatccttatc cggctttcct gcggtcacta aacgcggcga ttgttcccgc    329940
     acacaaatat gtcggcgtca ccgatttccg caacgccccg gccaatgccg agttcatcgg    330000
     taccgggccg ttcaagttcg cggagtggaa gaagggtagc ctgatccgcc tggtgcgtaa    330060
     cgacaaatat tgggataccg gcaaacccta tctcgacgag atcgatttcc agatcatacc    330120
     ggatgcaaat tcgcgggcga ttgcgttcga aacgggccag gtcgacgccc tgcgcgcagg    330180
     cgatgtcgag aatttcgata ttccgcgtct ttcggcgctt gatggcgtca agatacgcga    330240
     ggacggttgg gaatatctac agccgatcgg ctatgttcac ctcaacaacc gcaatccgat    330300
     ccttgccaag ctgcaggtcc gccaagccat tacgcaggcg atcgatcgcg atttcatcat    330360
     caacacgatc ttcgcaggct tcggcaagcc gatcaacggc ccattttcga gcctgtcggt    330420
     ctacaaggat gcaagcgtcg aaaccgtcta ccctttcgac ccgcagaaag ctgcagcgct    330480
     acttgatgag gccggctaca agcccgggcc ggatggaacg cgcttcacac tgaagctcgt    330540
     tccgcttcct tatggcgaac tttggtcccg cgaggccgaa tatctgcgcg aagcccttgg    330600
     tgaagtcggc attaaggtcg acatcgtttc caccgacgtt gccggctggt tcaagcggct    330660
     taccatcttt gactatgaca tcgccgagaa cttcgtctat acaaccgccg atccggcgat    330720
     cggtatttcc tatggctaca agacggtcaa aggcgacaag gccggcacca cgggcgccaa    330780
     tgtcaacggc tattccaacc cggaggtcga tgccttgctg gatcagggct cgcatcagcc    330840
     cgacgaagcc aagcgcaagg agatctattc gaaggtgcag cagatcatat cgcacgacgt    330900
     gcctttggtc tggactcatg acatcgtctt ccccacccta tatcgagaca gggtgcagga    330960
     tctgatcacc accgcgctcg gcacggacga caacttcgcc tcggtttggc tgaggaaatg    331020
     agccggccgt cggatcgcat ccgcgtgcat ggacagggag cagccctggg cttcgtccag    331080
     gccgtgtcgc ttcggcttgc caaggcggcg atcaccctct tagccgtcat cgtcctgacg    331140
     ttcgtgctcg tccgccttgc cccgggcgac cccgccctgc tgctcgcagg cgatcaggga    331200
     gggagcgatc cggctttcgt cgccgagatt cggcagcacc tcggtgtgga cggtcccatt    331260
     cacctccagc tctggcatta cctgcaggcg gttgccaggc tcgacttcgg cacctcctat    331320
     cgcgatcagc gtcccgtgat cgacatcgtg ctggaaaggc tgccggcaac gcttctgttg    331380
     actatttcgg ccttcgtttt ttccatcgtc acaggtgtcg gcctcggcgc tctggcagcc    331440
     cgccgaccgg gctcggcgat cgacagcgcc gtcacgacgc tctccgtcgc cttcttcgca    331500
     atgccaatgt tctggatcgg actgattttt attatcgtct tcgccgtgaa gctgggatgg    331560
     ctgccctcct acggcatgca agccgcttcg gctgccgcca agggcggctg ggcggcattc    331620
     ggcgatctcg ccgcgcacat ggtcctgccc gttctgacgc tcggcctata ctatatgtcg    331680
     atccatgcgc gggtcagccg cgcagcactc ctgcagatct ccgatatgga tttcatccgc    331740
     accgcccgtg ccaagggcct tccagcttgg cttgtgtggc gtgaccacct cctgcgaaac    331800
     gcgcttctac cgacagtcac cgttgcggca ttacaggccg gtcagttgat cggcggctcg    331860
     atcctggtcg agacggtctt tgcatggcca gggatcggca ggcttgcctt cgattcgctt    331920
     gcgagccgcg actacaacgt cctagtcgcg gtgttcatcc tttcttcgtt cggcgtcctc    331980
     atcgccaacc tcattgccga catggcctat cgtttgatcg acccgaggat cgaccgggag    332040
     gtgacgacat gatccgccgc ccgcgccatc ccctgctccg cgcaccggtc ctgttcggct    332100
     tcgccgtgct cgcacttctt ctcttttgca tcgtgttcgc cgatgtcctc tatccgggag    332160
     acccgtggcg aatggtgtcg cggccaaacc tgccgccgct ttcgcccggc taccccgctg    332220
     ggaccgacat gctcggccgt gacctggccg ccggccttgt gcatggcgct cgcgccaccc    332280
     ttgccgtcgc gctcagcgtc gtctgccttg ccatcggcct cggcgtgacg ctcggtcttg    332340
     ccgccggcta tttcggcgcg gccgtcgacg atgcggtgat gcgcgttacc gagttcttcc    332400
     agacaattcc gagcctcctg ctgacgatca tcatcgtggc aatcctgtca ccgacccgcc    332460
     tcatcgtcgt cctcgcaatc gcgctgattt cttggccacc cgtcgtgcgc atcgtccgtg    332520
     ccgaggtact gtcgctgcgt cggctcgact gggtccgtgc cgcccgtgtc agcgggctct    332580
     cgcatctgcg catcgctctt cttcatgtgc tgccgaacgt attgccgcag gtgatgatcc    332640
     aggcctcgct gctcgttgcc ggtgcggtca tgatcgaatc cagcatcagc ttcctcgggc    332700
     tgggcaatcg cgatgcagtc tcctggggct tcctgctcgg atccggtcgc accgccttta    332760
     gcgtcaactg gtggctttct accctgcccg gactggcgat cttcctcacc gtgcttgcct    332820
     tcaatctggt cgctgacggt ctggaacgct ggctcaatcc gaaaagtgga gcgggaggcg    332880
     gccgatgagc caatcgcaac ccgcagcgac agcgcccctg gtcgaaatcg aaaatatcga    332940
     tatccgcctc ccagaggggg gcgagcgaga gcttgccgtt cacgacgcga ccctttccat    333000
     tgcgcgcggc gaagtcctct gtattgtcgg cgaaagcggc tcgggcaagt cggtgcttgc    333060
     ctcagccatc gccggccttc ttcccggcaa cggccttcgg gtggagcgag gaaacttgcg    333120
     cttcgcgggt gaagatgtgc tttcccttgg tgaaaccgcg ctccggcgcc tgcggggtgc    333180
     gcggatcggc tacatattcc aggagccgat gacggcgctc aacccgctat tgaccatcgg    333240
     tcggcagatt gcggaagcgc ttaaggccca tggccatccc gcaccgccgg aaaggatcgc    333300
     ggaactcctt gctgccatgc ggctgcccga tccgggcacg ctacgtcgac gctacccgca    333360
     cgaactttca gggggccagc gccaacgcgt ggcgattgcc atcgcgatgg cctgcggacc    333420
     cgatcttctg atcgccgacg aaccgaccac agcgctggat gtgacaacgc aagcggaaat    333480
     cctgcggctc attctcgatc tacgtgcccg tcgcgggctc gcagtgctgt tcatcaccca    333540
     tgatttcggc gtggtacggg acatcgccga ccgcatcgtc gttatgcaaa acggcgagat    333600
     cgtcgaacac ggaaacgctg aacaattgct cagtgcgccg acccatccct atacgcgtcg    333660
     actgcttgca gcggtgccaa agcttgaagc ccgccggtcc ccacttgctt cggacctgcc    333720
     ggcagcactg gagctcgaag gcattcacaa gacgcatttc acccggcgcc acttccttgg    333780
     ctctgcgcgg ccggcaacac aagcgctggg gggtatcgat ctgacattgc gcatcggcga    333840
     gacggtagcg ctggtcggtg aaagcggctc ggggaaatcc actcttgggc aggtcatcac    333900
     cggccttgtc gaacgcgatg ccggcacctt ccgcctttcc ggcgaggcga taggccgggc    333960
     tcgggatctg ttcactcgcg agcgacgacc tgccgtgcag atggtgttcc aggatccgca    334020
     atcttcgctc aatccacgcc atagcatccg ccgcatcctg acggagccgg tgctgcagac    334080
     cggcttgtcg aaggaagaag ccgaaacccg catgatggaa ctgctcctgc gcatagggct    334140
     ggatccttca tccgccgacc gaaagccaca tgccttttca ggcggccagc gccagcgcat    334200
     cggccttgct cgcgcgctga tgccgaggcc gcgtttgctg gtggcagacg agccggtctc    334260
     cgcgcttgac gtatctgtcc aggcgcaggt cctcgatctc ctggccgaac ttcaaagcga    334320
     cctcggacta gccatgttgt tcatcactca cgatctgcgc gtagcagctc gggtggctga    334380
     ccgcattgcg gtgatgcaac acggcgtcat cgtggaagag gccgcaaccg ctgatcttct    334440
     gcggacgccg cggtcgactt acgcgcgcgc gcttattgcc gctgttccgg gccggaacgg    334500
     cgagacggaa ccagtcgcaa acagttcttc acgcatcctt gaagagacac cacatgactg    334560
     agcagacgag ccggaaagca gccggcaaac cactgccgtt gaacgcctcc gcgatgaaca    334620
     ccgcgaacca catctcccac gagctttggc gtcacccaga cgacctgcaa gatcgtgacg    334680
     gcgaacttag ctattggcag gaactcgctc gtctgattgg cattgaccac ctgggagagg    334740
     atcgttccag tgcggcccac tgtatcattc gtgaagatgc caccgcgctt gatcagaatg    334800
     atagttcggc cgcggccaac aaaaaggttc cagcatgaac ggcaatgtcc accttcattg    334860
     gtatctgccg accaatggcg atagccgagg tctgacaggc tcgggaaccg atagccatat    334920
     cgtggaactt tccggtggct tccgggcgcc aacgctcgcc tatctcggcc aagtggcacg    334980
     cgccgctgaa gaacagcatt ttcattccgt tctgacgcca accggaacat ggtgcgaaga    335040
     tgcctggatt accaccgccg ctctttccca cgaaacgaag cggctgaaat tcctcgtcgc    335100
     ctttaggccc ggcctcatat cgccgacgct cgtcgcccat caagcggcga ccttccaacg    335160
     aatgaccggg ggacgcctgc ttcttaacgt cgttacgggt ggcgatcgct tcgagcaggg    335220
     gcgcttcggc gatcatctgg accatgatgc ccgatatgaa aggaccgagg aattcctctc    335280
     agtggtgcgc ggtgtgacgt ccgcgcccgc gggccagccc ttctctttca agggtaagca    335340
     ctacgacatc cgcgaggcca acatcgacac cagtccgtat gatctgccac agatcttctt    335400
     tggcggcgca agccccgcgg cccaggaggt ggcagccggt caagccgacg tttacctggt    335460
     ctgggcgcgc tcgccagcac tcgaagccga aaatatcgcg cagctgaaag cacgggctgc    335520
     tgccagaggg cgttcgctgc gcttcggtgt gcgcttgcat gtcatttcac gcgatacgga    335580
     ggatgaagcc tgggccatgg ctgacaagct ccttgcctgg ctctcgccgg agcgtgtgcg    335640
     gaagaactgg gagctcctcg ccaaatccga atccgttgcc cagagccaga tgtcggcgct    335700
     gcatgtaggt cgtgaggggc tgccggcttc tgcacgtgaa ctggaaatct atcccggcct    335760
     ctggactggc tatggcctcg tgcgcggcgg ggctggtacg gccctcgttg ggagccatac    335820
     gcaggttgcc gatctcatcg aagcctatca tcacgccggt ttcgatcact tcatcctctc    335880
     tggccagcct catcttgagg aagcctggca tttcggcgag ggcgccgcag cgcttctcaa    335940
     gacacggggc cttctcgctc cggtgtccat gtaatcacaa ggaagagcgt atgccatcgc    336000
     ttccaaaaat ctcccctgcc gctgcctatc tctgtgccgg cattcctgaa accgaattcg    336060
     agagctggtg cgcggagccg atctgctcgg tttcgcgccc ctgaagacgc cgggcgaact    336120
     cgggggcggg ctcccccagg cgctggagat tgagctcccg aaagtcacaa aatgacattg    336180
     gataactctt acatggatat tcgacccctg aatgatgaag aaggccgccg gaaggctttt    336240
     gctctgttcc ggcaggcctt gttgggaatt ggtgattttg ggcgcaccaa ccccgaaatc    336300
     gaagcccgga ttctgagaga gggcaaaccg cttggtgcct tcgaggacaa tgtgctgcga    336360
     ggcgtcgtca acggctatga ttcgtcgatc accctgcccg gtggcaaacg ggtgcgccac    336420
     ctctccgtca cacatgtcgg cgtctctcca gacgcgacac gtcgagggat cgcccggctg    336480
     ctcatcaccg agcagcttcg tcgcgcccgc gccgaaggct atgtcgtcgc aggcttgagg    336540
     gcatcggacc cacgcatcta tggccgatac ggctatggcg tagcctcttg gtcggcccga    336600
     catgatctcg atctcacccg caccgagctg gcgatctccc cgtcgcgcga gggactccgt    336660
     atcgtcgatg ctcgtgaggc cttcgctttg tttcggcgaa ttgcagatgc cgatgccaag    336720
     ccacgcgcgg caacgctgtc ccgctgggag ggctggtggg ccatgcagga ataccgcact    336780
     gtccacagcc caacgcccca tcacgcggtc gtcttcggcc ctgaaggcaa tgagcgcggc    336840
     tatttgcgtt tccatgttga gccttcggac aactggttca cgtcatcgag ccgtgctgtg    336900
     gtcgtcgacg atctcgtcgc ccatgacgac gaagcctggc aggtcctgat tggccatctc    336960
     ttcacgcagg atattctgca ccgggttatc tttccatcac ggccagtgga tgatccgttg    337020
     cctttgcttc taaacaatcc gcgggcgcta gaaatctctg gccagcgcga cgaaagctgg    337080
     atacgggctc tcgatctcga agccttgctg accgctcgtc gctatggcgg cacccgccag    337140
     gtaacgattg ccgtcgagga caatgtcttc caggataatg gcggcatctg gtctctcggg    337200
     cccgagggtg cagagcgaag cagcaggaga ccggaggctc atgtcgcaat cgcagaactg    337260
     accacgctga tattcggcgc acaacacgca tcgcttcttg ctgcgtcggg gcgcatcaag    337320
     acgatcgctg tggaagtgac agaggaactg gaccgcgtgt ttgccagcag ccgccggggc    337380
     cattcaggca tctcattcta agggcgacat ggatcgccac ttgccggcgg cgagctgtta    337440
     aagagaagcg ttcgaagagc aaagcgggat agatctacat ggcggacccc ataattgttg    337500
     taacccgcgc acctgacaga caaacaatcg aagcaatagc gagcgggctg aatagcttca    337560
     atgacgaagt gacagggatt gatgaccgcc ttcccctcgc cgtcttcgcg aaagatccgg    337620
     tcaacggcaa cctcattggg ggcgtcacgg ggcgaacgtc gttactattt ctcgacgtat    337680
     tctacattgc aagaaaccat cgcggattgg gtcttggcag gcggattctg caaagcgctg    337740
     aggaagaagg aaggcggcgc ggatgccgac gggggttctc tatacaatct gcttccaggc    337800
     tccgggcttc taccaacgcc atggctggcg aattttcggt gaagtatcct gcgatccacc    337860
     gggaacaagc cggatattca tgacaaagga actataaatg gatgcccctc gcgcctgaac    337920
     agcacatgaa tacgccgata tcctcttggc tttgagcccg gcaagtcaaa aaataccgcc    337980
     cctttgcgaa ctgggattaa tgcacgctga cgagccctct tccaaaaaag gcggaaagcg    338040
     ctccgtcaga ggctgctgtc cgaccgaaga attcaccagc gcattagaca ttttgcctta    338100
     gatttttttg gttctcccgt aaacaatccg gtcgatctct atgcacatca gaactggctt    338160
     catcgaacaa ctcgtccacc agattaccac gttggaaggc cgcgtagtcg tcgctgttga    338220
     cggggtagac ggatcgggga agacaacctt tgccgatgag ttagctctgc tcgtgatgaa    338280
     agcaaaccac tccgtcgtac gagcgagcgt cgatggattt cacaatccca aggaaatccg    338340
     ctaccgtcgc ggcaaaagcg atcccgaggg tttctttctg gactcctaca actacgacgg    338400
     tttgcgtcgc ctcttgcttg atccgtttcg atcgggggct gctttagtag acattgcccg    338460
     ttacgatcat gcaaccgacg aagagatctc gaaaccggag agtgtcgagc cttcggccat    338520
     actccttctt gatggcatct ttttacatcg ggacgaattg caggaccaat gggactttag    338580
     catcttcttg tctgtgccct tctcagtctc ctatgcgaga atggcggtaa gggacggttc    338640
     caagcctgat cctttggcgc ctgaaaatcg ccgctaccac cagggccaac tcatctatct    338700
     tcagacttgt aagccagaag atcgtgcaac aatcgtcatc gataattctg ttatagaagc    338760
     accgaagctc gtacacagac ggcccgaaca ctgaagccgg atcgtttcac aggatcgacc    338820
     actatccgcg cattttcgtc gagctttgac cgatgatatt tggtgcttgt tcccaaccgt    338880
     atcagccatt ttgctccact tatgcacagg tttcgacaga ggaccagctc aatgacgcgc    338940
     aggttgacga gctgcacgta accggctgcc atcgcattca tcaagaactt ggatcgggta    339000
     catcccgcac aaggccggtt gttgccaagc tactgaagga actcgctgcc gacgacgtgc    339060
     tcgtcgtcgc gcgcctcgat cgcctggccc gatcggtcag ccatttactc atctcatcga    339120
     ggacttcgag aagcgcggcg tgcatttccg ctggttgcgc gatccgatcg atacatcgac    339180
     gctgcagggg cagctggttg ccggaatcgc catcgccgat ccggatctgt cgctgcgcga    339240
     tattgctgcc caattggccc agatgcatga gggacctccg cgcggaggtg ggaaatagca    339300
     accgtcttct ctcagggcgc cgctggacga tgctcgccgc ttgggattga tccgcgattg    339360
     agtgccaagt gcatccgaac ccttcgattg ggcgaattgc gttgtctaac gtacgcgagc    339420
     gtagagaagg ctgtcgcgcg gctcgttcga gatgtttgga tgcaacgtgt atcgcagcag    339480
     gaggccttcc ctcatcatgc ccgccttctc cattacgcgc gccgaagcaa tattttcgac    339540
     atcgcatgtg gcttcggcgc gaaaaatcgc gggttgtgag agcgcgtgtt ccaccaccca    339600
     acgcacaacc tcgctggcca ctccctgccc ccaataatcc cttcgaataa gccaaccgta    339660
     ggacacgcgg cttgaattca gtcgcggagg gatcattccg atcagctcag ttggggtgcc    339720
     cctggggctg atcaccccgg gaaagctggt accgttttgc cattcttgat cgccgtgctt    339780
     ggtaagatca tgcgcctgag aaatgtccgc gtgcggacgc cagaccggat acttggtgac    339840
     ctctggatcc gtcgcccatc cggcaaatat ggcttcggca tctgagagac gaatccgccg    339900
     gaccaaatga cgttgcgtct cgaatttttc tggaagccta tagacgtcat ccatcgcaaa    339960
     ctctccgggc aaaagacagt ttcagcgtaa tgctttgtca gtaccatgat tgagttttta    340020
     ccgtccgccc ttttcataga ttttcaggct gggcggaatg gtcgcccagc tcacggatga    340080
     acttacccaa ctttgatatg cgggtcgaac gagggctggt tcatccaggg aaccggcttt    340140
     aacatatatt cgtaccggat gccggggcga ggacgtaaac agcggcgaac cgcactccgg    340200
     acagaagtgc ctcgtcagtt cattcccccc atctcccttt tttgtgaacg gccgggggct    340260
     cccggataag agtttgaagt ttgttttcag caccgggata ctgacaccga acgcgctacc    340320
     ggtacaccgc ggcaatcgga gcagtgacaa tatgcggcgg cttcaatttc gcccgacctt    340380
     tcgatgagtt tataccaatg atccacgggt gagattgcca aatgcccttc tgctgcttct    340440
     gactagcagg cccaatgatt tttggcgaag gtttacatta tcggcttgga tccggtggag    340500
     aggctttaag ctttgccttt cgagtcttat gagccttttg aattcgggat ttcatcacat    340560
     ctgatgctgt gaacttgacg acccgacgag cggaaatcag gacctcttct cctgttcgcg    340620
     ggttgcggcc cgggcggtgg gttttggcgt tcacctgaag cgaggcaaat gatgaaagtc    340680
     ctatcggttc tccgcgtacc agtgcatcgc cgatctcacc aagcacaacc tcgacaagat    340740
     cggatgattc cgttcgagac aggccgatct tctgaaacac cgcatacgcc aaatctgcgc    340800
     gcgtcacagt tttcatgctc atgttctctg ttccaagcct ccgacaaaga agatcctgtt    340860
     atattgcggt ttgggaagca agacgtacca acgttgttgc ccaagacgga tctcgtagtc    340920
     cggtagtatc catcagctga ttagtcattt acaatgccgc ggtcgttacg atttcatgag    340980
     ccttctccgt tcaaggcccg cgaagcgtat cagtttgtcc gtgtcttgtg gtctagaccg    341040
     agggttcact tcatacccgg ctcagttccg cgtggaattc aacacccggc gcctcttgga    341100
     tgctgctcgg gtggttttca ctggtcagtg tgtattcaac gcggatgttt ggagttgacg    341160
     actgcgtagc gcgctgacaa cgactactgc ttctcttatg atcgccgaga aggttgcgtc    341220
     atcagcctgg gttatcttca ccgtcatggt tccgactatc atcgtcaacc gcattataag    341280
     tgctctatga tcccacgcat tgagatctcg ttgccgctcg gtaatatcta aaagcaccca    341340
     taccaatttt tcgatcacct gccggcgata ccgccgtgca tcgccggcaa agctttcttc    341400
     gagacgcaaa atttcttcca ggacatcacg caagtcgaaa tcacctcaaa tcgccgggct    341460
     aaaggcgccg cgatgttctg tgggagagaa cattcgggaa ttcgatgtgt catgactcgc    341520
     gtcgttgttg ctttcgatga tcaacgatcg aaaccatgct tcatacgtcc ctctccatga    341580
     gcagatcata ttttcacgat gcgcgccgag cagtgaaaag aagcgtacga agcggcgctt    341640
     ctgtgccaaa gagcgtcaaa aggcgcatct cttccttctt ctccagccga tagcggcgag    341700
     caaaatcgaa aacactccag aaggcttcat ccattttcgg caagtccgct ttccggattg    341760
     ctgcttctat aggtcgcccc atgacacatc tccgttcttt ggcggccggc aatatcgcgt    341820
     gacagcaagc aaagtccgcc gaaaggcctg ctttgaaagc ggatcatcaa cgtccaattc    341880
     cgcacgatct actattgtct ataaaaatag tagattaaag aaatgctggc cttttctccg    341940
     cgtcgaagag ggaaaatcta ttcctcttcc accctggatc acgcttggcg tgagatcggc    342000
     cccgctcctg cagacctcgg ccggttgcgc aagatcgtta cgggagcaag aggtccctcg    342060
     catcccgcat gggccgtaga ccctcatctg ccagcataag atacaatctg ttctgtgagc    342120
     caccgcaaga atgtggccat gcttgatgtg atgttaggca acgaggcaag agcagcagat    342180
     ggcttgtcct tggggatgtc ggctgctgtc gaaccggctg gatcggtcac tctgaacgga    342240
     tatgtccccg gcggtgagtt ccatacgaaa ctcaccgcga ttgccatttc acggtagcgc    342300
     gcaattggtt caaaatagtg aagtacttca tgtacctgtc gccgactatc agggtcagcg    342360
     ccaagcagaa agacgggtca aatcacaacg aaatagaata ccgcctatag accgctagat    342420
     tgcgtagtca ggatctgcag ttggttgttc catggttact cccggcagat cggacttcgg    342480
     ccttccaacc acccgcgccg gtacgccggc tacagaggta tgagccgaca ctgccgacac    342540
     gacgacactg ccagcaccta ctttggcacc gacgccgatt tcgatattcc caaggatttt    342600
     cgccccagca ccaatgaggg caccccggcg aattttcgga tggcggtctc ccgtttcttt    342660
     gcccgtcccg cctaaggtta catcctggag aatggagacg tcgtcatcaa cgatggccgt    342720
     ttcgccaatg acgagcccat ttccatgatc aagcataatc ccactcccca tatgggcggc    342780
     tggatgaata tcgatagaca gcacttcgca cgtgcgactt tggatgtggc gagccatatg    342840
     cttcttatta acccgccaaa gccagtgtgc tattcgatgc ccttgtaacg ccagaaaacc    342900
     tttgaagtag agaaacggga tgagtagctc ggatgtactc ggatcccggt catacaccgc    342960
     ttggagatcc aaaactgcgg acgttattat ttcaggagaa gattgaaaaa cgtccagcga    343020
     caatgacgtc agtacgccgg catcaacatc cctgttcgcg agtgtttctg aaaagcgata    343080
     ggccagacca cgggcgaagg tcgggtgaac gaggatgttc gaattcatgg cctgggcaag    343140
     ccgtggatcg ttgtccgcca ccgtccgagc ctccacgcag agggtggtcc ataggacctc    343200
     gctggggaaa tgaccgacga ttgcgccctc tccaattatt gtcttggcca gcgccgattc    343260
     tcttccgaac gggcccggca gtgctgtttg agttgtcata ggttgctttc cctcagaacc    343320
     gacccggctc agcggccggt gacatgataa ctgtaaacgt cgataatgtt cgcggttgag    343380
     gcgagagctg cagtgtagcc cgagcccatc tccagatcgg tccccttgac gatgacattt    343440
     ccgctgggaa gacggcactg aaaccgacga ccagcctgat tggcaactgt gaggcattga    343500
     aaatcgaccg aaagacccga accgaagact ttggccgttg cctccttgcg cgcccatgcg    343560
     cgaagaagga atttcgcttg cccgcccgga tggccgttaa gatattccag ctccgacggt    343620
     gacaaggtgc gcatgacggc cggcaggaat gacgcaccac catcaatctg ctcgacgtcc    343680
     accccgatcg tcatctcgct cgaaaaggca acaacggcaa tgtccccggc gtgtgaaata    343740
     ctgatcccag gccccgcgtg aacagatggc ttgccgttcg ccgcccgaat gatcttcaca    343800
     tcgttcggcg ggatctgaag catcgcgccg acgatcccac gcaccgcagt ccagcccgtc    343860
     acagaccggt tagaatccat cacccgcctg aaactccctg cacggcccca ttccttggtc    343920
     gaaataggca ggccgttggg gtcgatgggc tggtgcggta catttattga cacgacctcg    343980
     tgaaactcgc cctcaagcca gttgcttctc aactgcgaac caatggccgc aaggtcttcc    344040
     atccagccgg ccacttcgcg cgagaccatt tgccgtgcct ctgctcaaca ttcctaacta    344100
     aggcacgtac cctgccagcc aatatttgca tgtcggctgg ccgcacaggg ctcactgcgc    344160
     tggcagtgta tcgtagccct ttctccggta gacgatgatg gaaatgatcc agctcacgat    344220
     aaaaatgccg acgacgccgt aaccaacgct ggaaaggtta tcgttgagct cgccaagaag    344280
     cctccagaag tgcccgttca gagcgagctt atcaacaagg agtccagcgg ccataaggct    344340
     accgataaac accgccacga caacggaagc agcggtaatc gtcaaattgt accacaactt    344400
     gcggaccgga ttgacgaagg cccagccgta cgctcccgtc atgaggacgc tgtcggtggt    344460
     atccatcaat gacattcctg cggtaaacag cgccggaaac acgaggatcg tccagaagga    344520
     catgccttga gcggcctgca tcgccgagat cccaagaagg ccgatttccg ttgccgtatc    344580
     gaaaccaagc ccgaacagga agccgatcgg atacatatgc cacgatcggg aaaccacgcg    344640
     gaaaaccggc cggaagattc ttgcaatcaa accgcgaccg gcaagaaaag cgtcaagatc    344700
     ttcgtcgacg atcttttctc cccttctgac gcgcttgaaa gcggaccaga tacctttcag    344760
     cacaagcaga ttggctatgc cgataatcag cagaaacacc gctgacacgg ttgttccgat    344820
     aacacctccg atttcggcga tctcgttgag ttgcattgcg gcagctgtcg ccgcgatgac    344880
     gatggacgcg agaacgacga tggtcgaatg tcccaacgaa aagaaaaagc cgaccgagta    344940
     gggggcttta ccctcctgca tcagctttct caccacattg tcgatcgcag cgatatggtc    345000
     gggatcgaag gcgtggcgca gaccaagcat atatgcaaga aacgcggtgc ccatgagggc    345060
     aggtcgatct gcaaatgcca cccaagccca aacccatgcg gcgatattcg ccgcgatcag    345120
     aaagacaaaa gtagtcgccg cttttgctct ggtctggaat ggcttgtcgt cgaacggatt    345180
     cggaaacatt ggctgccctt tgtaaagtca tggggaggct agtcggcaga gaactgccga    345240
     ctgctgtctg ttcataggct gttggagatg gcgttagtgg cggccccagc cggggacgtt    345300
     gccggtgtat tcgacctcaa actggtcgaa ctcggccatg aggtcgatga gttgctgctc    345360
     ggacgccctg cggccgttgg cataaagggc gccgagcctg cggaaatatt cctcgcggtt    345420
     ttgtcccgga ctgaagaaaa tcagcatcac cgcctccttg tcgaacggat tgtggaaccc    345480
     gtgcggaacg tcctcgggga cctgaatata tgtccctgcg ggggcagcga catgctcgcc    345540
     attgatgaag atttccacgg tcccctcaag gacgtagaag gcttcgagct gatggcgatg    345600
     aatatggggt gatgccccgg gtgcaccggg tttcatgcgg tgctcaaaca agccgatacg    345660
     attgtccgtc tccttcccga cggccttgaa cgttgtatgc gtggtggttc cgatctgcac    345720
     ggattcacct tcaccaggaa acagggtctt cgaaaattgg gtcatgaatg ttccttcctt    345780
     tgatgctgaa caggatctgc aagtcgatgg ggtgttatgg gagctgcgtt gatctgcccg    345840
     ttatgaactg agcagcgata cgtaccgctc gcctgagtca ggaaagatcg tggcaatacg    345900
     tgctccggct acagccgctc tctgtcgaac atggcgacaa acatgggtga cagcgcccga    345960
     tgatattccc gcgacgatcc cggcagcggc aagcttgcgc gccattaccc aggcatcctc    346020
     gtcatcaacg gttacgatct catcgatcaa cgcgcggtct gtcgtcgccg cgacaaagcc    346080
     gccattcagc cccggaatac gatgaattcc accaagtttg ccactcagga cggcagagcg    346140
     agacggttca acggcgatga ttttgatttc cgggttcttt tccttcaggt attttccgat    346200
     accgctgatt gtcccgcctg ttcccacgcc gcagacaagg atgtcgatgt tcccggatag    346260
     atccctccaa agttccggtc ctgtcgtttc gtagtgggcg agaacgttgt ctgcattttc    346320
     gtgctggcag gcgaaccacg cccccggtgt cgcatcacgc agttgttggg ctttctcgat    346380
     tgcggcagtg tatccagcct cgcttggcgt aagctcgagt tcggcgccga aaaacttcag    346440
     caactctatc cgctctttcg aagcactgtc gggaagaacg atgatacatc ggtagcctcg    346500
     ggcgcgagca aaccccgcaa gcgcaatgcc ggtattgcca gaagtggctt cgacaacggt    346560
     gcctgtaccc gggaccagtt gtcctcgcgc ttcggcaccg gcgagcatgt accaggcagg    346620
     gcggtccttg atgctggagt aaggattata tttctcaagc ttggcaaaca cccctcgccc    346680
     accggcgaga tctgccggaa gttcaagggt cggcgttccg ccaatgccag agccgaagaa    346740
     gcgggccgct tttgccgttg gcgaagccga cacctcgttc cggttgccgg tctgaggggc    346800
     tttgcccttt tccaaatcgg gataaggcgc cgggattgca gctaccgaag cgttgcttga    346860
     cgataaaggg ttaacaccac tcatgacttg ttcgcctttc cagaagaggc cggagagaga    346920
     gaggacgatc caatgcgacc ctcggcgatc gccatcccga tcaagatgac agccccgccg    346980
     aggatgacgt tccacgacag tggttcaagg agcaaaacag caccgaagag gacggcgaac    347040
     accggaacga catagtcaac ggccgacgcg gttgccgcgc caacatcctg gatcagcctg    347100
     aaatacagga tgttggcaaa gccgctggcg agcacgccga gatagagcag ggacagcagc    347160
     ggtatcacgg agacggtttc gattgcgggc caggcgaaga atggtaaagc cagcccaaga    347220
     aggacagctg ccgaaatcag ctggttggcg ccaagcgtga tgggatcaag cttcaagggc    347280
     gacaggaagc gactgacata ggcatagccc acggcatagc tggcggcagc gccgaagcat    347340
     gccaatgcgc caagcagtga gctgccctcc accttccagg gactgacgac cagagccaca    347400
     ccgagaaagc ccaggaaaaa gccggtgact ttgcgcgggg tcgccggttc ggcccgcaat    347460
     gcaagcgtcg agatgaacag ggtgaccagg ggcgtgcccc cgatcagcac acccgccagg    347520
     ccggcgctgg tgtgttgttc gccgaaactg agcaagagat aaggaacgac gtttgcgaaa    347580
     atcgaagata cggcaacatg gaaccatgcc gtgccgctca gcttaaagga tcgtcctgtg    347640
     aacaaaatga tcgcagcgag cgtcaccgcg ccgaggatca gccgaaacag aacaagctgg    347700
     ttcggactga agtcctgaag cgcgaacttg atgaaggtga aactcgcacc ccatatcgcg    347760
     gcttgtccga aaaaccgggc cgcagttgcc ttttccattg tcactctccc tatttggcgt    347820
     tctggcgctg gtcgtaattc ggctgcctaa ccagaaattt ctgacgtccg atgatttccg    347880
     gctggtagac gagagcgtcc cagtttgcct cctccaccgg ctccagcgcg accgagacca    347940
     cgttcggggc gcagccaaag gccttgatga cggcagatgc gagctcgtcc gccaaaattt    348000
     gccggcgacc ctcatcgatt tgggctggga aatgcttgac gctgatatga ggcatgagaa    348060
     tctcctgatc ggatgacagt aggtcgctga gtgcctgggc gagtgcggtg tgaccctcgc    348120
     cgcgcaagat cgaatagtgg tcatgggaca gttcgatcac ttgctgaaag ctctgtcgga    348180
     cgcggctgcc cgctgtctca aggaacgaat agtcatcgcc caatgccttg atgagcgtga    348240
     tgggcgcagc aactgtccgc tggtcaagtt catggaatgt gtattcgaag gagaacgttg    348300
     ccttgacgac accgacaatc ctggcaacca gttcagcttg gagatcctcg aatttgtcgg    348360
     tgatgaagtc tatgaatgcg cgctcgtcac gaacggcgcc aagcagttcc gtttccaaag    348420
     gcgagttcag tgtcccggcg aacacggaca ggaggatccg caggaaccgt ccgtcttgaa    348480
     attgatcggc ggttggcggc gcctcagccg ccttttgtaa cggcgatccg ggtgcgatca    348540
     gaacgaccct ttcgacccgg cgcccaagct gttcaagttg ataggcggcc tcaaaggcaa    348600
     ccctggcgcc gaacgaatac ccaatgcagg tcaaggggcc gacaggatga tcgcgctgga    348660
     tcagcgccac gtccgcagcc gccatctcct ggatcgttgg aaatggcacc tcgtcaagat    348720
     tgatcccgtg cgcctgaacg ccaagaaaac gatgacggtt gtcgccagtc gcccgcacga    348780
     gcgtgcgaag gctcatgggg taacctccca atccgggcca acagtagacg ggacgtgcgg    348840
     caggtgccgc attcagaggg acaaggcgac tggagagggt cgcagcacct gcaccgattt    348900
     cgcctgccag agcctctaca gtcggtgcgg cgaacagcgc ctggatcggc aaccgggttc    348960
     cgaacctggc gttgaaccga ttgatgagcg ccatcgctga aagcgaattg ccgccgacat    349020
     caaaaaagga atcccttatg gaaagttcct cttcgcctag acgcagtatc tctttccaga    349080
     tcgccgcgac ctcaagttcg agcctcgtgc caggtggtac gatcgggcgt gcgctttcct    349140
     ccgcctcaac aaggttgcgc aatgactgca gatcgatctt accgctcggc gtggtcggtg    349200
     ttgtctcgat cacccttacc cgcgccggca ccatatactc cggcaaaagc tcgcgcagat    349260
     cgtccttgag gatttccgtc ggtccgcgca tgtgcacgag atcttcttcc atgccgcggc    349320
     tggatcgttg ctcggccgaa accccgcctc cgagcgcgaa ataggaaagt gtgccattgc    349380
     ctgaaaacgt ctccgcaccg atgagcgcat ccacccggct ggacgttgcc atctcgtgtc    349440
     cggatagcga actgtagcct gacgacatca atccgatgtc ggggtcagcc acctgcaatc    349500
     ggtggagaag acggccaagg tcaacgaacc cttcccatcc cgcatctttc gaaacgatga    349560
     gggcaatacc gaacgttgat cggtcgtaga cggcctgatt gatggcgatg acgtctttgc    349620
     ggcggatgac aggctcgcca acaatggtca gccggtcgtt gtccactcgg taggtaccag    349680
     gtccgacgcc gtctggtgtc tcttcgtgga tttgcagaag gattacaggt gcggcgaacg    349740
     gcggcggtgc aggcttgcgg tccagttcca cgctgagggt gtgaatgtag tcgtcgccac    349800
     tgaagagtgt tgccggaatg gtgtgaggcg gtgcagcttt tacagggaat aagccgtgcg    349860
     cggccgcaac gtgctccaga agccccagca tgtgcccggc ttccaggtgt agaacctcgt    349920
     ccacatttgt cgaatagact tcctggatac gtccacgctt gccatagatg tggaaccgga    349980
     cgcctccccc agatcgcgtg cccggcgaaa caagtgtcaa ggtgtgatcc gcggggtgga    350040
     agtaatacaa gccaggccaa agcccctcga cgccattgac gtcgacgaag atttgcgagg    350100
     cattcagcgc tccgggagat gcataggcat atttggccaa gagacgccga tcgctggtga    350160
     aggggccaaa ccaccgcaag atctgtccaa tcagcgcctt gtcgagcttc acatcctgag    350220
     cgctcgtcga cacagggggg tgctgtattt ggcgtatcgc ctcaaccagc ctgtcagctc    350280
     gtactcttgt cctgaaattg cgataggtct tgcgcgcgaa tgcctgcgcc gcgacatcct    350340
     ccgatgcctc acggaacggc aggatgacac tatttccatc gagctcgtcc ggtgcgcgga    350400
     aggcgctgtt tgacagctgc gcattgacct gacggcggct tgccttggat ttgtgatggc    350460
     tgccggcggc gctttggtcc atcaacgccg cctcggtatc atcgagttcg acgaaggcgg    350520
     ccaattgagt ggtgccgaga cgggttttcc acgggacgac cgtcgctcgt cgtatccaga    350580
     gatggttttc gatcgccagg cggatttcgt ccagttcgat gcggtggccg ctcactttaa    350640
     cctgattgtc gacccggcca tgaaaggcga cagccccatc ggcacccttg atcgcaaggt    350700
     cccccgttcg gtagacccgc cgttcgcgtc cctttgcatc gatcaacgtc gtgaattttt    350760
     cagccgtcat ctcggcgttg ccgatatagc cccgtgccaa ctggggtccg gcaatacaca    350820
     gttcgccgat gtccccatcc tcgatctctg tcggcccttc gcaaacaata aggtccgtgc    350880
     cataaaccgg gtagccgatc gggaggaccc ggtccgtgtc gtccagttgg tctgccttga    350940
     cggtataggc cgaaacgttg atcgtggtct ctgtcggccc gtagagattg gtgacactcg    351000
     ccgacggatg cgctgcaaga aggccctggg caagatgcga cgtcaacgcc tccccgccgc    351060
     tgaagatctg ggacaagttc agatcccgaa acccctccgc atccagaagg gcgctccaaa    351120
     gtgtgggaac gcactgaagg gtcgtgacgg cgtgtcgtct cgcggtttcg atcagccttg    351180
     cagggtcgcg ataggtgcca atgcccacca tgaccacggt agcgcccagc gcgacagcga    351240
     ggatttccca ctgcgccgca tcgaagctga agggtgtctt ctgcaaaatc cttacggatt    351300
     cgtcgatgcc catggcatcg tgcagccagt taagctggtg cgcgatgctg ccgtgctcga    351360
     tcgcaacacc tttgggtctg cctgtgcttc ctgacgtata gatgacgtag gctagatcgt    351420
     tgggacagac atcgccaccg tcttgcgcgt cctcaccctc cgtttcccag tgttcctcaa    351480
     cgcagacaat actaccttca gacggcgtga tggtccgtgc atcgcttgca agaggtcccg    351540
     tcgtgaggat gatcttggcg ccggaatcct caagcgcata gcgcaagcgg gtgctggggt    351600
     attccgggga caaaggcaga tatgcgcctc ctgcgcgaag aaccgcccag atggcgatct    351660
     caagctccag cgaggaatcg acgaacacgc cgaccaccgt gtcggcccta accccctgta    351720
     atcgtagtcg gactgcgacc tgtccactgc gccgccagag gtcgagaaat gtcagagacc    351780
     cggtatcaga cgccacagca acccggtgcg gatgacgtcg aacctgttct ttcagtttct    351840
     gtatgagtgt cgaagatgtc atctcgatac cgcccgtttg gaatggctac atccaagcag    351900
     attgatatca atcttgataa caatgatgtg ctcaatcgcg gagcgcgatg ggaaaaaatt    351960
     gctcactttg agctgtcaag cgcacatctt cggagcactt tgcttaaaaa gtttgctttg    352020
     ctggtttcgg ccatgcatca acagaccaga cgttagtctc gcgaaaaagg cagcagcagc    352080
     ttgcgatagc tttcctcttt tgccccgccc cgcaactcag cccgggtcgt gcgaccgacg    352140
     atctttccat tcgccatgac cgcgatctgc tcgcacagct gcgcaacgac cgcgaggtcg    352200
     tggctgatta gtaggtagga gatcggccgt tcgacccgca gatctgcgag cagattgagg    352260
     atctcagcct gcacggatac gtcgagtgac gatgtcggct cgtcaagaag gaggatctgt    352320
     ggctcgacga gcagtgcccg ggcgatgcaa agtcgctggc gttgcccgcc cgagatctgt    352380
     ccggggaaac ggaagcggac ggaccgcggc agaccgacaa catccagcac atcggcaatg    352440
     cgtatgtcct gacgatcgag gcgatgaacg atcaatggtt cgcgcaggat cgcatctacg    352500
     gtatgcgccg ggttcagagc agccgcagga tcctggaaga cgatctgtag ggtacgacga    352560
     tccgcgaagg tccgcctggc cgcaagttta cgaccgaaaa cctcaatggt tcccgaccag    352620
     gtatcgtgga tgcccgcgat gcatttcagc aatgtgcttt tgccgcagcc ggattcgccg    352680
     acaatgccga ggctttcgcc gtggcccagc gtcagcgaga catcgtcgac gacaagggag    352740
     gttccgagcc ggatcgatag tccgtcgata gaaagggcac tgatcgtcat cgggcccaat    352800
     ccgggtcgcg cgtgagaatt ggcaaacgac gacctggatc gtctagagtt ggcacgcacc    352860
     cgatcagtcc gcgcgtatag ggatgctgtg cggtctggta cccctgtccc gagatcagcg    352920
     tttcaacggt acggccggca tacatgacca gaacacgatc tgcgaagtcc gaaacgagct    352980
     ccagatcgtg gctgatgagg atgaggccca tgccgcgcag ccggacctgc tcgtctatca    353040
     gctcgagaat gcgcctttgc actatggcgt cgagggccga cgtcgcctcg tccgcaatca    353100
     gaatatccgg cccgccggca agcatcattg cgatcatcac tcgctgggcc atcccgcccg    353160
     agagctcgtg gggataaagg tcgaataccc ggcgcggatc acgaatatgc acctcgtcga    353220
     ggagcatctc caccgcattg cgcacgtcgc gccgcggggt ctgtcgatgg atgcggagca    353280
     tctcggcgat ctgccgcccg gccgtctgca caggattgag gccctgcctt ggatcttgaa    353340
     ccaccatcgc gatgcgatgg ccgcgaattg cgcaaagctg cctgccagac agcgacaaca    353400
     aatccatctc gccgaatcgg gcgtggtggg ccgtgacgat cgcattgtgc ccggcaagtc    353460
     cgagcagcga gcggaccgtc atcgactttc ccgaccctga ttcaccgaca atggcaagac    353520
     gctcgcgacc gagcgtgaag ctgacgccct tcacgacatc agcatagccg ccggggcgac    353580
     gaaagcttac tttcagatca cagatatcga gtagcggagc cgacaatggg agtgcctctc    353640
     aggatcgggg gtcaacaagg ttgcgcagcg catcaccgag caaattaaag ccgagcgcga    353700
     aggtgaggat cgcgattcct ggcatcgtcg acacccacca tgcctcgaat atgacatccc    353760
     taccctcggc caccatcgct ccccactcgg cctgaggcgg cggcacgctg gcgcctaaga    353820
     accccaatcc ggaggtgatg agaatgatgc tggacgcatc gagtgtggcg cgcacaatgg    353880
     ccgaaggcag gcacaacggc aaaatgtgcg tgaacatgat gcgcgttggg gatgccccga    353940
     tgacttgggc ggcctgcacg aattcggcgc gcctcagcgc cacggcctcg gcgcgcgcga    354000
     tgcgcgcata ggacggccag ccggtgagcg cgatcgcgat gatcgccgtc gaaatgccgg    354060
     ggccaagcgt gaccgccacc gcaatcgcca ggacgaggcg cggaaatgcc atgaacacgt    354120
     cacagagccg catgatcggc gcatccagtc gctcaaaaat gccagcggtg atgccaacca    354180
     gcacaccgaa aggcagtacg atcgccagga cgcaggcgac aatggacagt gtcggccgag    354240
     cgccggagag cacgcgcgaa aaaatgtcgc ggccaagcgt gtcggtccca aaccaatggg    354300
     cagcggatgg cggctgcagt cgatcgccaa gggcctgaaa gccggggttc tgaaccggca    354360
     gaaatgtagc aagcagggcc tcgcccacca tcaacgcaac gatcagcagc cctgtggaag    354420
     cgatcggatc gtgcagcagc gccgagacgt cgcgtgtgac ccgtcccaat tgcgcctgaa    354480
     ggcgggtgtt ggggctgtcg tcgagaagcc atgtcttgac cttgcccata cgtcagcctc    354540
     gtgtccgtgg atcaagccgc gcctgggcga cttccgccac ccggtttagc accatgaaca    354600
     tggtgccgat gatcagcgtt ccggccagaa cggcacgcat gtcagaggcc atgagagatt    354660
     gggtgatgta caagccgagg ccaggccagg cgaataccgt ctccgtcaag acggcccctt    354720
     ctagaagata ggcatagttc caggcgacga cggcaagcag cgggccgacg gcgttgggca    354780
     gggcatggcg ccacaggacc cgtgtttcgg acagtccctt cagccgcgcg acgttgatat    354840
     agtcttgtcc gtactgccac agcagaaaac cgcgggtggt ccgggcaatg tcgctgaaag    354900
     caaccaaacc gagcagcgca gctgggagga ctatatgtga cacagcattg ccgaatgccg    354960
     ccatgttgcc gctgagcgcc gtgtcgacca gaacgaggcc ggtcaccgcc ggtatcgtgt    355020
     actggtaggc gatatcaagc cgacctggac ccgctaccca gccgagatgc ccgtaaaaca    355080
     gcagcagccc caccagcccc atccagaaaa tcggtatgga actcccaagg atcgtcgcca    355140
     gcctcaccag accgtcgggc cagcggccgg agaagcgaac cgccaacagc ccaaccggta    355200
     cacccaggcc aacgcccaac aaaattgcca ccgtcgccaa ctcgactgtc gccggcaaga    355260
     accgccctat gtcctgtgcg accgcgttcc cggtcgtcgt ggcgacaccg aaatttcccc    355320
     gcgccatgtc gaggacaaac aggacgaact gttccggtat gggcttatcc agatgcatct    355380
     ctcgatgcat ccgttcatag agttcttggg gcgcgtgatc gccgatcacc gtcaggactg    355440
     ggtcggttgg aagcaaacgt ccgatggtga atattacaaa aaggaggccc aacaggacga    355500
     cggccggaac gatcgccgcc gaagccaatc gcaggaagac ctgagcgatc gcacggacat    355560
     agacccacgc ttgtcgcgcc gccaaagaaa aagccggggc aaatccaacg aaaagagcgc    355620
     gcccagacgg caatgtcggg atctcgttcg tcataagctt gcccctcgtg atcaccagtg    355680
     accgaacgac aaccgtgagg tcaccgacgt cgggcgaacc atttcatggg gcgaacaaca    355740
     ttgctaacaa tatagatttc attatatgcg gatcttggag atataattcc ggcgattgga    355800
     ccaacaacgg aaaggcagcg gtttgcaaag gccgaacgga aggcgccagc gcaagatctt    355860
     ccgtcgccct cctgctttta agcgtcgatc ctggtcaggc tctgctccaa ggccttgccc    355920
     atattgttga gatgctcgag catcgcttgg cccgcacgca cgccgtccgc cgcgcagatg    355980
     gcgtcgacga ttttttcgag ttcccggagc gattgcttga tccgaccggg gaacaagact    356040
     gtctgggcgc ggaagcgagc aatttgcgcg ttcaacgtcg cgataatgcg ggttgcagtg    356100
     gaatgggcgg cgatccggcg gatttccgcg tggagcttgc cgatgtgctg cgaatattcg    356160
     acatatgcct cttcggcttg cgcctgagtg attgcagcca agatgctctt gaggcgctcg    356220
     caatcggcgg cggtcgcctt ggcggcggca ttgcgggcca ccagcatttc aagcgaagcg    356280
     tatgtctgta gaatctcgac agcttccttc tggctgatca cacgcacacg cgcgcccttg    356340
     ttgcgctcga cttcgaccag tccttcctga tcgagcttgc caagcgccag cttgacattg    356400
     acccggttga cacccagcca ttcggccagt tccacctcgg ggaggcgctg ccccggcaaa    356460
     aaatatcccg tctcaatcgc tttgcgtaac cttgccaccg gatcggtgtg tcgcttggaa    356520
     accctggtca cttcaatctc tcttcaattc actcgcatta ctcaaaagac agcatcaaag    356580
     ccgtcttccg cccgtggcgg cggtaacccc gccattttcc cggacgctat gattagcata    356640
     caatattgtc agcaatgtcg ctagcaaaga ggataatttt acattcggcc aagtttacag    356700
     aaaaataatt caaagttgaa ttaggcataa atacatcaac ctgggactgc gtgcgtggag    356760
     cgggaggcca ccgccgtcgg cagacggagg acggcgccgc cacttaccga cagctacact    356820
     ggcgggagcg ccaggcgcgc tcaataaacg gtgatgaccg cttggtcggg tcaggccgcc    356880
     aggatagcct tgagaaaggc tctggtccgg atattttgcg gcgcctcgaa aatctgcgcc    356940
     gggctgcctt cttcgataat ccggccgccc tcaaggaagc aaacccgatc ggcaatgtcg    357000
     cgcgcaatgc ccatatgatg cgtgaccatc agggtggtga attgatgctc gcgtgcgagg    357060
     tcgcggatga cggaaaggac ctcacccacc gtttccggat cgagtgccga cgtgacttcg    357120
     tcgaacagca ggatcttggg gcgcatggca agcgcccggg ctatcgccac acgttgctgc    357180
     tggccacccg aaagctggat cggaaagctg ctttgcttgt ccgcaagtcc aacgagtttc    357240
     agaaggtcaa gcgcacgtgc atatgcctcg tccttggaaa gccccagcac gcgaatggga    357300
     gcctccgcga tgttacgcag cgcgctcata tgcggaaaca ggttgaagct ctggaacacc    357360
     atcccgatct tgcgccggat cgcccgagtt tgcggttcgc tggcctgccg gcttgatttt    357420
     tctgaaccct ggtcatgcca aagcgcctcg ccatccacca atacgccgcc ggcttgaacc    357480
     gtctcgagcg tcatgagaat gcgcaggatc gtcgatttgc cggaaccgct tgggccaatg    357540
     agcgtcagat tttcgttctg catcacgtcg aggttgaggc tcgaaagaac cgtttgggcg    357600
     ccgaatgtct ttttcacctc gcgaaacgtg atgatgggca aagtcgtctg gtcagccacg    357660
     gctcggtctc ctgcccagcc aggctttcga caccatcgcc tccaaccgcc gcacgatgag    357720
     cgacgttgca aggctgatga ctaaaaagat gaggccacac atcgtgatgg gttcaatata    357780
     ttgaaagtga tccgcgccat actgcatggc gacaaacatg atgtctgtca ccgcaatcga    357840
     tgccaacaac ggcgtttcct tgaaaattga cacaagcaga tttccaagcg ccggaatgag    357900
     gaaggggacg agttgcggca cgataacgtg ccgataggcg gcaaaccgcg aaaagccaag    357960
     cgcggtgatc gcgtcgcgct gccccgacgg caaggcctca agaccggcgc gataggcctc    358020
     ggcgacgaag catccgtaat ggatcgccag cgcaagaatt ccagttgtga tcggcggcaa    358080
     aatgatgccg gcctggggta gcacaaagaa ataaaaatag atctgctgca acaagggggt    358140
     ggatcggatg aagtcggcca ggaagatgcc gggccccgcg attaaaacaa aacgcgaccg    358200
     tcgcgccatc aagagcggga tgccgactgc gagcgcccct gcaaatccca ggatcgcgac    358260
     gtagatcgtc acattcgccg ccgaaatcag ctttggcaaa atagctgccg cgacgtcgag    358320
     ccggaaccag ttgagctggt ggatgtcgat gccaagtatc gtcatctgat cgccacgatt    358380
     atccgatgcc tggcgcgcgc cgtgtgtttc ccccaaatga ctgccgatga aaccccgcgc    358440
     atcacgccgc acctgccgcg ccgcgcaact tccacccgcc gaagcgtcgc tccatccact    358500
     gcgtcaggcg gatcagcgcc tgcgcgagta tgaaatagat ccccaagact gtgagaagca    358560
     cggggaccgg ctggtaggtg ctgacgatga tcgaatgcgc ttgctccgtc agttccgcga    358620
     gcccgatcag cgaaacgatg gacgtgccct tgagaagcat gacgaattcg ttgcccatca    358680
     acggcagtag cgcgacgagc gcctgtggaa gcacgacata gcgcaccctc tgaaaggcgc    358740
     tcatactcaa agcgacagcg gcctcggtct ggctgacagg cacggacaga accgccgccc    358800
     tgacatattc cgacgaatag gcggcgtgcg tcagcgaaca gccgatcacc gccgcctccc    358860
     acacgctcaa ctgcatgcca aggaaaggtg cggcaaaata gagccagaac aacgtgacat    358920
     agagcgatac gccacggaaa aattctacaa aggtcaaggc cgcataacgc acaagccgta    358980
     tccgggcgag ccgggcaaaa ccgaccagaa gtcccagcac ggagccaagc gcaaggacga    359040
     tcaaaaacag gaggagcgtt tgcgccaacc cgtcaagcag cagcgggacc cacatgagca    359100
     ggtcacgcat gcgcaggatc gccaaccaga accgcatgga gcgcttcagg accgcccagg    359160
     agcgtgaggc acacgatcgt tctactcctt gcagatgtcg acaagcttca cgtcaggcga    359220
     cgggacatct gccggcgtga ctgaatattt tgcaagaata gcttcatagt ccggcgtgct    359280
     ccgaaacgcc cgcagcgcat cgttgaacgc cgcaacgaga tcctggtcgt ctttacgaaa    359340
     gccgaaaccc agatagttga tcgacggttt tccgtcaaag acggggagta taaacggcgt    359400
     cgcccgctct accgactttc caccgtcagc cgctatggat tcgttcgcgg cgaaaatcgt    359460
     cgacgtggtg agatcgacgc ggcccgattt cagagcgaag aacacttccg gaaagtcctg    359520
     gaacaccaca agctggctct cgggaatacc cagccgctca aaatccttgc gcgacgccga    359580
     tccctgctgc gtaccgatct tgatggtcgg atttttcagg acgtcgtcat agctatggat    359640
     gttcttcgga tttcccttct gaaccgtaat cgcgtcagcg atctgaatat gcggttcggc    359700
     aaaggcgatt tcggcgcatc ggtccggacg aatgaaaagt cccgcggcga tggcgtcaaa    359760
     atgccccgct ttcaggccgg gtatcaacgt gctgaatttc acagccactc catcaaccgt    359820
     atgaaccccg agctttgcga aggcggcccg cgccagttca tagtccacac ccgcaaggct    359880
     gccatctggc tgtttgaaac tatagggttt ctcgttggaa aagccgatct gcacgacgcc    359940
     ggtgcgcttg atccgctcca aagtgctttc tgccgccgcg gacgatgcca cgatgcccgc    360000
     tgaaaaaatg gcaaggaccg acgccaggaa aattctcttc atatgcactt acccccgagc    360060
     aattcgcgtt tcattttgca ccgccaccat atgtgaaact tggatattga taacaatttt    360120
     gatttcaatt tttggggcat tcagcgaatg ttttgccgtc atgtccggcg tgatgaggca    360180
     tcgcatgccg ggacgatatg cgacgagatt gatcagacgg cgtttagccg gcaaggcgtg    360240
     acgcgttgcc cgagcgtgcc cggccgtttc cgaacaaggt ttcgcgaaag gtcgaacgat    360300
     gctctgcgat acgtccgcgg ttgcgcaact caggaatgac ctggtcaacg aagtcaatga    360360
     tgctgcgcgg cgtcacgatc gagttgaaat tgaacccgtc gacacctgtt gcgtcgacga    360420
     tggcttccag ttggtcggcg atctcaaccg gcgttccgac cagaatgccg tctccaaagc    360480
     gtccaacatc gtcaatcacc tcccgcactc ggaacggcct gtcggactgc gtggtgtact    360540
     gggccgcgcg cgactggttg gcctcggtcg gcgcataggc caggatcgca tccggatcga    360600
     gggaagacag atcgtagccg gacgagccgc aatattgcgc tagcgccgat tcgggcgagc    360660
     gatagcgggc ataatcctcc aaccgctcgc gggcttctgc ctgcgtcggc gctacgatcg    360720
     ccgtctgttg atggaagatc agaatatcgt cgggcgcgcg tccaaagtcc acggcgcgcc    360780
     ggcggatgtt ggtgacgttc tccttgaccg ccgccaatgt ccgcccctgc acgaagacgc    360840
     attcggcatg gcgggcggca aagtcacgcc cggccttgga actgccggct tggaagatga    360900
     caggcgtcct ctgcaaagag ggctcgcaga catgcgggcc tgcgaccttg aagaattcac    360960
     cgtgatggtc gacggagcga accattgccg ggtcgatatg aacatcgttt tcgatgtcaa    361020
     accggacggc accgtcactc caactggatt cccacagctt gtagcagatg gtcaagaact    361080
     catccgcgat ggcgtatcga cggtcatgtg ggatgggttc gtccaacccg aaatagcggg    361140
     cagcggcggc gatataggag gtgacgacat tgaggccgat gcggcccttt gtgaggtgat    361200
     cgagcgtcga aagccgccgg gcgacatgga agggatgttc gtaggttgtc gagatcgtcg    361260
     tcacgaaatt aagcgtcgcc gtggcattgg ccatggaagg aattatcagc gaggggtcgt    361320
     tcgaagggaa ttgcatcgca tggcggatcg cgacgtccgg tgaaccccta tagacgtcgg    361380
     atgcaccaaa gaagtctccg agaaagaacg cggtaaaacc gccttcctct atcttgcgcg    361440
     cgatggttac ccagaaatcg atgtcattat aatcgtgatg ctgactatcg ggatggcgcc    361500
     aaagaccgtg cgagtcgccg gtgcggttgt tcaattcgaa gagattgaaa aagatcggtt    361560
     tcctagccat tgcgccctca gtccctgatt tcattgccgg gaatgcggct gtagcggctg    361620
     ggtggacgcg ggatatggag gttgtcgcgc agtgtcgtgc cctcgtaggc ctcatgatag    361680
     agcccacggc gctgcaattc cgggacgacg agatcgacga agtcgtcaag atcacctggt    361740
     aggtaggaga agcgcacgtt gaacccgtca gcgccaccgc ttttaaacca atgctcgaaa    361800
     tggtcggcaa tatcggacgg cgttccgacg atcgtgttgt aaccggaggc gagccatcgg    361860
     tagagttcgc gaatagtcag tcccgttcgt tttgcatggg cgaccagcag ctcctgccgc    361920
     gttttatcgc cctctgtcgg cgggacggcc ggcaatggac catcgattgg atatttcgac    361980
     agatccgctc ctgctgcccc cgacaacata gcaaggccgg cgacggggtg taggagatcc    362040
     tgcaattgct catacttttc ctgcgcctcg ctgcgcgtcc tggcaacgac aggggtgacg    362100
     ccgggcagga ttgcaacgtg atcgggatcc cggcctgccc cggccacgcg cgcccggacg    362160
     tcgtcataaa atgcgatcgc accgggtaga tccgattgtg ctgtaaagac gacatccgcg    362220
     aaactggccg ccgcgttgcg tccggtgtgg gaggaacctg cctgtacgat caccgggtgg    362280
     ccttgcggcg ggcgggcgac agcgagcggt ccgcgcactt tgaaatgttg gctggaatgg    362340
     tcaagcaggt gcatcttgtc cggactgaag aaccggccac cccctttgtc gaacaaaaag    362400
     gcatcgtcat cccagctgtc ccaaaggcct ttgacgatat cgacaaattc cgtcgcccgc    362460
     tgataacgaa gcgcatgggg cggatgttcg cgccggctgt agttcagcgc ctcggcgcca    362520
     tttgaagagg tcacgacgtt ccagcctgcg cgtcccttgc tcagatagtc gagggaggcg    362580
     aactgccgcg cgacaaaata cggttcgtag taagtcgtgg tgacggtgcc gaccagacca    362640
     atccggctgg tcgcaacagc gagcgccgag agcagcgtta ccggctcgaa atcgactacc    362700
     ctcgcgctat agctcagcgt ttcggcatcc agcttgacgg gaaagggaag cgtatcggca    362760
     atgaaaatcg cgtgaaacag acccctttcg gccgtccttg caaaggcgat ctgcgcatcg    362820
     atatcgaggc ttgcctgcgc gtcagcgcgc gggtagcgcc atcccgccgt gtgttggccc    362880
     ggcgtctgca gaaatgcacc gaggatcagc ttgtcgcgtc gtgccatgtc atgatctcaa    362940
     tagaagtatg tcagaggaaa gcaccatgcc ggatcatccg gcatggtgct tagggatcag    363000
     cttttggtgg tgcgccaata ggctggggtg tcccagctcg ggcctggcac gaacccctta    363060
     acatttgcgc gaaccggcac ctggccgagc tgctggtaga tgacgatgaa cggcgaatta    363120
     tcgcggacct gtttctgcag atcgagatag atcgcttctc gcttggcggg atcagattcc    363180
     gttaggccag acagcgtctt tttggtcagc tccggaacga gccagtgatc acgccaggcc    363240
     gcgttcttgt tcttggaact atcgctgtca tcgtcattaa tcgtgaaaaa cgaagcactg    363300
     gcatgaacgt ccagataatc tggcgaccat ccaaagaaga ccgcatcatg ctggcgtccg    363360
     cgaaaccggg tctgcagctg tgcccggtcg agcgtgttca aatcgacttt gaccccagcc    363420
     tgaccaaagg tggactgcaa ggactggctt atctcccgat cgggcgaccg gctcgacacg    363480
     tcaagcttga gcttgaaccc gtccttatac ccggccgcct cgagcagcga ctttgccttg    363540
     gcgatatcaa gtttatatgg cgtctcgtcc agcgatccgc cggagccgct gccccaaaag    363600
     ctctgatgga ccttcgcctg tcctttcaga atgctgccga cgatcccatc atagtcgatc    363660
     gcccaacgca gagcctgctg caccttggca tcgtccaagg gcttaacacc tcgattaagc    363720
     gcgatatagc tcacgtccgt cttggggctg gagataatgg tgatgttcga atttgttgag    363780
     agtgcttgga tctggtcggc actcaggttg cgcgcgatgt caacatcgcc cttctcgatc    363840
     aagaggcgtt gggtcgcggc ctcaggaatg tgacggagaa cgacgctctt aagggcgacc    363900
     ggttcacgct tgtagtgagt gttggcggta aggaccacgg cttcgttggg cgtccagccg    363960
     gcgagctggt agggaccgga gccggcagta ttcttcttca accagccggc gccgagatct    364020
     ccgtcggtct cgtgcttgag ggcttcctgc ttgtccacga ccgaggatac agtcgatgac    364080
     agtaccttca gaaaaagatc gggtgcgtag ggcttatcaa gcttgagcac gagggtcttc    364140
     tcgcctgtga agctaacccg gtcggcgata ttctccttcg accagccgaa ctgggttagg    364200
     taaaagactg gtgtctttcc aagacggatg acccgttcca aggaaaacgc tgcatcctcg    364260
     gcggtcacgc cacgaccgga tgcaaagaac aaaccttcac gtatcttgaa ggtgaacgtc    364320
     agaccgtcat cggaaaccgt ccaggattcg gccaccccgc cgaccggctt cgtgaaatcc    364380
     gaaggatcga aggtgatcaa ccgttcatag atattattga cgacctcgcc gccagtcgct    364440
     tcgtagactt cagcggggtc gagggtgatc agatcgctaa tgtattttgc cacgacgagg    364500
     gtgtcggcag gcgtcgcggc aaaggcctgc ggggcgccga agaggaaagg agcgcccacc    364560
     aagaatgcga cggttttgag caagccgccg cggcggcgag gtgggacata cgaccggccg    364620
     cgcgtcgaac gcgttcgaga aaatagaggc attaatatct cctgatgttg cttcggcgca    364680
     tttcgggagc cgaaacaagc atcattcgcc ttcgctcatc ccccgcaccg gacttcagag    364740
     tgaagccggc tcaaataacg tagcctcttt gcaatcatta ttgataacaa ttttgatctc    364800
     tttttatctc gctctttgaa aggagtttcc ctttaccacc aggaacccag cttaaccttc    364860
     cgcacccaaa accgatcggc ggacctgccc tgcccgctct ggcacctgcg tccggtttgt    364920
     gagcacaccg gcacaaacga cgcaaaacgg tcccgtgatc gaaagcgctg tcaaagacac    364980
     cgatcgtctc gagctgtcgc ggcggaattc aacaccctcc ccggcatctc tcgaaacctg    365040
     cctgggcaaa ccgaatgacg ggagaagact atgcggcctt agatttatgc acacgtcaat    365100
     ccatatggct ggttcgactt tgatctcgac agccggatag atttcggcaa gatcgccgca    365160
     cgaacagtca cgcactaaat gcccattgca aaactcaggc acagaaatct aatttttacg    365220
     gcgatttttg ctaatctgat acacattcga ggaatattcg tggctgcgat aatgatccct    365280
     gatttcatca cccactatca ccctctcgaa gacccgccgt tccaaaatct cagtgatgct    365340
     tccgatgatg agttaccatt catcatcgcc cggctctcgc accgtagagc ggcaggctcg    365400
     aaacggattt tcggccgagt ttatatggat taccgtcggc agaccgaagc caagctaaag    365460
     gatttgtttg tgaaagcagg gggaagacca gaacgaagcg cgccgaacta cttcgtcctt    365520
     ggcacctcga aatggtttgc gaacttatat cccgaagtcg gcgacgtacg gtttcccctc    365580
     agcacgtttg cgcctgagac gatcagtttc acctaccccg acagctgcgt atccatgaga    365640
     ctggggccaa acttcggcct gccgcctgat cctcaatgtc ccaatcacga aacggtgttt    365700
     cgcatcacag agctggagaa aatcatcggc aagtatggcc ttccgcgaga tgatgcagat    365760
     gatggcgccg cctatgctga ctatcattta cgcgaattcg agcgatacat cgaggtgcgg    365820
     gtctggacgg atgcgccaat tagggcgctg cctggtcgga gtcggtgagg cttctctgtc    365880
     gcgcaatccc tgattttgat acgtccaaaa aatgagcgta tcaaaccgca actacctcct    365940
     acacacggaa gctgccatcc agacgccgac aatgagaagt gccgacccgc cgagggctgc    366000
     tatggtgtaa gcgctgttct gcggccacgg ctgacagaag ttgacgccta ttttgtgagc    366060
     tgatggcagc cagacgctct gcctctgcca gcgcggcagt tttggttttg aaggggccga    366120
     catcgttttc ttccgtgtcg ggtaaccact tcggaaggaa ccaccagcct ccagggcgat    366180
     aactggaact gcttctgacc gagccgacat tcttggcgaa gaaccagccg gagtcgattc    366240
     cgtcctgctc ccatgagatg ctctgctctg tcacggcaca ctccacgcct attctttcat    366300
     cgggggtatt ttatcggtcc tgtacgacca gggcaataac tcgtcgatct gactgttcgg    366360
     gtggccgttg acgatcctgg taagcgcgtc agcgatatag ccaagcggtt cgacatcatt    366420
     gagcttggcg gtctcgatga gcgacgcgat ggtcgcccag tgttcggctc cggcatcaga    366480
     gcctgcaaac aatgcgttct ttcgatttag agcaattggc ctgatggatc gctcgactgt    366540
     gttggagtcg atctcgatgc gaccgtcgcc gatgaacctc gtcagcccat cccagcgtga    366600
     caaggtgtac cggattgctt cggccagctt tgtcttctgg ctgatgaggc cgagctgttc    366660
     ggtgagccag ggcgcaaggc tgtcggtaat cgggcgactt ttctcctgtc tgatgacacg    366720
     acgatcatct tgcgtccggc cgcgtatctc gtcttcgttt ttgtagagtt cggcaatgcg    366780
     ccgtagcgcc tcggtggcaa tgggtgcggg accggcggcg gccagctcgt aaaagcgccg    366840
     acgaacatgc gaccagcaga aagccagcga gaccgtgttc ttggcagcca acgggcggta    366900
     gccactgtaa ccgtcgacct ggagaatgcc gacgaagcct tcgagatggg tcatcgggcg    366960
     ctcggccttg cgatccggtg catagacata aacgacaccc ggtggatcat tgccctgcca    367020
     aggcctgtca tcgcgagcat aggcccagag ttgcccggtc ttggtcttgc cgcgtcccgg    367080
     atcaagcacg ggtgctgtcg tctcgtcagc gaagagcttg gaagaggact tcaacacatc    367140
     gagtagccgc tgatgaaccg gacgaaggtg ccaagcggca cggccaaccc agtcggcaag    367200
     cgtcgaccgg tcgaggtcta tgccctgccg cttgtagatt tgcgcttgac gatagagcgg    367260
     tagatggtcg gcatatttgg agaccagaac gtgggcgaca gttgcttcgg tcggaatgcc    367320
     gccttcgatc agccgggcgg gagccggagc ctggacgacg acatcctcgc aagcccggca    367380
     cccgtacttc ggacggcgaa caaccagcac ccggaactgg gccggaataa tgtccagctt    367440
     ctcgctgata tcttcgccga tccgatgcag atcatgatgg cagcctgggc aggcatgatc    367500
     atcgatatca acgaccatct cgatccttgg caagtgagct ggaagcgagc ctcggttcgt    367560
     tcgccgtttg gcgacccgcg tctggcgcag atcggctgag gcttgctcct ttgcttccag    367620
     gccatgcgcc tcgacctgtt cggcctcttc caagcccaag agaagctgat cctcgggaag    367680
     cgtttcggcg cggcggccga agcggtggcg ctgcaattcc ttgatgatct gccgtaggcg    367740
     ggcattctct gcctcgcgcg aaagcaccat cgctttcagc gcgttcaggt catctggaag    367800
     ttcgtccgcc cttatcgtca tgggtcaaga acagcatatt ttgcctccca aaacgagatg    367860
     tcggatggag ctgattcaat tggtcgcggc tgctatccgg cctgaacagg cgtgcgcgtt    367920
     tcgctcggcg catgcacgcg tttccagtcc agcccctcga acaaagccga gaattgcgcg    367980
     gatgtcagat gcattgcgcc gtcctgcatc cggggccaat ggaattcgcc atcctcaagc    368040
     cgcttggcga ccaagcatac gccactgcca tcccagaaga tcagtttgat gcggtcggtg    368100
     cgcttggccc tgaacacgta gatcgtgccg gagaatggat cagttcccat ctcagccttc    368160
     accagcgcag ccaatccctc tgcacccttg cggaagtcga ccggcttggt ggcgatcatg    368220
     actttaaccg cgccggacgg accaatcacg atgatgcttt catggccgca atgacggctg    368280
     caatcgtcgt ggcgtcagcg ccagatgcaa ttctgattgt cgcaccacca atttccagct    368340
     caatcacggc gtcgccgtga gccttcctcg gtgaacgtgc tcgccgcacc tttctcggca    368400
     tgggcatatc ctgtgcgacg acgacggcag gcgcaaacat cggtgccccg tccggcaata    368460
     catcgagcgg cttgcgggca agccgccgcc aggtgaacaa ctgttgcgat gtcagcccgt    368520
     gacgtcgcgc caccgaggaa accgtcacgc cgggctcatg gctttccgcg acgatctgcg    368580
     ccttcagctc gtcgctccat tcacggcgac gaccacttcc agtgaaaacc tcgaatcgtc    368640
     gaaccggctc gtcatccttg gttttaagcg taagctctga aatcgacata tgtctaagcc    368700
     ctctattcag gctcaacatc gtcaatcaca acatgatccg gaaggtgggg tcaaaacgac    368760
     gcttacgcta tggtcgtcac aagcgctgat cgtctacagg ggggtgaaga ttggaccccg    368820
     atcgggtcat tttccggcag aaatcgacag tcatccctca aacaggtaaa aagcagttcc    368880
     atcgagatag cgtatagtct cagcatcgcg gcgcactatt tcttcaagcg gatgcataag    368940
     ggtagcaatt actggataag tgaggtcgtc aatagttcgg ctaagttgtt ctccgggctg    369000
     caccagttgg cggacctcat gaatagattc aagccgcgct atctcatcaa gaccgacgta    369060
     tcggtttagg atacccgagt ggggagaaat aagcgcaaca gatgtaaagt acgatagcac    369120
     cttgtatggc tcgtcggctc gtcgcttaaa tcgatcgcgg tgcaagtaag cgtccaccgt    369180
     ccactcaagc tgcgattctc cagtacaaag tctagcatga tgctgtatgt cgccccctgc    369240
     cgtgcgggct cccacctcaa tgaggcaagg ccccgttgga gtcatcttca tctcaagatg    369300
     agcagggcca tttcgaatat caagtgcatc gagcgcctcg tatgcatatt tgacgagggc    369360
     gtcagccggg tcgcgttcgc ggggtagaat gctgatcgat ccacagagat cgagaacttc    369420
     atttgcactt aggcgattgg tctgccagat gtcgcataca tggtgttttc catcacagct    369480
     aacagtgttg accatatatt ccgtaccaaa aaggtactcc tgggcaacga tggcatcgtt    369540
     ctgtggcgtg taaacatttc cagtattgat gagctcttga taggccttca ccgattgctc    369600
     gaccgtatcg cagaagcgta tacctccgcc attgcctccg cggattggtt tcaggactac    369660
     ccgttgacct agcttgccgt gccattcacg aagatggttt tcatcttcta ttctgatttg    369720
     agccgccgcc ttgatcccag cggcccttat agtctcgatc attatgaatt tgtcacgccg    369780
     agcgggactt ttggctgtgc cattagacgg aaggttgagg cgttcgctta ggaaatctgc    369840
     aaactctacc cctacctcag atcccggtat taccgcgact ggagaatagc gcgaaattga    369900
     ttcaactgtg gcatccacgt tgccagtgtg agttatattt tcaatataac cgtctagctt    369960
     caaggatgac cggaacacga ttggaagctc aggagaactt tgaacccgaa cgcaattcac    370020
     gcctgcattt gtaaagctat caagtaaact tcccctgccc ttattggtag gtaagtacga    370080
     gtctacaatt actaccgtat ccttggtcat tggaaagctc catcctgagc gccaaattgt    370140
     ttagttgcca agtcgggctc cgccattgat ctgaagaatt tgaccggtga cttgggcagc    370200
     gtcatctgtc accaaccagc cgatcaaact tgcgacctgt ttcggatgcg taatagccga    370260
     agtgagggtt tcagctttaa gttgttgtct gcggccgctc ggaagtccat cgccaaaaaa    370320
     ttctgtctcg tcgacgtaac caggagcgat ggcattcacc gttatccgcc gagaccccaa    370380
     ccgctttgca aggtcaaaca catacggatg gagcgcgctc ttcgaggcag catatgaacc    370440
     tgtccccgag ccccgatacg ccgcgattga actcgttagt actaccctgg cgtcctcccg    370500
     gagcagaggc gagagggcct cggttaagag taccgcagtt aaaacattta ttttaaagtt    370560
     cccggtccaa tttgccgcaa ttgtttttaa atcggttgaa gcactcggtt ccagtagttc    370620
     aaaatttcca ccagcattat tgatcaaagc atcaacacca ggatagttgt tgccgacgta    370680
     ggtgcttagc tcggacacct gcctctcgtc agataaatcg ctcacaaatg aatcaactgc    370740
     attacccaat gcttctttgg ttttctcaag cgcgcttgct cgccttccca cgatgagtac    370800
     acggtatccg atagtgacaa gcttttcagt tattgctgca ccgattccgg ttccaccgcc    370860
     gcttacgact gcgaccttcg acatgtactt agccttcaga gttacttgag gagtgaataa    370920
     tatatggcgt ttcatagatc tgcggtttgt caaaagtcga tccactacaa ccactcttat    370980
     ccgttcgggt cggtcgtgaa cctcgtgtgc taaccggtat agcttcccaa gaagatggtc    371040
     gcgcacgctc tttgaagcct tatctagcgc cttgtctgtg tgctgctgca actcaacatt    371100
     aacctccatt cgctcctgcg gcgaaccaga gtcgattagg acgatttgcg ccgctcgaac    371160
     atcggggtgg ctcaatacgg cttcatacgg ttctcgcgga tagaaaagca ccgacaggaa    371220
     tttgacttga tcatcggatc ttccctcgac cgtaaacgca ccagcgcgcc cacaactgca    371280
     gacacaggcc cgcccgcggt ctccaagctg atagcgaacg actgggttga tgcagtcttc    371340
     gtccaagcaa gttattgtta tctggccgcc cagaaactca atatgttggt aaggtacaag    371400
     atgaaatgtt ccaatagtgc attgtgggta acttacccca atcacccacg tctctgtgga    371460
     cccgtacgtg ccataaattt ctaggttccc atacagcgta acctcatcca gcgttgcctt    371520
     gctgaatgct tcgcctgtcc agatgatttt tttcagcgtc ggtactcgcc gtcgggtttc    371580
     atttaaccgc tgcaacacaa ggctaatctg cgttggcgta ccggctagcg tagtcgcacc    371640
     cactgcctca aaaaacggca gccagcgatc aacggcttcg cgatctccca gagggccaag    371700
     gggaacgctg actgctcccg ccttatgact aagggcattg aagaatgggg acatcgaacc    371760
     gagttctgcc cccagattta agttcattac aacatcatca ggatcaagtg gatcccaaac    371820
     ttgacggatt ttctcgagaa acatcccgct ggggatcacg ctgataagag gctcggaagt    371880
     tgttccccca cttccaagga tgatggctcc ggcagattgc gaacgagcac gagcgagcaa    371940
     actttccctc actgctctaa aatcggattt gcggagaact ggtagtaaat ccaacggggc    372000
     accgtgttgg aatgggctat aagcgtcagc tagttcggga agcccggacg ctaattgcac    372060
     gatccttgtc gagactctgg aatgaggaaa ctggatttct ccatcagata aattcatcac    372120
     attgccctgt tgatcaaacg tctattaatg tccttcattt gtctataaaa agagtagagt    372180
     attcgcgggt caaggcggat atttatatcg cttgatgcag gtgaggtatt gaaatggaat    372240
     tttcccaact acgccatttc gtggcgctaa ccgaagtatt gcactttggt cgctgcgctc    372300
     agcagctagg catcgcgcaa cctcatctaa gtcgttcgat cgcaagcttg gaagccgaac    372360
     ttgaggtgcg gctcttcgag cggacaagtc gacgcgtcga attgacgacg gcagggaaag    372420
     cttttctcgg cgaggccttc gaagttctac ggggacaaca gcgtgcgatt aacgctgcgc    372480
     gcgcagctaa ccgtaaggac cgcgagactc ttcgcattgg gtttgtttca tctgcgacat    372540
     ttcgggttct tccagaagct gtgcgtcaaa tgcgcgcgct gatggatgta catgtcgagt    372600
     ttctagagca aacaacaaac gaccaaatag catttttgca aagtgggaac ctcgatattg    372660
     gcttagggca tcctccaatt accgcaggaa accgaatagt cgtagatatc ctacgaccag    372720
     acgggtacga tgtactattt tatgaggacc accctatggc tagctacaat tctgtctcgt    372780
     tcgagcagat cgcgggtgaa ccgtttgtct tgtttccgga gattgaaggt ccagtatttt    372840
     acaacagatt ccgcgaacta tgtcgcaggt ccggaaaaga aatgaacgtg tctcacgttg    372900
     cttccaggat gcataccatc catagcctgg tctctgcagg aatgggcatc gggtttgccc    372960
     cattacatac aaaaagtatt caagttgatg gaatagttcg cgtgccgctc acaccctacc    373020
     ccgaggcgtt gaagcttgat cttgctgcat tttatgaccg attaaataga aaacagtcac    373080
     tcaagctgtt tctcaagatc gcacaaggag tttaagttaa aactacaacg ccccaagaga    373140
     ctgagtgaga atatttttat gaattatcgg ctggcgacgt atattttcac cacttaaatc    373200
     cgtattttcc gaaaggaggt caagtatctc catgtatatc caataaatat aaacactaaa    373260
     ccagtaatag aaagtataat ttgatatgaa tcaattttca gatgcgtcga acttgcgaag    373320
     agcgacacga atagaggtgc caaaaacatg caaaagttga ataaggcgtt agttaaagaa    373380
     atgacgatgt gatgtaattt ctgatcgaat tcgccgagaa tccagataga aataaatgga    373440
     taagaaagtg cgtaagaaat tccgaaggct acaccgcaaa aagccactgc ctctggagct    373500
     cgaactaaag ccatgacgag gagagatata gccatggagg agatcgccca accagagact    373560
     agcgaactat tgaatttctt tatatgattt acgacaaaaa atctggaagt aaaaaggcct    373620
     atagttgacg ctacgatgaa aagtgatcct ggcagatctt tagctgccgc tgcatatgga    373680
     aggaatgata ttacgtaacc ccagatgctc ccggcgacta acaagcatag aagtgggagc    373740
     cacgaagacg gacttcgtat tataacggag aaattcgctg tcaaatcgaa ttcttggtga    373800
     cggtcgtagt tctgaagcca gatcaagaaa aatagtgcaa cagatataac tcctgggaat    373860
     gccgtgaaga taaagtatcg ttcgcttcca taatttgaaa tgtaccactc agctacgggc    373920
     gggcctaaca ggttagaccc gggaatcatt gcggtgtaga tcgcaaacag cgagactgtc    373980
     cgcggtccat gcagcatacc ttttacgaag gtaagcgcag caggatagaa aatacccgcg    374040
     cctattccgt acaccatacg cgacaagaag attccgccga aaactttggg agtaatctca    374100
     aaacttaagt ggcagacgca cataatggcc atccctgcga gcatgagaac cgttgttcca    374160
     aggcgggcca ttagagccgc tgacaataag ccgaatacga gagcgaaaat cgaagttgat    374220
     gccatcgcat agccagttat cgcgagtgga atgcctttag tttccattac tcctggtaaa    374280
     aaagactgac tcgtcgtcat agagaacccg agcagagtgg ccacgcaagc gacgacaaag    374340
     gcccccctgc gaaacgctgg ttccttagca accgaaatgg atgatataga catcgcgcac    374400
     ctttcgcggt cggtcgacgc agccggtact tatcggtgcg acaagctcag tggatgccgt    374460
     cgcgacacgc gatggcggca ttggttgatc tatggaaaac aaatgcagcc ttacattgat    374520
     ttctggcgtt catgccgtaa gggaatttag cgtcgaaaac acgtccgacg ctgcctcttc    374580
     aaagaccttg cgccgtgcaa ctagctcatg tgtctcgatc cacctcggca acagatccga    374640
     cagtgccttt gctgtttcca tcagcaaaat ttcacttcgt gcccgcgaga agatttgaac    374700
     ggccatagga aatccgcgac tgctcacgcg aaatggatag gaaatagctg aaagattgca    374760
     gaggtttgca atgatcatgt agttccaagg atcgaattga tcagagggtg taagtggcaa    374820
     catatgttgc gttgtctgga ctggtacgcg gctaactgga tatggatcga ccggcagtaa    374880
     aattgcggaa aatccgccac ccgttatgaa atcctccatc tcgcgaacca cgacatcgcg    374940
     cttagcacaa gcatcttggt attcaccgag cgaaatgctt ttaccgcttt gaatcgtctg    375000
     ccgagtgctc ggtcgtaact gatccatagg aaatagttcc ctatgtgtgt caaagtattg    375060
     gtggagctca taagcaacca ttttccagcc atattgacgt tttggccaga tattccaatt    375120
     gaccctttcc actgaaaatc caacagcacg aatttgtgct acataatcct caaaggaacg    375180
     cgcaatttct tcgtctatta gcttgggaag atatggggcg acgagagata ttccctcagt    375240
     cgcgctgact tcttgcgggt aaatttgaga gagatcatgg tgcttccaca aataaaggat    375300
     gtcatcgatt gatcttgtta ctgctccaat ccgctccagc gaggaactaa ctggaacaat    375360
     tccccgccta tgttcctcag attcactgaa gacaatgccg acggctccgc aaaatgacgc    375420
     cggacgacgc acagagcctg ccgcgtcggt accaaatgat acgtcactga tgccactcgc    375480
     cactgcggcg gcagagccat tactagagcc ccccggcgaa aacaacggaa atagtggatt    375540
     tatacagctg gagaagttat tgccgacacc gaactctgtc gttctcgcct tgccctgcgt    375600
     aaaaattccc gcattctcga gttcggctac tattgcagcc gattcaggtg ggattacaga    375660
     tatttcatca ctaccaaatt tactcgtaat tccttttacc gagattagat ctttataaga    375720
     agctgaagtg accccgcgtg ccgtaattga tggcgaattg ggaatgtggg ttagcgccga    375780
     aatcttcgaa tttatcgtcc gagcatattt atcaaatcgc ctacgccaat tttcccaata    375840
     aatagttgac tgcgacagca atgaatttcg ttcagaaagc gctgtaaaag gcgtcaaatg    375900
     tttaatttct ttcaacgaag gatcccgtct actagctcga tctaacataa aatattcaga    375960
     tttgatcatt catcaagaag ttggcctgca tacttcaatt cagagaatgt atcgattgag    376020
     atggacgtga gcctgtggcc agcacgattc gaaagacatc atttgggtag ctctgatcgc    376080
     caattcgaaa atgcgtttcc ccgaactttt cgaagccggt tcttttatag aatttgatcg    376140
     cccgctcgtt cttagggttt actgttaacc agatatccgg gcgaccagat tcagcgcaaa    376200
     attgttgcgc ggcttccagc aacttttgac ctatccctcg ccgatgatgc cgcggctgca    376260
     cgtatagagt tgaaatttct gtatcgctat aggcagtggc tggagctact gaagccgtga    376320
     tcaaacgtat gaatccgtct atcccttcag agttttgtga aacccaaatt ttttcgttgt    376380
     ctcgcgaaag gatttctttg taacgatccg gagtatacct ttgcagaacg taatcggcaa    376440
     aaaatgcatt gatgccattt tgcaagaagg taccaaacca tatttctaga cttatggcag    376500
     cgatgctaga ggcatcttca atcgtcgctt ctctaatcat gtccaatctt tcggggttct    376560
     tttgccgggg cttggctctc aatcttcggg atattgactt atgcgacatc cattcggttc    376620
     gacacggcgg cgtgcgaaat gccagtgatc tttcccgccg agcttttccg gaaaggcgct    376680
     gtgctgtagt gaatatccag cggatatacg ttgcgcgaaa attcctcgtg cagcgctcgg    376740
     gctatttctc tccgaaattg ttggatgaca aattggctgc ctctgcagtg aaagtgtacg    376800
     acgaacccgg tcccgcggac cgtgtcggat gctgcagcga catagaactc agcctgcgag    376860
     aatcgccgat taagaaactc ctggagaaaa tcgagatcgg tatttgcgcc gtttatctgg    376920
     atcactcggt ctagccgacc acagagagtg aattggcgct cttccgtgaa gcgcaccaga    376980
     tcaccagtgc gaatgtgcgg caacccgttc ataatcgctt tggctgaagc cgtccgaggc    377040
     tgaacacacc ggggaccaga tacaatcagc tcggtcagca ggtcagtttc ggtgcgattg    377100
     gggagtacct ccacgtctga aaacaattcc cagtcgttcg