(data stored in ACNUC7421 zone)

EMBL: CP000638

ID   CP000638; SV 1; circular; genomic DNA; STD; PRO; 631775 BP.
XX
AC   CP000638;
XX
PR   Project:PRJNA13372;
XX
DT   30-JAN-2009 (Rel. 99, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Agrobacterium vitis S4 plasmid pAtS4e, complete sequence.
XX
KW   .
XX
OS   Agrobacterium vitis S4
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Rhizobiaceae;
OC   Rhizobium/Agrobacterium group; Agrobacterium.
OG   Plasmid pAtS4e
XX
RN   [1]
RP   1-631775
RX   DOI; 10.1128/JB.01779-08.
RX   PUBMED; 19251847.
RA   Slater S.C., Goldman B.S., Goodner B., Setubal J.C., Farrand S.K.,
RA   Nester E.W., Burr T.J., Banta L., Dickerman A.W., Paulsen I., Otten L.,
RA   Suen G., Welch R., Almeida N.F., Arnold F., Burton O.T., Du Z., Ewing A.,
RA   Godsy E., Heisel S., Houmiel K.L., Jhaveri J., Lu J., Miller N.M.,
RA   Norton S., Chen Q., Phoolcharoen W., Ohlin V., Ondrusek D., Pride N.,
RA   Stricklin S.L., Sun J., Wheeler C., Wilson L., Zhu H., Wood D.W.;
RT   "Genome sequences of three agrobacterium biovars help elucidate the
RT   evolution of multichromosome genomes in bacteria";
RL   J. Bacteriol. 191(8):2501-2511(2009).
XX
RN   [2]
RP   1-631775
RG   Agrobacterium Consortium
RA   Setubal J., Wood D., Slater S., Nester E., Farrand S., Goldman B., Burr T.,
RA   Goodner B., Otten L., Dickerman A., Almeida N., Sun J., Jhaveri J.,
RA   Banta L., Houmiel K.;
RT   ;
RL   Submitted (14-MAR-2007) to the INSDC.
RL   Virginia Bioinformatics Institute, Virginia Tech, Washington Street, Box
RL   0477, Blacksburg, VA 24061, USA
XX
DR   MD5; 8f01b4d2d1e332537d2d2c50fb77cf9e.
DR   BioSample; SAMN02602976.
DR   EnsemblGenomes-Gn; EBG00001020786.
DR   EnsemblGenomes-Gn; EBG00001020787.
DR   EnsemblGenomes-Gn; EBG00001020788.
DR   EnsemblGenomes-Tr; EBT00001622503.
DR   EnsemblGenomes-Tr; EBT00001622504.
DR   EnsemblGenomes-Tr; EBT00001622505.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00489; ctRNA_p42d.
DR   RFAM; RF00490; S-element.
DR   RFAM; RF00519; suhB.
DR   StrainInfo; 759566; 0.
XX
CC   Strain/DNA available from Tom Burr, Cornell University,
CC   tjb1@cornell.edu.  A. vitis S4 was isolated by Dr. Erno Szegedi in
CC   1981 from aerial gall that developed on a two-year-old woody
CC   grapevine cane.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..631775
FT                   /organism="Agrobacterium vitis S4"
FT                   /plasmid="pAtS4e"
FT                   /host="Vitis vinifera cv. 'Izsaki Sarfeher'"
FT                   /strain="S4"
FT                   /isolate="Kecskemet-Hungary; ATCC BAA-846"
FT                   /mol_type="genomic DNA"
FT                   /country="Hungary:Orgovany"
FT                   /db_xref="taxon:311402"
FT                   /culture_collection="ATCC:BAA-846"
FT   gene            70..1296
FT                   /gene="repA"
FT                   /locus_tag="Avi_7000"
FT   CDS_pept        70..1296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repA"
FT                   /locus_tag="Avi_7000"
FT                   /product="replication protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7000"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39747"
FT                   /db_xref="InterPro:IPR017818"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4E9"
FT                   /protein_id="ACM39747.1"
FT                   /translation="MGFDMAKIAPKTDAVIEGLTALMERHADALSSQLQAHHLKVFPPT
FT                   SEKGIRSFGPSEASKLLGVGESYLRQIASEMPELNVSMSPGGRRIFSIEDIHVIRKHMD
FT                   QIGRGNRRYLPHRRDGEQLQVISVMNFKGGSGKTTTAAHLAQYLAMRGYRVLAIDLDPQ
FT                   ASLSALFGSQPETDVGPNETLYGAIRYDDEQVPIEQVVRGTYIPDLHLIPGNLELMEFE
FT                   HDTPRALMKRKEGDTLFYGRISQAIEDIADNYDVVVIDCPPQLGYLTLSALTAATSILV
FT                   TVHPQMLDVMSMNQFLAMTSNLLREIESAGAEFKFNWMRYLITRFEPSDGPQNQMVGYL
FT                   RSIFGENVLNFPMLKTTAVSDAGLTNQTLFEVERGQFTRSTYDRALEAMNAVNDEIESL
FT                   IKKAWGRTT"
FT   gene            1293..2306
FT                   /gene="repB"
FT                   /locus_tag="Avi_7001"
FT   CDS_pept        1293..2306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repB"
FT                   /locus_tag="Avi_7001"
FT                   /product="replication protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7001"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39748"
FT                   /db_xref="GOA:B9K4F0"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR011111"
FT                   /db_xref="InterPro:IPR017819"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR037972"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4F0"
FT                   /protein_id="ACM39748.1"
FT                   /translation="MSRKHILGVSTDAQDAKPSDNRAGKTRSMPLLGVARKERDPATKL
FT                   TANIGNALREQNDRLSRAEEIERRLAEGHAVIELDVSTVDPSFVQDRMPGDIDGLLESI
FT                   REQGQQVPILVRPHPDQPGRYQVGFGHRRLQAVSELGLPVKAVVRDLTDEQLVIAQGQE
FT                   NNERQDLTFIEKARFAHRLNKQFSREIVIAAMSIDKSNLSKMLLLVDTLPPELIDAIGP
FT                   APGVGRPSWQQLTELIEKAPSPSDVSKYALSNEVQALPSAERFKAVLVSLKPPRVSRGL
FT                   PEIMSTPDGDRLAQVSQSKSKLEITIDRKATPDFAAFVIDHLPALYQAHRAQNQKK"
FT   gene            2470..3684
FT                   /gene="repC"
FT                   /locus_tag="Avi_7002"
FT   CDS_pept        2470..3684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repC"
FT                   /locus_tag="Avi_7002"
FT                   /product="replication protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7002"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39749"
FT                   /db_xref="InterPro:IPR005090"
FT                   /db_xref="InterPro:IPR021760"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4F1"
FT                   /protein_id="ACM39749.1"
FT                   /translation="METGNVTTPFGRRGMTLALVRRQVATSDIKPGKRADKWKIFRDAS
FT                   AAMDLLGIQSNSLAVLDALLSFYPENELRQDAQLVVFPSNAQLALRAHGLAGATLRRHI
FT                   AVLVDAGLIVRKDSANGKRYARKDNAGQIEEAFGFDLSPLLARSEELAIMAQQVMADRA
FT                   TFRKAKESLTICRRDVRKLITAAIEEGAQGDWHEIECAYISLVGKISRTPALSEVALVL
FT                   DEMNSLKRDIIKRLENQVNSEKNSANAAQIERHIQNSKTNYITEFEPRSRKEQEATEEQ
FT                   NNPPKRLPIKSFPLGMVLKACPSVCDYGPDGKIANWRDLMTAAVVVRSMLGVSPSAYQE
FT                   ACEIMGQENAATAIACILERANFINSAGGYLRDLTRRSQQGEFSLGPMMMALLRTNGEA
FT                   GMKTG"
FT   gene            complement(4003..5256)
FT                   /locus_tag="Avi_7004"
FT   CDS_pept        complement(4003..5256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7004"
FT                   /product="Flavin-containing monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7004"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39750"
FT                   /db_xref="GOA:B9K4F2"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4F2"
FT                   /protein_id="ACM39750.1"
FT                   /translation="MPVEKIHALVVGGGQAGIAMSEHLTRNNVAHLVLEKGRIAERWRS
FT                   MRWDSLVANGPAWHDRFPNLTFPGNADAFVPKEGVADYFETYAKKYNAPIRSGTEVTHV
FT                   ERLGGRPGFRVETANGVIEARYVVVATGPFQLPNIPPIVPPTANINQIHSSEYRNPHQL
FT                   GEGAVLVIGAGSSGVQIAEELMRVGRKTYLSVGPHDRPPRTYRGYDCAWWLGVLGKWDA
FT                   QVQELQTSNHVTVAVSGARGGETIDFRRLAAQGMVLVGMTENFKNGKLSFAEDLANNLD
FT                   RGDQTYLSLLDEADAFVALNGLNLPQEPEARILGPTADCITNPILELDLTAAGITTIIW
FT                   ATGFRSDYSWLKVKAFDEAGRPRHHRGVSSERGLYFLGLPGLSGRASSFIWGVWHDAKH
FT                   LADHITIQDNYLGCMPQA"
FT   gene            5807..7513
FT                   /locus_tag="Avi_7005"
FT   CDS_pept        5807..7513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7005"
FT                   /product="GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7005"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39751"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4F3"
FT                   /protein_id="ACM39751.1"
FT                   /translation="MILNHQFGNRKNSFDLDAAAALDEAWDLACKGRSVRAFSLANSVL
FT                   ASAEQRGDQGLIAGSSQQCAWYCFQLGETETGLVYVEKAISLWKSLEEPMLEAQALSIG
FT                   AWLHLELGNLEQAVEFAAEALNIADQSRNLRSRSLAINVIGVIFWMTRQPSLAVDYCSR
FT                   AVELAREAYDITFECWWLINLGGAHAEDAYLAQEADNQKFETSISSAIDITKQALSLAQ
FT                   SLKDAWAERLCIANLAEYFNAVEAFSAAEMLLERYRDIPGDDYVRGEGHYLVTLGSTLV
FT                   SLKRYEEALVPLEQAHLLAGENFNLETLMHACLSLSKAHEYLGAFESALDFHKKYHKLH
FT                   QQFTAERIQRNARMAEIRYETKKLKAMLDTEAERSAEIARSLEALQQQTSVLTEAANTD
FT                   PLTGLSNRRHLETIISDINTQSASYALAILDVDHFKKINDTFSHIIGDRVLVQIGTLVK
FT                   VVVRETDIAVRFGGEEFVILMTDLTLAHAERVSERLRMTITNFDWSEIADGLNVSVSIG
FT                   VAMSDDAVDAEAVLQLADRRLYWAKQTGRNRVVCFLPSGNRFEQTTSAITD"
FT   gene            complement(7955..9118)
FT                   /locus_tag="Avi_7008"
FT   CDS_pept        complement(7955..9118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7008"
FT                   /product="phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7008"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39752"
FT                   /db_xref="GOA:B9K4F4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4F4"
FT                   /protein_id="ACM39752.1"
FT                   /translation="MAQIVEKDTEIHVEQTSAPPLSTAVEGNVCAPPLSAAGLSLQAPP
FT                   LLSPVNEDQTPTHLTSLASRARDYVEAARSANTRKAYACDWKHFSAWCRRLNLRPLPPD
FT                   PQTVGLYITACASGNAVGTPTRGAKTNAVSTIERRLSSLSWNYAQRGLTLDRKDRHIAT
FT                   VMAGIRNSHARPPVQKEAVLAEDIIAMIETLDRGTLRGLRDRAMLLIGYAGGLRRSEIV
FT                   GLDIKPDQTEDGRGWIEIFDKGMLVTLRGKTGWREVEIGRGSSDTTCPVVAVESWITFA
FT                   RLAHGPLFRRVTGQGKSIGPNRLNDKEVARLVKRAAMAAGVRGDLSEIERAFKFSGHSL
FT                   RAGLASSAEVDERYIQKQLGHASAEMTRRYQRRRDRFRVNLTKAAGL"
FT   gene            9348..10077
FT                   /pseudo
FT                   /locus_tag="Avi_7011"
FT                   /note="two component response regulator fragment;
FT                   Incomplete gene (pseudogene)"
FT   gene            complement(10140..10887)
FT                   /pseudo
FT                   /locus_tag="Avi_7012"
FT                   /note="transposase; Frameshift (pseudogene)"
FT   gene            complement(11193..11645)
FT                   /locus_tag="Avi_7013"
FT   CDS_pept        complement(11193..11645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7013"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7013"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39753"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4F5"
FT                   /protein_id="ACM39753.1"
FT                   /translation="MSPTYETILSLASGLGVDVSELFAHKPSSPVSGRRAVTRVGEGSK
FT                   LKTSHYEYELLCADIANKKIIPLLTRINAHSVQEFETLVVHPGEEFVYVLEGSVTLHTD
FT                   LYAPTVLNAGDSCYFDSMMGHALVSTSSDPATILWVCSNVISPLIG"
FT   gene            complement(11936..12985)
FT                   /gene="mdh"
FT                   /locus_tag="Avi_7014"
FT   CDS_pept        complement(11936..12985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdh"
FT                   /locus_tag="Avi_7014"
FT                   /product="malate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7014"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39754"
FT                   /db_xref="GOA:B9K4F6"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4F6"
FT                   /protein_id="ACM39754.1"
FT                   /translation="MTLKTNFAAGTCRLPFEALQNLLKRIFLAAGASEHVANILSANCA
FT                   GCERDGALSHGIFRMPGYVSSIRSGWVDPAAVPVLETGGSGFLRVDARNGFTQVALDFA
FT                   AQSLKERARQEGIALLSIRNSHHFSALWPDVVPFAEERLLAIAMVNSFACTAPFDAKVP
FT                   VFGTNPVAFAAPCDGMVPMVVDMATSAIANGDVQIAAREGFSLPPGLGIDRSGKPTVDP
FT                   HAVLDGGALLTFGGYKGSAISMLVEVMSAALTGGKFSYEVDWSDYPGAQTPHTGQLVIL
FT                   IDPDVGRNAQFSRRVRHLVERLRLAKVSRLPGDRRLVTRERSMREGVCLQKSDLERMEL
FT                   LAQQRWAST"
FT   gene            13283..14869
FT                   /locus_tag="Avi_7015"
FT   CDS_pept        13283..14869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7015"
FT                   /product="ABC transporter substrate binding protein
FT                   (oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7015"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39755"
FT                   /db_xref="GOA:B9K4F7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4F7"
FT                   /protein_id="ACM39755.1"
FT                   /translation="MGMMSRMSSRLLGMTAAAALLGAGMAFGASGDLVVNAPTAPSTLD
FT                   PAWACGVPDIGFLQNFYVRLVDFGIKKNAAGSEEVDYGAVRPYLAKSWTISDDGKTYTF
FT                   KLNDNYKFTSGKPVDAAAVKYSFERGLKMGGCGQYFLTDGFLSPSIIESIEAPDATTVV
FT                   IKLIQSNANSLADWATGAASIVDPTVVEANGGVVAGKPNEYMSSHVAGSGPYVLDSYSP
FT                   NQSAHATANPNFGGEPPLAKSIQMNWISSAPTLLLQARSGQADVTYGLSKQAVSTLKSS
FT                   PDVKVEAFSNPFVQQMMLPNTKAPWDNPKVREAVAHAVPYEDIVKKVAFGYGTFYFGPV
FT                   PPSMAGFNAELSKPIQFDLAKAKTLLAESGVKLPVDVEVLVQEGDTTQQQIATVLQSTW
FT                   SKLGINLKIRIAPGAEYQDLTQGHKVQSLMRLDGPGVFEAGYYFGYDVMCKTPYNLTES
FT                   CNPKIDELVVKLRATLDKVEHQKILDEITTLWRADYPKLLFFEDQPVIVLSNNVKSFRF
FT                   APLTDFRFMGK"
FT   gene            14987..17008
FT                   /gene="hyuA"
FT                   /locus_tag="Avi_7016"
FT   CDS_pept        14987..17008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hyuA"
FT                   /locus_tag="Avi_7016"
FT                   /product="hydantoin utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7016"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39756"
FT                   /db_xref="GOA:B9K4F8"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4F8"
FT                   /protein_id="ACM39756.1"
FT                   /translation="MATRIGVDIGGTFTDLVYFDEENGRTVEGKVPTVPSAPEEGVAHA
FT                   IRAHVPQDIIDSAAYFLHGTTVGLNALLERRGAKVGLITTQGFRDVLEIRRGDRAEMYN
FT                   LFWKQTVPLVPRRLRLEVDGRIRGDGAVLSPVTRESVLAAYELLAAEKVDSIAVCLISA
FT                   FANPQHELEIEAILRDAGYEGGISLSHKISGEYREYERTSTTVIDAFVRGRMSNYLRRL
FT                   ENTLRNLGFKGQCLITRSGSGSMTFSEAEDRPFETIMSGPVGGAQGAGELAKMLGRKAM
FT                   ITADVGGTSFDTAVIINGEPQVLFEGMIDNMPVQTPWVDVRSIGSGGGSLAYVDVGNLM
FT                   RVGPQSAGAVPGPACYGKGGTQPALTDAAAYLGMLGPGNLASGIHLDIGKAEAALAPVA
FT                   SAIGQDIEMTAAGVLRIASSAMANAMREISLDQGFDPREMTLLPFGGAGPLMATLLADE
FT                   LKMNEIVVPPLAGNFSAWGLLGADMVQSAARTRILDLTDDSLKIANEVLEGLFVAIRSR
FT                   SERSFAEAVNAVRLDLRYKGQEHRLSIVADNENGRISEGAESIKTKFRAEYSRTFGSTM
FT                   NDEIEVVSIRATVRVPLPRREIRFTHEPEAVAEFQMLEAFSFEKGKRMSFAIVQRQAIV
FT                   GKLSGPAIITEGTCTTYLDADWTARIGTVGEIILERKN"
FT   gene            17011..18726
FT                   /gene="hyuB"
FT                   /locus_tag="Avi_7017"
FT   CDS_pept        17011..18726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hyuB"
FT                   /locus_tag="Avi_7017"
FT                   /product="hydantoin utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7017"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39757"
FT                   /db_xref="GOA:B9K4F9"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4F9"
FT                   /protein_id="ACM39757.1"
FT                   /translation="MKRKDPVLHLAGVPSKGLAVNSDPITTEVVRHALNSAANQMKRAL
FT                   IRTAFSPIIYEVLDFAVAIYDRELRMLSQAPSLPIFMGTLNFAVREAVKNIGGEDKIFD
FT                   GDILMYNWPYGTGSHPQDMVIIMPVFYRQDLIGYTAIKGHWLDIAAKDPYCTDTTDVFQ
FT                   EGTIFPGVKIYKKGELNDDIYRMILGNSRVPKAVSGDLDAQVTGCRVGAKSFLEVVERF
FT                   GLDTYRNAVEHMFDHGEAIIRSFFEKIPDGRYVGNGEMDDNGVTKNRIPFEITVDVKGS
FT                   DVTIDFSETPDAQGGPVNSPLPSTISASRVAITMLAGYGEAPHEGHFRPIKVITRPGSM
FT                   FDPEPPSPCFLYGWSALQAIEVIYNAISKALPSSVPACSGGCICSVVWWGTREETGEAW
FT                   ADGAPHPTGQGAWDGGDGGTMLHISESATRFTPVEVWEARNPFLVERLALAQDSVGPGK
FT                   YRGGPGIDLFFEMTEDTFITTVFERSKSQPWGLEGGLGGRANNAMVVMPDGTEHIVPKT
FT                   THFLVPKGGLLKLQTGGGGGYGEPAERPLEKIQADLDDGYISEAFARQHYPHAF"
FT   gene            18723..19625
FT                   /gene="dppC"
FT                   /locus_tag="Avi_7018"
FT   CDS_pept        18723..19625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppC"
FT                   /locus_tag="Avi_7018"
FT                   /product="ABC transporter membrane spanning protein
FT                   (dipeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7018"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39758"
FT                   /db_xref="GOA:B9K4G0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4G0"
FT                   /protein_id="ACM39758.1"
FT                   /translation="MNLMSRKGYDFSRFFSQRNIMRSFFGQIFRDSEMAAGTIILVVLF
FT                   AIAVFGPMVWHFDPLEVDILTALSPPDWSHPMGTDDVGRDVLARFMSGARVSLAVSCAV
FT                   TVLATLLGGGLGLVAGFSGGWFDLAVSRIMDAILSFPPLILAMAVAIGLGPGVISAVFG
FT                   IVLAAIPWFYRLLRSEVLRIRNLSYIDAARALGVSRLSILRRHVLPQAVSTVLIQASSV
FT                   FSFAILTLAALGFVGLGIQPPLPEWGTMITEGLAYALTGQWWLGLFPGLGIFLLAASAN
FT                   LIADRLREYYDPKSAKGGH"
FT   gene            19628..20629
FT                   /gene="dppB"
FT                   /locus_tag="Avi_7019"
FT   CDS_pept        19628..20629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppB"
FT                   /locus_tag="Avi_7019"
FT                   /product="ABC transporter membrane spanning protein
FT                   (dipeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7019"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39759"
FT                   /db_xref="GOA:B9K4G1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4G1"
FT                   /protein_id="ACM39759.1"
FT                   /translation="MLRFIVERVFSALLTLLGASLIAFIVLRAVPTNPARLIAGPFATD
FT                   EVIGQVEAALGLNKPLYIQYADYIVGFVRGDWGFSYSAGQPVLQQIGQRLPASAELALY
FT                   AFLFAFIGAIFLTVFSVFARSRWLDRLLRGSAFVFVGVPPFWIALLFLIVFSENLGWFP
FT                   GPVGRGDAPPVVVTGLYSIDFLLGGDVSGFFGALHYLALPSVTLALGSLGYLIRLLRAN
FT                   LLDTANEPFVTVLHAKGVRGLVIAFGHVLPNAFLPTLTAGGLILAQLLGGSVLVERIYT
FT                   WPGVGGLVIDGILRQDYAVVQAFILLSALIYIVVNFLIDILYGVVDPRVRRS"
FT   gene            20632..21648
FT                   /locus_tag="Avi_7020"
FT   CDS_pept        20632..21648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7020"
FT                   /product="ABC transporter nucleotide binding/ATPase protein
FT                   (oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7020"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39760"
FT                   /db_xref="GOA:B9K4G2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4G2"
FT                   /protein_id="ACM39760.1"
FT                   /translation="MNTQPSSTAALLTVSDLNTTFDTARGLVNSVDGVSFSIAPGKTLG
FT                   LVGESGSGKSVTSLSLMRLIERSNGRIEGGSMLFKSRNGEVDLVGLPEKEMRSIRGNEI
FT                   AMVFQEPMTSLDPVWRVGKQIAEAVRLHQGASKAEARHRAIEMLRLVGIPAPEKRVDDY
FT                   PHQMSGGMRQRVMIAIALSCRPSLLIADEPTTALDVTIQAQIIDLIKRLQVEIGMSVLF
FT                   ITHNMGVIAQVADHVAVMYAGQIVEHGPVRRIFSNPRHPYTIGLLNSIPRKGAVGSDGR
FT                   LQAIGGIPPSPFDLPTGCRFAPRCTFATDDCSRANPPFESVEADHIVRCLHWKEVAP"
FT   gene            21645..22625
FT                   /locus_tag="Avi_7021"
FT   CDS_pept        21645..22625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7021"
FT                   /product="ABC transporter nucleotide binding/ATPase protein
FT                   (oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7021"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39761"
FT                   /db_xref="GOA:B9K4G3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4G3"
FT                   /protein_id="ACM39761.1"
FT                   /translation="MSDKPDLLVIENLVKRFPVKRDTFFGPARYVHAVADVNFSVRRGE
FT                   TVGLVGESGSGKTTIGRLVMRLDEPSSGNIVFDTQNIGNLVERDTLPFRKRIQMIFQDP
FT                   FSSLNPRMRVGAQIAEGLEVHGIGNKADRVRRVTEMLDLVGLPVDAASRYPHEFSGGQR
FT                   QRIVIARALIVEPEFVVADEPVSALDVSVQAQVLNLLQDLKERLHLTMLFISHDLAVVE
FT                   HLCDRVVVLYLGRVMEIAPRDALYERPRHPYTEALLSASPVPDPDHQPIRAMTEGDLPN
FT                   PIDQPSGCVFRTRCRYAMPACAQTVPPLLAVGLDHVTACLRDDIL"
FT   gene            22680..23708
FT                   /locus_tag="Avi_7022"
FT   CDS_pept        22680..23708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7022"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7022"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39762"
FT                   /db_xref="GOA:B9K4G4"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="PDB:4K7G"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9K4G4"
FT                   /protein_id="ACM39762.1"
FT                   /translation="MRTNKVIHVIGVHAEGEVGDVIVGGVSPPPGDTLWEQSRFIASDE
FT                   TLRNFVLNEPRGGVFRHVNLLVPPKDPRAQMGFIIMEPADTPPMSGSNSICVSTAILDS
FT                   GIISMQEPLTHMVLEAPGGVIEVTAECANGKAERINVLNVASFVTRLAAALEVEGLGTL
FT                   TVDTAYGGDSFVIVDAIGLGFSLKPDEARELAELGMKITAAANEQLGFVHPCNADWNHI
FT                   SFCQMTTPITRENGILTGKSAVAIRPGKIDRSPTGTGCSARLAVMHARGEIGIGETYIG
FT                   RSIIDSEFKCHIDSLTEIGGLSAIRPVISGRAWITGVSQLMLDPTDPWPSGYQLSDTWP
FT                   AI"
FT   gene            complement(23847..24239)
FT                   /pseudo
FT                   /locus_tag="Avi_7024"
FT                   /note="transposase; Frameshift (pseudogene)"
FT   gene            complement(24391..24564)
FT                   /pseudo
FT                   /locus_tag="Avi_7025"
FT                   /note="transposase; Frameshift (pseudogene)"
FT   gene            complement(24717..25697)
FT                   /locus_tag="Avi_7026"
FT   CDS_pept        complement(24717..25697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7026"
FT                   /product="ABC transporter nucleotide binding/ATPase protein
FT                   (oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7026"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39763"
FT                   /db_xref="GOA:B9K4G5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4G5"
FT                   /protein_id="ACM39763.1"
FT                   /translation="MSTAPLLKAENLHVTFERKTGGFPWQKPRILHAVNGVNFELRAGE
FT                   TLGIVGESGSGKSTLARAIIRMLDASGSVIWQGNTDLLRLSPREMLKHRADIQMIFQDP
FT                   LASLNPRMTVGQIISETLITHHHGLSSKEIKARVQAAMDQVGLLPSLINRYPHEFSGGQ
FT                   CQRIGIARALIVEPKLIICDEPVSALDVSIQAQVINLLMDLQKNLGLALIFIAHDLSVV
FT                   KHISTRVMVMYLGRTVEIADRDTLYANPQHPYTQALLSAIPIPDPKLEREKIVIPLEGE
FT                   LPSPMSPPSGCVFRTRCPRAEDRCAAEVPVLQGDVHAVACHFRGA"
FT   gene            complement(25694..26662)
FT                   /locus_tag="Avi_7027"
FT   CDS_pept        complement(25694..26662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7027"
FT                   /product="ABC transporter nucleotide binding/ATPase protein
FT                   (oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7027"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39764"
FT                   /db_xref="GOA:B9K4G6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4G6"
FT                   /protein_id="ACM39764.1"
FT                   /translation="MTLLKITDLSVGFDTPDGQVKAVQGLNLTLNRGETLGIVGESGSG
FT                   KSQASFAIMGLLARNGRASGSVLFDGQEILNAPAAVLNPIRGARIAMVFQDPMTSLNPY
FT                   MRISDQMAEVLIYQKGMSKRDAMVECIRMLDAVKIPDAKSRIRLYPHEFSGGMRQRVMI
FT                   AMALLCRPDLLIADEPTTALDVTVQAQIMGLLRDLQSEFGMAMILVTHDLGVVAGSCER
FT                   VLVLYGGRVMETGPAEALFASPSHPYTQGLLRAIPRVDREDERLRTIPGVPPNMMNMPR
FT                   GCPFSPRCDYVIAECNVAPPPLENFAPDRARACTRPVEELV"
FT   gene            complement(26664..27590)
FT                   /locus_tag="Avi_7028"
FT   CDS_pept        complement(26664..27590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7028"
FT                   /product="ABC transporter membrane spanning protein
FT                   (oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7028"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39765"
FT                   /db_xref="GOA:B9K4G7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4G7"
FT                   /protein_id="ACM39765.1"
FT                   /translation="MMVDRAQMEKLATRMRDETVRGRSPWADARRRFMRNKAAIAGLIG
FT                   LCLVAVFALLGSYLAHWSNDELDFSVMGQVVDLGRPSFENGHYFGTDDLGRDLFARTVQ
FT                   ATQVSMSVALIGSLIAVVVGTLYGAISGYAGGIVDSIMMRTVDILMAIPYMFVLILLLV
FT                   MFGRSTTILFVGIGLMSWLDMSRIVRGQTLSIKSKEYIEAAQATGVSSIKIILRHVLPN
FT                   LMGVVTVYATLLVPIMIMTESFISFLGLGIQEPLTSWGAMISEGAGSMTHGTLWQLAAP
FT                   LFFFIITLFSFYFVGDGLRDALDPKDR"
FT   gene            complement(27595..28518)
FT                   /locus_tag="Avi_7029"
FT   CDS_pept        complement(27595..28518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7029"
FT                   /product="ABC transporter membrane spanning protein
FT                   (oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7029"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39766"
FT                   /db_xref="GOA:B9K4G8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4G8"
FT                   /protein_id="ACM39766.1"
FT                   /translation="MLVYVLRRLAVAIPTLLILIITSFLLMKAAPGGPFTTEKALAPEI
FT                   LANLNAKYGLDAPLWRQLVTYVWGVVVHFDFGPSFIYKDRTVNEIIAQGFPVTLTYGCI
FT                   SFVVAVLIGGALGICAAVWHNSWLDYLAVGVAIGTHVLPSFVLAPILVLIFTLWLGWLP
FT                   GGGWEGGQWPYLIMPVISLSVLFIASISRLTRSSMLEVLNANHIRTARAKGLPARVVIF
FT                   RHALIPALLPVISYLGPAFVSMITGSVVVDMYFSTGGIGKFFVDAALNRDYAVMMGITI
FT                   LIGGLTILFNLVVDLLYAWIDPKIRY"
FT   gene            complement(28572..30185)
FT                   /locus_tag="Avi_7030"
FT   CDS_pept        complement(28572..30185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7030"
FT                   /product="ABC transporter substrate binding protein
FT                   (oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7030"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39767"
FT                   /db_xref="GOA:B9K4G9"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4G9"
FT                   /protein_id="ACM39767.1"
FT                   /translation="MRKLLLLTTCLAFSFSSLSYADAGTKNGEKLAANQTYTYRVLDSF
FT                   KTLDPQLNADTDGSDALRNLFETLMNEDTQGNLVPGAASSYDVSSDKMLYTFHLRPEAK
FT                   WSDGTPVTAGDFVYAWQRLADPKTASEYASYLEMMQVENTTDIIGGKKPPQELGVKAVD
FT                   DHTFQVKLIAPIPYFVKMTVNASMSPVKKSVIDKFGDDWTKPGNLVGNGAYVLTEHVPG
FT                   EKLVMKRNPNYWNNANTVLDTVTALIINDGNQAMTRYLAGELDEVGIPTGQYPRMKKDY
FT                   PDQAKSTPRSCTYTYLFNVSEKGPAALKDVRVRQALSYAINRDVIVNNILQGGQKPAYN
FT                   WVHWATAGFKMPDIAAAHMTQKERDDKAVALLKEAGYSPDHPLNLTLSYNTDEGHKKIA
FT                   IAVSQFWKKVGVNLTLTNMEWKVLTDKLNHQDFEVSRYAWCGDYNEASTYLDVFTSASG
FT                   NNYVKYSNPAYDKLLKEAKTAADPQPLYTKAEEILAVDAPHAPIYQYSNVMMLKPDVRG
FT                   YPEKSVMGNWYAKDMYRVAK"
FT   gene            30546..31193
FT                   /locus_tag="Avi_7032"
FT   CDS_pept        30546..31193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7032"
FT                   /product="transcriptional regulator TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7032"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39768"
FT                   /db_xref="GOA:B9K4H0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4H0"
FT                   /protein_id="ACM39768.1"
FT                   /translation="MAEVGNTGTKRRPVQARSQKMKMAIMESTHAVMREQGVRAVTTNA
FT                   VSAHSGIKVGSIYDYFPNKEAIIAEIYEEKLAQVRAFLEAGSEKIEADDWQIQLAALIR
FT                   ETWVYQLSIGLDRTIVDAAYYYETLFPIAQQHARLVASNYVELLSHLGSTWSHEQLFDL
FT                   GISLYTLVNANWSYWRLTGTDDQIAIERQIVLTITLITPTLTASASSHSPAC"
FT   gene            31376..31669
FT                   /locus_tag="Avi_7033"
FT   CDS_pept        31376..31669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7033"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7033"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39769"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4H1"
FT                   /protein_id="ACM39769.1"
FT                   /translation="MLQRTGGDYEIDLSVTTTPIGAISRLEHALGGFEHERENYRNRLA
FT                   DAKRRLASYTPRLGESFSFQAELELKLGQLDEIERDLAATADEPEEDRQEAA"
FT   gene            complement(31828..33282)
FT                   /locus_tag="Avi_7034"
FT   CDS_pept        complement(31828..33282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7034"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7034"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39770"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4H2"
FT                   /protein_id="ACM39770.1"
FT                   /translation="MPIHNPCALLDRLLQEPNESTWLEFKVNNKDPREIGEYVSALANA
FT                   AMLAGRDRAFMVFGIRDKTRERVGTDLRLQQLKHGNEDFTNWLSRMIEPRIMLDVVDVE
FT                   CDGLTYSLIAIEPSYERPVKFSDAEFIRIGENKKKLSDFPEHERSLWIATGRRRFESAV
FT                   AVSNATADDIFAQLDPEPLFELTGDPRPKNPDEIIRKMIEYGFLLDNLEGRYDITNLGA
FT                   IMLARDVTLFPSIAGKAVRIIKYIGRDKSKSDFEQEGKKGYAVGFTGMMRFLMERLPKE
FT                   ERYINGVRRMVPHFPETAIREVIANAMIHQDFIVGGVGPVVEIYENRIEVTNPGNSLIA
FT                   TDRILDERRSRNEKLASTMRAFGLCEERGGGLDKTLIEIEADHLPAPDFISSENSMRVV
FT                   LFAPRAFAQMSKAEKMRACFFHCVLRWLTHDYMSNATLRERFSLAPEDYQAVSAIIAES
FT                   IKLGRIAPADPDQGKRNARYVPYWAV"
FT   gene            33780..35495
FT                   /gene="parB"
FT                   /locus_tag="Avi_7035"
FT   CDS_pept        33780..35495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parB"
FT                   /locus_tag="Avi_7035"
FT                   /product="chromosome partitioning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7035"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39771"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4H3"
FT                   /protein_id="ACM39771.1"
FT                   /translation="MQLITADPRSLKDNPDRSRQSKSSPQSDALLCASIRAIGVVQPPI
FT                   VKLDPEGGNSYIIVFGHRRAAQAIAADLVEIPLLLADPSDDLGAMQSFAENIAREPLNP
FT                   VDQWCAIERLVALGWTEESIAMALALPSRQIRKLRFLANILPAMLDQMARGDMPNEQQL
FT                   RTIAAAGQDEQAEVWKKYKPKKQDPQVSWWEVARALTTTRMLAKHASFGDDLAQAYGIT
FT                   WVEDLFAPADEDSRYTTDVEAFLGAQQEWLANNLPKRGSVIEANEYGQAKLPAKAQQVY
FT                   GKPGKGDLTGWYINARDGSVQSVAYRMPEAKKPKLVKDLDGVETIVEEVETPKVRPDVT
FT                   QKGLDMIGDLRTDALHEALARAPIEDDTLMALLILAFTGMNVTVASGASDNPYGHAKCG
FT                   PHAARLIGEDGKLSFDRETLLQAARSVLVEVLSLRRNRSDSGLIARIAGDAIGADQFLP
FT                   NMATEDFLSCLSRTALETTAETAGVPGRIKVKDTRAALVEHFAEDKLVHPAALLAPSTD
FT                   DVRSWAGRFASVDSGSEDVRDDLDALEDQLSGGDLVDHSAVEEEAGEGFREAAE"
FT   gene            35577..36239
FT                   /locus_tag="Avi_7036"
FT   CDS_pept        35577..36239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7036"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7036"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39772"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4H4"
FT                   /protein_id="ACM39772.1"
FT                   /translation="MAEIHDDMAEDTAAEKAAHEAELRTLKRPTIPAGASTPWGRAQVS
FT                   RQFADGIILHSTASHGGFHLAEKANSAVHALFRNDGEFYEEDCEWAKVAHAFPHLFTAY
FT                   ERRVADRTLRDYFPDAYERVMGVILNGSQSHVRDAQDFEKRHRHDWVVIAALNSDHQPG
FT                   LVECLATLGGIRGEVGERRFMVPRSDYVIGRHGFVIDPAKHEPYDGPSSFVTWAARR"
FT   gene            36664..37509
FT                   /locus_tag="Avi_7038"
FT   CDS_pept        36664..37509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7038"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7038"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39773"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4H5"
FT                   /protein_id="ACM39773.1"
FT                   /translation="MGASRSKAAGAPRCGRILASSQGRSASVAARKCGQHHPQTILAPP
FT                   GDALTLGRAAGAHVLLPAPKGLSRTTTGTPGFAETSLVKDPIMAPLNRSTQKNRPVKSQ
FT                   RATTLEMVRHACPDATQALRISESFGLALIDSDGIRDLHRGQLIESADALKDGLAEKAM
FT                   QIHMQRIVGSFVGSAYGAGQFYSRAVTEARDLTTKLSNDTRDEDLDGPVGFDSRAQRKR
FT                   EFAADMGLQAHVLRMAAEGAVSAYEDITGETWKPYERTVEQPANSVDQKAATAQMAAFE
FT                   "
FT   gene            complement(37605..38432)
FT                   /locus_tag="Avi_7039"
FT   CDS_pept        complement(37605..38432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7039"
FT                   /product="short-chain dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7039"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39774"
FT                   /db_xref="GOA:B9K4H6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4H6"
FT                   /protein_id="ACM39774.1"
FT                   /translation="MSRKTFFITGANSGFGLAIATAAAQMGHQVIGTVRSEIARSALAA
FT                   AVPAIHPVLCDVTAFDQIPDVVRDTEDKHGPVDVLINNAGYGHEGVIEESPLEQMRRQF
FT                   DVNVFGAVAVAKAFIPRFRERRQGFIVNVTSMGGMITMPGIGYYCGSKFALQGISEVMR
FT                   SEMAPFGVHMTTLCPGSFRTDWAGRSMIRTERSIADYDSLFDPIREARQAVSGKQLGDP
FT                   EKLAAAVLILVETDNPPPQLLLGSDALKHVSARLKRLQEEIDAWTSVTVSTDG"
FT   gene            38508..39440
FT                   /locus_tag="Avi_7040"
FT   CDS_pept        38508..39440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7040"
FT                   /product="transcriptional regulator AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7040"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39775"
FT                   /db_xref="GOA:B9K4H7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4H7"
FT                   /protein_id="ACM39775.1"
FT                   /translation="MKLLPNPMIDGHRQSMRDQLVELAGGLATRHGYNPTGLDPVRILR
FT                   TEAVLHDVPVLYNPGAVFVLQGSKQGMLDGEIFRYDEDHYLAVSVPVPFRMESTASPKR
FT                   PLLAVYLEFDMQLAAEIALQVEKRSELAGHPPRGLMSNKMDADIEDVLLRLLRALRSPV
FT                   ESAVLGAGILRELHYRVLVGPQGGAMIAALQHSGPYGKIFRSLAWLREHYSTEISIADL
FT                   AGRVGMSVPSYHVHFKDLTCTSPMQYVKAMRLHEARLIIARQEKTIAMVATSVGYASPA
FT                   QFSRDFKRHFGRTASEEAKWVRHHLGELV"
FT   gene            complement(39527..39943)
FT                   /locus_tag="Avi_7041"
FT   CDS_pept        complement(39527..39943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7041"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39776"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4H8"
FT                   /protein_id="ACM39776.1"
FT                   /translation="MVALTLRLRVLMVPEKPLPEAVKEPMVAIVVIPLRLFGPRPSRPR
FT                   WQSIGPGTIGLHPTDRNGVEDGQGEAFLPREEWALQRTGEENEPAVADADRAEPREAVF
FT                   GQTCPIETAVDVPADRSSGTTMALSGGAEWEQVA"
FT   gene            complement(40213..40491)
FT                   /gene="hupT"
FT                   /locus_tag="Avi_7042"
FT   CDS_pept        complement(40213..40491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupT"
FT                   /locus_tag="Avi_7042"
FT                   /product="HNS-type DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7042"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39777"
FT                   /db_xref="GOA:B9K4H9"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4H9"
FT                   /protein_id="ACM39777.1"
FT                   /translation="MTTTNEIADKIAANNGLTKVQAKGIVESVFKAIADAAGSDAETSI
FT                   PGFGKFKVKTSPEREGRNPATGEKMTVAASKKLTFAPAKALKDALNK"
FT   gene            40592..41044
FT                   /locus_tag="Avi_7043"
FT   CDS_pept        40592..41044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7043"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7043"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39778"
FT                   /db_xref="GOA:B9JRL0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:B9JRL0"
FT                   /protein_id="ACM39778.1"
FT                   /translation="MSSHRIDLPRKAAGTRHWPAALKEEIVLATLEAGATVASVARGYD
FT                   LDPSQIYQWRKALKVSRLSSQEVATSPEFLPVQIWAAADGEQASVQEHAGQEQAEALSC
FT                   PERGSVTSSISGAIEIQVGPLHRVRVCNDFASDTLERVLDVLRRQQ"
FT   gene            41041..41394
FT                   /locus_tag="Avi_7044"
FT   CDS_pept        41041..41394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7044"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7044"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39779"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:B9JRL1"
FT                   /protein_id="ACM39779.1"
FT                   /translation="MIALPSGQDVRVWIATGYTDMRCGFPSLALRVQEVLKHEPLSGHL
FT                   FCFRGRRGDLIKLIWHDGQGSCLFTKRLERGKFIWPSADGGAVAISPAQLSYLLSGIDW
FT                   RNPQQTWRPTKVG"
FT   gene            41440..43098
FT                   /locus_tag="Avi_7045"
FT   CDS_pept        41440..43098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7045"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7045"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39780"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:B9JRL2"
FT                   /protein_id="ACM39780.1"
FT                   /translation="MALKPDALPEDLASAYLALLANHDVVVNERNIAVAEAANAQAMLS
FT                   DRDARIASLELRIDKLKRELHGQSSERSARLIDQLELQLEELVTAASEDEVAAQAAAAK
FT                   TANVRPFVRKRPVRKPWPDDVERERVVIAPPSTCACCGGSRLSKLGEDVTETLEEIPRR
FT                   FKVIETVREKFTCRDCEAISQSPAPFHATPRGFIGPQLLATILFDKFGMHSPLNRQSTR
FT                   FKCEGIDLSTSTLGDQVGLGTSALMPLFDLIEAQVFAAERLHGDDTTIPIWGKSKCTTG
FT                   RIWTYVRDDLPFKGDAPPAAVYYASSNRRGEHPQRHLARYGGILQTDCYNGFEPISIAA
FT                   QKDVPITFAFCHAHARRKFFELADLEKSARDSKRNGRPISPIALEAVKRFDALFDIERQ
FT                   INGLSAEERLAVRQHKSRPLFDDMHAWLQRERATLSRSSDLVKAMDYMLKRWDGFALFL
FT                   EDGRICLTNNAAERALRGIALGRRNWTFAGSQRGAERTAVMLTLITTCRLNDVDPKAWL
FT                   ADVFTRIADLPVTRLHELLPWQWKLRKGIAIAPVG"
FT   gene            complement(43079..43312)
FT                   /locus_tag="Avi_7046"
FT   CDS_pept        complement(43079..43312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7046"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7046"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39781"
FT                   /db_xref="UniProtKB/TrEMBL:B9JRL3"
FT                   /protein_id="ACM39781.1"
FT                   /translation="MEIDEDKIDDAVLALLWLTLHNEGCAWKGFDWATTDRLHKKGMIG
FT                   DPVNTSKSLILTDEGLERSEALFRELFTRPAL"
FT   gene            complement(43451..43663)
FT                   /locus_tag="Avi_7047"
FT   CDS_pept        complement(43451..43663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7047"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7047"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39782"
FT                   /db_xref="InterPro:IPR008893"
FT                   /db_xref="InterPro:IPR036930"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4I4"
FT                   /protein_id="ACM39782.1"
FT                   /translation="MARFYALAVQPTLFGEVSLARAWGRIGTRGQQMLLLFDNENQATN
FT                   LFLDVLREKRKRGYRPKRPVDIQRI"
FT   gene            complement(43932..44465)
FT                   /locus_tag="Avi_7050"
FT   CDS_pept        complement(43932..44465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7050"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39783"
FT                   /db_xref="GOA:B9K4I5"
FT                   /db_xref="InterPro:IPR001471"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4I5"
FT                   /protein_id="ACM39783.1"
FT                   /translation="MYAIHRLDIDKHRQDAWMVNLSRGGKSIHMTFSDSTYGGKDQALE
FT                   VAQAYRDAVLRVVPPLSNNDMRMLVRKNRSEGSSVPGVYYIGPTGAHKTGIWMARIEIA
FT                   LDDNTPVPAGKRRRRQFTRTFNVSKFGYEEARRMAEEERIRMVMAVENGEDPALRSPQA
FT                   LKLHEKLTRDDNDD"
FT   gene            complement(44560..45033)
FT                   /locus_tag="Avi_7051"
FT   CDS_pept        complement(44560..45033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7051"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39784"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4I6"
FT                   /protein_id="ACM39784.1"
FT                   /translation="MAGLADAFFERINCYHMADWLQETMLKLGRPMPNPALQPGAFSRS
FT                   DRSWGLILTFGRVGTSLDNWQDEIILVSAEGDSTSPMPFGLDPINETPASATMKLSDNI
FT                   AGPGDARGDADERRISFFMEGGRLIELRFNEGMIGFDRIIMARLGEPQEWQPA"
FT   gene            complement(45038..46090)
FT                   /locus_tag="Avi_7052"
FT   CDS_pept        complement(45038..46090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7052"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7052"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39785"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4I7"
FT                   /protein_id="ACM39785.1"
FT                   /translation="MKKASFTRLCAVNRDIVYLGTTPDDQEMATPFTAICQYNAGEWSY
FT                   ETFAFALASLTLYREPGSPHRVLYVLGETGTVVNFHTKDRETILDLSKAPRTKHRLGYL
FT                   VKIRQIGDHLYVCGDGGQTYRRSSNGQWEALDVEFYDGPDAIMDPTSELSKLDALLDQK
FT                   ANRTLENFEKIKKLRKENSSKTLWDLSGLSEDSIYFTGEKETVYWFDGEKIAEIPTEAD
FT                   RGLLSILVESEDRVWVAGRDGNFLIGNHKTGFRDLDALRGIDGWPSFNGMTMFNERLYL
FT                   SSYVDPRGLFVFDGHHVEQVRSGLTPDIDDVSAVEAVDGVLWVMGRKDLLRYDGTHWER
FT                   IDFPGNDLLR"
FT   gene            complement(46095..47153)
FT                   /locus_tag="Avi_7053"
FT   CDS_pept        complement(46095..47153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7053"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39786"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4I8"
FT                   /protein_id="ACM39786.1"
FT                   /translation="MPKKQVSFTRLCAVNKDIVYIGTTPDDQEMATPFTAICQYDAGEW
FT                   SYETFDFPLASLTLYREPGSSQRVLYVLGEAGTAVNFHTKTREIIVDLLNAPRRKHRLG
FT                   YLQSIRQVGDHLYVCGDGGQTYRRSSDGQWQALDLGFFDGPDAIMDPKSELRLMSSLTR
FT                   IKENRTEENYAKLKILREENQSKTLWNLSGLSEDSIYFAGEKKTVYWFDGEKITEIPTE
FT                   ADRGLLSILVENEDRVWVAGRDGNFLVGNHKTGFRDLDALRGIDGWPSFNGMTMFNGRL
FT                   YLSSYADPRGLFVFDGHHVEQVRSGLTPDIDDVSAVEAIDGVLWVMGRKDLLRYDGTHW
FT                   ERIDFPGNDPLR"
FT   gene            complement(47162..48556)
FT                   /locus_tag="Avi_7054"
FT   CDS_pept        complement(47162..48556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7054"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7054"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39787"
FT                   /db_xref="InterPro:IPR025425"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4I9"
FT                   /protein_id="ACM39787.1"
FT                   /translation="MSYPSQEASRETRLGLIISKYPDVCRSPHACVPYNIIAYQSDAAG
FT                   TAATVHMTGQRAHKQNSVVTKCFGDEPGVGLGVKSNTVGSVCHRKTHSRNVRIEGQWAT
FT                   RDTDEWYMNNKNTVGKLVWYTGSKDFKPTPPLEQPSASRSQEGLVMSDATPMTFEPGKE
FT                   YAFNDTTGQFTKPAQTQPTDTKQTASDGSRWWTIINGLKNIRSINPSGAGAMELMGAAD
FT                   YYLKQNVNEPTDWLSHGFLKTQPTHTNTPIDNGVPTNTAPTEPEKKQELEEKQTTAPAN
FT                   GRTDGNTKITGQQKRKRECRCVTGAYDDIKNVCGVECGSDYQAHHIVPDYTLRYGNRAE
FT                   AEKGQKRIPGLPTFGQGPAICLKGYSADAGSEHGLAHLADVQVNALGSGWSTPQGTADI
FT                   SSITEISRNAAVAATGGECEDEINTALDAQPSLDSNILGRTTIMPPAEGTDPYNLLSTG
FT                   AHATVH"
FT   gene            complement(48553..49623)
FT                   /locus_tag="Avi_7055"
FT   CDS_pept        complement(48553..49623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7055"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7055"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39788"
FT                   /db_xref="InterPro:IPR018683"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4J0"
FT                   /protein_id="ACM39788.1"
FT                   /translation="MLGKNLTRLAAIGFEQAHRDGEDMGVIAVRGRYQVNADGSLQLSD
FT                   RQDIVLVDEYDGNPHTSPLIKAADLIPFKPASDITFLGAAYAPDGRAKQDWLVAIKVGQ
FT                   LSHAIRVTGARSWVCTAGKWRLSDPQEATEVPIDYRLAAGDGHIEGLGSPSVPGNPIGV
FT                   SRPTPEQALSSASVPAPRIDDAEEDYSDPFFARKPLGFGPVAPFWYFRQRYAGTYDDTW
FT                   QAHRHPQLPTDFDYRFYHSAHPSMIYPGFLAGDEMVEMARLTPGGGTFKFALPALRPVA
FT                   SYRWRDGREVVVQLNLDGVHIDFRNGARNVDLTWRAWLPICPNFLCINLSDRPFADQEA
FT                   ASLPRASLHGLTEVLA"
FT   gene            complement(49634..51859)
FT                   /gene="vgrG"
FT                   /locus_tag="Avi_7056"
FT   CDS_pept        complement(49634..51859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vgrG"
FT                   /locus_tag="Avi_7056"
FT                   /product="vgrG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7056"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39789"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4J1"
FT                   /protein_id="ACM39789.1"
FT                   /translation="MDDVLSPADFIQASRVLKLSSPLGEDQLLPERMTVDEGVNRLFEI
FT                   TVSVRAKREAVKPEELIGKLVDVSLEIRQGELDGDGVRRPFNGLVTNLSEGPPVTRGLR
FT                   SYTLTIRPQLWLLSRRSDCRIWQNMTAIQVMETLFSEHGIPAPAYAPLHRTPPSREYST
FT                   QWNETDLDYLLRRFEQEGLFYWFEHETGVHRLKVSDSKVAWGSPSAAAEGEQNVRLAQG
FT                   SSDRNHINEWMRQFSYVPGQRAGADWNFETPSTVPLNVTPSLIQMPGAKQRELYEYPAR
FT                   ISDVKEAEVAETFRMQAVEADHERVTGQSNVRFLEAGRRFTPYEEPHPEHKYEEHVITR
FT                   IVHRVVDRSYETASNEMEYANAFEAIPSRVPLTPHRETKRPRIEGTQVAIVAGPSGEEI
FT                   HTDQYGRLKLWFPWDRKAQKDGSDTCWVRVAQAWGGGTWGAQVIPRIGMEVMVSFVDGD
FT                   PDRPLVIGVVPNPKNPVPYELPANKTRMVLRSNTHKGSGFNEMTFEDENGQENMFFHAQ
FT                   KDQTIKVLNNRVKRVDAHQVESIGQNKSIDVGQNHQEKIGGSKNVTVGGGASSSLFASL
FT                   ASIAAAGGIDSKNGSSAIGHGLLQEFAGAMASAGVTAEVASLSANADVTNAGNFRTAAG
FT                   TEQASTGSTLGGLLGKILPISGIVNTVIEKFRSDTIGIARTEQIGLYKNTTVGHTMTIN
FT                   AGEEFIIKCGESKLMMDKAGNVTIVGTKFNFAASGHVQINGEVIDLN"
FT   gene            complement(52241..52570)
FT                   /locus_tag="Avi_7057"
FT   CDS_pept        complement(52241..52570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7057"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7057"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39790"
FT                   /db_xref="InterPro:IPR008893"
FT                   /db_xref="InterPro:IPR036930"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4J2"
FT                   /protein_id="ACM39790.1"
FT                   /translation="MNQSSHIDSEKSLDATPIGNNNAVMEKDAKDLVHLHRIDTTQNMR
FT                   RFYLLAIQPTLFGGVSVIRNWGRIGSGGQTMIETFDRQEDADWAVSHLERAKKRRGYSE
FT                   VNRTE"
FT   gene            complement(52567..52872)
FT                   /locus_tag="Avi_7058"
FT   CDS_pept        complement(52567..52872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7058"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39791"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4J3"
FT                   /protein_id="ACM39791.1"
FT                   /translation="MSAVFMMASDQCSLYVLIIDRERQASTRHIEDPHCMFDVHLIKRF
FT                   QDTARLVPSSTDDLTTAKEHIGRHCEFARGIALQPEWDNTTSPISVLSNSGGSSRL"
FT   gene            complement(53348..55315)
FT                   /gene="traG"
FT                   /locus_tag="Avi_7061"
FT   CDS_pept        complement(53348..55315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traG"
FT                   /locus_tag="Avi_7061"
FT                   /product="Ti-type conjugative transfer system protein TraG"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7061"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39792"
FT                   /db_xref="GOA:B9K4J4"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR014135"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4J4"
FT                   /protein_id="ACM39792.1"
FT                   /translation="MTVNRLLLFVLLAAIMLAALVMTSGMEHRLAEFGSSTQAKLMLGR
FT                   TGLALPYIAVAAIGAIALFAANGSANIKTAGVSVLAANSTAIIIATIGETIRLTGIAGN
FT                   VPAGQSVLTYADPATMVGAGVAFVSAMFALRVAIKGNAAFAQTGPKRIGGKRAVHGEAD
FT                   WMKLQEAAKLFPEPGGIVIGERYRVDKDSVATMPFRADEPQSWGAGGKSQLLCFDGSFG
FT                   SSHGIVFAGSGGFKTTSVTIPTALKWGGGLVVLDPSSEVAPMVVDHRRKAGQKVIVLDP
FT                   TRQGVGFNALDWIGRHGNTKEEDIVAVATWIMTDNARTASARDDFFRASAMQLLTALIA
FT                   DVCLSGHTDAKNQTLRRVRANLSEPEPKLRGRLTEIYEQSESDFVKENVAVFVNMTPET
FT                   FSGVYANAVKETHWLSYPNYAGLVSGDSFSTDDLANGGTDIFIALDLKVLEAHPGLARV
FT                   VIGSLLNAIYNRNGDVKGRTLFLLDEVARLGYLRILETARDAGRKYGITLTLIFQSLGQ
FT                   MREAYGGRDATSKWFESASWISFAAINDPDTADYISKRCGDTTVEVDQTNRSSGMKGSS
FT                   RSRSKQLSRRPLIMPHEVLRMRSDEQIVFTAGNAPLRCGRAIWFRREDMKACVGENRFH
FT                   HPHTTTTSIAAPKVTKSDED"
FT   gene            complement(55302..55547)
FT                   /gene="traD"
FT                   /locus_tag="Avi_7062"
FT   CDS_pept        complement(55302..55547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traD"
FT                   /locus_tag="Avi_7062"
FT                   /product="conjugal transfer protein Dtr system"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7062"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39793"
FT                   /db_xref="GOA:B9K4J5"
FT                   /db_xref="InterPro:IPR009444"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4J5"
FT                   /protein_id="ACM39793.1"
FT                   /translation="MRAGLVRLDRMAKAMTTEARKKDTREKIELGALIVKAGLRYEKRA
FT                   LLLGLLIDANKRIKGNEAERSRLTSIGVEAFGHDGE"
FT   gene            complement(55522..55818)
FT                   /gene="traC"
FT                   /locus_tag="Avi_7063"
FT   CDS_pept        complement(55522..55818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traC"
FT                   /locus_tag="Avi_7063"
FT                   /product="conjugal transfer protein Dtr system"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7063"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39794"
FT                   /db_xref="GOA:B9K4J6"
FT                   /db_xref="InterPro:IPR012930"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4J6"
FT                   /protein_id="ACM39794.1"
FT                   /translation="MKKPSSKIREEIAKLQDQLRAAETREAERIGRIALKAGIGEIEID
FT                   EAELQAAFEEIARRFRGGKGPATGKENGHGDKPDRDTRPSFTPGADAGGPGEA"
FT   gene            56074..59376
FT                   /gene="traA"
FT                   /locus_tag="Avi_7064"
FT   CDS_pept        56074..59376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traA"
FT                   /locus_tag="Avi_7064"
FT                   /product="Ti-type conjugative transfer relaxase TraA"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7064"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39795"
FT                   /db_xref="InterPro:IPR005053"
FT                   /db_xref="InterPro:IPR014136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR041533"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4J7"
FT                   /protein_id="ACM39795.1"
FT                   /translation="MAIAHFSASIISRGDGRSAVLSAAYRHCAKMEYEREARTIDYTRK
FT                   QGLLHQEFVLPADAPNWVRSLIADRSVSGAVEAFWNKVEAFEKRSDAQLARDLTIALPL
FT                   ELTAEQNIALVRDFVEKHILAKGMVADWVYHDNPGNPHIHLMTTLRPLSEDGFGAKKVA
FT                   VIGEDGQPVRTKSGKIVYELWAGSTEDFNKLRDGWFERQNHHLALSGIDLRVDGRSYEK
FT                   QGIDLEPTIHLGVGAKAIERKAESQGVRPGLERIELNEKRRSENTRRILRRPEIVLDLI
FT                   THEKSVFDEGDISKVLHRYIDDPGMFQQLMARIIQSPDVLRLQRDTIDFATGDKVPARY
FT                   STRAMIRLEARMATQAIWLSNREGRAVSPTILDETFRRHVRLSDEQRIAIERIAGPARI
FT                   AAVVGRAGAGKTTMMKAAREAWELAGYRVVGGALAGKAAEGLEKEAGIQSRTLASWELR
FT                   WGRGRDMLDDRTIFVMDEAGMVASKQMAGFVDAVVKAGAKIALVGDPEQLQPIEAGAAF
FT                   RAIVDRIGYAELDSIYRQREDWMRKASLDLARGRVGDALAAYRSEGRVLGSELKAQAVE
FT                   HLIADWYRDYDPAKSTLILAHLRRDVGMLNGMARDKLVESGIIGEGHAFRTADGIRQFD
FT                   VGDQIVFLKNEGSLGVKNGMIGHVIEAAPNRIVAVVGEGDQRRQVTVEQRFYSNLDHGY
FT                   ATTIHKSQGATVDRVKVLASLSLDRHLTYVAMTRHREDLQLYYGKRSFAFNGGLSKVLS
FT                   RRNAKETTLDYERGNLYREALRYAENRGLNIVQVARTLLRDQLDWTLRQKNRLADLAQR
FT                   LRAIGERFGLQQSLKTQAMKETAPMIAGIKTFSGSVADTVEQKLDTDPALKKQWEEVST
FT                   RFVYVYADPETAFRAMNFDAVLADKDSARQVLQTLEAEPAFIGPLKGKTGILASKADRE
FT                   DRRVAELNVPVLKRDLEHYLRMRETAVQRLRADEQVLRQRISIDIPALSPTAHVVLERV
FT                   RDAIDRNDLPAAMAYALSNRETKTEIDGFNQALAQRFGERTLLTNAAREPSGKLFDTLS
FT                   EGMQPEQKERLKEAWPVMRTAQRLAAHERTVQSLKQSGELRLTQSQTSVLKQ"
FT   gene            59394..59903
FT                   /gene="traF"
FT                   /locus_tag="Avi_7065"
FT   CDS_pept        59394..59903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traF"
FT                   /locus_tag="Avi_7065"
FT                   /product="conjugative transfer signal peptidase TraF"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7065"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39796"
FT                   /db_xref="GOA:B9K4J8"
FT                   /db_xref="InterPro:IPR014139"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4J8"
FT                   /protein_id="ACM39796.1"
FT                   /translation="MSLAGVGVVISSLVATGWIGGYRLNLTPSEPLGLWRIDALFRDVD
FT                   VGDLVFVCPPATATFEEAWQRGYLRRGLCASGFAPLIKTVAALPGQHVAIGETIEVDGV
FT                   PLGASRLRKSDGQRRVIVPYSGGVVPRGYLFLHSSFESSYDSRYFGPIPDSGLLGLAKP
FT                   ILTFDP"
FT   gene            59974..61059
FT                   /gene="traB"
FT                   /locus_tag="Avi_7066"
FT   CDS_pept        59974..61059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traB"
FT                   /locus_tag="Avi_7066"
FT                   /product="conjugal transfer protein Dtr system"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7066"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39797"
FT                   /db_xref="GOA:B9K4J9"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR016707"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4J9"
FT                   /protein_id="ACM39797.1"
FT                   /translation="MTLPVVMLFPLLWAQSPSRLVAAAVSAGYFLAASRGLPQGVANFY
FT                   AADLWPGLLLWAVASLAFVVVHAVLWARQTERLRAVRYVVAMVQMALPPFGIIGWAHPL
FT                   TAAGILFPGWGWFGLGAAAILLVVMTGRRWKIAVAALVGLHAWSATNWTQPKAPDRWKG
FT                   VDLALGQRLGRDSSLTYQRGLIATARAMEDGKARFVVLPESALGFWTPTVARLWQDGLQ
FT                   GSSVTVIAGAAVIDAAGYDNVMVAISASDARVLYRERMPVPVSMWQPWLDWTGQGGGAR
FT                   ADLLRNPTVDIDGQKIAPLICYEQLILWPVLQSMILSPAVIVATGNGWWTVGTSIVAIQ
FT                   KASVTAWGRLFGVPVIVAFNT"
FT   gene            61071..61721
FT                   /gene="traH"
FT                   /locus_tag="Avi_7067"
FT   CDS_pept        61071..61721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traH"
FT                   /locus_tag="Avi_7067"
FT                   /product="conjugal transfer protein Dtr system"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7067"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39798"
FT                   /db_xref="InterPro:IPR010680"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4K0"
FT                   /protein_id="ACM39798.1"
FT                   /translation="MVDAALIQQCADPALKPAIVEQFIERAGSQDPLFIKVRSGSRVIL
FT                   VPKPATPDDALTLIRNNLGRNTVRVGITQYPAGLGILEAGQLKPDLVDACTNIRMGTAL
FT                   FAKVYRIVTKWYGNPTNKDVLPQVLDDAIIAWQTGYFEGVAVFRAEDPVDGKIDEFEQD
FT                   GKGSTRREDENEINHTTAPAGNDTDDPNSAGIRIDLSGIGARSQYNGLAGDPN"
FT   gene            62486..63337
FT                   /locus_tag="Avi_7070"
FT   CDS_pept        62486..63337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7070"
FT                   /product="transcriptional regulator AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7070"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39799"
FT                   /db_xref="GOA:B9K4K1"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4K1"
FT                   /protein_id="ACM39799.1"
FT                   /translation="MNAQEERSRDWVSIRRPFAKAGLETMTARYIQQSFKPHAHDEYVI
FT                   GIIEGGVHSVWCRGIHHNMPSGTVVTMHPGDVHYGNAAIAEGWKQRMIYISENEIGKFI
FT                   SDIAGGDKFLLPDFKQTFHDRPDLAHSFAQFHEVLHSSPLALARDVALDSIMRVTIGAL
FT                   SPDFVKAKDAKQPSGRIADAVEFLHNRIEDDVTLDELCDVAGLRRRQTIEAFKRCTGLP
FT                   PHAYHVIQKVKAVKTMLRDGFSATEAAARAGFADQSHMTRHFVGVVGMTPGAYALDCQK
FT                   KY"
FT   gene            63440..64354
FT                   /locus_tag="Avi_7072"
FT   CDS_pept        63440..64354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7072"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7072"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39800"
FT                   /db_xref="GOA:B9K4K2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4K2"
FT                   /protein_id="ACM39800.1"
FT                   /translation="MVGFRNASLSRRPVAVSMWADLAVLGVAVVWGTSYPVAKGALLYA
FT                   PVLILILYRFLITTIIMMIVARREIVAMSRGDILRGFLLGSILFSIFLAETYGVALTSA
FT                   TNTALIISLCVIFTPILDYGLSRKLPPPAVIASAIVCCVGVGILTGGINAFGAGDLLVL
FT                   GAAVLRAIMVVSTKRLMFGRQISSAALTAIQGFSVTTLTLVVVIAQFGVGSIAVDADPQ
FT                   FWFAVAFLSLFCTIAAFYIQNAAVRRTTPTRVGFLMGTEPFFGFLLAHLLLAEPISATS
FT                   VSGAALILAGSFAGILSENRKRS"
FT   gene            64988..65404
FT                   /locus_tag="Avi_7073"
FT   CDS_pept        64988..65404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7073"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7073"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39801"
FT                   /db_xref="GOA:B9K4K3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4K3"
FT                   /protein_id="ACM39801.1"
FT                   /translation="MSYKVHIKASDVIDVHVGCRIRLQRVLKGMSQKALAEGVGVTFQQ
FT                   VQKYETGTNRIGSSRLQAVARILSVPVAFFFEDGPQSSSPSQLPEAGIGKEITRFIRSE
FT                   EGLALNLAFTKIQDANVRRKVIGLVKTLAKEHAE"
FT   gene            complement(65523..66239)
FT                   /locus_tag="Avi_7074"
FT   CDS_pept        complement(65523..66239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7074"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7074"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39802"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4K4"
FT                   /protein_id="ACM39802.1"
FT                   /translation="MTQTVRDPLYRRHRFPAEVIAHVVWLYLRFPLSLRMVEDLLAARG
FT                   IIVSHQTVRLWAEKFGRRFANEIRRRSAGKLGDKWYLDEVVISIGGKKHWLWRAVDQDG
FT                   FVLDVLVQSRPNTKAAKRLIRKLLKGQGQAPRVMMIDKLGSYGAAKRDIMPGVEHRSHK
FT                   GLNNRAENSHQPTRRRERIMKGFKSARHLQRFVSIHDPVANLFHIPRHDILSHHHRELR
FT                   TAAMQMWSEFARLQAA"
FT   gene            complement(66567..67679)
FT                   /locus_tag="Avi_7075"
FT   CDS_pept        complement(66567..67679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7075"
FT                   /product="major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7075"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39803"
FT                   /db_xref="GOA:B9K4K5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4K5"
FT                   /protein_id="ACM39803.1"
FT                   /translation="MLGVSIGALLPNAMETFSLSPFMAGMVFVIWSIGFSVGSFAAERL
FT                   LRAYGTIIVLTLLSALTAVFSLLQFTATVPSLFYAIYLALGLCGGAIFTASHTLFGELF
FT                   VDRRSSALAVLDVVFSVGNMAAPLLIVAVLSWKISWQSFYLLLTFGFTLITGLFALQLL
FT                   GRNAEVFHERADSTMDARTGLNILPLASLVSLAIASFALGATEWTQNVWFVSYALEEGL
FT                   PQDLARFGLSAFTAGMIASRVFVIWFDGAVRSVAIQRTMLLLALVGETIVIIAATAPLM
FT                   LLGNVILGAGIGGLFPIFLGRAMDHNPSSSAALSMLMVVSLTLGGQVASFALGALSDRF
FT                   GVTTAFSATVPIILIMAITFEAYRRSVAKA"
FT   gene            complement(67729..68790)
FT                   /locus_tag="Avi_7076"
FT   CDS_pept        complement(67729..68790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7076"
FT                   /product="zinc-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7076"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39804"
FT                   /db_xref="GOA:B9K4K6"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4K6"
FT                   /protein_id="ACM39804.1"
FT                   /translation="MSTTMQVIELNGPNRLSISQRQVPETPVDGVLLKTSAVSICSTDI
FT                   SHYHGNLLAEDYPVILGHEYSGIVVDVGPECPSSLQGQRLAYFGQTDFGGMAEYRALRP
FT                   LFAGDLRSSPFKTGRFFKDDERAAAITLPDEISDSDAPLIEPITAVLRSILTHPPAVGN
FT                   RVLVLGGGPCGAIAGAILQTLYATKSVAVLERNQARQEIARSQYANFVFGSAEELRESD
FT                   DDAFDYVFDALPPLVNIEADSCPRRAAMRAAKPGSKYVLYGASQTLQQFDTWLLLAKGI
FT                   TLASAAFDVDHFPMYKTAFVMKTAKELLLRRIIDPGWMMTNHMSFWRPQEVIQFFAEYY
FT                   TTPHLKTVIHFDQ"
FT   gene            complement(69237..69911)
FT                   /gene="menG"
FT                   /locus_tag="Avi_7077"
FT   CDS_pept        complement(69237..69911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menG"
FT                   /locus_tag="Avi_7077"
FT                   /product="demethylmenaquinone methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7077"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39805"
FT                   /db_xref="GOA:B9K4K7"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4K7"
FT                   /protein_id="ACM39805.1"
FT                   /translation="MLGFRVCKRKQNVCAEWVEKFRTLPVANVSDVMSRMTAGGAPLRP
FT                   FYTGPRMVGAAVTVKARPGDNLMVHKALDIAEPGDIVVVDAGGDLSNAIIGELMVAHAA
FT                   QRGLGGIVIFGAIRDSEELLAGSFPVFAAGVTHRGPYKDGPGEVNVPIAINGMVIEPGD
FT                   LICGDADGLLSVPLSSVETVFEAASKKHAAEIKQMENIKLGKNDRAWVDASLTRLGCVI
FT                   EA"
FT   gene            complement(69942..70892)
FT                   /gene="serA"
FT                   /locus_tag="Avi_7079"
FT   CDS_pept        complement(69942..70892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serA"
FT                   /locus_tag="Avi_7079"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7079"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39806"
FT                   /db_xref="GOA:B9K4K8"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4K8"
FT                   /protein_id="ACM39806.1"
FT                   /translation="MTGAELAPEATELLKRHAIEIVYADGYSGSENLAEIAKTHAVDAI
FT                   LVRQGQINDQVIASSSRLRVIAKHGSGVDNIDLDAATSHNIPVLRALAANAQSVAELAI
FT                   TLSVTLMKDIGSLSDTVKGGAWPKTKYVGRDLAGACFGIIGFGEIGRRTAKLAQGLGME
FT                   TIAYDPFAEDADGTRVSRDLSDILAQSDIVSLHCPLTPQTHHLINAERLKVMKSTAFIV
FT                   NTSRGAVIDEAALLDALKDGSIAGAALDSFEQEPPAADHPFWALPNLIATPHVGGASRS
FT                   ALRNMALQSAQHIVDVLTGAPFDRRALANQNLAQN"
FT   gene            71096..71791
FT                   /locus_tag="Avi_7080"
FT   CDS_pept        71096..71791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7080"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7080"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39807"
FT                   /db_xref="GOA:B9K4K9"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4K9"
FT                   /protein_id="ACM39807.1"
FT                   /translation="MPGNSSGVAAVERAVSMLEAFTDVDYSLTLGELARRTELDKSTVL
FT                   RIARSLAKSSMLVRNDDASWRLGPKLVRLGGLYQSTFKSSAIVEPLLAQISDESGESAA
FT                   VYVKEGVVRVCLHRHDSTQSIRHSARVGDAMPLDRGAPGRVILAFTGSSGKLYDDIRAK
FT                   GFHVTIGERDPQVASVAVPVYRDGQALFGSLALTGPPSRFNEEAVSKNLEILRVAARKL
FT                   SAALGGDPG"
FT   gene            71843..72802
FT                   /locus_tag="Avi_7081"
FT   CDS_pept        71843..72802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7081"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7081"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39808"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4L0"
FT                   /protein_id="ACM39808.1"
FT                   /translation="MNMMRTAILAASSLLATIGSAHAEWPKDRPIQMIVAFAPGGSTDV
FT                   MARAMQPYLEKELGADIVIENRPGASGEIAYTALAKAKPDGYTFSYINTPGFLSMQVQR
FT                   KLGYDPKTIKPIARIVDDPAAIVVPAASEIKTIAQFIEAAKAKPGAVSFGSSGIGTDDH
FT                   LAIIILGAEAGTKITHIPFNGAGETRTAILGAQVTGGGLNVSEFGGNDTSGLRMINTFG
FT                   KERSPELPDVPTAIESGFNVEMTSERGIAAPREVPAEIADRFAAAVKATLDNPEFQKQA
FT                   KQMALPLAYLSGPDWEKEMPTRLARFQKIWDTTPWVQQ"
FT   gene            72799..73260
FT                   /locus_tag="Avi_7082"
FT   CDS_pept        72799..73260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7082"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7082"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39809"
FT                   /db_xref="GOA:B9K4L1"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4L1"
FT                   /protein_id="ACM39809.1"
FT                   /translation="MSVKPVANGRDFPDILAGGVLIFLGALGLWAGRDLTYGTPAMMGP
FT                   GFLPKSLCAIIALIGVIVLIKALSKPHESLDAVNPKPLLILVAAIAGFAFAAERFGFVA
FT                   ATIWLLVVGSLADPESRWKEIFISTAVLTTLGALLFVYGLGVQMPIWPF"
FT   gene            73292..74800
FT                   /locus_tag="Avi_7083"
FT   CDS_pept        73292..74800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7083"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7083"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39810"
FT                   /db_xref="GOA:B9K4L2"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4L2"
FT                   /protein_id="ACM39810.1"
FT                   /translation="MAFLDVLMLGFSEALTPTNLMFCFIGALLGTLIGVLPGIGPTATV
FT                   AILLPVTFFLPPLGALIMLAGIFYGAQYGGSTTAILVNLPGEASAVVTAIDGYQMARKG
FT                   RAGAALAIAALGSFFAGTVATIALAVAGPTLSAFALSFGPAEYVALCIFGLLAATILAH
FT                   GSVVKAIGMVCLGLVLGMVGIDVNSGSARMTFGSTDLYDGIDFVVIAVGLFGIAEIATN
FT                   LESKEIRGVLQSKIGRLWPTREEFKDSWAAVLRGTGVGTILGVLPGGGATLSAFSAYSV
FT                   EKRISKTPEKFGHGAIAGVAGPEAANNAGAQASFIPLLTLGIPSNSIMAMMLGAMTIHG
FT                   ITPGPSVIQNQPELFWGLVASMWLGNAMLLVINLPLIGLWVKLLQIPYRLMYPAILLFC
FT                   CVGVYSVSNRGFDVALVILFGILGYVLRKAKCEPGPLLLGFVLGPLLETNLRRAMLLSQ
FT                   GDWLVFFERPISAVLLVITVAMLLTLILPTIRKNRKAAFEASED"
FT   gene            74891..76069
FT                   /locus_tag="Avi_7084"
FT   CDS_pept        74891..76069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7084"
FT                   /product="dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7084"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39811"
FT                   /db_xref="GOA:B9K4L3"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4L3"
FT                   /protein_id="ACM39811.1"
FT                   /translation="MVSALFASAGHRLRDVLSLDDFEVLAKRHLPGPLFGYIAGASETN
FT                   ASLRMNAEAFRDISLTPRVLRNVSTRTTKTILFGEEWSAPFGIAPMGISALMAYRGDLV
FT                   LAKAAQDAGIAMIMSGSSLIRLEEIIEAAPRSWFQAYLPGEPDRIDGLIDRVASAGYKT
FT                   LVLTVDTAVLANRENNIRAGFSTPLRPSLRLTWQGMTHPAWTIGTFARTILTHGIPHFE
FT                   NSYATRGAPIIASNVMRDFGKKDHLSWGHFSRIRQRWTGNLVVKGILHPEDAAMAAERG
FT                   ADGIIVSNHGGRQLDGAIAPMKALPAIVDRVGSDTVVMIDGGIRRGTDMVKALALGAKF
FT                   VFVGRPFVYAVAVGSKAGVAKATSILSDELHRDMGLLGVTEIIELPSILTRI"
FT   gene            complement(76152..76820)
FT                   /locus_tag="Avi_7085"
FT   CDS_pept        complement(76152..76820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7085"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7085"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39812"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4L4"
FT                   /protein_id="ACM39812.1"
FT                   /translation="MLGTASAATLAASVDVRCLRLRNDVDLRFKCAIFRVRLSFGRYAG
FT                   TVIKVRGRWTYLYRAVDKLGNTIDFYLSPTRNAKAAKRFLDKALNDLKDWETPTVINAD
FT                   KAPTYRIALSQLKTKGKYPAEFMHRQVKYLNTVIEADHGKLKQLIRSVRGFKTLKTAYA
FT                   TIKGFEVMRAVRKGQAAIFNLTGDICGEARIDERTFGIGPNALTEASALLAQNRESQAA
FT                   "
FT   gene            complement(76852..77577)
FT                   /gene="ameR"
FT                   /locus_tag="Avi_7086"
FT   CDS_pept        complement(76852..77577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ameR"
FT                   /locus_tag="Avi_7086"
FT                   /product="transcriptional regulator TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7086"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39813"
FT                   /db_xref="GOA:B9K4L5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4L5"
FT                   /protein_id="ACM39813.1"
FT                   /translation="MKHIEDNAGSERKPLAGAAKSVPAVAADKPYHRKNLREDLLRSAL
FT                   ELTVERDGPAFSLRELAMREKVSHTAVYRHFSDKASLFAELSSEGFRQLALYQNRTIEA
FT                   PDLPPLARLEQMGATYVRFAMENVGFFRVMFDVNLAGEWEEARKGERTAFGNLVGLVRQ
FT                   CQSEGDIIDADPRAIATYLVLSPHGLAHFNNIGHLTHLLQTSMTLDQLATQVFRLTLAP
FT                   FLTKPYSEQDVRALVNSIF"
FT   gene            77781..79088
FT                   /locus_tag="Avi_7087"
FT   CDS_pept        77781..79088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7087"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7087"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39814"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4L6"
FT                   /protein_id="ACM39814.1"
FT                   /translation="MKSLTSADRLSRTISRRTIVKGAGALALGTLMSPHVVRASSGKIK
FT                   IGYIGCLSGLRAEFSVADLWTINQMKALVAKGLDVGGKTYEVEFVIRDNQSDVNRSASV
FT                   ASELVLRERCNLVLVADGDGALAIGELADTRRVPVISTMMPWEGLYAARGSTPEKGFPY
FT                   TFHFFPSSASILQNYVGMWNAAGTNGRVGTIYLDHAVGRALMDPAHGLPAQMKQAGMTE
FT                   VAAGAFQLGTTDFSNQIARFKDGNCDVLAGYMFQQHFVTFWNQVRQAGLTPKVCTFAAA
FT                   FAFSSTMEALGKSGDGMTTDVFWTPSYPYKSSLTGIGARDLANQWQNESGKQWLQPLGY
FT                   IHALWEVGFAALKQSTDPRDANAVRTSIANLDIETMAGRVNFKTTTKKSIADMPMAAGQ
FT                   WRFDAAAKFPFDLDIVYNALAPEIPVTAHLRRLQNA"
FT   gene            79081..79842
FT                   /gene="rbsA"
FT                   /locus_tag="Avi_7088"
FT   CDS_pept        79081..79842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsA"
FT                   /locus_tag="Avi_7088"
FT                   /product="ABC transporter nucleotide binding/ATPase protein
FT                   (ribose)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7088"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39815"
FT                   /db_xref="GOA:B9K4L7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4L7"
FT                   /protein_id="ACM39815.1"
FT                   /translation="MHRSSEAQDNVILRIDNLNKSFQALHVTRQVTFDLLSGECVGLIG
FT                   PNGAGKSTLLGLLSGSLRPDSGTLTLDGANVTPFAQFKRVRSGIAKASQIPQTFDRLLV
FT                   FDNVRVAALYGAGIREKEAADWTADVLSQCGLGDKARRETRTLGLLDRKRLELAKAVAA
FT                   RPRVLLLDEVAAGLTEPEILEIVKLVERLKPGRATVWVEHIPYALRDVCERLILMDAGA
FT                   KLLDGPFHTVWQDPKLHQIYMGVPDGTTFDV"
FT   gene            79820..80524
FT                   /locus_tag="Avi_7089"
FT   CDS_pept        79820..80524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7089"
FT                   /product="ABC transporter nucleotide binding/ATPase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7089"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39816"
FT                   /db_xref="GOA:B9K4L8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4L8"
FT                   /protein_id="ACM39816.1"
FT                   /translation="MAPLLTFDDLVVRYGDIPALAGVSFAMDEGETLALVGANGAGKST
FT                   LLKALCGLVDRWEGGISLDGTVIKPGQVESTTARGIALVPEGRLLFNSLTIEENLKIGQ
FT                   TGRQGRWSLDEIYALFPILHERRRQNPGHLSGGQQQMVAIGRALASNPRLLLCDEISLG
FT                   LSPKVTEDVYAALASIRASGVSLLIVDQDIARVCSRADRVVCMLKGRVSHISPAAGVTA
FT                   HTLRDAYFGAAQ"
FT   gene            80521..81390
FT                   /locus_tag="Avi_7090"
FT   CDS_pept        80521..81390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7090"
FT                   /product="ABC transporter membrane spanning protein
FT                   (urea/amide)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7090"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39817"
FT                   /db_xref="GOA:B9K4L9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4L9"
FT                   /protein_id="ACM39817.1"
FT                   /translation="MTLSDMLELLIQGLTLGGLYGLVGAGLALNFGVLKVVNLVHGELI
FT                   TCGGFIAAFCLSMVPNMPFPLILVLAMAGTALVGAGLQALVVERAMTTRDPMVTMLVTF
FT                   GLGIVARNVMVELFGADLRGLDVGGLSHARLQIGTVSVGVLPLMTFAFALAAFAVLHVL
FT                   VNMTAFGRAVRATSDRPDIARLMGVRVRTLHIKVAALAAALAALAGMLLAMRASISPYS
FT                   GVERLIVAFEVVVLGGVGSIRGALIAGLVLGTAQVVTARFDGNAGLLYVHLTFLAGLGL
FT                   RAFRGKLS"
FT   gene            81387..82346
FT                   /locus_tag="Avi_7091"
FT   CDS_pept        81387..82346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7091"
FT                   /product="ABC transporter nucleotide binding/ATPase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7091"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39818"
FT                   /db_xref="GOA:B9K4M0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4M0"
FT                   /protein_id="ACM39818.1"
FT                   /translation="MKLLVQSMALVAVIGSVAFFASGYIDPGLLYLLSEALLLLFMAQM
FT                   WNLLAGYGGMVSMGHQAFVGLGAYLFFALANFGVLPVGAALPVAALAVGLMALPLGLLL
FT                   FRLRNAYFSVAIWVVAEILVILFSKFSALGGTGGMTLRPDGGNLDLPLEQYVFAIALFS
FT                   CVGFTLAMRWVLARPTGLAILAVRDNEDAAQAAGVNVQKLHLALFAISAAGCAWAGSLY
FT                   YANVLYLTPTDAFQINWVIGMMFIAVVGGIGTLTGPVIGTVIFIGLREFLTSFGFSGSI
FT                   YWIVMGLIVIVTLVYAPRGLWPALHSLFRRMSIERKSA"
FT   gene            82343..83800
FT                   /locus_tag="Avi_7092"
FT   CDS_pept        82343..83800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7092"
FT                   /product="amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7092"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39819"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4M1"
FT                   /protein_id="ACM39819.1"
FT                   /translation="MNASNDPTKWTASEASLALAAKQIGAVELLDAYLARQAALDGEIN
FT                   AVCALNPDLARTVAQQVDADRIAGKSLPILAGLPMTIKDCFDVVGLPTTAGIPDMASYR
FT                   PQTDADAVANLRRAGAVFYGKTNTPLAAADHQTYNPLFGLTRNPHDLSKTVGGSSGGAA
FT                   AALAAGFTALELGSDIGGSIRIPSHYCGVYGHKSSWDTVSMRGHMPPPPGHLAKNPLLV
FT                   AGPMARSAQDLSVAFEILSSDCNRILKPARHSALADFRFGVWVDDNPVDPVYASAILDF
FT                   AESLRKQGAKVVEIPGGPSGADRLFDTYIKMLFATIGSELDDDEIARYTQAGNDPATGE
FT                   FGPLLAGAVVESHRKFVEQAQMQARFQSVWAKQFETLDVLLCPVSMGTAFPHDCDDGHG
FT                   PVPQMKRTIQIGNISQPYLDNLRWPGIATLLHLPATVRPLPHPVNGMPAGVQIIGPYLE
FT                   DRTTLTFAKLCDEAFGRSEMPLLPRKS"
FT   gene            83891..84262
FT                   /locus_tag="Avi_7093"
FT   CDS_pept        83891..84262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7093"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7093"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39820"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:B9JTB0"
FT                   /protein_id="ACM39820.1"
FT                   /translation="MTRRRFDLTDFEWTVIQPLLPNKPRGVPRVDDRRVINGILWRFRT
FT                   GSPWADVPDRYGPYTTCYNRFVRWRKAGVWDHVLGEISKAFDGDIVMIDSSCVRVHQHA
FT                   ATGKRGINTMAAWDVPVAA"
FT   gene            84346..84654
FT                   /locus_tag="Avi_7095"
FT   CDS_pept        84346..84654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7095"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7095"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39821"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4M3"
FT                   /protein_id="ACM39821.1"
FT                   /translation="MAEPLLQTISKGAILLADKAYDTNAIRAFAKQRQAWANIPAKSNR
FT                   KGSFPFSQWVYRQRNLVERFFSKLKQFRGIATRYDKDPLNFLAAVKLAAARIWIRSL"
FT   gene            84694..85212
FT                   /locus_tag="Avi_7096"
FT   CDS_pept        84694..85212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7096"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7096"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39822"
FT                   /db_xref="InterPro:IPR020915"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4M4"
FT                   /protein_id="ACM39822.1"
FT                   /translation="MITRAPISATKRPIPMDTSFAFDQLRLLPVWEASVLLEPTQVRGP
FT                   GPLGVRNIVPIVGGDFEGVIAPETDSPRRFCGTIQPGGFDLQRERADGMLELEAIYHML
FT                   TDDHVSIEIRNYALLEPKLDGSIGYSRCRIFVDAPDGDYAWLNRRIFTGSVEVIRPQKQ
FT                   VLIRSFTVV"
FT   gene            complement(85515..86114)
FT                   /gene="rhtB"
FT                   /locus_tag="Avi_7098"
FT   CDS_pept        complement(85515..86114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhtB"
FT                   /locus_tag="Avi_7098"
FT                   /product="RhtB family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7098"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39823"
FT                   /db_xref="GOA:B9K4M5"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4M5"
FT                   /protein_id="ACM39823.1"
FT                   /translation="MTNLWIYVGACLAIIAIPGPALIYILSRTVEGGFRAGFLSASGIA
FT                   VGALANALASAVGLSLIFKTIPASLTVVKYLGAAYLLFLAYKAVSPGASSATQIDSDQT
FT                   KFFRQGVIVSLLNPKVTLFFAAFLPTFIDPSQGYFVQTSFLAVTFVIIAFLFDISLVLT
FT                   SGYTRQYFLRQSGANNVLFKYASAICLVFVASFAIR"
FT   gene            complement(86119..86688)
FT                   /locus_tag="Avi_7100"
FT   CDS_pept        complement(86119..86688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7100"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7100"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39824"
FT                   /db_xref="InterPro:IPR010349"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4M6"
FT                   /protein_id="ACM39824.1"
FT                   /translation="MFDRYTLDSKEYHQIDTLVSSIKHRALRAWLSELAGDDGYWVNDS
FT                   CGMPCWVAPMHQHARLWNALSNSNASAMEAIKELWTANPILIGGSNRVDTTILQFGKGR
FT                   LFAKEGADGLLFLHATGKKGEPPVTILVKMSQAARDEHLYFAVIIAIKQYVPSRATLMH
FT                   DFASHLQFIIASNVLSFESTLEPRKS"
FT   gene            complement(86706..87731)
FT                   /pseudo
FT                   /locus_tag="Avi_7101"
FT                   /note="asparaginyl-tRNA synthetase related protein; Stop in
FT                   Frame (pseudogene)"
FT   gene            complement(87943..88314)
FT                   /locus_tag="Avi_7103"
FT   CDS_pept        complement(87943..88314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7103"
FT                   /product="Transposase and inactivated derivatives IS5
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7103"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39825"
FT                   /db_xref="GOA:B9K4M7"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4M7"
FT                   /protein_id="ACM39825.1"
FT                   /translation="MEEKHGAKFRRGWRKLHLALDANTGDIIAHVMNNQEVGDGSQVGP
FT                   LLEQIDMPIWQFTADGAYDGETNYDTVPSHSADAAVVIPLPANAVERQHDDPPSQRDRP
FT                   QSHAGLRALEIRRCRKATA"
FT   gene            complement(88356..88640)
FT                   /locus_tag="Avi_7104"
FT   CDS_pept        complement(88356..88640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7104"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7104"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39826"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4M8"
FT                   /protein_id="ACM39826.1"
FT                   /translation="MTPDALSCWEAPKRRTRGGQPHYSDLAIETALTLGLVFGLRLRHT
FT                   EDLVTSVLKLISLDLAVPDHTILSRRGSKPRAPDKKYDDRIPQKSLSAS"
FT   gene            88930..90174
FT                   /locus_tag="Avi_7106"
FT   CDS_pept        88930..90174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7106"
FT                   /product="phosphoenolpyruvate synthase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7106"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39827"
FT                   /db_xref="GOA:B9K4M9"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4M9"
FT                   /protein_id="ACM39827.1"
FT                   /translation="MNFEARSSKHFDRVSPKGCFGQQKQDAGPFAFGTKSETLFKINKI
FT                   SKNFTILPIAVVQYSDWQEDRDRTARKVWSDLEMAQTLIVRSSCAVEDSEVASHAGEFL
FT                   SLLNIKSLADLDRAIDDVFMSYGKPTPGEQVLVQPMAREVVLSGVAMTADAQSGAPYTI
FT                   VDYAHGADTEAVTAGTSNSGMAICVTGYESHLPPCLQPLAPALRELAEITGGKPVDIEF
FT                   AITATGTVIIFQVRPIVMKSPRHKVVGFGFPYLIENVRRCYKDIVKFNARNGLANALFG
FT                   VMPDWNPAELIGIKPRPLTYSLYRYLITDVAWTKGRAPLGYTDMSGDGLMRLIGGTPFI
FT                   NVSASLSSFVPKSVPALIRSNIVADASRALAAAPQFHDKIEFEIMPTVFTPDLTQPHWR
FT                   ARFPTRSGLGIWKIS"
FT   gene            90249..91325
FT                   /locus_tag="Avi_7108"
FT   CDS_pept        90249..91325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7108"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7108"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39828"
FT                   /db_xref="GOA:B9K4N0"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4N0"
FT                   /protein_id="ACM39828.1"
FT                   /translation="MYEQKSDLKSANLMDATRLLSWVRHNAAPLFSGAARSAFIATSIL
FT                   RVLARTGYIHEAVIEDISRSAQAIGSELVRDFQRLERDVFMARYGHIRPGTFDITVPRY
FT                   DQEPEKYFSFLDATQAQPDVRDTGSFVELSASDIARIDAHFAALGYNFNWARFRTFAAS
FT                   AIHAREYVKFLYTKQVSDALEIISNVGVQYGCNREEMSFLTLSDIENMLDFTSDIDRRI
FT                   REISASNRVSWQQSLPVRLPDLLTSPDDIFGFEVEASAPNFVTYETVQAPVALSLDNDL
FT                   RGKIVFIETADPGYDWVFTRGIAGFITRYGGENSHMAIRAREFGIPAVVGAGRHYDKWK
FT                   TFSVLRCDCRARRVEPII"
FT   gene            91322..91936
FT                   /locus_tag="Avi_7109"
FT   CDS_pept        91322..91936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7109"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7109"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39829"
FT                   /db_xref="GOA:B9K4N1"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4N1"
FT                   /protein_id="ACM39829.1"
FT                   /translation="MSRFVAITMRDAVLPERNEHRDCLETGWWTFLEACEFVPVCLPNH
FT                   LGQAELILDSGILSGVILSGGGNVARSLEHVRARDRVEDIVLARAKEKGLPVLGVCRGL
FT                   QKLCHAFGGTLVERAGHTVTRHRIAGNWGERCVNSYHDYGIDEVPSQCHVLAEAEDGSP
FT                   EWLAHDSLPVSGIMWHPERNVVPDQADIALFRARFSTIGCY"
FT   gene            91936..92706
FT                   /locus_tag="Avi_7110"
FT   CDS_pept        91936..92706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7110"
FT                   /product="transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7110"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39830"
FT                   /db_xref="GOA:B9K4N2"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4N2"
FT                   /protein_id="ACM39830.1"
FT                   /translation="MRAIMLVAGRGSRLRNLTDMRPKCLVPFRGRPLLELSVERLKAGG
FT                   VEKFTFVAGYRSEAIEAFIETHEIDAEVVLNRDWDSTNMVQSLFCAADRLAAEPCIVSY
FT                   GDIFFESGIVRNLISAQGDLVLAYDHNGRTLWERRFKDPLSDIENFRIGTEGRLIAIGG
FT                   RVQDITTVQGQYMGLFKLTPTGLAEMQDFCASLSADRRRSIDVTSTFSALLGRGTLIRC
FT                   VPNLDPWGELDSPEDIHFFEASTPLNTPALERSY"
FT   gene            92703..93350
FT                   /gene="rhtB"
FT                   /locus_tag="Avi_7111"
FT   CDS_pept        92703..93350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhtB"
FT                   /locus_tag="Avi_7111"
FT                   /product="RhtB family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7111"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39831"
FT                   /db_xref="GOA:B9K4N3"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4N3"
FT                   /protein_id="ACM39831.1"
FT                   /translation="MMDPALWLLFALAYLGITFSPGPNVLMVLNHTAKYGYRHVFVTMA
FT                   GNLSCQLLIIVAIGVGIGSLLTVESAAYHWMKIAGALYLIYLGARIVYDVFIRGRLKAV
FT                   KAPTQLNQVHALPSARKRFLEAFAVSASNPKTVIFLSAFLPQFISPEWPIVPQFAIMYL
FT                   TIAIIVISVHYMYAFLLIRAQRRFSGMFSSRLFPGLSAAIYLFLGVTLGVSA"
FT   gene            93419..94009
FT                   /locus_tag="Avi_7112"
FT   CDS_pept        93419..94009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7112"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7112"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39832"
FT                   /db_xref="GOA:B9K4N4"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4N4"
FT                   /protein_id="ACM39832.1"
FT                   /translation="MRDPANAVTLAGLGFAVAGLHASVVGEVHLGAACLALALFADMTD
FT                   GWVARRSGLRRAAHMSRAGMQLDSIADLMHGAILPAALMGALSDWSAISLLLSVLLALC
FT                   AATRLTYFSVFGGNPDGSYRGVPVIYTSFLTSLLIGLLPMPFAAQVLPWCIATIAVFNV
FT                   SSLRVPKMTGGGLAAFNLLSVGVVILNLLKSIT"
FT   gene            complement(94454..95137)
FT                   /locus_tag="Avi_7114"
FT   CDS_pept        complement(94454..95137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7114"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7114"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39833"
FT                   /db_xref="GOA:B9K4N5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4N5"
FT                   /protein_id="ACM39833.1"
FT                   /translation="MVDFKGSHYPKEVILYALFFYVRYAVSYRDLEEIMAERGVNLDHA
FT                   TLNRWVVKYAPLIALQAKRRKSKPSGSWRMGETYIEVKGQWMYFYRAVDKHGKTLDFML
FT                   SEHRDEAAATDFFARTIENNGWPEKVVIDKSGANLAGLQNMNILLLLHGWFWLIEVLQV
FT                   KYLNNMIEQDHRFIKKLTRPMKGFKRFQSASATLDGIEVAHMIRKKQFSTSVQSPFQQF
FT                   SALAT"
FT   gene            complement(95236..95781)
FT                   /locus_tag="Avi_7117"
FT   CDS_pept        complement(95236..95781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7117"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7117"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39834"
FT                   /db_xref="GOA:B9K4N6"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4N6"
FT                   /protein_id="ACM39834.1"
FT                   /translation="MEEKHGAESRRRWRKLHLALDADSGEIIAHVMTDQDAGDATQVEA
FT                   LLDQIDDPIGQFTADGAYDGNPTYEAVTKRSAGAAVVIPPRANAVEQPDADLFSQRDHH
FT                   IAAINADGRMKWQAATDYGKRSLVETAIGRYKSIIGHRLRARSFATQQTEVAINCSSLN
FT                   RMLACARPKSVRCETDTA"
FT   gene            complement(95854..96180)
FT                   /locus_tag="Avi_7120"
FT   CDS_pept        complement(95854..96180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7120"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7120"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39835"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4N7"
FT                   /protein_id="ACM39835.1"
FT                   /translation="MKFKVTNWAEYDACLRQRGSLTLWVTSEVVDGWAAQRRKTRGGQQ
FT                   RYSDLAIETALTLGLVFGLRLRQAERFLMSVLRLMGLDLAVPDHTTLSRRAKNWQSPDK
FT                   RQCH"
FT   gene            complement(96351..97313)
FT                   /locus_tag="Avi_7121"
FT   CDS_pept        complement(96351..97313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7121"
FT                   /product="transcriptional regulator LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7121"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39836"
FT                   /db_xref="GOA:B9K4N8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4N8"
FT                   /protein_id="ACM39836.1"
FT                   /translation="MRRRVPLNSVRAFEAAARRMSLVQASDELCVTPTAVSHQIRQLED
FT                   FLQTKLFLRRSSRLELTPESRACLAKLTEALDIIDDAIAALHKPMDMPERLVVGASASV
FT                   GSLWLMPRLRNFYRTAPEIDISLTTFIERSAIETDTSDVWICNWHTNLDRRVELLLEED
FT                   IIPVCSPQMAEEFGELSFDSLRELPLVHVDRAKASINGQYPDWDRYLREYGISRNDIAK
FT                   GPRFNQAGPAIEAAKAGMGALLGRSILIERALETGELIRLGDPYPIRNPYYLISPLQPA
FT                   SNAVKMFKDWIFAQAKTRTSTYVELPHKNRRGSDFRLTV"
FT   gene            complement(97429..98709)
FT                   /locus_tag="Avi_7122"
FT   CDS_pept        complement(97429..98709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7122"
FT                   /product="MFS permease"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7122"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39837"
FT                   /db_xref="GOA:B9K4N9"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4N9"
FT                   /protein_id="ACM39837.1"
FT                   /translation="MLANRFPALQIRNFRIFYLGLLLSLAGPWMQTTAQAWLVLKLSDS
FT                   SLALATVTSLQFLPIMLLALVGGVVADRFPRRRLMAITQSLAAVQALVLGVLVMTDTIA
FT                   LWHIYLLALSLGVINALDNPLRQAFVSELVDVPRLGNAIALVSMMQNLGRIIGPAIGGV
FT                   VIAAFGVGPAFLINAVTCSTILFALASIRAADLQPIRFSGRYTMISQIAEGLSYARKTP
FT                   SILFLLIATAFIGMFGQNFTTIVPLAANYLVHAGAAEFGLLNSSLGMGSFFSAFMLTGR
FT                   RKPTVGLILVAGLSFGLVLIAIAFCGSLIVSCLLFLLVGAAAVTFSTSVAGSLQIQSPP
FT                   EMRGRFASMVHLLITGSSPIGAMMTGVLAEHFGVPAAISTNGVLCCIGTAFAFFYFHRM
FT                   RRNFPFDLTRPAPDSAAQPIATAQPAE"
FT   gene            complement(98742..99611)
FT                   /locus_tag="Avi_7123"
FT   CDS_pept        complement(98742..99611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7123"
FT                   /product="D-N-carbamoylase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7123"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39838"
FT                   /db_xref="GOA:B9K4P0"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4P0"
FT                   /protein_id="ACM39838.1"
FT                   /translation="MTFRAAAVQLGPASATIKATLARILTLLDKAAEQKITLAVLPELA
FT                   LTPYFAATIHDRAAQYADKEENDAAISAITTKARDCAMTVILPFAEQNGNRIYNSMAFI
FT                   NSRGEHVGTFRKMHIPGFVEQKESGEVTILEKRYFVPGDKGFAVHDCEPWKLGGLICYD
FT                   RRFPEAYRSLFLQGVDVICIGYNTPVMPASTLSASRHASELAMCGGAYSNGTYVVAAGK
FT                   AGMEGGLRYIGGSVVIGPDGRLLSKAKTMGDELVVADIDLQRQQLIRDRWDFHANRRPD
FT                   SYLMSAAV"
FT   gene            complement(99745..100434)
FT                   /locus_tag="Avi_7125"
FT   CDS_pept        complement(99745..100434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7125"
FT                   /product="hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7125"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39839"
FT                   /db_xref="GOA:B9K4P1"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4P1"
FT                   /protein_id="ACM39839.1"
FT                   /translation="MAVWDRFLTDDDKLVVARRARRPLNGPGRRNALLIIDMQVTACGL
FT                   DKPIYEQLDLYSGACGPHAWKAIPVQQRLLAAARAAQMPVIYSKHVFYDISGLPEARSD
FT                   NNFSARNAKSDIPPEVAMQSGDLLVEKQTPSCFAFTNLHLMLSNLNVDGLFLAGNSTSG
FT                   CVRATAVDGTALGYKIQVIEEAVFDRIEMSHAAALFDMQFKICDVISEDEALSQFSSHG
FT                   ARKIQAA"
FT   gene            100680..101783
FT                   /locus_tag="Avi_7126"
FT   CDS_pept        100680..101783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7126"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7126"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39840"
FT                   /db_xref="GOA:B9K4P2"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019914"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9K4P2"
FT                   /protein_id="ACM39840.1"
FT                   /translation="MTKIGVFIPIGSRGWLISTTSPATMPSFELNKAVVQQAEHYGLDF
FT                   ALSMIKLRGYNGPSEYWVHNLESFTLMAGLAAVTKKIQLFASVAMLTMPPAVVARMAAT
FT                   IDSIAPGRFGINMVTGWQPKEYQQMGLELTPEHFARRYDYASEYVQVMRDLWTKGVSNF
FT                   KGEFFQMDDCKLSPRPSAHIPVVGAGQSERGMRFVAEYGDYNFIGAGGDMNQTDGARTM
FT                   VAKVEAAAKQSGRDTGAFLLLMVIADRTDELAFAKWELYKQGTDIEALEWQASQAGQDT
FT                   VAKEGSTAAALVRQIKNPQPTGMLKLIGSYEKVAAMLDEIALSTPGLKGIMLTFDDFVI
FT                   GMEQFGQYIQPLMRSRNPNLKRNLDAA"
FT   gene            complement(102052..103362)
FT                   /locus_tag="Avi_7127"
FT   CDS_pept        complement(102052..103362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7127"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7127"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39841"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4P3"
FT                   /protein_id="ACM39841.1"
FT                   /translation="MGMTLPYQLDACTLTTLTHGGQLSVTDIATSIIRRIEERDSAVRA
FT                   YAHFDPTQVLAAAQMLDAAPHKGPLHGVPIAIKDVINTKDMPTQHNSARYHGHQPGMDA
FT                   ACVDTLRQAGALLIGKTVTTEFATTNRGSVTRNPHDLACTPGGSSSGSAAAVADFQATL
FT                   ALGTQTGGSTIRPASFCGIYGFKPTWNAISREGLKMYSATCDTLGLYGRSADDLALLAD
FT                   VFALDATETALADDLAGKRIGVCLSPAWPKAELATQQAMNTAIDALKQAGAVVSDIALP
FT                   AMFDGILAAHHIILRREGRSAFLNEANATPDLHDELKAIVENRQAITPSQARDAYRLAD
FT                   QCRAAFDDIAASYDVILTPSSTGEAPRGIETTGDAIFNSIWTLMQVPVVNVPGLYGPNG
FT                   RPVGVSLTAQRYQDRKVIAYADLLGAALQNRQSMAAE"
FT   gene            103570..104073
FT                   /locus_tag="Avi_7128"
FT   CDS_pept        103570..104073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7128"
FT                   /product="flavoprotein oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7128"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39842"
FT                   /db_xref="GOA:B9K4P4"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4P4"
FT                   /protein_id="ACM39842.1"
FT                   /translation="MDIARFKLGMRRLASGVSLITTLSDGVRHGLVATAVSSVSGDPPS
FT                   LLICVNKNASAHGHIERSGIYCVNILSESAQPIAASFSSAIDRDKRFLRGEWQILKTGA
FT                   PALVDSLASFDCEVRHALSYATHTIFIADIVATELWDSTDAPLVYLDGRYRQVLVEPDM
FT                   TPAE"
FT   gene            104155..105462
FT                   /locus_tag="Avi_7129"
FT   CDS_pept        104155..105462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7129"
FT                   /product="ABC transporter substrate binding protein
FT                   (spermidine/putrescine)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7129"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39843"
FT                   /db_xref="GOA:B9K4P5"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4P5"
FT                   /protein_id="ACM39843.1"
FT                   /translation="MEHQMSNQKRKGITRRGLIKGAAAVGGMAAGSGAISGFPTIWAQN
FT                   IKDIKLVHVGQSYSTIKNIQEQASKDLGFTIEMQTADVATQMNRMLTQPESMDVADLAN
FT                   TSVRYLLGRNIVQPVTTKEYKWWDKTISLFQTGKYPNGKMASLEGFAPIKAQYYANKTA
FT                   SAYSMTPTEWLVGIPLYYNADTLGVRPDLIGSTKIDSWARLLDPAFKGHVALQEGVNVG
FT                   LPDAAMALSALGEVSYVDKGNMTRSEIDKTIKKLIEYKKAGQFRSFWLNFDQSVQLMAS
FT                   GEVVLQSMWSPAVTEVRTRGIACTFQPLKEGHRGWYIMMFQMQHLTGLKRECAIEYMNW
FT                   YNSGWAGAFISRQGFYNTVPENVKPLMSANEYGYWYEGKPASEPILNPFGKVMEKPGAV
FT                   RDGGSLWDRMGNIGIWNTLMDEDRYLVRRWQDFIAA"
FT   gene            105491..106360
FT                   /locus_tag="Avi_7130"
FT   CDS_pept        105491..106360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7130"
FT                   /product="ABC transporter membrane spanning protein
FT                   (spermidine/putrescine)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7130"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39844"
FT                   /db_xref="GOA:B9K4P6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4P6"
FT                   /protein_id="ACM39844.1"
FT                   /translation="MSLSSAKRVSLLQIAPMALVLVCFVILPLAMIIAVSFMDYGFAEV
FT                   IPEFIWENYLDIFTSELTLRLYLQTFKFLAIVWAITLFLGFTIAYYLMFHVRSPIVRAL
FT                   CIAACAIPFWTSGPIRMVSWVPLLGREGLVNQVLLHLHIIEQPLSWLLYSEFSVIVVYV
FT                   NVLTLAMLGPIANSMAKIDKNLLHAARDQGASEGQIIRLVIIPLIKPGIAIGSIFIVTA
FT                   VMGDFFIVKQMGGGQINTAVGAIATELNAFQYPPAAAKSVVMLVIVLGFVASLLRLVDI
FT                   RKELANQE"
FT   gene            106364..107209
FT                   /locus_tag="Avi_7131"
FT   CDS_pept        106364..107209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7131"
FT                   /product="ABC transporter membrane spanning protein
FT                   (spermidine/putrescine)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7131"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39845"
FT                   /db_xref="GOA:B9K4P7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4P7"
FT                   /protein_id="ACM39845.1"
FT                   /translation="MRERGQPRPASFYLLLGIFAVYLAFLYGPMLCVFILSFQGPSGGM
FT                   SFPMVGVSTHWFQVLLGGTGGEGVGDLHDAFFRSMRLAAIVAVLTMTISVAAGMAYRRK
FT                   FPGANLVFYSAIAAMVLPGIFVGFGIALAFHLLGYKIQWYSSGIGAQLTWSLPFGLLIM
FT                   FIVMGRFNRSYEEAATDLGATSWQRFSQVILPIILPGVVGIFMAGFTSSYEELARTSLN
FT                   VGSGNTMPMEITGLLTAATSPVLFAIGTLTTAVSFILVIGMLLLATTLAKRQQSRLQPH
FT                   "
FT   gene            107237..108310
FT                   /locus_tag="Avi_7132"
FT   CDS_pept        107237..108310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7132"
FT                   /product="ABC transporter nucleotide binding/ATPase protein
FT                   (spermidine/putrescine)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7132"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39846"
FT                   /db_xref="GOA:B9K4P8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4P8"
FT                   /protein_id="ACM39846.1"
FT                   /translation="MRHETQLTTVPTDSVAKNVIQKTAPSSSAHHNDVELVAVTKRYGS
FT                   STAVDTISLRIPSASYCCLLGPSGCGKTTTLRMIAGHEIVSDGDILVQDRNVTLAPAVQ
FT                   RGTSMMFQNYALFPHLSVVDNVAFSLKLKGVARSERRRQAMDYLALVQMEVLAERLPAQ
FT                   LSGGQQQRVALARSLITRPKVLLLDEPLSALDPFLRITMRSELKRIQRELGITFVHVTH
FT                   SQEEAMALSDMIVVMNGGAIMQAGPAREVFARPLNAFVARFIGGHNVLNLGGRQFCVRA
FT                   DKCRIAGAEDDRHTIAEVVGGEYQGAIGRLSLMTADRQPISVMVSDNDYFAFSHSIGDR
FT                   VSVSWSVKDEWGLEVVG"
FT   gene            complement(108406..109317)
FT                   /locus_tag="Avi_7134"
FT   CDS_pept        complement(108406..109317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7134"
FT                   /product="Integrase catalytic core"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7134"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39847"
FT                   /db_xref="GOA:B9K4P9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4P9"
FT                   /protein_id="ACM39847.1"
FT                   /translation="MVHYFPSNGRKHYGPGSIRSRHNDRSSGLENSPVDCFPAQTVRRA
FT                   IQNSQESLRALSKRYGINPKTVAKWKKRTSVADLATGPKEPHSTVLILEEEAVIVAFRR
FT                   HTLLPLDDCLYALQPTIPHLTRSSLHRCLQRHDISRLPEVEGDKEPKKKFKSYPIGYFH
FT                   IDIAEVQTAEGKLYLFVAIDRTSKFAFVELYAKAGKMNAAQFLRNLVKAVPYAIHTVLT
FT                   DNGIQFTNRACDLYAFHHIFDRVCDENGIEHRLTKVKPPLDQWAGRATGKHDQGSDRQA
FT                   CPLQRRLQFRAKAQDPKEPHAL"
FT   gene            complement(109395..109688)
FT                   /locus_tag="Avi_7135"
FT   CDS_pept        complement(109395..109688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7135"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7135"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39848"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR028344"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4Q0"
FT                   /protein_id="ACM39848.1"
FT                   /translation="MSFKLSVEAEEDIITIAEQGARMFGVDQAKRYHDELFALFDLIAA
FT                   NPRIARERNEIEPAVRIHPFKAHLIVYRVEDDEKIFVVRIRHGHEDWVSISM"
FT   gene            complement(109685..109978)
FT                   /locus_tag="Avi_7136"
FT   CDS_pept        complement(109685..109978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7136"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7136"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39849"
FT                   /db_xref="GOA:B9K4Q1"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR022789"
FT                   /db_xref="InterPro:IPR038296"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4Q1"
FT                   /protein_id="ACM39849.1"
FT                   /translation="MTNFAKIEYDSFKWRFPMATMNVSLPDPMKDWVEAQARTGRYSNA
FT                   SDYVRDLIRRDQTRNDKIAAMQGFVEAGLQSGVGIRSKDELFAEAMDRASKS"
FT   gene            110468..110992
FT                   /locus_tag="Avi_7140"
FT   CDS_pept        110468..110992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7140"
FT                   /product="AraC-like transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7140"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39850"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4Q2"
FT                   /protein_id="ACM39850.1"
FT                   /translation="MRVLVPISDSHMKSHGTTATDTFGCPLKQLSINQTLAGSDIVVFR
FT                   KGTSVVRLDQVKTSSSNRGLVVGVSSIGGHTRRIHHQHRVNINDFAGKSIYIRELAEAY
FT                   KADFGGSFEFLLFEISPADLIRIAEGAELSGITSLAAETASKDIVLANLARARFRRLKN
FT                   RRTQARCSSTR"
FT   gene            111121..111663
FT                   /locus_tag="Avi_7142"
FT   CDS_pept        111121..111663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7142"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39851"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4Q3"
FT                   /protein_id="ACM39851.1"
FT                   /translation="MDGKPLARTTIIQSCTILFGFSKPLQIELWNIFLRSRDTTNFCNR
FT                   AGSRHPQCYLATGSRKRSQTPRSSICKDHIMQELAANFIKTANAFDIEGVMSLVAPDAI
FT                   IDDVSVGDAFIGPEGIKQYLNQFFVGYHTQSRLLSVGKQDDHTAFVRLDFAGDFGHEIG
FT                   VLKITINSDGWIHADLE"
FT   gene            complement(112177..113175)
FT                   /locus_tag="Avi_7144"
FT   CDS_pept        complement(112177..113175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7144"
FT                   /product="OmpA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7144"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39852"
FT                   /db_xref="GOA:B9K4Q4"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR032608"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4Q4"
FT                   /protein_id="ACM39852.1"
FT                   /translation="MSGFRTGLATLALITVLGLPKFAAAEAPSQDIEGGKDNPIVSRFS
FT                   GAVIIGYQQQDYAALTLPLGPYDASQKSHFAKSKTVEGRLTSIAYAIPEGKTALEVYRN
FT                   YEQTLRAAGFQPAYQCEGSACGGYDFAAALADPINHAMGDNLFNLRIDLINATDGNVRA
FT                   MTAHLERPQGPVDVSLLVSQDSGRQPGLLLQILEGRAMETGEVTADAQAMSDSLAKTGH
FT                   IALYGIQFETDSAALKAESDKTLAQMAEFLTQDVSRKVYIVGHTDSSGALERNMNLSQA
FT                   RAAAVVKALTAKFGIDSDRLQPKGIGPYAPAASNANDAGRAKNRRVEMVER"
FT   gene            114361..114690
FT                   /locus_tag="Avi_7146"
FT   CDS_pept        114361..114690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7146"
FT                   /product="Restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7146"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39853"
FT                   /db_xref="GOA:B9K4Q5"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR029471"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4Q5"
FT                   /protein_id="ACM39853.1"
FT                   /translation="MARKIRDNFASDDMQAEPVICPLCERVIPDDQMEDHHLVPKSKGG
FT                   KLKLPLHRICHSHIHRVFTDAQLAKKFSTIAAILEDPAIQKFVAWVKTKPPSFEDEAEE
FT                   RTRRR"
FT   gene            complement(114792..115490)
FT                   /locus_tag="Avi_7148"
FT   CDS_pept        complement(114792..115490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7148"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7148"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39854"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4Q6"
FT                   /protein_id="ACM39854.1"
FT                   /translation="MNISSSTFASYRYKRHRFPAEIIAHAVWLYFRFPLSLRHVEDLLA
FT                   ERGIDVSFQTVSEWAAKFGSEFAALLRRRSKGGFADKWHLDEMVVTFKGRKYWLWRAVD
FT                   AEGYMLEALLQSRRNKKAALKLMRKLLKGQGLTPRVMVTDKLRSYDAAKRDIMPGVEHR
FT                   SHKGLNNRAENSHLPIRRRERIMMRFKSAAQCQRFVSTHGPIPISFWFTATSNCRRSPN
FT                   ASHRGYGRLA"
FT   gene            115974..117344
FT                   /gene="virH2"
FT                   /locus_tag="Avi_7149"
FT   CDS_pept        115974..117344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virH2"
FT                   /locus_tag="Avi_7149"
FT                   /product="P-450 monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7149"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39855"
FT                   /db_xref="GOA:B9K4Q7"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4Q7"
FT                   /protein_id="ACM39855.1"
FT                   /translation="MISVENYQQKIPNIRQRCLFNNSFRFRKDPLSLLSSCCQINSPLI
FT                   GIDKGFYVVTAPELIELVLHDKHQVFRKSLPDDDRGMVNFASSIMNSSGDDWRHKRKVL
FT                   QPGFNLDAVAKGVDATIEITQGHLDQWQVEPPSSDIRKSLQRLCFDIGCQFFLKTTLGE
FT                   KEQSAFVILSDLIIAKTRDGIRFPLGPFDRTEARLASARDAAKELAGAALARARQQREG
FT                   RDKSVASHDGFERSFDEGSDEDDNWLRDEFCTMILSGLEPMSAGLAWTLHLLTAHPDVL
FT                   QRVTAEIDALAMSGDGPISLDGLPETRAALKEALRLFPPAWLTGRTVFEDTVLGDFLLP
FT                   KGSALMISPWVNHRSGRYFDLPEHYRPDRWLDGTLEKRLPRYAFFPFGGGSRRCIGEHF
FT                   SMIHMTAILVCILRRFTLKRMPHTKVRPYPALVLRPLGVTLTLTPRAPEAGLDRNFI"
FT   gene            117341..118090
FT                   /locus_tag="Avi_7150"
FT   CDS_pept        117341..118090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7150"
FT                   /product="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7150"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39856"
FT                   /db_xref="GOA:B9K4Q8"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4Q8"
FT                   /protein_id="ACM39856.1"
FT                   /translation="MTASSVNNYDSYAEFYDSWQESWPESVMAPCVNVLADIADGRPAL
FT                   ELGVGTGRIALPLSQRGLDVSGVDLSEAMLERLKRKPGAEKLSLVLGDMADVPIEGEFG
FT                   LIYCVASFDYLLTQEEQLRFFANAEKHLAEGGSLVVQTIIPNEAIFSSDFRLNRMGDLP
FT                   SDEDGMASVMLMGVKGDPISQVLEQRIMVIGQHPKVFRHKIRCVWPNELDLLARSAGLF
FT                   LHARWSNWQRESFVSASRTAISEYRRS"
FT   gene            118131..118826
FT                   /locus_tag="Avi_7151"
FT   CDS_pept        118131..118826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7151"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7151"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39857"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040632"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4Q9"
FT                   /protein_id="ACM39857.1"
FT                   /translation="MSLCVIGAGLGRTGTLSLKLALEHLGIAPCYHAMEIAATVRTSLP
FT                   LWNDAIGGTADWDRIFEGYRATVDYPSCLFWRELMEHYPQAKVILTRRDPDGWFESVSE
FT                   TIFPAKRKGMLLGDDGLALSDFLRRDFGDNISDRTFMTNYFRRWNQSVIDDVPADRLLV
FT                   LEAGDGWEPLCAFLGVARPDVAYPWLHARPKKSRWNLFRRRSMPEQKPEELEDNTRDYL
FT                   DGLHQTTFR"
FT   gene            118848..119786
FT                   /locus_tag="Avi_7152"
FT   CDS_pept        118848..119786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7152"
FT                   /product="sulfotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7152"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39858"
FT                   /db_xref="GOA:B9K4R0"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4R0"
FT                   /protein_id="ACM39858.1"
FT                   /translation="MDANDHLLKKREFANRYFDASIWNDIKYRDGDIVVASYAKAGTTL
FT                   VQQIIAQLIFDQDDEVDVAAISPWIDSVYPDKKVKLDLIEAQTHRRFLKTHLPMDALIF
FT                   SEKAKYIYVGRDGRDIVWSLFDHQNAARQDAQLLLDKEAGPSGRLRVATPPQSSITEFF
FT                   DAWLDKDGFPFWPFWENLRSWWLARIVPNVLFVHYADLITDMAEQILRIAAFLEVPLSL
FT                   DRLPRILHNCSLGHMRDHARRYVPHGAGLWKDDGKLFFNKGQNGRWIDILTPEANAKFE
FT                   QHAMAELGVDCAKWMMSGRAGLKHVAFHCPQ"
FT   gene            complement(119889..120803)
FT                   /locus_tag="Avi_7153"
FT   CDS_pept        complement(119889..120803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7153"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7153"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39859"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4R1"
FT                   /protein_id="ACM39859.1"
FT                   /translation="MNFTSGSLPVATRDVSQAKADLDQFGYAILADLVTGSGLEALRQR
FT                   LVEQADAECAAGVALLHDVDDKPLSQEVARTIDQHLVPRQILMMLYNKGKVFREIAHNP
FT                   SLLTCVRHIFGGREFNLSGLAAQITNHGRPAQKLHTDQDQLPLDPSKAYVANILVMVSD
FT                   FTEANGATRVIPGSHLWPRPPWSRSPNTAPDYPFRTMGIPAPPMTTIAVEGPAGSALIL
FT                   DGRVWHGAGAHAAPGVTRYAVASSYVLPFIRQYENFPANILPEIFEALSSDERHLLGYA
FT                   GYKGSLGYVEPKASRIGESAPAG"
FT   gene            complement(121123..121797)
FT                   /locus_tag="Avi_7154"
FT   CDS_pept        complement(121123..121797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7154"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7154"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39860"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4R2"
FT                   /protein_id="ACM39860.1"
FT                   /translation="MNAITEKLKRQSKDDFKGRHFEAWLIVQAVAWYLRYPLSYRDLEE
FT                   MFRERSFEVDHSTINRWVLAYAPMIEKRLRQFRRPHCGSVRVDETYVKIRGKWRYVYRA
FT                   IGKHGNPVDFLLTAKRDLDAANTFPSAIKTSVDSGLLHPDPVHYATKHLQQGIESDHFR
FT                   LKKNMPKIGGFQSFNTARRTIAGFEAMLWLRKGFGYSGGWTVNDQNDLLARLFGLQKVN
FT                   KV"
FT   gene            122247..123653
FT                   /locus_tag="Avi_7155"
FT   CDS_pept        122247..123653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7155"
FT                   /product="nitrilotriacetate monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7155"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39861"
FT                   /db_xref="GOA:B9K4R3"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4R3"
FT                   /protein_id="ACM39861.1"
FT                   /translation="MTKTIRFNAFEMNCVGHQSPGLWRHPRDRSWQYKDLEYWTDLAKI
FT                   LETGFFESIFIADVIGYYDVYKGNLDNALLQGVQIPVNDPLQLANPIAQATKHLGIGIT
FT                   ASTSFEHPYTFARRLSTADHHTKGRVGWNIVTSYLESGAKNVGQGGLRSHDNRYDVATE
FT                   YVEVLYKLFEGSWEEGAVIRDKERGIFADPAKIHEIGHKGKYFEVPGYHLSEPSPQRTP
FT                   VLFQAGASGAGKQFAAGHAECVFISTPLKDATRAYVADIRKRAAEQGRDPKKVLIYAMA
FT                   TIIVDETDEKARAKYEDYAKYASYDGALVLMSGWTGIDFGHYQPSDTVKKVKTNAIISA
FT                   VEHLSEGNKVWTIEELAKWGGIGGLGPLFVGSPTTIADLLQEWVEETDIDGFNLAYALA
FT                   HDSFADVIGYVVPELQKRGVYATQYREGTLREKLFGEGPYLPRTHPAHQFRDIERVKRE
FT                   EANKASGEAA"
FT   gene            123779..124573
FT                   /locus_tag="Avi_7156"
FT   CDS_pept        123779..124573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7156"
FT                   /product="ABC transporter nucleotide binding/ATPase protein
FT                   (branched chain amino acid)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7156"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39862"
FT                   /db_xref="GOA:B9K4R4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4R4"
FT                   /protein_id="ACM39862.1"
FT                   /translation="MSTPTGPALEVKHVSLSFKGVKAISDLSFQVERQEICALIGPNGA
FT                   GKSSLLNILNGVYVPDSGEIVFEGEHFRRMQPLEAARRGIGRGFQNNALFSGMSVLDNV
FT                   IAGLSRHSKVTLLEEAFRLPRALKQERDFRERAQAVLHLFDLEKHAAAIVGTLPYGVQK
FT                   KVEIARAVVGKPRLLLLDEPLAGMNAEEKQEIAAVIARLNTEMKLTIVLIEHDIGIVLK
FT                   LAHHVVVLDYGRKLADGLPETIRDNPDVIAAYLGSDHKEIAA"
FT   gene            124570..125451
FT                   /locus_tag="Avi_7157"
FT   CDS_pept        124570..125451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7157"
FT                   /product="ABC transporter membrane spanning protein
FT                   (branched chain amino acid)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7157"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39863"
FT                   /db_xref="GOA:B9K4R5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4R5"
FT                   /protein_id="ACM39863.1"
FT                   /translation="MNMFIETLIGGLLAGTMYSLVAIGFVLIYKASGVFNYAQGSLLLF
FT                   AALTYVTLTDQGVPAFGAIAVTIALLILTAIAIEKLLLRPLTNRSPMTLFMATLGLSYV
FT                   VEGVAQGIMGSQVRALDLGIEDLPIFLGDIMISQFDLIAAGVALAIVVILSLLFSKTRI
FT                   GIQLRSVADDTRAALSIGININRIWQIAWAVAGLVGLVAGLLWGARQGVQFSLSLVVLK
FT                   ALPVLIIGGFTSIPGAIVGGLIVGAGESLAETYLGPFLGGGITPWFAYALALVFLFIRP
FT                   AGLFGERQIERV"
FT   gene            125455..126507
FT                   /locus_tag="Avi_7158"
FT   CDS_pept        125455..126507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7158"
FT                   /product="ABC transporter membrane spanning protein
FT                   (branched chain amino acid)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7158"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39864"
FT                   /db_xref="GOA:B9K4R6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4R6"
FT                   /protein_id="ACM39864.1"
FT                   /translation="MTNLELPLVTHPVQNIGLKAVGLVALVILLLAAPFLTSEYWINAI
FT                   IVPFLILSLAGLGLNLLTGYAGQLSLGAGAFMMVGAYATFAFQLRVPELPLPLALIISG
FT                   LISGVVGLAFGLPSTRIKGFYLIVSTLTAQFFFEWLFLKFPWFYNGNSSATIALPHGLS
FT                   VFGLDLNNPHGRYFLTLGSVALLTWLSFNLVRSQTGRNWMAIRDMDTAAAVIGVPTFRA
FT                   KLQAFAVSSFILGIAGALWAFTYLGSASVQSFGLTRSYQILFIIIIGGLGTIRGAYLGA
FT                   AFVSLLPLALDWLFQYLFSGHVDAGLLQNIQKAIFGILIIWFLIKEPEGLSRLLGLRRA
FT                   HGARRRLFPS"
FT   gene            126525..127853
FT                   /locus_tag="Avi_7159"
FT   CDS_pept        126525..127853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7159"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7159"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39865"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4R7"
FT                   /protein_id="ACM39865.1"
FT                   /translation="MKRFVIAALFASTIFSASAPAFAADVSQYIPLPTYRVGAYASSGE
FT                   LWWAGERDYFRYINEVEGGVEGVKLNYEEFETEWSPDRTVEVYERVKAGKDGSPLAFFF
FT                   THGTPATYALLEKAAADKIPLIDPAGGKTETVDGTVFPYAFPLLFSYYSQASTGINYIA
FT                   SKVGGLDKLKGLKIATLYHDSAYGRASQPAIELLAKKYGFENIQIPVADPGNEQSPQWR
FT                   QIREQKPDWVFLRTWGVSTVVALKTAQRFGFPADHIIGDVWAGSESDAIPAGAAAIGYS
FT                   ALAPYPGGTDFEIHKRLKAEILDKGKSDLRDPKLFGAVNYNIGLVNAALAVEALRTGYK
FT                   HFGPKPLNGEQGRWAFEHLTIDDKRLEQIGFKGLLQPIKITPTDHEGGGAARIQSWDGK
FT                   KWVLKTDWIKADHDLLNPLIKQGAEAYAKEHGITPRTPETETN"
FT   gene            127916..129265
FT                   /locus_tag="Avi_7160"
FT   CDS_pept        127916..129265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7160"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39866"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4R8"
FT                   /protein_id="ACM39866.1"
FT                   /translation="MFKIFLRNALAVAASAFVFASAAQAIETTPGPDSNKQFFPIASFR
FT                   VGPYAASGASIWAGRIDYYRYINEVEGGINGVPIVWQECETEWTAEKGIECYERFKRGL
FT                   NGAPISAYFPNGAPAAYALSDRATKDKIPLVTLAYGRTEATDGRVFPYNFPVMVTFYSE
FT                   ASAVVNYIAQREGGFDKLKGKKIATVYHDSAYGRETLDPLALLAKKYGFENIQIPVADP
FT                   GSEQSSQWRQVREQKPDWVFLRTWGVSTPVAIKTAQRFGFPADHVIGDVWASSEEDVIP
FT                   AGDAAKGYLALTPYPAGADFDIHKRLKQSIIDTGKSDLRDTKAFGSVYYNSGLVDALIS
FT                   VEIVRQAQAKFGNRPITSEEAQWALEHFKLDDAALKKAGFLGLVQNLQLTPADHEGGGA
FT                   VRVQQWNGKNWTLISDWVQADRQTLRPLIDAKSAAYAKENGITPRDVGTN"
FT   gene            129417..130217
FT                   /locus_tag="Avi_7161"
FT   CDS_pept        129417..130217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7161"
FT                   /product="ABC transporter nucleotide binding/ATPase protein
FT                   (branched chain amino acid)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7161"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39867"
FT                   /db_xref="GOA:B9K4R9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4R9"
FT                   /protein_id="ACM39867.1"
FT                   /translation="MMSFALEPTEKQPEVTDIVADNLLDVSGIEVVYGGAILAVADVSL
FT                   TVGAGEIVALLGANGAGKSTVLKAISGLVSADRATVRKGHIRFDDSDILGSAANHLAAR
FT                   GIVHVLEGRHVFSHLTVEENLQAGAFLHRPRRRDLLRQIEEVYDWFPRLKEKRKTLAGL
FT                   TSGGEQQMLAIGRALLTQPRLVLLDEPSMGLAPRIVQEIFEIIGRLNREKGVAFLLAEQ
FT                   NAALSLAHSSRAYILESGKVALVGTSAELTARDDLHHIYLGASA"
FT   gene            130257..131483
FT                   /locus_tag="Avi_7162"
FT   CDS_pept        130257..131483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7162"
FT                   /product="thermophilic desulfurizing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7162"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39868"
FT                   /db_xref="GOA:B9K4S0"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4S0"
FT                   /protein_id="ACM39868.1"
FT                   /translation="MSQIDLGWGEGPSERYESLAEKFRPIFAEISTGAIERELNRTLPT
FT                   EQIAKLKAAGFAALRVPESEGGTGVTLPELFNLLIELSAADSNITQALRGHVGFAEDVV
FT                   NKLDGPDRRRWTERLVRGDLVGNAWTEIGNAQQASFSTTVSKRDGQFVINGQKYYTTGS
FT                   LFADWINVGVTGLDGASSAAQVRRDDPGVEVIDDWNGFGQTLTASGTTTFTDAAVDPLD
FT                   IVADDNQFRYGAAFYQTVHLATLAGIGRAIADETAAAVAKRVRNYSNAAGPRSSQDPQV
FT                   LQVVGRIRSNAYTATAIVLQVARAIERAYQAHFSGDRDAEDRANIIAELETSQALTVVT
FT                   NLILEASTIIFDALGASSTSKPIGLDRHWRNARTLSSHNPRIYKDRIVGDFAVNGTPPP
FT                   FQWRIGLAG"
FT   gene            131638..132648
FT                   /gene="tauA"
FT                   /locus_tag="Avi_7163"
FT   CDS_pept        131638..132648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauA"
FT                   /locus_tag="Avi_7163"
FT                   /product="taurine ABC transporter periplasmic binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7163"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39869"
FT                   /db_xref="GOA:B9K4S1"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010068"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4S1"
FT                   /protein_id="ACM39869.1"
FT                   /translation="MSLKKLVTFALASVGIALVALPTFAADKKVVVAYQTDALPSSVAI
FT                   ANGELAKATGYDIDFRKFNSGAEIFAAIASGDVQVGYVGSSPFAAATSRGLDVKAFYLA
FT                   SISGTDEALVVRNGSGINSVNDLKGKKLAAAPVSTDHYQLLALIKSLGLSEKDVQVFAI
FT                   PQPEIVASYNRGDIDGGFVWDPALTELSKNGKVLVTSKDVAEKGAPTFSAWVAAGKFAK
FT                   ANPDFLKAYAGVINKYYASFAKDKSAWGADSDNAKQLAKLLGGTAEQQAAALKNLNLLT
FT                   PEVQASAAWLGGGENSGAAKILKDTAQFLKAQGKIGDVLPSYAAFVTPEALQVTN"
FT   gene            132716..133507
FT                   /locus_tag="Avi_7165"
FT   CDS_pept        132716..133507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7165"
FT                   /product="ABC transporter nucleotide binding/ATPase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7165"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39870"
FT                   /db_xref="GOA:B9K4S2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015859"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4S2"
FT                   /protein_id="ACM39870.1"
FT                   /translation="MLRIQNATVYFDARDGGDVHALEKVNLDIPEGAFVVALGASGCGK
FT                   STLLNAIAGFLPLSTGSITLNGRAISGPGADRGVVFQKDTLLPWANVLDNVALGLKFAG
FT                   VSARERRDRAEELLNLVGLGDFARSFPYELSGGMRQRVGIARALTTEPEVLLMDEPFGA
FT                   LDSLTREQMQELLISVWHRTGKRIFFITHSIEEALFLGTHLVVMSPRPGRIIARYELDF
FT                   VREFVKTNDVRAIHLSPQFALLREEIRELLHATHSPKEAFA"
FT   gene            133570..134355
FT                   /locus_tag="Avi_7166"
FT   CDS_pept        133570..134355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7166"
FT                   /product="taurine uptake ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7166"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39871"
FT                   /db_xref="GOA:B9K4S3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4S3"
FT                   /protein_id="ACM39871.1"
FT                   /translation="MREFGIGRKPTVLISVVTALVLLFAWWLVSALGVVPHLFLPRPDE
FT                   VVHQFVVIFSDGYAGASIGDHVGASLFRIGVAAILAIAAGIPIGLLMGLNRWAKGILDT
FT                   PIEFYWPLPPLSYLPLMIIWLGIGETSKIMVLFLAMFAPICLSAQAGVKSVPIERVNAA
FT                   RSLGANRWQLFSSIVFPSALPEILTGIRIGLGIGWGTLVAAELIASTRGIGYMIMSASQ
FT                   FLATDVVFVGIAIISVCAFAFGAAIRLLERVLVPWKGKA"
FT   gene            complement(134438..135508)
FT                   /gene="ssuD"
FT                   /locus_tag="Avi_7167"
FT   CDS_pept        complement(134438..135508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuD"
FT                   /locus_tag="Avi_7167"
FT                   /product="sulfonate monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7167"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39872"
FT                   /db_xref="GOA:B9K4S4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4S4"
FT                   /protein_id="ACM39872.1"
FT                   /translation="MSSDLQFLWYIPNQTVPGHRGDDTVVGHNALETLVKQAEALEQNG
FT                   WQGALIGAGWGRPDTFTVATALATRTRSFEALIAIRPGYWQPAHFASSAATLDHLTGGR
FT                   VRINIVSGKDSVSAYGDTEGDQAERYGRTREFMRLTRRLWTEENVTFKGQYYHVTESTV
FT                   QPRLQPRGERKHPLLYFGGASAAAEEVSATEADVQLFWGEPLADIGERINRLKDLSRKL
FT                   DRDLPPLQFGLRVTTLVRDTTEQAWTDAEAKVEAMAKSSGVVWHDHAGTVAVGQQRLYD
FT                   LAKRGDVLDDNLYTAPGKFGGGGAGTTWLVGSAQDVARSLKKYQELGITHFVLSDTPYL
FT                   GEIARQGQQLLPLLRG"
FT   gene            complement(135594..136652)
FT                   /locus_tag="Avi_7168"
FT   CDS_pept        complement(135594..136652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7168"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7168"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39873"
FT                   /db_xref="GOA:B9K4S5"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR026992"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4S5"
FT                   /protein_id="ACM39873.1"
FT                   /translation="MTLQQKIATLPFVDIGRFHAGPEERAAFIADLRRILFDHGFFYLT
FT                   GHGVDPKLIADVLETAKRFFALPLEEKLKIEMVKSRHFRGYNRAGYEHTRGQQDWREQL
FT                   DINTEGTPVEIGPETPAWKRLLGPNQWPEAIPELKPLLLTYQAEVTCVGIDVLKAIAVA
FT                   LDQPEDVFAQIYEPQPSQLLKIIRYPGRDVAETDQGVGAHKNGGFVTVLLQDKVEGLRV
FT                   QTEDGVWLDAPPVPGTFVVNTGELLELATNGFVRADVHDVVAPPAGIERFSVAFFLGSR
FT                   YDATIPVITLPDELHRKERGITVDLLNPIFREVGQNHLKSRLRSHPDVARAHHADLLTP
FT                   EQLAGQAVAQAY"
FT   gene            complement(136667..137269)
FT                   /locus_tag="Avi_7169"
FT   CDS_pept        complement(136667..137269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7169"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7169"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39874"
FT                   /db_xref="GOA:B9K4S6"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR010195"
FT                   /db_xref="InterPro:IPR023923"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4S6"
FT                   /protein_id="ACM39874.1"
FT                   /translation="MTDTIIDPKVENAPNVFTQDQIGWTPWLEPLTETELTERHYEALV
FT                   DKARAKSPYFSLLVRDPDILEARTKTDKDIFYNTADGLPRAERELSATATSRYNGCIFC
FT                   ASVHSRFASHHSPRKDDVQKLLDEGVGADLDERWNAIVSASVALTATPPVFATTHVERL
FT                   RAAGLSDDEIYDVVHGAAFFNWANRLMLSLGEPTPAA"
FT   gene            complement(137282..137860)
FT                   /locus_tag="Avi_7170"
FT   CDS_pept        complement(137282..137860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7170"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39875"
FT                   /db_xref="InterPro:IPR023982"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4S7"
FT                   /protein_id="ACM39875.1"
FT                   /translation="MTDIIDTLSGIAPGSKGEALRARRPVTKDGAQASWQALFAPGDDS
FT                   QFSIEERFAVAVFVAALHGQPEIAAFYAEKLATNPALLSAIQTAASKGTAIGPYGHYPA
FT                   GPLSSENTEGPAFTVADSEKAILGARLSAALEHAHLLIFHLRDSKSQALDALLKAGWST
FT                   TGIVTLSQLISFLAFQIRVVAGLKVLNAT"
FT   gene            complement(137893..138939)
FT                   /locus_tag="Avi_7171"
FT   CDS_pept        complement(137893..138939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7171"
FT                   /product="monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7171"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39876"
FT                   /db_xref="GOA:B9K4S8"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR024003"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4S8"
FT                   /protein_id="ACM39876.1"
FT                   /translation="MTQITLAKQAKRLGFFTRLLDDTDAAGRYRLAEEQIQHAEANGFD
FT                   SAWIAQHHFHAEEGGLPSPAVFLAHVAARTSTIRLGTGVITLPMENPLRVAEDTAVTDL
FT                   LSGGRLEVGFGTGGTRESFEAFGIAADKRGEVYGQYLDIVRKAWAGKDVGAGNRLYPNA
FT                   PHLLDRVWLATFSPVGAKLAGESGDGLMLSRTQPRPADRPHARLDELQNPIIDAYLSAL
FT                   PQGRAPRILGSRSLFVAEDRKRALKLAEEGLTKVAARFAAAGHRIDGTSVEDLIKALDS
FT                   HVGTPDDVIASLKADTALARSTELVFQVHSIDPPHADILRSIELIATEVAPKLGWSRKT
FT                   SKALAAAE"
FT   gene            complement(138936..140579)
FT                   /locus_tag="Avi_7172"
FT   CDS_pept        complement(138936..140579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7172"
FT                   /product="ABC transporter nucleotide binding/ATPase protein
FT                   (oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7172"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39877"
FT                   /db_xref="GOA:B9K4S9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4S9"
FT                   /protein_id="ACM39877.1"
FT                   /translation="MSKTPSVLDIRELNISYGDGESRTRVVHDVSLEVGAGEVVALVGE
FT                   SGSGKTSTAQAIIGLLSGNGQIDSGSIRLNGEEISRWSEKSLRGIRGPVLSLIPQDPSN
FT                   SLNPVLTVGAQVREILEIHGKLSRRDADRRVVELLTQVGLSQPALRARQYPHELSGGMK
FT                   QRVLIAIAIALKPALIIADEPTSALDVTVQRRILDLIDDLRKAYGTAVLLVTHDLGVAA
FT                   DRSDRLVVLQSGRIQEQGKTAEVLVAPKSAYTARLLSDAPSLAAPVVRPAIAADRPISV
FT                   TVDNLVQEFKLPTGERFRAVDGLSFTVPQGTTHAIVGESGSGKTTTIRSIAGFQKATSG
FT                   SIRVGDFDLGSLNHKSLRAFRRKVQLVYQNPWSSLDPKQTIFSIVEEPLLNFEPLPKQE
FT                   RAARVEAMIERVGLPLSVLNRKPHALSGGQRQRVAVARALVLEPEVVVLDEAVSALDVT
FT                   VQAQILALLGSLQRDFGLTYIFVSHDLAVVRQIADTVSVLHNGKQVDYGPVETVFTHPQ
FT                   SAYTRELIEAIPGRAFPKRHQHSLTAGSPS"
FT   gene            complement(140576..141454)
FT                   /gene="dppC"
FT                   /locus_tag="Avi_7173"
FT   CDS_pept        complement(140576..141454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppC"
FT                   /locus_tag="Avi_7173"
FT                   /product="ABC transporter membrane spanning protein
FT                   (dipeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7173"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39878"
FT                   /db_xref="GOA:B9K4T0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4T0"
FT                   /protein_id="ACM39878.1"
FT                   /translation="MSSVEILSLQANGVKSDSVKRRASLTRFKGLRPGLVLAWVVMVTV
FT                   LLWAAMPWLFTSYNPLEGIPGGQLKAPSAAHLLGTDSLGRDLYARMVYGSVHSLSGALA
FT                   AVGVGLVAGTLLGLFAGAIGGRWDMIIMRFVDVLLSIPTLLLSLSIIILLGFGTINAAI
FT                   AVGVTAIAGFARLTRSEVVRVRRADFVEAAYGSGGTFLSVLWRHILPNSLTSVIAYAAV
FT                   QFGWAILQMSTLGFLGYGAPPPTPEWGLLISEGRNYLATAWWLTTAPGLIVVAVVLSAN
FT                   RISQSLGSTSR"
FT   gene            complement(141451..142395)
FT                   /gene="dppB"
FT                   /locus_tag="Avi_7174"
FT   CDS_pept        complement(141451..142395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppB"
FT                   /locus_tag="Avi_7174"
FT                   /product="ABC transporter membrane spanning protein
FT                   (dipeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7174"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39879"
FT                   /db_xref="GOA:B9K4T1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4T1"
FT                   /protein_id="ACM39879.1"
FT                   /translation="MTRYVASRIGQAVLVLWAAFTLSFILLQAMPGDAVLIKFLSPDYG
FT                   LSPDQIKEIRAAYAVDSSVFVQYFHTLANFLQGDFGYSLHAGVPVTAQLAIGLPATLTL
FT                   AALAFLAAIVLAVFVAVLSSLAPFSFLRNLVQAVPSLLISVPVFWLGIMLIQIFSFRLK
FT                   LVSVINPGPWESLVLPVITLSVPIAAPLAQILIRNIDEIRTRPFISVVIAKGATPARVL
FT                   WRHVAINAALPVLTIAGVLFGELLAGAVVTETVFGLNGLGELTEKAVSTQDIAVLQAIV
FT                   VISATAFVIINLLVDLAYPLLDPRLRSRNGAAS"
FT   gene            complement(142458..144089)
FT                   /locus_tag="Avi_7175"
FT   CDS_pept        complement(142458..144089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7175"
FT                   /product="ABC transporter substrate binding protein
FT                   (oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7175"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39880"
FT                   /db_xref="GOA:B9K4T2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR023920"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4T2"
FT                   /protein_id="ACM39880.1"
FT                   /translation="MMTLRRTFLGLSLALAASVSLSTIGHASDAPVKGGTLVYLEQQAH
FT                   TNLYPPAGGFYPNSGILNQITDKLTYQNPKTLEIEPWIAESWTVNADNTEYTFKIRPGV
FT                   TFSDGSPVDANAVAKNFDRFGLGDKGLKQPVSEVVNNYDHSEVIDPLTVKFVFKKPSPG
FT                   FLQGTSVIGSGLLSLKTLSLPFEQLGDATKIIGSGPFVVSAETLGKSLDLKVRADYTWG
FT                   PKKLEHQGRAYLDGIKYIITREDGVRIGALLAGQADLIRQIQAYDEAQVETQNFKIYAP
FT                   GTRGVNNSVVFRPDNPLVADVRVRKALSLATNRDEIIKTLFSKNYPRATSIIASTAIGY
FT                   VDQSDKLGFDVEKAKALLDEAGYKPDADGIRAKDGAKLVLTAYESLPQPQNRAALQLIA
FT                   QQWQKVGVKLNVLAGDAGSAALDDLDPLKTPVTPAIVGRADPDVIKSQYYPKNRDALRQ
FT                   KGGLSDKAKTFVDDKLNSLLEEISSQPDPQKRLKVVAEVQAYVLDQAYAIPIFEEPQVF
FT                   AGAPYVKGVAFDAVARPSFYSVWLDK"
FT   gene            complement(144788..145972)
FT                   /gene="acd"
FT                   /locus_tag="Avi_7179"
FT   CDS_pept        complement(144788..145972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acd"
FT                   /locus_tag="Avi_7179"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7179"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39881"
FT                   /db_xref="GOA:B9K4T3"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4T3"
FT                   /protein_id="ACM39881.1"
FT                   /translation="MSATVSAIKPNAAPSPDPVEIARELARDFATRAAEYDRSGDFPHD
FT                   NIAALHEAGLLALLIAKDHGGLGANLETAQKVVSEIAVGDPSTALILTMHYTIHGVINL
FT                   GRWPEALAARVLAASRAKPVLVNNAQAEPGMGSPAHGGLPETIAHIEGDHWVINGHKGF
FT                   VTGLAGLTWAVVLALTTEEVPRLIQVLVPLDTPGIRKVRTWEATGMYSTASDDLLLENV
FT                   QVPLSDLIFEQPASEPLRRDPDFGNIFFTLLSSVYHGVALSARNDILKHLTSHAPTSLG
FT                   APLASIQRLQEGVGQIEVLLATNARLLRSLARDVDQKKAGPTDALAVRHVVIDNAVSVT
FT                   DLALEYGGNRGLRRDYHLERHHRDAITARAHAPQSHMIRSIFGKAALERAATTP"
FT   gene            complement(145969..147003)
FT                   /locus_tag="Avi_7180"
FT   CDS_pept        complement(145969..147003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7180"
FT                   /product="desulfurizing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7180"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39882"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4T4"
FT                   /protein_id="ACM39882.1"
FT                   /translation="MVTPISKLWYTRCPVPTPVGLAAQLGYLEQSFAEIGITLESIIDS
FT                   PDKAVRQSHFNHTLEWSFRHGGNVPPIRARSEGRNTRLVGITWTDEFQAIITLPQTGIK
FT                   SLKDLVGRRFGVPKRPDGIVDFMRATALKGLVSALSLDGVSINAVDLTDITITESVLDG
FT                   QTGASLFGLKRRQSFGEEAAALLRGEVDAIFVKGTAGIAVANLIGAVTVSDFGFHPDPT
FT                   IRINSGSPRILTVDARLADERPDLVERLIAVIRKASGWAEAHPDETRRFIAREAGASEE
FT                   QVLAANGRDVHRHLGIGLEPAHVAAVKHYKDFLYQWGFLQADFDLEAWVDQRPYETLDR
FT                   RAVA"
FT   gene            complement(147070..148698)
FT                   /locus_tag="Avi_7181"
FT   CDS_pept        complement(147070..148698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7181"
FT                   /product="ABC transporter substrate binding protein
FT                   (oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7181"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39883"
FT                   /db_xref="GOA:B9K4T5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4T5"
FT                   /protein_id="ACM39883.1"
FT                   /translation="MIVNRPSTEHAAHSTTRRGFLLASAAVSAFAVSGTNLRAATPAKG
FT                   GTATLLLSSEPPVLTTIAHTAFNSVYVSPKVTEGLLTYDFDLTPKPLLATEWQISPDGL
FT                   KYTFKLRDGVKWHDGKPFTSADVAFSIKTIAQVHPRGRNTFLNLTEVETPDARTVVLVL
FT                   SKPAPYLITALASSETPIVPKHLYEGTKVQENPVNLAPVGTGPYKFKQWVRGSHIVYVR
FT                   NEDYWDKPRPYLDSLIVRFISDSAARSIAIEAGEIDLAPSTPVSYGDLDRLKALPHIGF
FT                   ETQGYQYSNGVTRVEFNLEKEFFKDVRVRRAFAHVIDRNVIFNTVNYGYGAPITGPINP
FT                   KLSKWYVSDLKTYPIDLKAAEALLDDAGYKRGPDGIRARLKLDYVPGEGYPRGADYIRQ
FT                   ALAKVGIEVTVRTQDFATYTKRIYTDRDFDFAYEGMSNLFDPTVGVQRLYWSKNFLKGV
FT                   PFSNGAAYSNPKVDALLEAAAVEIDPKKRVAQWKEIQQILVEDVPAIDIAAAPEITIYN
FT                   KRIADHTLGAEGIISSLAFAYIAST"
FT   gene            148964..149953
FT                   /locus_tag="Avi_7182"
FT   CDS_pept        148964..149953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7182"
FT                   /product="ABC transporter membrane spanning protein
FT                   (oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7182"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39884"
FT                   /db_xref="GOA:B9K4T6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4T6"
FT                   /protein_id="ACM39884.1"
FT                   /translation="MTASNRILKRASRVTLQAIPTVVGIVILNFFLLQLAPGDAADVLA
FT                   AEAGSATVETMADIRARFGLDLPVLHQLGNYLGNLAHFSLGYSPRYGMPVAELIGQRLP
FT                   GTLVLMGAAFIIALVLGVVLGSVMAVFSGRLPDRVISLGSLLFYSVPGFWIGLMLILLF
FT                   SVKLGWLPSGGDSTIGSPLTGYAALLDRARYIVLPATSLSLYYLAIYARLTRAAMLEVK
FT                   SQDYVRTARAKGVTPLRLTLRHILRNALIPITTMAGMHLGGMLGGAVVVETVFSWPGLG
FT                   RLAFEAVMARDFSVLLGILLLSSFLVIIINAAVDLFQAWLDPRIGESQ"
FT   gene            149950..150957
FT                   /locus_tag="Avi_7183"
FT   CDS_pept        149950..150957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7183"
FT                   /product="ABC transporter membrane spanning protein
FT                   (oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7183"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39885"
FT                   /db_xref="GOA:B9K4T7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4T7"
FT                   /protein_id="ACM39885.1"
FT                   /translation="MTIINATTPLAEATRQREGEKASVETAKEAKAPKGWPYVHAPDAL
FT                   TARTSLIPKRGLRREVKIFLTNPNALIGVAFLAIVIITALLAPLLYPGDPLEMVSRPFL
FT                   WPGQNPAYPLGTDSMGRDVLAGIVHGARVSLTVGIAATVMGLTIGVTIGAFAGYFGGVI
FT                   DDVLVKIIEIFQTLPSFVLLVVLVAIAQPSITTVTFAIGIITWPMVARLTRAEFRAIRE
FT                   KDYVLAARSLGYGHARIVFAEILPNALPPIIVTSSVMVAGAILMEAALSFMGLGDPNRV
FT                   SWGSMIGSGREVIRTAWYLTALPGLAIVFTVISLNLISDGLNDALNPRFSEERR"
FT   gene            150954..151952
FT                   /locus_tag="Avi_7185"
FT   CDS_pept        150954..151952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7185"
FT                   /product="ABC transporter nucleotide binding/ATPase protein
FT                   (oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7185"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39886"
FT                   /db_xref="GOA:B9K4T8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4T8"
FT                   /protein_id="ACM39886.1"
FT                   /translation="MSALIDVRDFSVGFGSAQPVKGVSFSVERGEMLAIVGESGSGKSL
FT                   TALGLIGLLPSHAQKGGSIRFKGRELLTYSERQWRAIRGGEIGMIFQEPMTSLNPVLTV
FT                   GEQITEVLRIHEKLDRKQARKRAIELLDLVNIPESGKRVDDYPHQLSGGMRQRVMIAIG
FT                   VACNPELLIADEATTALDVTIQAQILQLLDNLRRDLNMAVILITHDLGIVAQWADRVMV
FT                   MYAGRKVEEGLPQPVFDQPYHPYTRGLLAASPRGGAGQHYRDGPLVEIPGSITSSVNEK
FT                   GCAFRPRCSSARTSCGQAVPSLTQVSPGRFAACPVVSANFSEVSHDALVGA"
FT   gene            151930..152871
FT                   /locus_tag="Avi_7187"
FT   CDS_pept        151930..152871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7187"
FT                   /product="ABC transporter nucleotide binding/ATPase protein
FT                   (oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7187"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39887"
FT                   /db_xref="GOA:B9K4T9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4T9"
FT                   /protein_id="ACM39887.1"
FT                   /translation="MTLLSVRNLSTQYAGARGTVRAVDDVSLEIEAGETVALVGESGCG
FT                   KSSLGKSLMRLVEPSSGQITFQGGDVTAMPANELRGIRRRIQMIFQDPFASLNPRQTIR
FT                   TILTTPLKVHGIGDGKRRREIVEAIIEQVGLPADSLDRYPHEFSGGQRQRIGIARAIIL
FT                   EPELVVCDEPVSALDLSIQAQILNLLVELKSRLSLSYLFVSHDLSVVRYFSDRVLVMYL
FT                   GKIVESAPTAELWANPRHPYTRALLAAVPDPARRKQAAPISGDLPSPHNPPSGCRFHTR
FT                   CPLATDLCREQAPDYQLFGQAHAVACHHANEH"
FT   gene            152887..153936
FT                   /locus_tag="Avi_7188"
FT   CDS_pept        152887..153936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7188"
FT                   /product="aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7188"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39888"
FT                   /db_xref="GOA:B9K4U0"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4U0"
FT                   /protein_id="ACM39888.1"
FT                   /translation="MVDYRYLGRSALKVSPLSLGTMMFGGPTPDEVAFRIIDKAREQGI
FT                   NFIDTADVYHDGKSEEVVGRGIKASRDHWVLATKFVNSREKGPNLGGQSRKWVIETVEN
FT                   SLRRLNTDYIDILYFHRAVFDAPLEEPVRAIADLIRAGKLRYFGVSNFRGWRIAEIAHL
FT                   ADQLGIDRPIASQPLYNIVNRTAEAEQLPAAHHYGLGVVSYSPLARGVLTGKYEPGKAP
FT                   AADTRAGRGDKRILETEWRPESVEIARKVAAHAHAKGISAADFALAWVLNNRYITAAIT
FT                   GPRTEEHWDGYIRALDVRLDAEDEALVNSLVAEGHPSTPGFNDPSHPVEGRVPRYNDQP
FT                   SVKPVRAVA"
FT   gene            153997..155235
FT                   /gene="acd"
FT                   /locus_tag="Avi_7189"
FT   CDS_pept        153997..155235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acd"
FT                   /locus_tag="Avi_7189"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7189"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39889"
FT                   /db_xref="GOA:B9K4U1"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4U1"
FT                   /protein_id="ACM39889.1"
FT                   /translation="MMTMPHSARVPDSTEALTRDGLLAQARTLSDTFAKDAARSELERE
FT                   LPFEAFRLIKEARLGTLRIPKAKGGPGGSIADYIELLMILGEADSNIPHALRSHFNFTE
FT                   GLALGPTVLEDRRHLDHVLEGKLFAGASTEQGTKRPGEITTVLSREGDHYRLNGRKWYA
FT                   TGTAFADFGSFSAVDEQGDPIGVLIPLDRKGITILDDWDGMGQRMTASGGVLLENVEVL
FT                   AHEVTGRKLSSQIGRHCGALRQLHLAASAAGAVQGAVKDGIDYVLNHARTTLHSTAETA
FT                   NDDPFVQKMLGEITSGAFAVQTLIREAARALDRTAETFAMGDEEAIETALISASLITAQ
FT                   TQIITSQLALSVATNIFELGGGSATSRRFNLDRHWRNIRTVYNHNPLLHKARVVGDYYL
FT                   NGTTTHLKEGRVF"
FT   gene            complement(155286..156047)
FT                   /locus_tag="Avi_7190"
FT   CDS_pept        complement(155286..156047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7190"
FT                   /product="Nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7190"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39890"
FT                   /db_xref="GOA:B9K4U2"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR016446"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4U2"
FT                   /protein_id="ACM39890.1"
FT                   /translation="MPPSWNETLDVLLNHRSARAYLPKALPQGTVELLVAAAQSAPTSS
FT                   NLQAWSVVAVEDPERKARLEEFAAPNPQINAAPLFLVWLVDLARLRAIARSNDSEGAGL
FT                   DYLESFVIGAIDAALAAQNAVAAIDSLGLGSCYIGGIRNRPEDVARELNLPPETIAVFG
FT                   LTVGYPDPAVKTDVKPRLPQSAVLFREQYGTVSEQDLASYDERLKTFQQGQNLPQAGWT
FT                   SVIAKRIGSASALKGRVELTAILRRFGFALK"
FT   gene            complement(156158..157852)
FT                   /locus_tag="Avi_7191"
FT   CDS_pept        complement(156158..157852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7191"
FT                   /product="ABC transporter nucleotide binding/ATPase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7191"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39891"
FT                   /db_xref="GOA:B9K4U3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4U3"
FT                   /protein_id="ACM39891.1"
FT                   /translation="MSLSLSKTKPVLRINSLSVDFPGFDGNFRAVDDLSLTIARGEVLG
FT                   VIGESGAGKSMTGAAIIGLIDPPGRITSGEIHLQGERIDNLGDKALETLRGRRIGTVFQ
FT                   DPLVSLNPLYTIGQQLIETIRRHLPLDQGQARQRAIDLLREVGIDEPARRLDAYPHEFS
FT                   GGMRQRVVIALAVAADPDLLIADEPTSALDVSVQAQIIALLKSLCQRRGLAVLLITHDM
FT                   GVVAEIANRVVVMHKGRIVESGSVAEVIGSPKHDYTRALIAAIPSIRRKNTRASVASKG
FT                   DLVKVEGLIRDFALPGGGGLPFFSKNRKQRSLRAVNDVSFSIGEGQTFALVGESGSGKS
FT                   TIARIVVGLLGAQAGKVTIGGTVLGQDKAPALKGAVQMIFQDPYASLNSRWRIGDIIAE
FT                   PIRTLGLETDNRVIEQRVTDLLEKVRLDPDARSRFPHEFSGGQRQRIAIARALASRPRF
FT                   IVCDEPTSALDVSVQAQVLELMASLQAEFGLTYLLISHNLAVVRQMADRVGVLKNGVLV
FT                   EEGPVEEVFERPQHDYTRMLIAAVPDIDDSVVPSTDVKQRPKVLSDH"
FT   gene            complement(157849..158775)
FT                   /locus_tag="Avi_7192"
FT   CDS_pept        complement(157849..158775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7192"
FT                   /product="ABC transporter membrane spanning protein
FT                   (oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7192"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39892"
FT                   /db_xref="GOA:B9K4U4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4U4"
FT                   /protein_id="ACM39892.1"
FT                   /translation="MTTQTLRPFSKRHRWRRISPVTILAGALAVVLVLAALFAPLLAPH
FT                   DPFNPATLDLMDGMTPPMAANAFSCKVFWLGTDNQGRDILSSILYGSRVSLLVAFSATL
FT                   LSLALGVGAGLISGYAGNAVDAVIMRVADAQLTFPTILVALLIFGIAHGIIPASQQEQA
FT                   AVWILIFAIGFSNWPQFARTVRGAVLVEKRKDYVAAAKLIGVSRSRILLTHILPNIAGP
FT                   ALVIATIGLALAVIEEATLSYLGVGVPPTRPSLGTLIRIGQQFLFSGEWWIIGFPAATL
FT                   VLLALSVNLLGDRLRDALNPRLRNNRR"
FT   gene            complement(158780..159760)
FT                   /locus_tag="Avi_7193"
FT   CDS_pept        complement(158780..159760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7193"
FT                   /product="ABC transporter membrane spanning protein
FT                   (oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7193"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39893"
FT                   /db_xref="GOA:B9K4U5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4U5"
FT                   /protein_id="ACM39893.1"
FT                   /translation="MAGFILRRFFQSIGVMLAVALIAFAVIRFVGDPLESLTSQETRLD
FT                   ERVELKARLGLDQPVPIQFLTFLKRGISGDFGTSYKQQEPVTRMIFERLPATLELATAS
FT                   SLIALLFGGLFGVYCALRPKGVLTHAIMTLSLVGVSLPTFLIGIGLIAVFSVQLGWLPS
FT                   FGRGETVKLGWWTTGLLTLSGWRSLILPAITLSLFQMTMLMRLIRAEMLEVLRQDYIRF
FT                   ARARGLSRRSIHFGHALKNTLVPVITVAGLQFGSVIAFAVVTETVFQWPGVGSLFINSV
FT                   QSVDVPVMAAYLVFISALFVLINLIVDGLYYAVDPRLRIVRTGTE"
FT   gene            complement(159867..161453)
FT                   /locus_tag="Avi_7194"
FT   CDS_pept        complement(159867..161453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7194"
FT                   /product="ABC transporter substrate binding protein
FT                   (oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7194"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39894"
FT                   /db_xref="GOA:B9K4U6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4U6"
FT                   /protein_id="ACM39894.1"
FT                   /translation="MIKTHIAGLAAAFLGLSLLATTADAATLRWARASDALTLDPNAQN
FT                   DGVTGALLDQIYDTLVTRDAKGALEPRLATEWKVKDGAPATWVFTIRKGVKFHDGSALT
FT                   AEDVVFSINRARSDKSKLRQLHADVVDVKAVGEDKVEVTLRAPNLIYPNNLTGTDILSK
FT                   SWAEKNNALEVQDAAASKDNFAVRNANGSGPYILKSREVGVRTVLEANPAYWGEKNQGI
FT                   TEIVYTPIADNATRIAALLSGEVDFVQDVPVQDIERLKKTSGVKLLTTPENRSIFLGYR
FT                   LDKAPLASSNAKDKNPLSDLRVREAFDLAIDREALKTVVLRGNAVPTGIIVPPFVHGWT
FT                   PALDTYSKPDIAKAKALLTEAGYPDGFTITLDTPNNRYVNDEAISQAVVGFLGRIGVKV
FT                   TLASRPFTQHSPLLADRKSDFFLYGWGVPTYDSAYNFNDLIHSRNDHYGAWNATYFSDA
FT                   AIDAKIESLGTEVDVAKRDKTISELWTYVKDQHLYLPLHNQIIAWAVRDGFGLEIPTNN
FT                   TPRFNRGTTGS"
FT   gene            complement(161669..163000)
FT                   /locus_tag="Avi_7195"
FT   CDS_pept        complement(161669..163000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7195"
FT                   /product="monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7195"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39895"
FT                   /db_xref="GOA:B9K4U7"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4U7"
FT                   /protein_id="ACM39895.1"
FT                   /translation="MTTQKQLHLGAFMRPVSLHTGAWRYPGAFPDANFNFGHIVSFAQK
FT                   LEAAKFDAFFMADHLAVLNMPVEALKRSHTVTSFEPFTLLSALAALTSHIGLVATASST
FT                   FEEPYHLARRFASLDHISGGRAGWNIVTTANPDSALNFGRDAHVEHGERYERAREFYDV
FT                   VTGLWDSFADDAFTRDVESGQFFDPAKMHVLDHKGAELSVRGPLNIARPPQGWPVIVQA
FT                   GQSEPGRQLAAETAEVVFCAPRDLAAGKALYADIKGRMGKIGRNPDHLKILPAAFVVIG
FT                   DSVEEARAKRLKLDGLVHYDSAIASLSIALGHDVSGLDPDQPLPEIPDTNASKSSREQV
FT                   LKLAREEGLSVRQLAQRYGGYAGLAFVGTAASVAQEMAEWLQEHGSDGFNVVFPYLPQG
FT                   LDDVVEKLVPELQRQGLFRKDYQGVTLRDNLGLPRPENRFFPGA"
FT   gene            complement(163043..163828)
FT                   /locus_tag="Avi_7196"
FT   CDS_pept        complement(163043..163828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7196"
FT                   /product="sulfate ester transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7196"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39896"
FT                   /db_xref="GOA:B9K4U8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4U8"
FT                   /protein_id="ACM39896.1"
FT                   /translation="MAQTASSHSAVNWTRVRRGVVLPLLLLLIWEISSRTHLVDPRFLP
FT                   SLEEVAHTAKREILDNGLAGELGASLLRNLSGFGIGAVLGISFGTLVVLTKLGERLVMP
FT                   TFNGLKQISLLAWIPLISIWFGFGEQAKIVFVALAAFIPIALNTFDGIRQVPRDLIEVG
FT                   RALRFSPRQRIFTIYLPSALPMIATGVHLGLIYSWLATVGAEYFLAVGPGIGGLVIAGR
FT                   ERFDMSLVMVGVIILGLVGFIFNRLAAALETHLLRWRVN"
FT   gene            complement(163831..164649)
FT                   /locus_tag="Avi_7197"
FT   CDS_pept        complement(163831..164649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7197"
FT                   /product="ABC transporter membrane spanning protein
FT                   (aliphatic sulphonate)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7197"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39897"
FT                   /db_xref="GOA:B9K4U9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4U9"
FT                   /protein_id="ACM39897.1"
FT                   /translation="MASVAELLVPHAGTRQIKIPKSVTSLLLALVLPFALLLLWWLTSV
FT                   QGWLPEQILPAPRYVYETASNLIGDGELLYHTGVSLRRVVIGFTIGASLGLSLGVLMGL
FT                   SPRAEDYIKPLFLALAQIPTLGWIPLLMLLVGIEETLKIIIIAKGAFVPVTLNTFSGIR
FT                   NVSVKYREIGRSFRFSPWQQLRLIVLPAAAPTIFTGIRYGLTNAWTSLVGVELLASSEG
FT                   LGYLLVWGRQMFWLDTVIVAMVVIGLVGFIMDRGLRRTENLLQRWKQEEA"
FT   gene            complement(164673..165746)
FT                   /locus_tag="Avi_7198"
FT   CDS_pept        complement(164673..165746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7198"
FT                   /product="ABC transporter substrate binding protein
FT                   (aliphatic sulfonate)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7198"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39898"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4V0"
FT                   /protein_id="ACM39898.1"
FT                   /translation="MKSAFLLRIATSLGLLALVSGPLQAADPLVIHVGYAAIGVDNRPF
FT                   AEGTSAATARAGEYLEKEFANDPNVKIEWTFFKGAGPAVNEGFANNQLDFAYQGDLPAI
FT                   IGRANGLKTKFLLASGARKPLYLAVANGSGIKTVEELKGKKVAYQRGTNGHLAAVKILE
FT                   AHGLKERDVQVINLDSAGTVAALTSKDIDAAFGDTALINLAANGSAEIVYTTKGDDPRF
FT                   GRNAGIVAREAFIDAHPEITQKVVDAFVKAAKWSSDEPNRAALFELWHKSGTPVPILED
FT                   YFSNDTLAYRNAPLLDELLISQYKEQAVKSKEFGLIRRDVDLNGWFEPKYLNSSFERLG
FT                   LKTFWKAYGADGKPSAS"
FT   gene            complement(165813..166649)
FT                   /gene="ssuB"
FT                   /locus_tag="Avi_7199"
FT   CDS_pept        complement(165813..166649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuB"
FT                   /locus_tag="Avi_7199"
FT                   /product="ABC transporter nucleotide binding/ATPase protein
FT                   (nitrate/sulfonates)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7199"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39899"
FT                   /db_xref="GOA:B9K4V1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4V1"
FT                   /protein_id="ACM39899.1"
FT                   /translation="MTAGAHLTIRDISRLFDINGKVLNALDSINLDITEGEFVTIVGAS
FT                   GCGKSTLLRIAAGLDIASSGTITHAGKVVNEPSLERGIVFQEPRLFPWLSVERNVAVGV
FT                   ENSGLPKATRQQLVRDHLELVGLTGFAKAYPHQLSGGMAQRAGIARGLVNRPNILFLDE
FT                   PFGALDAMTKARLQDELQEIWARERITMVLVTHDVEEAVYLGDRVVVMSARPGRIRDII
FT                   PVEIERPRRRTSAEIVAARDRVLQSLHGSDEVRQSSGARPLPTRENTLAQPAFSHG"
FT   gene            complement(166775..168115)
FT                   /locus_tag="Avi_7200"
FT   CDS_pept        complement(166775..168115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7200"
FT                   /product="nitrilotriacetate monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7200"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39900"
FT                   /db_xref="GOA:B9K4V2"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4V2"
FT                   /protein_id="ACM39900.1"
FT                   /translation="MTRPSSRRLKTLVGAGNLTAAANDASPQAGAKRAADLARKAEAEK
FT                   ITGLFTADLLQTDPAGLAGTTGTNEPIIQLAALSQVTSHIGLIATVSTTFHHPYNLARQ
FT                   IGTLDHASGGRAGWNAVTSSVGEENFGETLASPEERYARAAEFIEVVNALYDANERDAA
FT                   TRRNSGSISIDPAKFHPINYRGQHFQVEGPLNVPPLPQGRPVQFQAGQSDAGVNVGARY
FT                   AEVVYTSQPKLEDAIAFATDLRNRAKGFGRGDDLPFIMNSFHSVIGESDADVARRVKAK
FT                   HEKIDYEQGRLKLADMLGGHLDLSDLPLDKPLPEVLLPEVTSINRRRGRVEIFRRYARE
FT                   GLTLRQLIIHAQDTGHWSVAGTPEQLADAIEERFRAGVLDVISLHGLGNPDQEDLLLNG
FT                   LLPELRRRDLIDTDYVGHDFRSNLELPEISRQQTALQESPVQKAVFG"
FT   gene            complement(168138..169769)
FT                   /locus_tag="Avi_7201"
FT   CDS_pept        complement(168138..169769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7201"
FT                   /product="ABC transporter nucleotide binding/ATPase protein
FT                   (peptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7201"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39901"
FT                   /db_xref="GOA:B9K4V3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4V3"
FT                   /protein_id="ACM39901.1"
FT                   /translation="MTPLIQIRNLTIGFPKDGRDHNVVHGLDLTIHAGETLALVGESGS
FT                   GKSVTARALLGLSGPGAKISADQFDIEGQSVLGFGEKQWRALRGTKVGFVLQDALVSLD
FT                   PLRRVSQQLSDAFGRRGFFKHPDLLQNSRALLQSVGIPDPDRRLPQYPHELSGGLRQRA
FT                   LIATAIARHPALLIADEPTTALDATVQKQILDLLAERRKAGHTLLLISHDLAVVSRLAD
FT                   RVLVMNNGYIVEEGPTAKILKTPEHPYTRQLLDAVPSASSKGFRLSPSTEIELKRPAEP
FT                   IRIALPPKQIDDGRIVLSANNLVKRYGTSLAVNDVSFHLAAGEALGIVGESGSGKTTVA
FT                   KIILGLVEPDGGSVLIDGKPWSNISEAQRRPRRAHMQLIAQDALSSFDPRYTVEKIVGE
FT                   SLDSVGVYGDARRARVIEVLDAVRLNRSFLSRYPRELSGGQRQRVAIARAFAPHPTLLV
FT                   ADEPVSALDVSVQAQVLDLLAELQAASGTSLLFISHDLGVVHHLTDRVVVMKDGRIVEA
FT                   GQVENVFSTPRHSYTRALLDAVPTLA"
FT   gene            complement(169766..170638)
FT                   /gene="dppC"
FT                   /locus_tag="Avi_7202"
FT   CDS_pept        complement(169766..170638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppC"
FT                   /locus_tag="Avi_7202"
FT                   /product="ABC transporter membrane spanning protein
FT                   (dipeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7202"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39902"
FT                   /db_xref="GOA:B9K4V4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4V4"
FT                   /protein_id="ACM39902.1"
FT                   /translation="MSLSSTLLDRNLGRTSDILRGILARPGLLIAALFVVLVALSTLWP
FT                   ALLTSADPITADPLQAQLPPSADHWFGTDHLGRDVFSRVVYGTRYSILIGVSAITIAAV
FT                   FGSLLGLLAGLSRGLVDEFITRFLDVVSSFPDLLLALVLISFTGPGTLNLIFALGVASI
FT                   PRFARVVRAQTFVIAQSGYVEQAKTFGLTRPVLVFRHVLPHAIAQVPILATIGLGTAII
FT                   NAAGLSFLGMGPQPPAPEWGAMLADARNYLRVAWWIGVWPGLAITATVIAISVLGRRWQ
FT                   AAFEGRRQA"
FT   gene            complement(170635..171681)
FT                   /locus_tag="Avi_7203"
FT   CDS_pept        complement(170635..171681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7203"
FT                   /product="ABC transporter membrane spanning protein
FT                   (dipeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7203"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39903"
FT                   /db_xref="GOA:B9K4V5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4V5"
FT                   /protein_id="ACM39903.1"
FT                   /translation="MDAEQTTTLGPATHTNATHSQVPTTWRSSRFRLRRSSLTGQILTR
FT                   IGSGLLVLWAAVTLSFISLHLAPGDIVSLLIGEQLRTPEVEAAIRAEWGLNDPVYVQYI
FT                   HYLGRVLHGDFGRSYILQTDVSGLVLSQILPTLKLTAAALTVAIVFAVTIAVLTAAKRV
FT                   PRIIAGGLELLLISTPSFWLGILLLFVFSFTLKLFPVSGDRSFSALVLPAFALGLPLGA
FT                   VIAQVLREGLERALEEPFALTVRSWGTHSLVLRLRHALRHAALPAVTLTGWLVGNLLSG
FT                   AVITESVFGRPGLGRVTVNAVLAHDLPVVLAVAILSAFVYVVLSTAVDVLYLRLDPRLR
FT                   TKAREDAR"
FT   gene            complement(171730..175029)
FT                   /pseudo
FT                   /locus_tag="Avi_7204"
FT                   /note="ABC transporter substrate binding protein
FT                   (dipeptide); Stop in Frame (pseudogene)"
FT   gene            complement(175062..176063)
FT                   /locus_tag="Avi_7206"
FT   CDS_pept        complement(175062..176063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7206"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7206"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39904"
FT                   /db_xref="GOA:B9K4V6"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4V6"
FT                   /protein_id="ACM39904.1"
FT                   /translation="MSYALGFLDKSPLDGAESATAALQRTLALAEKAEEAGFSRFWVAE
FT                   HHNAAKLASSSPEVLIGFLLAHTRRIRIGSGGVMLQHYSAYKVAENFNLLAALAPGRVD
FT                   LGIGKAPGGMPLSTRALQAAFDPAKKPSFEAQLEELDGFLHHDTNIEADADHLAAFPAP
FT                   EKPAERFLLGASPESAKLAARLGWNFVYAGHINGDETAIHDALSAYRAAGGPSALLAVS
FT                   VVVAKTDALAESLTGDIRRFRVEIESGQGVNVGSREQALDYVRQTGAQQYRIEERTPRV
FT                   IRGTPARVHDELERLHRSYGIAEFIVDCPVSQGANRLETIELLAGGRKALAA"
FT   gene            176317..176943
FT                   /locus_tag="Avi_7207"
FT   CDS_pept        176317..176943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7207"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7207"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39905"
FT                   /db_xref="GOA:B9K4V7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4V7"
FT                   /protein_id="ACM39905.1"
FT                   /translation="MTDILVRSSLQDPAAQPLIDGLVSEYDGRYGADSRAGGALAEILR
FT                   YPAAIFTPPLGDFLLLQRNGKTIAGGAFMSHDDETAELKRIWTHPELRRQGLARTIVLA
FT                   LEEKAAQLGYTRAYLSTGFRQPEATALYISLGYRPLFDVAADPTLYRSLPFEKHIGTKA
FT                   GQPATSSIYPPAASFDEATDRVKAVKATQEAKITARLARFEVTAA"
FT   gene            177000..178025
FT                   /locus_tag="Avi_7208"
FT   CDS_pept        177000..178025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7208"
FT                   /product="monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7208"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39906"
FT                   /db_xref="GOA:B9K4V8"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4V8"
FT                   /protein_id="ACM39906.1"
FT                   /translation="MPLSHIKHFAFLIPGSYREDNPAEGLEETLRLFELGEELGYDSAW
FT                   VRQRHLERGISSASTFLAAASQRTSTIGLGTAVIQLGYENPFRLAEDLATVDGLSRGRL
FT                   NVGVSVGAPPFAHLIAPFTDAAPETDYSHARAEKLALALQSKPLSEETLAGNAAGAQIP
FT                   RVRPLAPGLTDRLWYGGGSQKSARWAGETGFNLLSGNIITGEQTDDFLTAQRALIETFR
FT                   QNWQHERAPRVALGRVILPTDSASPETRRRYAEFVEERNKRTHAPQGPRRTLILPDVVG
FT                   TTPEIIEILSRDPVLPLVSEFRLELPYDFHAEEYAQIIEDFAQLIPAQGKRKSKLSLAA
FT                   G"
FT   gene            178062..179063
FT                   /locus_tag="Avi_7209"
FT   CDS_pept        178062..179063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7209"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7209"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39907"
FT                   /db_xref="GOA:B9K4V9"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4V9"
FT                   /protein_id="ACM39907.1"
FT                   /translation="MTQTHPLLLGIGVDAAARDSNRPTDWQGFWRALIARLDGAASFLT
FT                   LEDGFARADDGLDAVLLANWLGARSHRIGIIAGAAVNFLEPFHVSTAIATLDYVTQGRA
FT                   GLLHQRLDQTRAEQAGRAIGRLNGFPAIAAHDLDRDAIDAGEVIRRLWDSWEDDTVIRD
FT                   PVSQRFLDGAKLHYINFESPNFRVLGPSITPRPPQGQPVVAVSWTGTEDIALAKAADVV
FT                   FVSGDNDRIAELAAQINGGSTTAGPVLVADIAVGATPLSGAEAVERLTQTATAGFGAVR
FT                   LVLSDPQTQIDHVLHEILPALGSAGLVREPSGNTLRARFGLPTAINRTATAA"
FT   gene            179082..180416
FT                   /locus_tag="Avi_7210"
FT   CDS_pept        179082..180416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7210"
FT                   /product="monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7210"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39908"
FT                   /db_xref="GOA:B9K4W0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4W0"
FT                   /protein_id="ACM39908.1"
FT                   /translation="MAQKQIILGAQFPGVNNFTVWSDPAAGSQIAFSSFQHFAQSVERG
FT                   KFDFIFLAEGLRLREQKGRFHELDVAGRPNTLAILTALASITNHVGLIGTLTTTFNEPY
FT                   ALARQLATLDVLSGGRSGWNVVTSPGAFTGANFRRGDHLPFKERYERARAFIEISHAVW
FT                   AGEDFTHHTKHFDVVGRSSLAPLPQGAPVIAQAGDSEEGRELAASHADLIYSRHGTLEA
FT                   GQAFYKDVKARLAKYGRKPDALKILPGANFIIGDSLEDAQDKLRTIRLQQVSPKTAIVF
FT                   LEQVWNHDLSSYDPDGPLPSIEPDTTDEKLAQGRANNLDAKGRVETAQQWRELAERDHL
FT                   SIRELIIRVTARQHFIGTPQTIADEIDLYVQSDAADGFVFAPHITPGGFDEFVEKVIPI
FT                   LQDKGVFRSNYAEDSLRARLNLPLSAHADSGAVSTTRETIAPLRA"
FT   gene            complement(181186..182781)
FT                   /locus_tag="Avi_7212"
FT   CDS_pept        complement(181186..182781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7212"
FT                   /product="ABC transporter substrate binding protein
FT                   (oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7212"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39909"
FT                   /db_xref="GOA:B9K4W1"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4W1"
FT                   /protein_id="ACM39909.1"
FT                   /translation="MTLTRRDFHRIALAAGAFTALPGGAFAAAEEPISGGTLKIVYFPE
FT                   PTQLVAINTSSGGAQFIGAKIFDGLLTYDYDLTPKPALAKEWSISPDGKTYIFHLRPNV
FT                   TFHDGKPLTSADVAFSIFRLKEAHPRGRAIFATVESIDTSDPLVAKLILSKPTPALITA
FT                   LSGSESPIVPKHIFETFKPTENPKPQQIIGSGPFALKEWVPGSHILLERNAAHWDAPRP
FT                   YLDRVILRLINDASARSAALETGEADIGPNPVPLSDLDRLKSVATLKVDDQIYAYAGQQ
FT                   NQLVINLENSYLKEQKVRQAIAHAIDVKALINIVLYGYGIPSPTPISPGLAKFHNPDIG
FT                   FAKYDVALAEKLLDEAGFRRQANGKRFKLRVTTNPFNPASYSDFIAQALIKIGIEADIQ
FT                   KFDFGTYVKVVYTDRAWDLSVESLSNTFDPTAGVQRVYWSKNFKIGLPFSNASHYENPE
FT                   VDRLLEAAAVEPDIEKRAQLFRDFQVIIARDLPVINLVSPIQPVVGNKRVRNYAYGAEG
FT                   LIGNLAYASLAKNS"
FT   gene            complement(182799..183137)
FT                   /locus_tag="Avi_7213"
FT   CDS_pept        complement(182799..183137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7213"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7213"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39910"
FT                   /db_xref="InterPro:IPR021439"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4W2"
FT                   /protein_id="ACM39910.1"
FT                   /translation="MAQDILFLLSPGFEDAKHPSTRFVCPSCNQIEGLLRSFPDLAAKL
FT                   TIHRVDFPRPRQEVIAVVGEDHQGLPLLVFGENPPEDATTYSDTHFIQDTKRILTLLAE
FT                   RHGFPQLH"
FT   gene            complement(183191..184789)
FT                   /locus_tag="Avi_7214"
FT   CDS_pept        complement(183191..184789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7214"
FT                   /product="ABC transporter substrate binding protein
FT                   (oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7214"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39911"
FT                   /db_xref="GOA:B9K4W3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4W3"
FT                   /protein_id="ACM39911.1"
FT                   /translation="MTITLTRRKALLLGAALGGSTLLPAFGFAADTSKKGGIATFVAVG
FT                   EPTTLVPLSDTNTRTRAISTKILEGLVRFDSSFKPHPVLAESWELSADGLRFTFRLRKG
FT                   VKWHDGKDFTSADVKFSLLAFKKVGPRGRVTFANVSDVETPDTLTAVVVLAKPAPYLLR
FT                   ALTGGETPILPAHAYAYATDNYAESPNGNAPIGTGPFVFEEWKRGSYVKLKRNPNYWQA
FT                   GLPHLDGFVARFVGDGAAASIALETGEADYSTDVSFNDIERLKQSKTLTVDIYTDAYLN
FT                   NAQVFEFNLDNPILAKAEVRHALAHAIDRNFIIDAIFYGTAKPAFSNIPAVFKDYNDEA
FT                   PFQYEFDLKKANELLDKAGHPKDANGIRFSLRLTYIPGDSFKKTAEYFRSTFGKLGVKI
FT                   EIVDGDLATFIKRVYTERGFDINLNGISRLFDPTAGVQRLYWSDGIKNIAPYVNAAHYN
FT                   NPKVDDLFRAAAIEVDEKKRDEEFKEIQKITGADLPNFSVIALPTVIARNKRIQNLVTT
FT                   IDVAYSDLAEAWKDS"
FT   gene            complement(184832..186025)
FT                   /locus_tag="Avi_7215"
FT   CDS_pept        complement(184832..186025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7215"
FT                   /product="hippurate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7215"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39912"
FT                   /db_xref="GOA:B9K4W4"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4W4"
FT                   /protein_id="ACM39912.1"
FT                   /translation="MTSSPDPLPSPHVIDRIASYTPELTAIRHDIHQHPEIGFEEVRTS
FT                   GIVAEKLTSWGIEVHRGYGKTGVVGRLRGKHAGNRSIGLRADMDALPMPEETGLPFASV
FT                   YPGKFHGCGHDVHTTILLGAARYLAETRDFAGTVTFIFQPAEEGLGGARAMIADGLFKD
FT                   FPVDEIYGLHNSSYSPPNHLRVSPGAAMAGADFFDITLRGKGAHAAHPDLGRDPIPAVG
FT                   ELIQALQTIVSRNVPPTDPAVLSITRIEGGSAYNVIPETASIAGTVRAFSDEVRQTIRT
FT                   RITEISNHIAAAHGLTATVDIRDIFSVLTNNDTAVEAVVSVAREVLGDARVSTQPYRTM
FT                   GSEDFADLLKHAPGAFFTLGHSGTVPAHNPGFIVDDAILPVGATLFSRLVESRLKAA"
FT   gene            complement(186111..187280)
FT                   /locus_tag="Avi_7216"
FT   CDS_pept        complement(186111..187280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7216"
FT                   /product="monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7216"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39913"
FT                   /db_xref="GOA:B9K4W5"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4W5"
FT                   /protein_id="ACM39913.1"
FT                   /translation="MALIAESAKEPDLKGPLDFENSPLSRAVRQPLMLGLFLNLQDINF
FT                   SSLPTSNSWTFDYNAEVVKKADALGFEIAFSRTQWLPKGGYDGEASLDSFIALGAMAAI
FT                   TTNILLISTIHVLYGPLHPLHLAKYGATLDHIAKGRWGINIVTGHRAIEHEMFGWQRIE
FT                   HDKRYDMASELFHVLNRLWSETENFSYEGKLNPWAVNNGWITPKPEFGRPPLVTATGSP
FT                   AGIDFAARHSDLVFVTSPGGAHIESALETLPDHIAAIKTRAASYGRRVKTIINPIVVSR
FT                   DTEAEAFAYADAIEAGKPQQGTRAFATNNYESDAHAWRGRGDPRHKQGRNLGGNIEIIG
FT                   SPEQVVDQLLALHRAGIDGIQLNFYDFRDDLDYFAERILPLLKQAGLRL"
FT   gene            188026..188994
FT                   /locus_tag="Avi_7220"
FT   CDS_pept        188026..188994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7220"
FT                   /product="ABC transporter substrate binding protein
FT                   (aliphatic sulfonate)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7220"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39914"
FT                   /db_xref="GOA:B9K4W6"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4W6"
FT                   /protein_id="ACM39914.1"
FT                   /translation="MGRILKRLIATACLLAFGTVSSFAADPKEITLDWATYNPVSLILK
FT                   KQGLLEKEFAKDGISIRWVQSAGSNKALEFLNAGSIDFGSTAGAAALIGKINGNPIKSV
FT                   YVYSKPEWTALVTRAETGITKPADLKGKSIAVTRGTDPHIFLVRALADAGLTEKDVKLV
FT                   LLQHADGKLALLRGDVDAWAGLDPLMASAEVENGAVLFYRKPQDNTWGVLNTREEFAKE
FT                   HPALVKRVLAVYDQARREAIAHPDALKVALEEAAKLPGPVIAKQLERTDLSSSQIGPAQ
FT                   RDTIFQAGVALQKAGVIGAEVDVAKAVDGLIDPQFSSGLGQ"
FT   gene            189020..189868
FT                   /locus_tag="Avi_7221"
FT   CDS_pept        189020..189868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7221"
FT                   /product="ABC transporter membrane spanning protein
FT                   (nitrate/sulfonates)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7221"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39915"
FT                   /db_xref="GOA:B9K4W7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4W7"
FT                   /protein_id="ACM39915.1"
FT                   /translation="MVAIFETIRQDESKAVPKASSFSGYRLGLYRAAASVILPLAGFVL
FT                   WELAVRFGWASGRLIPAPSRILETLWQLTITGELAHHLVASSLRVLVGFVSGAAAGTLI
FT                   GALTGYFTTLRRLLDPSLQAIRAIPSIAWVPLFILWFGIFETSKIVLIATGVFFPVYLG
FT                   ISTALREVDRKIVEVGKIFRLSNLELVWRILFPAVLPSFVVSLRAGLGLGWMFVVAAEF
FT                   MGASEGLGYLLVDGQQLGKPDQIIAAILAFAVIGKLSDALLVALTAPLLRWQDAYGGDR
FT                   L"
FT   gene            189868..190605
FT                   /locus_tag="Avi_7222"
FT   CDS_pept        189868..190605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7222"
FT                   /product="ABC transporter nucleotide binding/ATPase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7222"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39916"
FT                   /db_xref="GOA:B9K4W8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4W8"
FT                   /protein_id="ACM39916.1"
FT                   /translation="MLSVTHLGKTYANGAQALDNVSFDVNAGEILAIVGGSGCGKSTLL
FT                   RLISGLDQPTSGGVHLRNDLITRPHPLINLIFQEPRLLPWLRVTDNIGFGIRHLDSQER
FT                   KGRIAEVLETVHLNGYGNRWPKELSGGQAQRVALARALVTRPEVLLLDEPFSALDAMTR
FT                   GRLQQHLLDIWQATQATMVIVTHDIDEAIALAHRVIVMKPRPGRISEEIHIDLPMRREH
FT                   GMDYLVPYQQRLKSALNHSMAFA"
FT   gene            190715..191488
FT                   /gene="nocT"
FT                   /locus_tag="Avi_7224"
FT   CDS_pept        190715..191488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nocT"
FT                   /locus_tag="Avi_7224"
FT                   /product="ABC transporter substrate binding protein
FT                   (nopaline)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7224"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39917"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4W9"
FT                   /protein_id="ACM39917.1"
FT                   /translation="MKLLKSLATVALLQAALLLPAHAGENLATIKSAGVFKIGTEGTYA
FT                   PFTYHNESGKLVGFDVEIGEAIAAKLGVKAEFVEGKWDGLIAGLDAKRYDTVINQVGIT
FT                   ETRKQKYDFSDPYIASKAVLIVRSDDNNIKDFADLKGKKSAQSLSSNFGKLAEKSGAEL
FT                   VGTDGFDQSIQLVLTRRADATINDSLSFLDFKKHKPDAPVKVVAQQSDADYSGVIIRKQ
FT                   EPELLTAINKALADIKADGTYQKISEKYFGQDVSK"
FT   gene            191612..192271
FT                   /locus_tag="Avi_7225"
FT   CDS_pept        191612..192271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7225"
FT                   /product="ABC transporter membrane spanning protein (amino
FT                   acid)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7225"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39918"
FT                   /db_xref="GOA:B9K4X0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4X0"
FT                   /protein_id="ACM39918.1"
FT                   /translation="MVDSLVPLLWAGLVFTIPLTILSFTFGLTLGLVTAIGRLFGAKPV
FT                   AAIARFYVWVIRGTPLLVQLFVIFYGLPSIGILLDAFPAALIGFTLNIGAYSSEIIRAV
FT                   ISSVPKGQWEAAYSIGMSWRQAMLRTILPQAARVAVPPLSNTFISLVKDTSLAAAITVP
FT                   ELFQAAQRIVATTYEPLILYIEAALIYLALCSVLSTVQVRLERRFARYGGMMESNA"
FT   gene            192268..193029
FT                   /gene="nocP"
FT                   /locus_tag="Avi_7227"
FT   CDS_pept        192268..193029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nocP"
FT                   /locus_tag="Avi_7227"
FT                   /product="ABC transporter nucleotide binding/ATPase protein
FT                   (nopaline)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7227"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39919"
FT                   /db_xref="GOA:B9K4X1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4X1"
FT                   /protein_id="ACM39919.1"
FT                   /translation="MIELSNIEKRFGEAVILNDINLRIPEGNVTALVGPSGGGKSTLLR
FT                   CINLLEIPTIGTVKIGEASLTFAPGQKNGWQSIQKIRRQTGMVFQNFQLFPHQTAIENV
FT                   MEGLVTVLKWPKEKARQRAIELLNKVGMAHKADAWPSTLSGGQQQRIAIARALAPSPRV
FT                   LLCDEPTSALDPELAAEVVDVLSRLAGEGTTMVIATHDLRLASKIANDVVFLEAGRVVE
FT                   TGSAKNIFTVPQQDRTKRFISTINAAHSYDI"
FT   gene            193369..194169
FT                   /locus_tag="Avi_7228"
FT   CDS_pept        193369..194169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7228"
FT                   /product="outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7228"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39920"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4X2"
FT                   /protein_id="ACM39920.1"
FT                   /translation="MSRRAGLAALMALAVAAGTGALRAHAEDKVIKVGIVSGEDEDVWR
FT                   AVAQEAAKKGLTIKTVVFNDYTQPNEALERGEIDANAFQHKPYLDNQIKQHGYHITPVG
FT                   YTGVWPIGLYTKKYKAVADLPKGAQIGVPNDPSNEGRALRVLQNQGLIKLKDGTGILAT
FT                   IADITENPKSIKIKELDAGIVGRAIDDLDAAVVNTDWALKAGLSPADRIAQEPTADNPY
FT                   RNFIAVKQGKENEAWVKTLVASYQNDTVKAVFDKVYKGTGIVAY"
FT   gene            194247..195314
FT                   /locus_tag="Avi_7230"
FT   CDS_pept        194247..195314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7230"
FT                   /product="ABC transporter nucleotide binding/ATPase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7230"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39921"
FT                   /db_xref="GOA:B9K4X3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4X3"
FT                   /protein_id="ACM39921.1"
FT                   /translation="MNSQPLFAQATPVPDPDRVVELTDVHRRFGGTIALDGISLDVRKG
FT                   EILGIIGRSGAGKSTLIRCLNGLEQADRGEIRIEGRNIVGLAEQALQPLRRRIGMVFQH
FT                   FNLLSAKTVEVNVALPLKIEGVAKAERLARARDLLELVGLSDKAKAYPAALSGGQKQRV
FT                   GIARALAARPALLLSDEATSALDPETTRSILALLKDINKKLGLTIVLITHEMDVVRSIA
FT                   DRVAVIDAGRIVEQGDVWSVFANPQAEITKSLLSGNRPQLPGHLAARLRSEPGETVVLS
FT                   IDLAGDYAQGRLFADLADSFENGVRLVQGGVEHIQTQVVARLFLTVPASDLALLQKLQT
FT                   QLKSHHARVEVLGYV"
FT   gene            195319..195960
FT                   /locus_tag="Avi_7231"
FT   CDS_pept        195319..195960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7231"
FT                   /product="ABC transporter membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7231"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39922"
FT                   /db_xref="GOA:B9K4X4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4X4"
FT                   /protein_id="ACM39922.1"
FT                   /translation="MIDLLLSALWETVLMTVASGLISLVAGLPLGLALVVTAKGGIAEH
FT                   LWINRVLGAVVNAFRSIPFIILLVALIPLTRLIVGTALGTWAAIVPLAIAATPYYARIA
FT                   EVSLREVDRGLIEAVRAMGGNRWTIIREVLVPEALPGIISGFTVTLVTLIGASAMAGAI
FT                   GAGGLGDLAIRYGYQRFETTVMIAVVIVLIILVCGIQWLGDRLVAQLDRR"
FT   gene            196120..196920
FT                   /locus_tag="Avi_7233"
FT   CDS_pept        196120..196920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7233"
FT                   /product="outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7233"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39923"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4X5"
FT                   /protein_id="ACM39923.1"
FT                   /translation="MTFKVKTLLAAALIALSGNAYAETIKVGVVPGVYADSIEALVPEA
FT                   KAAGLDVQVVEFSDWTTPNIALQAGDIDVNYFQHKPFLDNAVAQRGYDIVPAGIGTLAN
FT                   IGIYSLKYKDFASVPDGATVAIANDPVNQGRGLLLLQKGGLIKLKDGVGFKGSLDDIVD
FT                   NPKHVTFTEVEGPQLARITRDVDLALGYPHFIVAAKAFDPSSGLIYSGVDDKQFAIVFA
FT                   ARKDKADSPALKKLVDIYQHSDAVKAAIDKAFGNDRKLYTLAWQ"
FT   gene            196911..198065
FT                   /locus_tag="Avi_7234"
FT   CDS_pept        196911..198065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7234"
FT                   /product="ABC transporter nucleotide binding/ATPase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7234"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39924"
FT                   /db_xref="GOA:B9K4X6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4X6"
FT                   /protein_id="ACM39924.1"
FT                   /translation="MAVVTTVLLDQLDASKAGLNGSATAATRASAAPQKSLALQGTGSV
FT                   VFENLSKIYTSSTGPVHALKDISVNVPAGSIFGIIGRSGAGKSSLLRTINRLERPTGGR
FT                   VLVDGDDIAGFNDDQLVGLRRRVGMIFQHFNLLSAKTVWGNVALPLLVAGVERHDINQR
FT                   VADVLKLVGLEGKEATYPSRLSGGQKQRVGIARALVSRPEILLCDEATSALDPETTLSI
FT                   LRLLQDINQRLKLTIVLITHEMSVIREICDQVLVLEQGEIAEQGCVWQIFGKPSHEATK
FT                   ALLEPLQRGLPADLASRLEVGGDGRAVVELSYTGEGGLEPDLSAISAAFGPGSRLVQSN
FT                   LDRIQGHVQGQVLIIAANPPDVSSPLIQALAHSARILGYVTTDV"
FT   gene            198046..198699
FT                   /locus_tag="Avi_7235"
FT   CDS_pept        198046..198699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7235"
FT                   /product="ABC transporter membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7235"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39925"
FT                   /db_xref="GOA:B9K4X7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4X7"
FT                   /protein_id="ACM39925.1"
FT                   /translation="MSPLMYERLGRAFLDTITMVGISALFALVVGIPLAVFLVLSSPGG
FT                   LIEAPRTNRILGALINGFRATPFIVLMVALLPFTRLVTGTTIGVWAAIVPLSISATPFF
FT                   ARIAEVSLREVDHGLIEAAQAIGCRRWHIIRHVLLTESLPGLVGGFTITIVTMIGASAM
FT                   AGAVGAGGLGDMAIRYGYQRFDTTVMIAVIIVLIATVCLVQFTGDLIVRRLQAQ"
FT   gene            199739..200020
FT                   /locus_tag="Avi_7237"
FT   CDS_pept        199739..200020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7237"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7237"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39926"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4X8"
FT                   /protein_id="ACM39926.1"
FT                   /translation="MVVSLAGCLDVGPFNCLRARWNNAPCAWAVTENCVVGWIAIISSI
FT                   SSELVDLIVDPIANLFNVPRHDIPSVHHRDLQAMAMQMWSEVAHLKVA"
FT   gene            200266..200940
FT                   /locus_tag="Avi_7238"
FT   CDS_pept        200266..200940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7238"
FT                   /product="transcriptional regulator GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7238"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39927"
FT                   /db_xref="GOA:B9K4X9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4X9"
FT                   /protein_id="ACM39927.1"
FT                   /translation="MPVVQSSIAMQASTAEEEAYLHMQQALRRGRYKPGDRLIAEEIAA
FT                   EIGMSRMPVREAFRRLASDGLVTLRPNRGCVVAGLTLAELQEAFEIRSVLEGLAVRIAM
FT                   PRMNAETFEELERLLTLMERAGGSGSSDWVLRHQEFHAFIYGLSGRPKLIRQITALHVV
FT                   IEPYMRIWFDYVDKPLSARQEHDTLIEALRSGDARRAEAVMQEHIVETASLLADYASPA
FT                   RR"
FT   gene            201032..201883
FT                   /gene="nocT"
FT                   /locus_tag="Avi_7239"
FT   CDS_pept        201032..201883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nocT"
FT                   /locus_tag="Avi_7239"
FT                   /product="ABC transporter substrate binding protein
FT                   (nopaline)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7239"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39928"
FT                   /db_xref="GOA:B9K4Y0"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4Y0"
FT                   /protein_id="ACM39928.1"
FT                   /translation="MTFRRMAALAVAFTTLISGSVTMAQDAPTEIKIATEGAYAPWNFT
FT                   TSDGKLDGLEIELANDLCARMKVKCTIVAQDWDGLIPSLTVGKFDVIMASMFITPKRLE
FT                   TIDFTQPYAVDPSGFAVPKDSAVGKLGISTEKFKLEDEAPSKAAIDKLKSLLKGKVVGV
FT                   QAATTNLDFLRKYFADTVEIREYKTTEQHDLDLAAGRIDAIFAQQTALAATLAKPEFAD
FT                   YTIAGPGFVGGVFGLGTGAGLRKQDTKLKEMLNTAISSAIADGTIKRLSEKWVKTDVTP
FT                   VK"
FT   gene            201900..202670
FT                   /gene="nocQ"
FT                   /locus_tag="Avi_7240"
FT   CDS_pept        201900..202670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nocQ"
FT                   /locus_tag="Avi_7240"
FT                   /product="ABC transporter membrane spanning protein
FT                   (nopaline)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7240"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39929"
FT                   /db_xref="GOA:B9K4Y1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4Y1"
FT                   /protein_id="ACM39929.1"
FT                   /translation="MRPGPWLHWPRELREGFAHMLEKLHLLGFAEGGWGPALIGAAALT
FT                   LLLSVLGFMLGACFGSLAAAGRLSSARIPRVIASAYATVFRGVPDLLTIYLFYYGGSVA
FT                   LTTVAHFFGANSFVGLPALATGVVAIGMISGAYQAEVYRGAYLAVERGQFDAAKALDLS
FT                   RSQMLLLVILPQLLRHAIPGLSNVWQLVLKDSALISVVGLVELMRQSQIGAGSTREPFL
FT                   FYLAAACLYFVMAGVTGRFFRSAEVRTSRGILHS"
FT   gene            202667..203359
FT                   /gene="nocM"
FT                   /locus_tag="Avi_7241"
FT   CDS_pept        202667..203359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nocM"
FT                   /locus_tag="Avi_7241"
FT                   /product="ABC transporter membrane spanning protein
FT                   (nopaline)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7241"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39930"
FT                   /db_xref="GOA:B9K4Y2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4Y2"
FT                   /protein_id="ACM39930.1"
FT                   /translation="MIDFGFFFEIIPKLLSGLPLTLTLAGTSIVCGFVLALVLALVQQG
FT                   ERRWVVWPVRTFVAVFRGTPLLVQIFLIYYGLGQFRPSLQAAGLWWLFREPYWCAILAL
FT                   TLNTAAYGSEILRGAIRNVPRGLIEAASALGMSRLANLRFIILPLALRQAIPAYGNEII
FT                   LMVKGTSLASIITLMEVTGIAQGLISQSYRAIEVFMAAGAIYLLLNFIIVRALTTLEAR
FT                   LTLYRTRS"
FT   gene            203401..204996
FT                   /gene="ggt"
FT                   /locus_tag="Avi_7242"
FT   CDS_pept        203401..204996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ggt"
FT                   /locus_tag="Avi_7242"
FT                   /product="gamma-glutamyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7242"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39931"
FT                   /db_xref="GOA:B9K4Y3"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4Y3"
FT                   /protein_id="ACM39931.1"
FT                   /translation="MRNFEKPTRSVAVSTDAMAATSHPYATLAAINILQAGGNAMDAAI
FT                   AACAVQCVVEPGSTGIGGDCFALYAPKGGDQVIAYNGSGRTPAALTVDWFEERGLAEVP
FT                   RQSPSAVTIPGAIDAWTRLHADHGRLPFEQILQPAIRYAENGYAITPRVYRDWVREEKL
FT                   LNDDPAASEIFLPNGRAPQIGEVHHQPRLAATLRRIAAEGRDGFYKGAVAEDMVDRLRA
FT                   LGGLHTLEDFAEAKGEYVVPVTTTFRDHTIHECPPNGQGIIALLILNILSRFDTQDDPS
FT                   SADRLHLEIEATRLAYAARDAWLADPEKASVPVEDMLSEEFATHLAGMIDLTRALTNLP
FT                   DFEMPLHRDTVYISVIDSERNAVSFINSIFDCFGSGIVAPQSGVVLHNRGQSFSLKRDH
FT                   PNMIAPGKRPLHTIIPGMVTRAGRTEISFGVMGGYYQAMGHAHLISKVIDYGMDLQDAI
FT                   DLPRLIPVGGKVPRVEAEHTVPAETIALLRRRGFEIVPAEDPIGGAQIIRIDWENGTLT
FT                   GASESRKDGIALGY"
FT   gene            complement(205215..205568)
FT                   /locus_tag="Avi_7245"
FT   CDS_pept        complement(205215..205568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7245"
FT                   /product="phospholipase/Carboxylesterase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7245"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39932"
FT                   /db_xref="GOA:B9K4Y4"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4Y4"
FT                   /protein_id="ACM39932.1"
FT                   /translation="MLHGVGSNGADFAPLANSWKASLPSAVFVSPTAPAPSSVGSGYQW
FT                   FSVAGVTEDNRSARIADARRSFDQVISLIVEGNGFTDKLDRVALVGFSGRLASLLPLQP
FT                   ALETHILLIHGMC"
FT   gene            complement(205803..206186)
FT                   /locus_tag="Avi_7246"
FT   CDS_pept        complement(205803..206186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7246"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7246"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39933"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4Y5"
FT                   /protein_id="ACM39933.1"
FT                   /translation="MTNALPPLYNGHAPITLQQLFREALYAFEEWDTGLTEPLVTFEGR
FT                   ITPISLVFEAMRECNDIVPMNISIAITQRLTKPWEGEGPLDQMSFSTAARIMRVLVRKR
FT                   LLADGAAEIVTVSKLTAERIPSE"
FT   gene            complement(206526..207167)
FT                   /pseudo
FT                   /locus_tag="Avi_7247"
FT                   /note="transposase; Stop in Frame (pseudogene)"
FT   gene            complement(207210..208208)
FT                   /locus_tag="Avi_7250"
FT   CDS_pept        complement(207210..208208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7250"
FT                   /product="transcriptional regulator AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7250"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39934"
FT                   /db_xref="GOA:B9K4Y6"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4Y6"
FT                   /protein_id="ACM39934.1"
FT                   /translation="MTPSDTNAPVDRLKIGFVLARSFTLSAFALFVDTLRLASDEFDRS
FT                   GRVLADWDVLGSTRHLITSSCGVQVAPTSDLVEDPSQFQFIVVVGGLLNNEQPIDRETA
FT                   AFLKKAAAKNVKLIGVCTGSFILAELGLMKSHRTCVSWLHYNAFRERFPDLQVRSDRIF
FT                   NLDRTRGSCVGGSSAADMAALIVRRHISKDAERNALEVLHIEKARSALAIQTRKPLSIE
FT                   CNDPRIRATLIMMEQHIEGNLPIQDLAAAVGLSRRQLERLFISETKSSPAMIYRRVRLE
FT                   RAKHLLVQSKAPLVEIALEVGFGNASHFAKVFAQTFGQSPTGLRTAIRATL"
FT   gene            complement(208262..209260)
FT                   /locus_tag="Avi_7251"
FT   CDS_pept        complement(208262..209260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7251"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7251"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39935"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4Y7"
FT                   /protein_id="ACM39935.1"
FT                   /translation="MRHSFFCIDSHTCGNPVRLVAGGGPLLPHLPIAERRELFVRDHDW
FT                   VRKALMFEPRGHDVMSGAIIYPAYRDDCDFAVIFIEVSGCLPMCGAGTIGLVTAGIEEG
FT                   LITPRVEGQLSIETPAGRVDIHYEKPGAFVESVRMFNVPSYLHAADVEVDIPGIGRLIV
FT                   DISYGGNYYAVVEPQASWSGLDGMSGSDIVDLSVKLRDALADICDPQHPDDERIRGVHH
FT                   ALWCDKPTSNAADGRGAVFYGDKAIDRSPGGTGTSARMAQLYGKGRLKVGEAFRQESII
FT                   GTVFEGRVEEEVVVGTLKGIRPSVGGWARIIGHNTIFVDDRDPLAHGFQIK"
FT   gene            complement(209280..210137)
FT                   /locus_tag="Avi_7252"
FT   CDS_pept        complement(209280..210137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7252"
FT                   /product="ABC transporter membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7252"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39936"
FT                   /db_xref="GOA:B9K4Y8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4Y8"
FT                   /protein_id="ACM39936.1"
FT                   /translation="MTPETVWFSPGAYLAPAVDWLNANFHPFFNTVTKIIEAVLGSIET
FT                   ILLFLPFYAVILITVALAAVFVTLRVAVTSAFALSFCFLSGLWEASMQTLALVTVSVCI
FT                   SVLIAFPLGILASRHRRVETIIRPLLDIMQTVPPWVYLIPAVMIFSLGRVPAIIATIVY
FT                   GIPPMLRLTTLAFNQVPKDLLELGQATGASPRAILFKIEIPAATPTLLVGLNQCILLSL
FT                   AIVVLAGLVGAGGLGAEVTRGLTRMEMGLGLRAGLAIVAVAIFLDRLSRGALQRGRAPG
FT                   AAST"
FT   gene            complement(210134..210982)
FT                   /locus_tag="Avi_7253"
FT   CDS_pept        complement(210134..210982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7253"
FT                   /product="ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7253"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39937"
FT                   /db_xref="GOA:B9K4Y9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4Y9"
FT                   /protein_id="ACM39937.1"
FT                   /translation="MDTSVITDSFDEHIDDTLNWISDHASWLFDSIRAVLEGTYGGVLW
FT                   LFQLAPFYVVALIAALLGWRLINSKAGLLIGVAMLGCTVMGLWAETMSTLALVITATFM
FT                   ALVIGIPVGIVAGFVQAFDKIVEPVLDLIQTLPPYIYLLPTIALMGYGPATALLATVIV
FT                   AMPPAIRLTSLGIRRTPNDFIELGQANGLTSWQMFVKIRLPFAIPSVMAGINQSLMMAF
FT                   GMVVIAGIVGSGGLGETIYSAVRTLNIATSINAAIAIVILTMVLDRLTQSAANRNTGVK
FT                   S"
FT   gene            complement(210993..212084)
FT                   /locus_tag="Avi_7254"
FT   CDS_pept        complement(210993..212084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7254"
FT                   /product="ABC transporter nucleotide binding/ATPase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7254"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39938"
FT                   /db_xref="GOA:B9K4Z0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4Z0"
FT                   /protein_id="ACM39938.1"
FT                   /translation="MTTSMHDASEVLIDCQSVWKIFGARSKAAVEAVKTRGLSKKQILT
FT                   EYDCVVGVSDASLQVRRGEIFCIMGLSGSGKSTLIRLLNRLIEPSLGTILVKGKDISAL
FT                   NAAQLRDIRARHIGMVFQSVALLPNRTVLENAAFGLEVRGVGKEERYKTARAALDKVGL
FT                   SDWTARYPSELSGGMQQRVGLARAIAADPEIILMDEPFSALDPLIRRQLQDEFRQLTKS
FT                   LGKSAVFITHDLEEAIRIGDRIAIMKDGVIVQVGNAEEIVTQPADDYVAEFVAGISRVH
FT                   LVKAHSVMIPVEVYKRDHPGSDIDTLLCATPEADIGALIALTMQSERDAVAIAEDGNVI
FT                   GIVTTRGLLCGVAGSPAQPTAAA"
FT   gene            complement(212176..213027)
FT                   /locus_tag="Avi_7255"
FT   CDS_pept        complement(212176..213027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7255"
FT                   /product="ABC transporter substrate binding protein
FT                   (glycine-betaine)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7255"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39939"
FT                   /db_xref="GOA:B9K4Z1"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4Z1"
FT                   /protein_id="ACM39939.1"
FT                   /translation="MKFLWKALCAAAMVGMTALSAHAEEKTVTIGTMSWEDLTPITGIT
FT                   KKVLEDSGYTVKVVPFSEWGIAYAALSKGDVQILASQTDYVAQDYWNKNKKRLEKISPV
FT                   SHGLYQAIAVPKYVPIDSVEQLNENADKFGGKIIGIEPGSGLMKDAANAVKDYGLKLQL
FT                   VEGSTAAMTAALKSASDRKEWIAVTIWEPSWMAQKYDVKFLKDPKGVFPPAQSYYWIGQ
FT                   KGFSAQNPHAREVIASVYVPLADIAAINSAVNDGKTMDEAIKSWTDSHADLLKRWENIK
FT                   SE"
FT   gene            complement(213106..214452)
FT                   /locus_tag="Avi_7256"
FT   CDS_pept        complement(213106..214452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7256"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7256"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39940"
FT                   /db_xref="GOA:B9K4Z2"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4Z2"
FT                   /protein_id="ACM39940.1"
FT                   /translation="MNKISVKRLPVENGVSGWEAISTRSFPLRSLEGNVTADWLIVGAG
FT                   FAGLSAARRLLQLRPDDKIVILDASEVGKGGSGRNSGFMIDVPHDLSSGEYSSGSTDDT
FT                   RIEMAQNRTAIAFATQAAAEYGMSSETFDPSGKINAAATERGMKLNEDFGKSLLNAGEK
FT                   HSFLDAAQMREITGTDFYLGGIYTPGAVLIQPADYIRNFAAGLWQQVDIFERSPVTSLM
FT                   RESGLWTASSPRGSVSAPRVILGVNGHINDFGHFNGRLMHFFGYASMTAPFPAEDFGRK
FT                   ASGHDRWALLPADPMGATVRKITSNGQSRIALRTKWTYDFSLKLTDQRLRKMAREHRVS
FT                   LDRRFPALKDLPFEHCWAGRICLTRNHVPAFGEIEEGLYSACCENGLGTVKSTLAGMLT
FT                   AELATGNTSTHLEEFNDHAQPSRLPPEPFTWLGANTVIKWQELRAGREG"
FT   gene            complement(214449..215966)
FT                   /gene="dhaL"
FT                   /locus_tag="Avi_7257"
FT   CDS_pept        complement(214449..215966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dhaL"
FT                   /locus_tag="Avi_7257"
FT                   /product="aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7257"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39941"
FT                   /db_xref="GOA:B9K4Z3"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4Z3"
FT                   /protein_id="ACM39941.1"
FT                   /translation="MHEPLTVAEYKAIAASLQLPTNAFIDGAFRPAKSGKTFTSINPAT
FT                   GETLAEIAACDVSDVDDAVAKARQAFDDGRWRHQAPGDRKAALLKLAKLIEENRHELAV
FT                   MESLDSGKPVRECQTVDVADTIHTIRFHAEVIDKLYDNTNPVGPNALAMVVREPIGVVG
FT                   CVLPWNFPLLMLAWKIGPALASGCSVIVKPAQETSLTTLRVAELAIEAGIPPGVFNVVT
FT                   GGGKEAGEPIGLHMDVDMVAFTGSTATGRRFLRYAADSNLKKVVLECGGKNPAVVLADA
FT                   EDLDLVAEQVVNGAFWNMGENCSATSRLIVDRTIKDELLERIGAYLREWKTGNPLDPEN
FT                   RIGALVSKTHFEKVKSFLDDAKTEKLSVVHGGATHGGIYIEPTVVDGVTPSSRLFKEEI
FT                   FGPILSVTAFDTLAEAVALANDTNYGLTASVYTGSLRQAIRLSRDIRAGLVTVNCFGEG
FT                   DASTPFGGYKESGFGGRDKSIFAHDNYCELKTIWIDISERSVDETIR"
FT   gene            complement(215959..216870)
FT                   /gene="dapA"
FT                   /locus_tag="Avi_7258"
FT   CDS_pept        complement(215959..216870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapA"
FT                   /locus_tag="Avi_7258"
FT                   /product="dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7258"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39942"
FT                   /db_xref="GOA:B9K4Z4"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4Z4"
FT                   /protein_id="ACM39942.1"
FT                   /translation="MKFEGIYTPAVTPLGPDGQIDREGFAAVLESLIEAKVHGIIVGGS
FT                   TGEYYAQSAQERLDLAAHAKDVIGTRIPLIIGTGATRTEDSVAYAIAAKDIGADAILVS
FT                   SPPYALPTERENAVHALTVDRAANLPIMLYNYPARMGVVMGDEYFSRVGKSKNVVAIKE
FT                   SSGDMANLHLLARKFPHIGLSCGWDDQALEFFAWGAKSWVCAGSNFLPREHVALYEACV
FT                   LEKNFDKGRAIMTAMLPLMDFLECGKFVQSIKYGCELIGLKTGSVRAPLRPLNAEEKRT
FT                   LETVVTTVKRTVAQITSGANNA"
FT   gene            complement(216867..217577)
FT                   /locus_tag="Avi_7259"
FT   CDS_pept        complement(216867..217577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7259"
FT                   /product="transcriptional regulator GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7259"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39943"
FT                   /db_xref="GOA:B9K4Z5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4Z5"
FT                   /protein_id="ACM39943.1"
FT                   /translation="MKGGKGELYDDLKRQILTMELDPDEDLDEVSLSEKYGLSRTPVRE
FT                   VFRRLEGEGYVDIRANKGARVIPMNHSTLRHFFLVAPMIYAAVGRLAVQNFKPGQLCDL
FT                   QITQERFREASMAQDALAMTLSNNRFHAIIGEMSGNEYLQPSLGRLLIDHGRIGHTFFR
FT                   PRNADMHERLQKSVGHHDGIIAAISARDEDAVVDLVFEHWELSRENMEMFIAPQALKAD
FT                   ALVDTPMQSMEKSS"
FT   gene            217980..218669
FT                   /locus_tag="Avi_7262"
FT   CDS_pept        217980..218669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7262"
FT                   /product="transcriptional regulator GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7262"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39944"
FT                   /db_xref="GOA:B9K4Z6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4Z6"
FT                   /protein_id="ACM39944.1"
FT                   /translation="MKVGKSSLYDDLKRQILTMELDPDEDLDEVSISEKYGLSRTPVRD
FT                   IFRRLAGEGYIDIRENRGARVAPLNHSTLRHFFLVAPMIYAAIGRLAVQNFKPKQLSEL
FT                   SDTQERFRAASHNADTLAMVLENNRFHAIMGEMSGNVYLQPSLRRLLVDHARIGQTFFR
FT                   PRNDDMQQRLRLATQHHDGFIASIKSHDENAVVDLVFQHWELSRENMELYVVPDNMTAD
FT                   LPVKLAP"
FT   gene            complement(218712..219026)
FT                   /locus_tag="Avi_7263"
FT   CDS_pept        complement(218712..219026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7263"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7263"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39945"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4Z7"
FT                   /protein_id="ACM39945.1"
FT                   /translation="MFVRTDLVPAPYGAAKRDIMPDVEHRSHKGLNNRAENSHQPTRRR
FT                   ERIMKGFKSARHLQRFVSIHDPVANLFHIPRHEISSDNHRELRTRAMQMWNEIACLQTA
FT                   "
FT   gene            219073..219225
FT                   /locus_tag="Avi_7264"
FT   CDS_pept        219073..219225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7264"
FT                   /product="truncated Tnp"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7264"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39946"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4Z8"
FT                   /protein_id="ACM39946.1"
FT                   /translation="MKVRNSRAYLYRAVDKLRNTIDFYLSPTRTAKTANRFLGNDLVLA
FT                   LPDHG"
FT   gene            complement(219320..220255)
FT                   /locus_tag="Avi_7265"
FT   CDS_pept        complement(219320..220255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7265"
FT                   /product="Ethanolamine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7265"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39947"
FT                   /db_xref="GOA:B9K4Z9"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B9K4Z9"
FT                   /protein_id="ACM39947.1"
FT                   /translation="MNEIGMATTEVEHALEVALTQVAGWQGRKLRYRAVLGGISNTNFR
FT                   IEVEGDPLSYFLKIPGRGTEMFIDRKAAAAASKQAETIGVGPRTFDYLAHLDIEIAEFI
FT                   DGRRPSTHRDFADPQIRHKAVSLYCDFHAAPELPLTKTVFDMIDEHYAQVEELGGYWPS
FT                   DHAWLRDQYRQARMALEASGLDLVPCFNDPMPGNFLIGENKSIKLIDFEYASNNERLYD
FT                   LAIWSGEMFFSESIDREIIEDYFGHYDTGYHARFIVLKALADIKWSTWAMVQNRISTLD
FT                   FDFYKYGIWKHMRARSIINDPRWPLFLKSL"
FT   gene            complement(220271..221236)
FT                   /locus_tag="Avi_7266"
FT   CDS_pept        complement(220271..221236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7266"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7266"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39948"
FT                   /db_xref="GOA:B9K500"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B9K500"
FT                   /protein_id="ACM39948.1"
FT                   /translation="MKPLGTPDNEGEARAERALSRFTTLPLHTLTYRVALPAVASPSYH
FT                   AVESVTFDIAPDGTEPTLFLKLAGDETKELVDDAISFAAATRLYDLGLSPKPIARAPLE
FT                   RAVLWERMGQGWRVAKIDDLMHEAPVSQLIKMQKAIAAGPLFGRPWSIFEGIDGLWAIM
FT                   QTLQAPLPGDASWMYAWTRTLYSAISAAGVDFCAAHGDPHSSNVMIGPSGQLQWMDFDM
FT                   AGDMDPYYQLGVQMNELYQFESQMQPLLEMHDGAFSTKAFARCRLYAAADDFYWALRSM
FT                   LLEMRSPRRSVEFLKYAEWRFLRCRMLLGRPGFEELVRSI"
FT   gene            complement(221233..222468)
FT                   /gene="amaB"
FT                   /locus_tag="Avi_7267"
FT   CDS_pept        complement(221233..222468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amaB"
FT                   /locus_tag="Avi_7267"
FT                   /product="N-carbamoyl-beta-alanine amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7267"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39949"
FT                   /db_xref="GOA:B9K501"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B9K501"
FT                   /protein_id="ACM39949.1"
FT                   /translation="MVDTLSSFGGGPDGSMNRLTLSQEDGRARDWLASWFAENGFVQSV
FT                   DAIGNQFGSAPLAGANAPVVMVGSHIDSQPNGGRFDGALGVVAACEAVLAVRERLAAEN
FT                   RLAACNFQVVNWTNEEGARFQPSLLGSSVFTGAAELDWALDRADGNGVTVRQSLQEIGY
FT                   AGKDKVPVPDALIELHIEGASTLFDAEEKFGAFTRFWGATKYRLAFLGCQAHTGPTPMA
FT                   ERKDALLGAAYLMADLRAMVDAYGLDLHTSVGRLEVFPNSPNIVPAEAVLFIELRSASP
FT                   EILEEAEQKLKVAAETAAAKAKIDYEIRSIDRRKAGNFAPGLIALAEQTAKSYGEPMRH
FT                   LDTVGGHDAVALSAVCPAVVLAVRSQNGVIHHPTEYTTPEDQAFGTQVLADMLYRLACD
FT                   GLEAAQHNEAAQ"
FT   gene            complement(222521..223282)
FT                   /locus_tag="Avi_7268"
FT   CDS_pept        complement(222521..223282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7268"
FT                   /product="transcriptional regulator DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7268"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39950"
FT                   /db_xref="GOA:B9K502"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B9K502"
FT                   /protein_id="ACM39950.1"
FT                   /translation="MSFTENRIKHILEMLKLHQRVTVVALSEQLQVSHESIRRDLKELE
FT                   IRGYARRVYGGAVIDGHDSDQPFGERIRVSAREKARIGEAAASMVENGMKIFIDTGTTT
FT                   LACLKHLESRKDVTIVSNSIAVAAHFFPYPDASVRVLGGRMRPEYQATYGHETVAALKE
FT                   HFFDLAIIAISAIHLERGFMDFGEDEAVLRRIARGQASRSIIVADSSKFGRLGSIHTFG
FT                   LSEIDAVVTSGVLPKDFSDYFSQSNVDIINA"
FT   gene            complement(223338..225182)
FT                   /gene="moaD"
FT                   /locus_tag="Avi_7269"
FT   CDS_pept        complement(223338..225182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaD"
FT                   /locus_tag="Avi_7269"
FT                   /product="ABC transporter nucleotide binding/ATPase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7269"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39951"
FT                   /db_xref="GOA:B9K503"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9K503"
FT                   /protein_id="ACM39951.1"
FT                   /translation="MTSPLLELKDLVVTAGYTEQSRRILDGISFTLQPREIVGVVGASG
FT                   AGKTVLSKAVVNWLEPPLSVRSGQVLFEGTDIFAIGAAEMRKLRRRVAYVGSNPMGALD
FT                   PTLSVGAQIVEKLRAVVPGTSYGDAEKRVISLLEAVRIPSARSRFHDYPSQFSGGMMQR
FT                   ALIVDALITNPALLIADNVTQPLDVTVAAQVIRLMKELTADFDTAVLFVSSSLPVAREA
FT                   CSRILVMEDGRIVEEQSAENLIATPIYPYTRELVAQTPKIWLEKNAVARLDDDRPVVIS
FT                   LRDASQIYKVRKKTGLGGVNNVRAVRNVTFDIRRGDSFAIVGESGCGKSTLMRLLSRLE
FT                   RPSSGQVLCKDKDIAQLSGKDLLAFRSTLQMVLQDPFGSLPPRTTVGRMLEEPLRTHGW
FT                   RDKATIRTRVLKVMGEVGLPAALYEELPLGLSAGQRQRINVARALVLEPEILIMDETLS
FT                   ALDQAEQFKLLDLFQTLQKEYNLTYIFISHDLAMVRKVCNRVAVMYLGEVFELAENERL
FT                   FFDPGHPYTKALLSAMPTLEERRYQPQDCLLEGEPPSPIHIPDGCSFKSRCPQAMEKCR
FT                   TISPSLTDRGEQDFAACHLVNPIFGTAPDKGSLVEAGP"
FT   gene            complement(225182..226102)
FT                   /gene="dppC"
FT                   /locus_tag="Avi_7270"
FT   CDS_pept        complement(225182..226102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppC"
FT                   /locus_tag="Avi_7270"
FT                   /product="ABC transporter membrane spanning protein
FT                   (dipeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7270"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39952"
FT                   /db_xref="GOA:B9K504"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K504"
FT                   /protein_id="ACM39952.1"
FT                   /translation="MMTFTSPAPSAIMAPVLSRSIPRRIYDKASSTPGFRIGVAIFLLL
FT                   ALAAALYPELSGLDPTKMNVRARLLPPLFIGETWSFAHPLGTDQIGRDMLVRSLVGLRY
FT                   SFLIGVSSVVVMLIIGCVLGTLAGYFGGRTDAVIMRMTDAQLSIPMIILAISVLGVSRP
FT                   TIPAIILVLGLSNWPVYARIMRSIVMTERQREYVRASKLGGSTDLRIILTLLVPLLLPP
FT                   VLFISVLDVARMMIFESILGFLGLGVQPPTPTFGNIIADGRKYLLNAWWIATMPGIFLG
FT                   LTLTSINLVGASLERARNTIHGGAE"
FT   gene            complement(226099..227079)
FT                   /locus_tag="Avi_7271"
FT   CDS_pept        complement(226099..227079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7271"
FT                   /product="ABC transporter membrane spanning protein
FT                   (oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7271"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39953"
FT                   /db_xref="GOA:B9K505"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K505"
FT                   /protein_id="ACM39953.1"
FT                   /translation="MFALNFLVRRLFQGAIIIFLVSLLIFTLLRVVPGDPVRMMAGGMA
FT                   PEALIEKIAKDMGLRDPILVQFGRYMSGVVQGDLGESFVRPANGAATGGSSFNDTTRGE
FT                   RAKVFTLIFDALPMTLQLAAVTLVIALVFSSIVGVAGGLAPGRWPDKLAFYISSIFISL
FT                   PNFWLGIVLALLFSVKLGWLPAIGYQGFAYTILPAIVLAVELAPVLIRTLVSSVSAQMM
FT                   EPYVSVGRVRGLSNTRIIANHALRNASVPLLNLLGVQFSSLLGGVIIVEYIFDYPGLGL
FT                   LTINAVLQRDFPLIQGIAIVTSAIFVLINILVDLVATTIDPRLEY"
FT   gene            complement(227162..228748)
FT                   /locus_tag="Avi_7272"
FT   CDS_pept        complement(227162..228748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7272"
FT                   /product="ABC-type dipeptide transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7272"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39954"
FT                   /db_xref="GOA:B9K506"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9K506"
FT                   /protein_id="ACM39954.1"
FT                   /translation="MSSEINRRRFLQGTVGAAAAAGFMQMNPDFFISSAFAQSGKTMTF
FT                   LSAENITGNWDPTAHTTLSQKNIEGFVMGFLTRSPMKLDNPGEVVYELATDIKLLDAHR
FT                   LQITLRQGITFHDGKPFKAEDVKATLEYGSRADRPAQWYPGPTETLTIETPDDYTVIID
FT                   TSKGGYPAHLFIFLASFLPMMSAKDVAGGPGGVLSQRLNGTGPFKFVEQRGNDTVMVAF
FT                   DGYFKGKPGIPGINFTFTGDSTTRMLSLMNGQASIVERLEPEQVATLKGNPQIAINEVV
FT                   SVENKYLWFRCSKPPFNDPRVRLAACHAIDRDMILEVLGSAGHASSNFVSPVKFGYADL
FT                   ENYPKYDPEKCQALLAEAGFPNGKGLPPLEYITSVGFYPKTKEYGEVLTGMLNEQGFPV
FT                   SLTVLEPAAWNEQLYDRPGGGPGHMVDCGWSTASPEPDLVLRTHFHSSSKRICGIVDKD
FT                   IDASLDKERNAANLEERKKVLQSETMPLIASKMPALSLFTSVMIHAMQKEFKEGLYIYP
FT                   DGSMDASKPAA"
FT   gene            229181..230149
FT                   /locus_tag="Avi_7273"
FT   CDS_pept        229181..230149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7273"
FT                   /product="DNA topoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7273"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39955"
FT                   /db_xref="GOA:B9K507"
FT                   /db_xref="InterPro:IPR001631"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013500"
FT                   /db_xref="InterPro:IPR014711"
FT                   /db_xref="InterPro:IPR035447"
FT                   /db_xref="UniProtKB/TrEMBL:B9K507"
FT                   /protein_id="ACM39955.1"
FT                   /translation="MGARGFLYYRPDGRRITQADEIARLNSLAIPPAYTDVVISTNPFS
FT                   HLQAIGTDAKGRRQYRYHKDWHAERGKAKFERLADFASRLPDLRERVDIDLRSRGLNVE
FT                   KALATVVWMLDNLYIRIGNAAYAETNKSFGLTTLRSRHVSVEGGSLKFRFKGKSGKEWN
FT                   LAHSDRRIANVVRKLQELPGQHLFQYVCDQGGCRPISSHDVNAYIREMTGDDFSSRQFR
FT                   TWGATCMAVDALASAEAATTKRELARQLNAAIDAVAAKLVNTRSVCRSSYIHPAVFEDF
FT                   QAGTLRDVLKLKTTSERLLQWMDEGEIQVLKWLKKQTVSNS"
FT   gene            230317..233289
FT                   /locus_tag="Avi_7274"
FT   CDS_pept        230317..233289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7274"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7274"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39956"
FT                   /db_xref="GOA:B9K508"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:B9K508"
FT                   /protein_id="ACM39956.1"
FT                   /translation="MKPLLPAFRRRLCVFTALASTVLPAHCFAQSAWSGNADNEFSNAS
FT                   NWSPSAPGAGDDAHVDTGSPQVTNDVTVNRLEVGGGNVTITDTGALTATNGTTITAGSV
FT                   SVNAGGVMNSNVSLDGGSLSIDGDLNGQLTLNNGNVTVNGTLSGAMVETGTALSNNGTV
FT                   DEVNISKGGTFVNNSGVTAGAVTNAGTTSNAGTIGSLTNTAGNFTNNAGGTISGKTTVS
FT                   GGTVTNNFVVTDADVAAAAAFINNTGATAGAIRNSGTVVNAGTIVSLQNDAGTFTNDAG
FT                   GVVTGDSTITGGSVTNNATLHDVDVGADATFTNANGATAGVVVNAGNSSNAGTIDSLTN
FT                   TAGNFTNNAGGTITGKSTITGGTVTNNFVITDADVAAAAIFVNNSGATAGTIRNSGTVT
FT                   NAGTVAALQNDAGTFTNNSGGTVTGTTTINGGRVVNNATLADVDNEAAGEFINNNGAVA
FT                   GTVTNSGSASNDGTIAALVNTDGIFSNTGTIDGTATISGGSLINDGTVAGAVVIDEGGL
FT                   LSGNGTIGELFVNAGGVLSPGRDIGTLTVDGDVTFSTGSIYQVDIDANGASDRVDATGT
FT                   VSIQGGTLEIRAVGGNYGLTTTYTILSASRITGTFDSVSSDFAFLTPTLTYGAATIDMR
FT                   FDRNNVQFSDVADTANGRATAVAVEALGTGNSIYDAVLSLNSSTANSAFSQLSGEVHAS
FT                   LKSALLWESRFARDAVLDQMAMDLDQRKDDVTVWTNSFLSSNRWSGNGNAAGIDTRTAG
FT                   VVMGVDASVSDPWRLGGLLGYSHDSLEQVKTESYHAGLYATGDIGPLNVIGGAIFSHND
FT                   ASTLRDISFGTITSQLTADYASATSQVFADLSSTHELDAIKLQPFANLAYVNLKTDAFR
FT                   ENGGDASMLAAKSSDEIATSTIGLRWSWRWPEDNLPVAVSGMLGWRHIEGDVSPYSSVA
FT                   FSGGTPFVVEGVEMPKDALLAKFGVSARLSKSARLTFSYSGEFGKGLRSSAAQVNLAGS
FT                   F"
FT   gene            complement(233401..233913)
FT                   /locus_tag="Avi_7275"
FT   CDS_pept        complement(233401..233913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7275"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7275"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39957"
FT                   /db_xref="UniProtKB/TrEMBL:B9K509"
FT                   /protein_id="ACM39957.1"
FT                   /translation="MNKVLASAITVAMTWMMTAAGAHADESAFLKTLAGSWSGKGTVKV
FT                   RTNAPTINVTCRFKSNTTAQSLALNGRCTSLVVFSRAISADLKINGATYSGSYVGAGTG
FT                   VAGLNGRRGGDAINLAINWAKEVNGDRRAQMTIEKVGASGMRLTTVDTDPATGKPIVTS
FT                   RIDLRRS"
FT   gene            234111..235064
FT                   /locus_tag="Avi_7276"
FT   CDS_pept        234111..235064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7276"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7276"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39958"
FT                   /db_xref="InterPro:IPR009843"
FT                   /db_xref="UniProtKB/TrEMBL:B9K510"
FT                   /protein_id="ACM39958.1"
FT                   /translation="MDSRAPTSEPPLSWSPRLPGWASLRGRDIPESDAAFSAGIALKSL
FT                   DDLIQADPPWLGCWRDRLALKSAAIAARMDGRSEDEHALRDALLLTAPGDDPGPAGKLF
FT                   LATRMLSRRSGAITTPFIQELAALLDLCWDEGLASIPDLVDSAIQSERAAPFVAVDLIA
FT                   AMCAIRPDIEVLALGLADVVLAQKLKWPRPVPLLLPERFGSSFRTIGGRGRVRPGEPAY
FT                   PKAICLALVDGVDAALRSTVDINRRAARLLAVAPKVRTKGAEPVIRRLLNEDAVLASAP
FT                   GSGLSRWAANRLFERLESFEAVRELSGRSSFRVFGV"
FT   gene            235067..235753
FT                   /locus_tag="Avi_7277"
FT   CDS_pept        235067..235753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7277"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7277"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39959"
FT                   /db_xref="GOA:B9K511"
FT                   /db_xref="InterPro:IPR005234"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9K511"
FT                   /protein_id="ACM39959.1"
FT                   /translation="MAGAPVAKQSRKERASAAAERLFDRELEDLPPELRWREWMLRVEA
FT                   VIFASAEPVGRETLARVVGKECSIDLLIDDLIEELRSRPYELVSVAGGWQHRTRVRFAE
FT                   TIRASTAPTRGAATKLSQFEAMVLMAVGYFQPVTRAELSKIFGKEVNRDTIASLRGAGF
FT                   IASGPRSPTPGAPYTYVTTKHFLSAFDMETLRDLPDIEALEDAGLLSRNAVREGPIAGE
FT                   PESDEE"
FT   gene            complement(235794..236444)
FT                   /locus_tag="Avi_7278"
FT   CDS_pept        complement(235794..236444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7278"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7278"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39960"
FT                   /db_xref="GOA:B9K512"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B9K512"
FT                   /protein_id="ACM39960.1"
FT                   /translation="MAGGTALRRAEIGQERREKTRQKLIAAAARVIAANGDKTATIDDF
FT                   IRAAGVARGTFYNYFPTRENLLDALWTQVGKDPFLEIGKACASISDPVERLIAQAWRIL
FT                   IRSGEDQAWGWLIFALSGNAETVNSDLRAYPAPDLKAGLSAGRLHYDHLDSARDFVVGA
FT                   VRAGMKTQLSGRGSSEYAHDICKMILLALAVPTEEANRIMGSATRTGVGVAAA"
FT   gene            236582..238144
FT                   /locus_tag="Avi_7279"
FT   CDS_pept        236582..238144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7279"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7279"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39961"
FT                   /db_xref="InterPro:IPR041411"
FT                   /db_xref="UniProtKB/TrEMBL:B9K513"
FT                   /protein_id="ACM39961.1"
FT                   /translation="MAISGELRKSEPFDVARMPMLDADQIGHLRRIENLSLLLPDDWSG
FT                   MQAKSTLQEDFGGLRFQLAYMSYALALTHRHRLPAAPGVFRKTFERLIEKILSPDVWTY
FT                   WHYISTGNGVINAAQGELPAEWNPVIKDNIMYSAYVQSMSLLYHYIFNDDRYAQPGALT
FT                   MEIKTLYWAAGGKKFVYDERSLNDHLYWMMVEKGYFGIACEPNCIFQICNQVPILGFRF
FT                   HDLVYGGSLAKEVTDGYQRAWSDFGIASERGHFRMMVQEIERNLIPTEAPWIDFWLGSL
FT                   MHAWNPELVKQHYPGQIAKWGEAGPDGTLWINEAPGIPTSLGFTSARDFGWAAVCASEV
FT                   GDDDSLSRMLAYADRFLHRSWTDGGLHYRRHDASFDDQGLFRAMDPHTGNALLGYARLN
FT                   VPGGLERLYAEPWDKAHFEEPALVEISDNADVLRARFERDAKSLVLTLAPRADRDGNVL
FT                   LELGNIWGRGDWSLAADGEHVLSGNASELGKHSGAVGAKREGDILGLECALRAPTNFVL
FT                   TFH"
FT   gene            238155..238655
FT                   /locus_tag="Avi_7280"
FT   CDS_pept        238155..238655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7280"
FT                   /product="Electron transport protein SCO1/SenC"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7280"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39962"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B9K514"
FT                   /protein_id="ACM39962.1"
FT                   /translation="MLEGSFSLTDHNGHAVTEASYRGSFMLVYFGFTHCRKVCPRSLAC
FT                   MTAALDTLGETRRMVVPLYITVDPERDTPERMKAFVEANFPRFTGLTGSREAIDSAKAS
FT                   FRVFSRKGLDPEDAEGYAMPHTAFAYLLGPDGKYLAHFMDTIDDLQMANRLRILLAETE
FT                   RVT"
FT   gene            239090..239491
FT                   /locus_tag="Avi_7281"
FT   CDS_pept        239090..239491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7281"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39963"
FT                   /db_xref="UniProtKB/TrEMBL:B9K515"
FT                   /protein_id="ACM39963.1"
FT                   /translation="MLSLTGPKGPSDTQASGNAVVDHDIAITHDKSDLLAAAIGSETAF
FT                   PRVKTSITHAKPAANVHHSHFSPVIQGVTFVGISLFDGQQTLCAARSAPISLIEIKRDI
FT                   VRYWVAPRTSSGGGFSAPVGAPTSAKGIY"
FT   gene            239488..240621
FT                   /locus_tag="Avi_7282"
FT   CDS_pept        239488..240621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7282"
FT                   /product="HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7282"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39964"
FT                   /db_xref="GOA:B9K516"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B9K516"
FT                   /protein_id="ACM39964.1"
FT                   /translation="MMRKFSTRSLATVLALGSFFMVAFAARSQDGEQKTDQAAALSVSL
FT                   VKPAVLLWPVIIPASGRLAAWHEATIAAETSGMKVTEVKADVGAHVKKGDLLVQFAPES
FT                   AQADLEQQQANVEKAEADLDQAIANGDRARGLTSSGALSSQQIKEYLITERKAKASLFS
FT                   AKAALASSQLTLDRTKVYAVDDGVISERSASLGDVVTAGGELFKLIRQNRIEWKAELPF
FT                   NRLADVKVGTKAVIPTPRGDVHGEVRMVAPSMSTDNGRVIVYVTLNPTPGMDAPKIGIL
FT                   ASGYFEFNNTDALTVPAAAVTLKDGFSYVFILNSADKKTVTRKRVKPGRRQDDRVEIIS
FT                   GIEKTDDVVASGGVFLADGSVVHVVDSNDAATTEESK"
FT   gene            240618..243674
FT                   /locus_tag="Avi_7283"
FT   CDS_pept        240618..243674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7283"
FT                   /product="Acr family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7283"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39965"
FT                   /db_xref="GOA:B9K517"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B9K517"
FT                   /protein_id="ACM39965.1"
FT                   /translation="MNFSSWSIRNPVPPLLLFALLTACGLWAFNRLDIQNFPDMDLPTI
FT                   NISATLDGAAAAQLETEVARKIEDKLTGLSKLDSVTTTITDGSVSISVAFEVGKDTQAA
FT                   LDEVKSAVDQAKSDLPQDMDDPTVSKQSLNSSPLTTFVVHSDKLDDAELSWFIDNDMSK
FT                   ALMAVKGVGEVGRLGGIDREIRVELNSNMLDSLGLTANDVNTQLEAVQTYLSGGKGRIG
FT                   GESQSVRTVVAAETADELRAMPVPLPKGSWVRLDELGTVTDSQSDLTSLAYLNGKPVIA
FT                   AQIKRSKGYSDIAVTDDVRTAMKAFAAANPQVTIEEAYNTIVPTEQNYESSMDMIYEGA
FT                   VIAVLVVWMFLRDWRATLLAAVALPLSIIPTFLAMYFCGYTLNTITLLALSLVVGILVD
FT                   DAIVEIENIERHLRMGKSPFDAAMEAANEIGLAVIATTFTLVAVFLPTAFMGGVVGIIF
FT                   KQFGVTASVAVLASLLVARLVTPMMAAYILKPGTAKEEEDGRLMRSYLWLVKGALRRRW
FT                   IPVLGTVGFLAFTLLLLSHLSTGFFPASDDAQTKVTITTPTGSTIETTDEASRKASEII
FT                   AKVDHVTSVFQATGTASTGGGASSTTTSSTNSATIVVNLTPIGERDVKQSQIEADLRKA
FT                   LEKVPGLRLETGTGGNGTQLTLTLSGDDSEVLEKAAASLETGLRTLSGIGNVTSSAAMQ
FT                   SPEIIIKPDLAKAASLGVTSKAIAQAIRVATAGAYDTALSKLNLPERQINIRVLLDTTN
FT                   RQSLDAISLIPVEGSAGNVALGAIADISIGSSPSEINRLDRSRNVTLTIELNGRSLSAV
FT                   TAEAAQLPSYKNLPQGVKFVEQGELKRQTELFNSFATAIAIGIFCIYAVLVLLFHDFLQ
FT                   PVTILMAIPLALGGALLPLVLTGTSFSMPAVIGLLLLIGIVSKNSILLVEYAIEARRGG
FT                   MSRYDALVDACHKRARPIIMTTIAMAGGMAPAALSLVAGDSSFRQPMGIVVIGGLLTST
FT                   FLSLLVIPVVFTFLDDLLVWLKARFGVTS"
FT   gene            complement(243791..244750)
FT                   /gene="fecR"
FT                   /locus_tag="Avi_7284"
FT   CDS_pept        complement(243791..244750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fecR"
FT                   /locus_tag="Avi_7284"
FT                   /product="two component sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7284"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39966"
FT                   /db_xref="GOA:B9K518"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="InterPro:IPR032623"
FT                   /db_xref="UniProtKB/TrEMBL:B9K518"
FT                   /protein_id="ACM39966.1"
FT                   /translation="MPVKESSDSRKRRNREAADWLLRNGDPNQSPDDRALFETWLKRDP
FT                   ENCRTYSAAEFVMGDAGRAIQSDPGLADIDMRPRNMAKPIIATLLVAALATGAFFAFDG
FT                   PLRMQADMIAGTDETPIRTLEDGSIVQLNASSAIAVDFTGGHRVIRLLRGQAFFQVAHA
FT                   PDRPFTVVAGETKVIALGTAFDVRYGKEDTEVTVTENAVQLERDGKQAASLRVNEGEQA
FT                   IYDYARKTTAVTPVDGLVALAWRRGQIAVDNAPLSYVVEEMNRHFRGRIIIAGSALARR
FT                   RVSGTIKVADTKDALAFVKKALGLEATRLGPLIVIHPS"
FT   gene            complement(245080..245622)
FT                   /locus_tag="Avi_7286"
FT   CDS_pept        complement(245080..245622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7286"
FT                   /product="sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7286"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39967"
FT                   /db_xref="GOA:B9K519"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B9K519"
FT                   /protein_id="ACM39967.1"
FT                   /translation="MSRSSSSSLVWDTVDSSELLNRAMEAHYADITNAVRRRGHPSSTA
FT                   RDVVHDLYVKLAAKPEVLLNKRSIKAFLCRAAINLGIDRQRRETKEARLFSGSEREALS
FT                   AASTGHAPDHTLEIEARLAALREAIAELPERRRVVFILHRLYHLTPDQISTRLNISRNM
FT                   VDRHLRRAFAHCLDRIL"
FT   gene            complement(245916..246710)
FT                   /gene="fecE"
FT                   /locus_tag="Avi_7287"
FT   CDS_pept        complement(245916..246710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fecE"
FT                   /locus_tag="Avi_7287"
FT                   /product="ABC transporter nucleotide binding/ATPase protein
FT                   (iron (III) dicitrate)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7287"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39968"
FT                   /db_xref="GOA:B9K520"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9K520"
FT                   /protein_id="ACM39968.1"
FT                   /translation="MTTDLQGGPRIISNGVDIAYGDRRIVENLDLAIPQQRFTALLGPN
FT                   GSGKSTILRAFAALMKPSAGSIILDGFDVSQLSTREVARKVGVLLQGAVAPEGLTVGDL
FT                   VRQGRYPHQSLFSRWSPEDQQACDEALMLTGTTDLANRMLDTLSGGQRQRAWIAMTLAQ
FT                   QGQTIFLDEPTTYLDLEHQIELMKLITMLVAKRGKTVVAVLHDINQAARYAEHIALLKG
FT                   GRIRATGTPSEVINAEMIADVFNVKSMVIRDPVAGTPLCIPL"
FT   gene            complement(246700..247683)
FT                   /gene="fecD"
FT                   /locus_tag="Avi_7289"
FT   CDS_pept        complement(246700..247683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fecD"
FT                   /locus_tag="Avi_7289"
FT                   /product="ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7289"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39969"
FT                   /db_xref="GOA:B9K521"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B9K521"
FT                   /protein_id="ACM39969.1"
FT                   /translation="MIRVFFVLILLLTFLVAASLAFGDVSLGWQELYDVLMGTGRAQLQ
FT                   SEMIVWDLRLPRVLLALLVGVALALAGTISIAIMRNPLADPGVLGINSGAAAAAMAVIV
FT                   LISDPPVALLQVAGFVGASAMALAVFALAWRSGTSSLRIILIGIGLSALASAGTTFLSA
FT                   FGDIGDVQRALVWLAGSVYDANMVKVRMLALWLIVPIALTLLAARELDLIRFGDNSARS
FT                   LGQPVDRIRGLMILLVTLLSGAAIAVSGLIGFVGLVAPHIARRLVGVSHARILPVAALV
FT                   GACLVVAADLIGRVILAPAQLPAGIVTGLVGAPFFGYILWRRRHDH"
FT   gene            complement(247680..248708)
FT                   /gene="fecC"
FT                   /locus_tag="Avi_7290"
FT   CDS_pept        complement(247680..248708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fecC"
FT                   /locus_tag="Avi_7290"
FT                   /product="ABC transporter membrane spanning protein
FT                   (iron(III) dicitrate)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7290"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39970"
FT                   /db_xref="GOA:B9K522"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B9K522"
FT                   /protein_id="ACM39970.1"
FT                   /translation="MTDRTAGYIAETDVGRVLALAALLCLLMLATVIAISLGAAMMPPA
FT                   KVISALFASETSRDHLIVMTIRLPRALAALLAGSALAVSGAIMQAVTNNPLASPDLLGI
FT                   NAGAAFAVVSVMAIFGAGIGDIYVWFAFLGAAIAATVVYALGSMGMVGQSPLRLVLAGA
FT                   IVATFLTSVTTVMLIFDQSTLDAVRLWTAGSVTGRNIEQVKTVAPYIIAGLIAALPFGR
FT                   HLTTISLGADTSRALGQNPIVWRGLSVAVVILLAGGAVALAGPIGFVGLVVPHVARMCI
FT                   GVDYRWIIPFSALGGALLVIVADTVGRLVFGSQSFPVGVTIALIGAPFFLYLARTRLRD
FT                   GA"
FT   gene            complement(248705..249640)
FT                   /gene="fecB"
FT                   /locus_tag="Avi_7292"
FT   CDS_pept        complement(248705..249640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fecB"
FT                   /locus_tag="Avi_7292"
FT                   /product="ABC transporter membrane spanning protein
FT                   (iron(III) dicitrate)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7292"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39971"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B9K523"
FT                   /protein_id="ACM39971.1"
FT                   /translation="MVALLRFCLFLLAFLMTGSLAQAACQGTLLTEDVYNPPLCIPAAP
FT                   KRIVTLDPLITLGMLIELKAPVIATPYMAITESEVLDVVRAEKMVDLGNPREPSLERVA
FT                   ALKPDLIIGSAEAHSGIYEQAAKIAPTVLFKHMDWKVYLQRLSEVTGREGVARSSLTAY
FT                   NDRVSAIRERMKDKKLTVSTVRLAPDRFVVFVDGPNAYAPFAVLHEAGVKRTAYETVTD
FT                   GTIVKRPDWEELANLDGDVLLYVSASGFESGPDDVLEKQVTENPLWQLLPAVREGRAYR
FT                   VDRGPWQSFYGISSANRILDDVERFILTTP"
FT   gene            complement(249699..252206)
FT                   /locus_tag="Avi_7293"
FT   CDS_pept        complement(249699..252206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7293"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7293"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39972"
FT                   /db_xref="GOA:B9K524"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B9K524"
FT                   /protein_id="ACM39972.1"
FT                   /translation="MGSESQTGKINRLPPEHNVALLLTVGCKALSTGEFGGSMTKTFST
FT                   THEARASLRAVLLAGSALVMLTPALPAMVREAQAQMSQHAISVPAGPLTPALNSLAAQT
FT                   GLQILFDASVAQNKSTRGVNGTLTPEQALKAVLAGTGVDARFAGENRVTLQNATSASEN
FT                   PEQEGTLLEPIVIYGARNATTLGGTTSSVAILNAESLANSQIRTTQETFRRMANTMDSA
FT                   TVNAGFVIRGMSSEGLVSSGGPAGSIYIDGILQTRYNARFGARNLWDVEQVEVYRGPQS
FT                   TLSGRAAMTGAVYIKSKDPTFEKEVEVSTTVGTDHLVGTAITVNTPIVEDQVALRLSGS
FT                   YERSRAQPSYSDFKSYDNYDDLITDISGIARAKLLLTPSELPDTRAVLTYSYSKDRPND
FT                   ALVGLYSGRGDFNNAPVTYTEYRWTEAHNLGLEVTHDISETLRFTSQTGYQYGINNRRS
FT                   IDYGTENVVNGITGEDDNSILTQEFRLNYEGDRWKWVTGIYGSYEKWDGATDIVAFDYY
FT                   QQNDTQHRTTANLAIFGEATYEFAPTWFATLGGRLDYLRDKDHQQNYSGLIDDSPVLTG
FT                   DPTSLTEYNFVPKVGISKEFGSNQKVGLTYTEGFRSGGSYLDRVTGELGTYDPEYSKNI
FT                   ELSYKGTLLDDRLTLNANLFYTKYSDQQVEIRPDPSIPGYRIISNAATSRSWGFEIEPS
FT                   MQVTDQFTTFASVGYLNTKFIDFNHAALSEPQDGKSFPEAPEWSLGFGGRYEFQNGVFV
FT                   GADAKYTTSYNSRFGTNGMYKIDARFIVNAQVGFKKDNWQVTLFSENLTDEKYFTLIDP
FT                   DYSLPYGQAGKRRSFGLNLRAKF"
FT   gene            complement(252303..253181)
FT                   /locus_tag="Avi_7294"
FT   CDS_pept        complement(252303..253181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7294"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7294"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39973"
FT                   /db_xref="GOA:B9K525"
FT                   /db_xref="InterPro:IPR024726"
FT                   /db_xref="UniProtKB/TrEMBL:B9K525"
FT                   /protein_id="ACM39973.1"
FT                   /translation="MMAAMDIPTSEEAMVRRALDAQAAYMPDVRADIGQVGAGWTTAEA
FT                   FFSDEVALGEFLAFEQSLNEGTDIKTAGALLMTDYGYILAAATVPIFAGFGLIPNLSPA
FT                   SVALSFYTTQEPHDGEMHRVRRAHVRFLEETFWQGQLGDAVAEERLRAEIERHFRPVID
FT                   AIHARTRLSRTALWRLAGDAIAGRFLDSGRRFGSVEAAKASAMQILKVPGSPLANRQLH
FT                   YFDLSVLDNNQQEFSYTFRQRGGCCRFYLVKGGEYCPTCVLKAPTDRDEELRLAMRQHL
FT                   GVADEIRSGSN"
FT   gene            complement(253238..254032)
FT                   /gene="grsT"
FT                   /locus_tag="Avi_7295"
FT   CDS_pept        complement(253238..254032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grsT"
FT                   /locus_tag="Avi_7295"
FT                   /product="thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7295"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39974"
FT                   /db_xref="GOA:B9K526"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9K526"
FT                   /protein_id="ACM39974.1"
FT                   /translation="MTITPSRPVLLCLPPAGTGAGLFRNWVQTAPSTMTVHPVALPGRE
FT                   ARYCEPAPRSIDALADQLAVELEPYIGGRYAIFGYSMGALLGYEIARRFSAAGLPMPEV
FT                   FFALGCNAPDRMVYEREPFHTMEADAFRQALIDLGGTDAEILNNPEAMELFEPLLRNDF
FT                   RICETYTHDATRGTLDCPVHIFLSDGDAFVNRQAAAAWCDFVTGGTRLHPVAGAHMLER
FT                   PVLDTLPARLATLWFGTGENRLQHRSEKWEPVFGKSDAKTRI"
FT   gene            complement(254029..255603)
FT                   /gene="mcyB"
FT                   /locus_tag="Avi_7296"
FT   CDS_pept        complement(254029..255603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcyB"
FT                   /locus_tag="Avi_7296"
FT                   /product="microcystin synthetase B"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7296"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39975"
FT                   /db_xref="GOA:B9K527"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:B9K527"
FT                   /protein_id="ACM39975.1"
FT                   /translation="MPQTALRITGAVDAEALKAAWQGAIDRHPILRSGFFWEERDEPFQ
FT                   IAFRSLPVAFTTLDWTGNDPASERERLQALFSANRAEPFDLRRPPLIRVQWISTGQDQS
FT                   IMVVCYQHIILDGWSIRQLLDEVLSLYRRAAGKAEPALPPARPYGDYIGWLKKRERAVS
FT                   LRFWKDRLQGFAGTTRLLAGDATGQFERQCREVPKPLHEAVLAYGAAHGLTLNTLLQGA
FT                   LSLLIARQTGSRDLIFGTTTAGRPVTLEGATTMIGLFINTLPVRVRLNEGLSVSDWLAT
FT                   IQKAHAETGEHDHVPLAAIQGPGVSLFDTLLVVENFPVQAKRADAPALLKTEGIDFDER
FT                   THFPLTLWATPHTAGLTLMAGFSRDMLASETAAALLERLGDIIAIMIRSSTTDVCAILD
FT                   ELPSVMAVAGLSEGGSGDRTHLMPTKQAPSGIPKSATPSATEITLAQIWTEVLKSGPLD
FT                   GQANFFELGGHSLLAVRVASRLRGAFCVPVPMRVLFEHPVLADLAAYIDSLRPQVPPAT
FT                   DHIEIDI"
FT   gene            complement(255728..263449)
FT                   /locus_tag="Avi_7298"
FT   CDS_pept        complement(255728..263449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7298"
FT                   /product="peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7298"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39976"
FT                   /db_xref="GOA:B9K528"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B9K528"
FT                   /protein_id="ACM39976.1"
FT                   /translation="MNELFAKIAGLSPERRALLEQKLKAQGITFPAPSGIQPRTDREAA
FT                   VPLSSAQKRLWFMQQLEPGTVAYNMNLALRLKGPLDRAALSRAYAALIARHEPLRTRFT
FT                   MGEDGQPQQIVEASGAADIGYHDCRQHPDPEKEARLQLKAFVETPYDLTRPPIRATLVG
FT                   VHEHEHVLALGMHHIISDRWSMGVFARDLSTLYHAEATGTAAVLAPLPVQFADWTLWQR
FT                   DLLDGPTLANQLAYWTESLAGELPVLELPLDRPHSLTASFSGAHLPVLIDRGLSLRLRA
FT                   LAAEQNVSLFTLLLAAFNVLLHLYTDSDDIILGSEVANRDRPETQTMMGPLVNTLVFRN
FT                   DLSGDPAFLVLLQKVADAVRRGLAHQDIPFERLVEAINPERSLSDLNPLFNVKFDIQHS
FT                   VAPPPGLHGLTIEAYPLREVATKYDLRFNLEDDQPDIKGKIEYSSQIFDESTIASMLAR
FT                   FERLLELVVREPSRRLSTLSLLAPEEEAAIIAAGSGPVRDYPVEECLHDLVLKQVEQTP
FT                   DADAVTDGDLTWSYRDLEAQSSRIAANLVAAGVKPGDRVGICMRRSPRMIAGILGIMRA
FT                   GAAYVPLDADYPPSRLVFIAEDSGITILLADHRPAFVTQAQTLLDVTTLPDIRLEARPA
FT                   VSPNHLAYIIYTSGSTGRPKGVAIEHRSVVAFMYWARERFTREEVARMLVPTSISFDLS
FT                   IFELYAPLVLGGTLVVADHFLALPQLASKVDVTFINTVPSLLQELLQEHRLPDSVQTAT
FT                   FCGEPLPAALVAILKRDYPNLRILNLYGPSEDTCFSTEVPLQGDHYQGGVVPIGKPLPN
FT                   TQAYILDRAGRLRPPGLSGELYLGGTGLARGYFGRPEQTAERFIANPFSSEPGSRLYRT
FT                   GDRIRRRADGNLEFCGRLDHQVKVRGLRIETGEIEHNLEQMEGVEKAVVAVTQGTDRQL
FT                   AAFIEPQDGVRLDETELRRALSEVLPVHMVPTLWCFLPRLPQQPNGKIDRAALPSLAAT
FT                   VATGSSPPETETEQRVADAWADVLAIDSISRDDNFFRLGGHSLLAMRMITRLSSSLPTN
FT                   AVLRKLFEFPRLKDFAAALERDETPMAAPSSTIDALPNSATIPLSFAQQRLWTLAELEP
FT                   DSAAYTVPAAIRFHGALDLEVLQHAFTALAARHPALRTQIVNRDGKPVVEIGGTNEPDI
FT                   AIVDVNEATLPEVLAAACRQPFNMATGPLFRARIFRLSADEHVVFVALHHIVSDAQSLQ
FT                   LMLRDLTRFYDAGRQGKVADLPPLTLTYGDFAAWQRKQPLGEQIDYWRRQLEHAPPLLE
FT                   LPTDFPRGARQEFKGGSIPFHLDSALTARLVNFAHERDATPFMVLLSAFSTLLSRYSGA
FT                   SDVVIGTPVSERPNRALEDVIGLFVNTLALKLTHDAATSFEQQVAATRLLVLDAFRHQD
FT                   APFECVVDALSVERSWSHNPVFQVMVTWQADEQHSPCPDDLTVTPVVLAQETSKVDLTL
FT                   DLRHRGDQFSGTLIYRSDLFRQETILHMAEAFTALVEALLSAPERAQIEIDGLPERQRQ
FT                   QIATWNATAKTYDAVPASLHGFFARSTERTPDAIAVTDRNRSVTYAELDRQAEALARHL
FT                   ASLGIGRGSAVGICLERNIDLIASILAVLKTGAAYVPLDPKYPADRIAFVARDASLSLI
FT                   LTKEERADFAEIKTLDPTAVWNGTQAVSGAPLPHTTEGSDLAYLIYTSGSTGQPKGVAI
FT                   EHRNAVAFTHWALDTFPAESFAGMLASTSVCFDLSIFEIFVTFAAGGRIFIVDDLFELP
FT                   DAHFANEVTFINTVPTPMTELMRFGPLPTKAKTVCLAGEPLPPSLARAILETGQVEALY
FT                   NLYGPSEDTTYSTGCRIDDAGLPIHIGKPITNTTAHVLDAALNEVPIGMPGELYLAGEG
FT                   IARGYHNRPDLTAERFLPNPFDSTGQAPLLYKTGDRVRRLADGNLDYLGRTDRQMKISG
FT                   FRIEPGEVEAVLMRYPGVTGAAVDAWRDNTGYARLAAWIEVAAPVGKAALSAHLSRELP
FT                   RHLVPTFFAMLDKLPRLPNGKLDRKALPDPSDEAKTLAEDQTPHKGHEEKIAAIWAKLL
FT                   GREAIGRNDNFFALGGDSILAIQVVAAARRIGIAIKPRDIFQYSTLAALAASVSDLATE
FT                   LHETGPMSGDIPLGPAQHWFFEQNYPDIAHWNQALMLRPRRVINEKTLQQAMDLLHQTH
FT                   DALRGRFWQQDGQWRQSVTELEGAPPLRSTSCTATEADAVLLVEANALQRRFDLTDGPV
FT                   WGATLVTIDGCEQRLLIAAHHLVIDGVSWRILLDDLQTCLTAFEAGLEMSLPPRTTGID
FT                   TWVRELKDSAVFDGEKDHWRTITEAKTAAIPTNRSGSNCAGDTDIVDLTIDPDLTGRLL
FT                   RDVPSCYPIDAEEIMLAALYNAIRDWTGHDRLRLILESHGRADLFEGVDLSRSVGWFTG
FT                   LYPVLFDVTGRDRRTTLLSVKESLRRVANDGIGYGVLKYLKGVALPQLEDIAEIRFNYL
FT                   GQTDTLFSGDALLSRAAEPSGDPRGARNGRGVLLDINAIISGGHLRIRLAYSRQIHDRQ
FT                   TIETLAAGLQNHLESLVDFCLTSTEAGYTPADFKHMTLDQDDLEAILRNL"
FT   gene            complement(263446..267846)
FT                   /locus_tag="Avi_7299"
FT   CDS_pept        complement(263446..267846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7299"
FT                   /product="polyketide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7299"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39977"
FT                   /db_xref="GOA:B9K529"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:B9K529"
FT                   /protein_id="ACM39977.1"
FT                   /translation="MNDLSAAPLSDDNRHHIAVIGMAGRFPGAPDVERFWQNLVDGAES
FT                   IERLSPEALKQRGVSAEMAALPDFVAASTPLAGADRFDAGFFGYSPAEAEILDPQQRIF
FT                   LECAWQALEAAGYVGDRTQGPIGVFAAAGINTYVFNLHDNSRIRETVSPYELFVGNDKD
FT                   FLATRTAFKLNLRGPAITVQTACSSSLVAVHMAAQSLLSGDCDMALAGGIALSQSSGYR
FT                   AREGGILSPDGHCRAFDAASSGTVPGSGVGIVVLKRLEDALADGDTIDAVILGSAINND
FT                   GALKASFTAPQVDSQAAVIADAQAMAGVRADTIGYIEAHGTGTRLGDPIEVAALTKAFR
FT                   RDTERRGFCALGSVKTNIGHLDTAAGIAGFIKAVLALKNRRIPASLHYENPNPQIDFAA
FT                   SPFFVNQRLRDWDNQIGTRRAGVSSFGIGGTNAHVVLEEAPPSPASKAGGGPELLLVSA
FT                   RTEEQLAASSEALAAGLDRADAPALADVAHTLRHGRRDFAKRRFVVARDAKEAASNLRN
FT                   LSQTATAEGETAQAVFLFPGQGSPYTAMGKALYADLPAFRAPFDACASKLDGLMGINFK
FT                   ACLFSNADDLDRTAFAQPALFAVEYALAQALMSHGVKPTALHGHSIGEYVAACLAGIFD
FT                   LETALQLVVARGRLMQAQAPGAMLAVMHADEPITPWLDEVITLAAANAHGVSVVSGPVE
FT                   AIASLQVRLKNKGIAGRMLKTAHAFHSPMMTEAAVQFRNVVAGVRLSVPQIPLISNVTG
FT                   TWMTAQDATDPDYWARHLLQPVRFEDGTRTLQALAAPVFIEIGPGRALGTLTAVAGVDG
FT                   SRILATLAEGKDESGQVLSAVGQFWQLNGVLDSVEASGRRRVRLPTYPFQSERYWVDAD
FT                   SEPATPKRTAAPAEGPGLYRTNWRRAQLSHGPNRLKGRVLVFDDGQLGSTLATELERSG
FT                   AEPYRALIGAGFSEPDFRCFSLRPTISEDYASLFETLAERGASPDHIVFGWPLTPCSNE
FT                   APEAAAQALLALVRELAKNDRAVTLTLLTRSAADVTGLEDLDIAQALVAGTLQVIAQEY
FT                   PSLHCRHIDIDAARPIESARRIRDALSGKDDVLALRGAHRWLPETERFDAPQGGPDFKR
FT                   NGVYVVVGDIVDGVGKTWVDALSGLGATVALLQDTTAPAFEYPARLKRQLDCGDAAALK
FT                   GALDDVFAELGRIDGIFLSLPQSNHQSAALIGELTDAHWAYNISSKLRPVRALGEAVAK
FT                   RKIGFCCVQSSLSTLVGGLGLGAYAATHHAIDRIVAEENKNGTTPWFAIGYPLIEAEPG
FT                   TTLQATGRANAFAISTEAAWDLTRCLIENGATGQTMLSGGTIPPVTSDIDAQEAAATDG
FT                   GRGRPALGVAYRKPGNDTEARIIGIFEEILGLSPIGADDGFYELGGHSLLAIRAVAKLR
FT                   EAFPVDIAMRELLFDNPTAAAIAKSILERMTEKTDLSALADLLDEVDTLSDADVSRLLA
FT                   GGNAR"
FT   gene            complement(267880..268440)
FT                   /locus_tag="Avi_7300"
FT   CDS_pept        complement(267880..268440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7300"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7300"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39978"
FT                   /db_xref="UniProtKB/TrEMBL:B9K530"
FT                   /protein_id="ACM39978.1"
FT                   /translation="MIALSPPSPYAIWREFHWAFFLNVQGLIVSLRRFQLSVERGQLTS
FT                   AEQELNTASTLLVSSAASMELAASFPKDVYEATVRTSMTQPHVESDDFSGLMSWDHAVL
FT                   ISVWRDLRPIFETLPDELASAHSAFIAAYKYLAESHTGVCSRFVDSGSLRFEDRNAVDT
FT                   LRRFERGRLGLIDPKGKGCPFHS"
FT   gene            complement(268437..269015)
FT                   /locus_tag="Avi_7301"
FT   CDS_pept        complement(268437..269015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7301"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39979"
FT                   /db_xref="UniProtKB/TrEMBL:B9K531"
FT                   /protein_id="ACM39979.1"
FT                   /translation="MSQYQRALDPDAAREESLAVESPVRGQITLKEVKASGPMEAPADD
FT                   GWLDLPLPDGLPAETPLSEIEKRRMHGVLSGLLEAIKLDHPQSTAQLDALLTDLGKAAG
FT                   ERPEIETAGLPLTPFQATDYDRYFRVNRQSAEEPAVAMVRSLIQTVRAVTQLFARSPEL
FT                   PVVHVRHQMEGFESHAHLLARTFGLEPLR"
FT   gene            complement(269252..270652)
FT                   /gene="mcyE"
FT                   /locus_tag="Avi_7303"
FT   CDS_pept        complement(269252..270652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcyE"
FT                   /locus_tag="Avi_7303"
FT                   /product="polyketide synthase and peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7303"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39980"
FT                   /db_xref="GOA:B9K532"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9K532"
FT                   /protein_id="ACM39980.1"
FT                   /translation="MNALTSNPTPAQAAAAIIAAFNMKTEKSKVASAQNRRVLSDKSAI
FT                   GVPFSLMAKEALYPIVVDRAEGTVLHDIDGNRYIDVLMGMGINLFGHNPPFIRDAIEAQ
FT                   LAKGFALGPQSDLAGETAALFCKLTGKERVTFTNTGTEAVMTALRLARAATGRHKIAMF
FT                   IGSYHGHSDQVLNRIAAPDDERTVPAFPGISPATAEDVVLLPYNDPRALDILERDGETF
FT                   AAVLVEPVQSRNIDVQPRAFLHALRDVTQRTGAVLIFDEMISGFRVAPGGAQQHFEVEA
FT                   DLATYGKIAGGGLPLALIAGSNRLMNHIDGGPWSFGDESVPPAQPTFFAGTYCRHPLAL
FT                   AAARAAATYMLQQGRSLQDDLNARTRSLVERLNVSLAAARLPVVFTQFGSFFSIAVNRS
FT                   RIPPLALGLLSLELLTAGIHLRSGDKGGFLSTAHSDGDITAIHDAFLNGLQSLAGFGLI
FT                   PLSDGTTP"
FT   gene            complement(270649..271539)
FT                   /locus_tag="Avi_7304"
FT   CDS_pept        complement(270649..271539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7304"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7304"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39981"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B9K533"
FT                   /protein_id="ACM39981.1"
FT                   /translation="MSRDMLEQASKYDHWAWLYNRTLGPRYGAYKIGPIERVVLPHVPA
FT                   GGAILDLCCGTGQLAAALSERGFNVIGLDGSADMLRYARENAPSVTFTEGDACNFTFDT
FT                   PFDAVLCTSASLNHMQSLNDLVFVFSSVSRALKPGGIFVFDVNHPAQMSRYWRGHPTEG
FT                   EINTDFAWLITPQYDSAANRGAFTVDIYRRPDAHPVSMLDRLFVRLAQFRRIRLALLSR
FT                   FSRLRPHWEHHSVVNRIWGHNLDAMSRALHESGFSVELRSTQGGPVDDSHAAYFFCRKA
FT                   PTAEKQAETAKETAL"
FT   gene            complement(271520..276040)
FT                   /locus_tag="Avi_7306"
FT   CDS_pept        complement(271520..276040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7306"
FT                   /product="peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7306"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39982"
FT                   /db_xref="GOA:B9K534"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR041464"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B9K534"
FT                   /protein_id="ACM39982.1"
FT                   /translation="MTAPETVEALLSRLSEKGIRITCVDGRLRLSGCESVLTQDITDAI
FT                   RARKAEIIANLSLDVAYQDATHSETIPARHADRPPLSFAQQRLWFVEQMMPEAGLHHIS
FT                   LAVEAHGSIDLSALQAALQAVAERHAILRTRINMRDGMPSQRIIADSDIPLQLIDRQGD
FT                   MPDEAEIDRIRQEEARRPFDLAFESPLRLTAIRLGPERTLLLLTLHHIAGDGWSMDVLL
FT                   GDLSAIYQAKVSGVELDLPALPIQYGDFAAWQRDHLAGPALERSLAFWTDHLEAPLPAT
FT                   QLPGDFTRPPVQANAGALHSIAFDAATTARLKALAKAEGATLFATLFTAFNTLVYRYTG
FT                   QRDLVIGTPVANRRHRETEGLIGLFVNPLPVRTRLHPAASFRETLRQSQATLWSVLDHQ
FT                   DLPFEQLVEALKPERDPSVHPLFQLKFQLDAQPSQRVGLSGLALTRLPRHDGVAKLDLS
FT                   LNLIDAGNTIHGTFEYDTALFRSETIASLAAHFGVLIEAIAIEPDTALAILPLLGTEER
FT                   QRQIVGWNATAKPFDEKAFFHTVFEAHAARKPDAIALVHVSDGKRRTLTYDALNRRANQ
FT                   IAHHLRGLGAGPETIVAIALERGFDMIAAWLGVLKSGAAYLPLDPAYPPERLAMMLSDS
FT                   QARLVLTESRRTLPETVTRIDLDTDWPRDAATGNPDLVNRPDHLAYIIYTSGSTGRPKG
FT                   VLVEHRGLVNLTQHKIRIGGVKPGDCVLQFFSFSFDASIPELVMALGAGASLLLLPASD
FT                   LLPGPALAEHMKTQAVTHVTMTPSALIALPSGDYPALRMVLTGGEAPTPELIERWGTGR
FT                   LFINAYGPTETTVNASMVPCGNGHPIEATLLPAANKQLYVLDANLEPVPVGQPGELHIG
FT                   GLGIARGYHGRPALTAERFVPDPFSATGGVLYRTGDRACQRADGRIRVLGRLDDQVKIR
FT                   GYRIEPGEIEAMVLTHPTIVAAAVVIHEIDGEKRVIAYGVAKEATTISAVDMKAFLAAH
FT                   LPRYLVPDAFVWLDRLPLTVNGKIDTKALPLLDLTPQAGRPPQGETENAIAAIFAQVLG
FT                   CPPVSATDDFFVIGGHSLLATRLSALAKSAFGLDIAIIDLFEAPTVEALAARISNRNHS
FT                   LMTEEEMCRADTELDAAIRIPAQIVSTHPLSHVFLTGATGFLGAYLLSELLKDKSRTVS
FT                   CLVRGVTGADRLRQSLQSYGLWRDDLAERIRPLPGDLSQQKFGLSDAVYTALGESIDAI
FT                   IHNGAEVHHLHPYQRLRAPNVGGTVEAIRLAAVGRGRPLHLISSLSALTRRGAGETIGE
FT                   SAVIGDFPLPAGGYNQTKWVAEHLAQAAKERGLPVTIYRPGAISGDSRTGTFNKADILC
FT                   RLMQGYLRSGLAPEGDTPLEMLPVDTVAHAIIALADEPSSIGQTFHLVHSSPVSSALLF
FT                   EAAAAEGLHLQRIPRLEWRAELDRIAREETDHPLYPLMGLFEQKPASSSQGTIRTVERR
FT                   ETHRALALASIVEPALDLRLFRSYLRAFILSGALNPSKENEQRYA"
FT   gene            276366..278633
FT                   /locus_tag="Avi_7308"
FT   CDS_pept        276366..278633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7308"
FT                   /product="polyketide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7308"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39983"
FT                   /db_xref="GOA:B9K535"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B9K535"
FT                   /protein_id="ACM39983.1"
FT                   /translation="MAVNDTSWTQRTSESSVDFISIIHMLEHRARDMEDDVAMRFFHDD
FT                   AVAAAQARPDSWTWRMLRDRARRVGQEIAQTGLVIPGARILVVYPPGLSFIAAFLGCLY
FT                   AGTVPVPVPAPRRADGINRWLHIAQDAGISGILCADDLLDGLRPLQRAVGHGFALAPKA
FT                   ADPARPVVFEDDGRPFHAPEAKHVAFLQYTSGSTSDPKGVMVTHGNLMANLRQISTAFE
FT                   YDPSDISACWLPHYHDMGLIDGILSPVFNGFPVALMAPASFLRRPLRFLELASHVRATV
FT                   IGGPNFSYEHCVDKYAPEAAAGLDLSNVRIAYNGAEPIRPKTLERFTAAFAPHGFHSRA
FT                   FYCCYGQAEATLFQTGNSPDDPPLILSVSRKALVETGAAVEADDGDEHDKLALAACGRP
FT                   AEGLDLALVDPEAGLRVDDGTVGEIWIRGPNVTPGYWGRAKLNAETFDQVLDGSRGWRR
FT                   TGDLGFRRNGQLYITGRLKDLVIIRGQNHHPEDIEQSVFSSHPALAQGRAGVFAIEVDG
FT                   EEQLGVVCELTREGLRDLDGDDVIRAVRGAVSRNHNVRAAVIALLRPSSLPRTPSGKVR
FT                   RFACRQGIVTGDLRIVARWDAKPQSVLNAPAIAEQRSWRDQLLEVPKALRKEALRHLLR
FT                   QEVAMLARLGEGDLPGNSAGFFDLGLDSVALVNIGATVERELGVPVRPTLIFEHPTILA
FT                   LSDHLYGLIEDDQSETVPLQDVKLQSNGPVAQTPPALASGSASVASSAITSELAALKAL
FT                   LR"
FT   gene            278797..283257
FT                   /locus_tag="Avi_7309"
FT   CDS_pept        278797..283257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7309"
FT                   /product="polyketide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7309"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39984"
FT                   /db_xref="GOA:B9K536"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:B9K536"
FT                   /protein_id="ACM39984.1"
FT                   /translation="MAGRFPGADDIDAFWDLLEQGQSGLRSVTDHELQEAGVDPTMAAR
FT                   PDYVRVWGGFDDPTAFDAGFFGYSPRDAELLDPQHRVFLECAANALDHAGYNSATYAGR
FT                   IGVFAGGALNYHFSQIQANPQLREATDPIHAGLGNVLGMIASRVAYHLDLTGPTVGVQA
FT                   TCATALVALHLAARGLLAREADMALAGAIAIGQPRPEGYLYKSEGIASPDGACRPFDAN
FT                   AKGTVFTNGVGVLVLKRLSDAIADGDTIHAVLSGSAIGNDGSAKVGLTAPSVAGQTAVL
FT                   QAALADARLDASEVDYVEAHGTATTLGDPIEIRALSSVYGDTLKQQGRRCGLGSVKGNL
FT                   GHMDVAAGMGGLIKTILALKHQILPASINFTSANPALDLAASPFDIVAQQRPWPVTELR
FT                   KRRAAISAFGMGGMNAHVIIEEPPVRDSEADTTGPYLLPLSAKTPEALAAMRSAVADHL
FT                   GTDDGAKLADIAYTLRQGRRTMEHRFVALAKDRDAAAQIIRSGEGPHCVAGEPLAGDAS
FT                   LILLFPGQGAQYPGMARALYETNATFRTAFDACLRLMPQELDLAAIIFGDGTTTEQLSR
FT                   TEITQPALFAIEYALAQMWLAKGIKPRAMVGHSLGEYVAACLAGVFSLQDAVTLIVARG
FT                   RLMQACPPGAMLSVMLSEQEARASLSPDVDLAAVNGPRSTVLAGTAEAIAELAARFDRS
FT                   GIGRQDLKTSHAFHSFMMEPALEAFAQVLGTVTLNPPQIDIVSNLTGDWLTAQEATDPA
FT                   YWVAHLRQTVLFGPCLARVLELPAPFLLEVGPGSTLTRLARQQGKAQLRVATSLPDAKA
FT                   LLDACDHALLALAELWIAGIDVELVAEKDAGPRRRVPLPTYPFQRSSYAIARIAPTESM
FT                   PDEAARQPSIEDWLYQPVWQRAPIEHLTTSGHEHWLILGGEETVAAIGPVSDQIKVTRV
FT                   RSGIAYENAGGTYHIDSADPQHYSAVLADLAANGATLTQIVNGFSLDANAAPDTAFASS
FT                   FALAKALTTTESRPPLLTVLACGLHAVTGAEVVDAQAAKVLGMLRVLSQEIPGISCRSI
FT                   DFPSAEGAIVPGLAEALSRPWRDDRTVMALRNGYCWVESHVPTCLPEPADVPALTAGAT
FT                   YLIAGDLLDGLALVYARSLVQTLGAKVVLVGPSGLPNAADWEHWLASHGPKHPVSALIR
FT                   ALRGIGTPGEDYVLFSGDLADPAWLATCLNSLGAPFGPIRGAFQTAAMGEVYHCPLTEA
FT                   TVERNAALFATKVDGLNALSAALADHTPDFVLVQSSLSTLVGGAGLAAYAGANSFLDAF
FT                   VDARRGAHRPVWQAIAWDTCLPFGTTREEATGFLNDAIDADEVWRATRAVLAQPQVSRL
FT                   AVTPVDLRHRMAAARQEPRAGVAVDQQENIGRERVQAAFIAPRDPIETDVAAVIGELLG
FT                   ISRVGIDDNFFELGGHSLLAVQVVTRLRKQFSIELPMRALLFDAPTVGGIAAVIRERLE
FT                   AARKEQAELAALLDDIEAEALRKEA"
FT   gene            283302..284369
FT                   /locus_tag="Avi_7310"
FT   CDS_pept        283302..284369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7310"
FT                   /product="monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7310"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39985"
FT                   /db_xref="GOA:B9K537"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR024011"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B9K537"
FT                   /protein_id="ACM39985.1"
FT                   /translation="MKFSLFYFDGDGSATNGDSYRLLMDSARFADDNGLSALWVPERHF
FT                   HAFGGLYPNPSMIHAALAMVTKRVQLRSGSIVLPLHHPVRVAEEIAVVDNLSQGRVGVA
FT                   IASGWTRNEFVLSREPHGSRRSLMWRSFDQVTKLLAGETLTFEDAEGNTVEAKTLPRPV
FT                   QPRVPFWVACQSMETFVEAGRRGINVLTALLGETLESLTPKIAAYRRSLEKNGFDPAAG
FT                   TVSIMVHTYLGGDVETVKANVKGPFSDYLRTHYHLLEGLARSMGLDIALENFSRDDLDS
FT                   LIEFGVEGFIKGRSLIGTPESTAETVEALGAAGIDEIACLIDFVQDYDLVMGGLPHLAR
FT                   LARQHAPQPTIAQVV"
FT   gene            284375..290926
FT                   /locus_tag="Avi_7311"
FT   CDS_pept        284375..290926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7311"
FT                   /product="peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7311"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39986"
FT                   /db_xref="GOA:B9K538"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B9K538"
FT                   /protein_id="ACM39986.1"
FT                   /translation="MPVNSADPILALRARVAALSPAEREAFRRQLEARGIAWERVAPEE
FT                   TPQETSRVSTRPARLPLTPGQKHFWLQQSLYPESSAYHVAYRWRFEGPLDRAALERSLA
FT                   TIVSRHAPLRTAFPVEAGEPWQEVHPDHAFALGFTDLEATGEDGEALALAVATEPFDLS
FT                   KAPLIRAHLFRQHESEHLLAITLHHIVADGWSRGVLMRELTACYRAYRMGAAPALSHIT
FT                   RDFGDLVLDQHAWLQRRDCGRDRDYWKQTLADLKPLELPSDRSRSSSVDMTAATVTRVI
FT                   PVSVSSQVASLASQLGTTPFVVMAAAFSLLLHRYSGERDLSVCVPVAGRDNPDAAGLIG
FT                   LFTNTLVLRAQLDPRMTFSQWVGAVQERFSDALDHQAFPFPLIAEALGMSRDQRQSPLS
FT                   QVMFQLQSQDYRAQNAEQIDFGIDGLIVRQQPARLSETKVDLSWYVMERESGYLLNIEY
FT                   RVAIFDAWRIERMAAHFEVLLGSILQSPNALLPRLAYLSKEEHATVVALGTPTARPVPD
FT                   ITMHDAIAHVARHQPDAIALESKGQSWTYGELQKDVDALTDTLVGLSVHPGDRVAVSLP
FT                   GRGQSVIAFLAILKAGAVYVPLDPDHPADRVAYMLEDSGVSLVLTDRADLYPAQRSLDP
FT                   TRPLPVSETPAALPPSDPARIAYLLYTSGSTGRPNGVPIAHASLLNHLRSMAVSPGLAP
FT                   GDRLLAITTPTFDISILEMLLPLSVGATTVLYGQDLLLAPQRLADVLVTDRISHLQATP
FT                   AYWRMLIDSGWEGLPHLIALCGGEALDAPLARKLIDRTKELWNVYGPTEATIWASALKV
FT                   THAHAESGKVPVGGLLDNTHLHVLDAYMQPLPRGIGGELYIGGPCLSPGYWNRPALTAA
FT                   RFVPNPFYDENSPALRLYRTGDAVVRLANSEIEFIGRTDFQVKLRGYRIEIGEIEDKLL
FT                   RESVVEQAIVTLDAENERLIAYVLVRDWPTTNDGEIERKLRQSLSAQLPRYMVPTAFVI
FT                   LEEFPLNPNGKVDRKQLPIPQLSTTRAEPIPARNAIEATLLEIWKAVLRREDIGIEDNF
FT                   FDLGGDSIIGVQIVAKAQAKGLKLEPTQIFELQTIAAQAIAAVAESAVHTIEVQAIEVA
FT                   ESGPSFEMTPVQAGMLFHSLMAPASGTYIEQCWCVLEGTLDADAFKSAWGRVIARHEVL
FT                   RGACRWTDVERPIMVIAEDVVPEWREADWSGEDAAGQETAFAAWLEADRRRGFTLDAAP
FT                   LLRFALIRLGPGRHRFVWSFHHLLMDGWCGSLLVGEMLKAYAGESLPAPPPSYRQYVAW
FT                   RDRQDITAAQAYWSHALADLPQGGFLGETKIGEAAQEAIIEIRRSLDASLATRLAAMAR
FT                   RERLTLATVLQGAWALLLSRYGAEDDVIFGTVLSGRPPDLPDADRMIGLFLNTVPFRAR
FT                   TRPEERVAEWLQGLQSAHRQREKHGHAALADIQRWAGKTADQPLFDTLLIIENLPLSMQ
FT                   AAFAEGTHTLTLSDPGSYERTHYPLSLRIFPGAEIEIALAADPSRLSSTKADRLLRHYE
FT                   TLLSSIADDPRACLGTIEMLKPDERDILLQTGRGPQTQPCAAVHDQIIARAKEEPGKAA
FT                   VVQVGEGRDSTMSYGDLAGYAEALALRLYQQGIGRGAVVAVYLRRGSALLPSLLAVMRS
FT                   GAAYLPIDPDYPAERIAYMLADSGAALVLTDLGDSERAVIPQDVPVLDPTEAFGCAQAS
FT                   FEPAAVQADDLAYILYTSGSTGQPKGVAITHGALANFIESMADRPGIGADDRLLALTTI
FT                   GFDIAGLELFAPLSQGATVLLADSAIARDGRRLAALVDRVQPSVMQATPAGWRMLIEAG
FT                   WRGSQELRMLCGGEALDSLLAAELLDRGDCLWNLYGPTETTIWSAATEVRREDLNGHSV
FT                   TVAGPIQNTQLYVLDRRGEPVPPGTPGELHIGGAGLSPGYWGKPGLTADRFIPNPFRRG
FT                   PQDGYHLYRTGDLVRLAENGALDFLGRIDNQVKLRGYRIELGEVEARLAAHPRVAEAAV
FT                   LVEDGGAGKQLIAYLRWREPFVGDASAELGPHVAGSLPLYMLPSAYVALDAFPLTPNGK
FT                   VDRRALPACRPKPAQRQTHLPISGEPAATLAAIWREALKIDHVNPGDNFFECGGHSLLV
FT                   VSLQGVIGKRFGVSIDITAFFQFPTLETLAAHIAQLQAGREGQWSGGDRTLLRQTGRDR
FT                   LAGRRGLRAERTGA"
FT   gene            290930..292306
FT                   /locus_tag="Avi_7312"
FT   CDS_pept        290930..292306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7312"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7312"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39987"
FT                   /db_xref="GOA:B9K539"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B9K539"
FT                   /protein_id="ACM39987.1"
FT                   /translation="MQTVETLGDAAPPRRPPSARTTKSLFRLSLPMFVHSLLTFLVMLS
FT                   EMLIMSAYSANAAAAVAIVRQVLQVVFEISSMVGIGAVILISHSLGRGDEEGARQIATL
FT                   AVFTNTLLGLLVGGLLFLGGPVALRILDVPASIVHDASLYLVLAAAAMVFNALATAAIA
FT                   CLRAFGSSRVIVMTGLFLSVIYIGATYVLVLGAGPIPPLGVTGAAYATLGSRIAMALMF
FT                   GLAVYCALGLRFASGPIRARLSLVRRMLVLAFPSVSDYIGYGFYQLVLLGFVAGFGVSS
FT                   VLSRTYVMLAMTFLILVVMAVSQGNEVLVGYRWGEGRRQDAYRQALRSSFAATLVTTTI
FT                   ALLFWLMSDQYLGLFGQGGEVLALSTYLLLLTIFIQPGFAFNTVLLHSLRAVGDVRIPV
FT                   LVSIGLTWGLGLPLAWLFCVQADYGVEGVWYALIIEETLKAGFMLSRWHGRGWMGNAIA
FT                   "
FT   gene            292394..292912
FT                   /locus_tag="Avi_7313"
FT   CDS_pept        292394..292912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7313"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7313"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39988"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9K540"
FT                   /protein_id="ACM39988.1"
FT                   /translation="MRLKRQSEIAIGILTVCAKSPSTKYPAQHLAQEVGATRDHAYQVV
FT                   ALLVRNGFLNSDRGPGGGLRLARDAKDIKLADVLRITQPELDGNAEEPEPGTLKGQPLL
FT                   DGIVAAASSFLVSLLDRFTVADLVASPDSSAIACLECSLVTSRPVRERLMLLPAPQLSP
FT                   VDDTLEADA"
FT   gene            complement(293638..294453)
FT                   /locus_tag="Avi_7315"
FT   CDS_pept        complement(293638..294453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7315"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39989"
FT                   /db_xref="UniProtKB/TrEMBL:B9K541"
FT                   /protein_id="ACM39989.1"
FT                   /translation="MSLGCYDIEMRTRNAAVLVVLFSHSTKHHFKSVDFPADVLSIADK
FT                   EDTYFTNTPDILANFIKDVSAPYDLVITIGGSKGGHGALYHGTLLARMIEKPVRVLAFS
FT                   PVVMLSDNPNDVLYVSYQKLMERAQTTPELAENLRQSTQVITADPPPNLTAFCIVGADN
FT                   HCDCVEASRLIGAHILTLPMHHHETVIPFLCDTSDARAVTKTVLVLYDRAAEEADVAHL
FT                   LEKGSVDKMIADLSRVPKQPRLDELTNLVIKGDASIVRQAVTTAGALQA"
FT   gene            complement(294618..294815)
FT                   /locus_tag="Avi_7317"
FT   CDS_pept        complement(294618..294815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7317"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7317"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39990"
FT                   /db_xref="UniProtKB/TrEMBL:B9K542"
FT                   /protein_id="ACM39990.1"
FT                   /translation="MRGFTLKTAYVTIKGLEAMRALRKGQAKIFNLTKGIRGQAHIVEC
FT                   SFAVQEVCNRAGSASVLSTG"
FT   gene            294871..295224
FT                   /pseudo
FT                   /locus_tag="Avi_7319"
FT                   /note="aldoxime dehydratase; Incomplete gene (pseudogene)"
FT   gene            295759..298083
FT                   /locus_tag="Avi_7320"
FT   CDS_pept        295759..298083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7320"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7320"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39991"
FT                   /db_xref="GOA:B9K543"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR041395"
FT                   /db_xref="UniProtKB/TrEMBL:B9K543"
FT                   /protein_id="ACM39991.1"
FT                   /translation="MSFYTQMKKSSKSQAAVAEIQRVKVSIADGKLAARANLDAVTGEA
FT                   REMLIAVNELLEASMQPMQKLGASIADMSGEHDKGDIDVRLPSEDFKGDFAVMAKGVND
FT                   MVGGHIAVKKKAMACVKELGLGNFEAPLEQFPGKKAFINETIETLRTNLKGLISEMNTM
FT                   SLEHDKGDIEVFVPVEKFKGDFAVMAKGVNDMVAGHIAVKKKAMACIKALGEGNFEASL
FT                   EQFPGKKAFINETIETLRANLKGLIFEMNTMSIEHDKGDIDIFVPVEKFKGDFAVMAKG
FT                   VNDMVSSHIAVKKKAMACIKALGEGNFEAPLEQFPGKKAFINETIETLRGNLRAITTEL
FT                   QRLIAASTAGKLSERGAADHFVGDFAKLVSGINGMLDAIILPISEGNRVLRQVSFGDLT
FT                   QHVDIECEGDHASMKNAINNMVDNLRNTATIADLIASGDLTVEPEPLSDKDTLGIALVS
FT                   MVERLRGVVADALAASQNVSAGSQQLSAGSEQLSQGATEQAAAAEEASASMEEMAANIK
FT                   QNADNAAQTEKIARQSSKDAEASGEAVNRAVTAMRTIAEKISIVQEIARQTDLLALNAA
FT                   VEAARAGEHGKGFAVVASEVRKLAERSQSAAAEISGLSGQTVQVATEAGGMLARLVPDI
FT                   RKTAELVSEISAACREQDIGASQINEAIQQLDKVTQQNAGASEEMSATSEELAAQAEEL
FT                   QASIAFFKVDIAGDVKMQASRNQSTKARPKSNISTKPAAMAHMSKPGHSVAGQQARVKG
FT                   WVLDMSMGGPDAEDSDFQERA"
FT   gene            complement(298934..299899)
FT                   /gene="asg"
FT                   /locus_tag="Avi_7322"
FT   CDS_pept        complement(298934..299899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asg"
FT                   /locus_tag="Avi_7322"
FT                   /product="asparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7322"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39992"
FT                   /db_xref="GOA:B9K544"
FT                   /db_xref="InterPro:IPR000246"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B9K544"
FT                   /protein_id="ACM39992.1"
FT                   /translation="MSNTQPSPFAIAIHGGCGVMNKADMPESEWEAARADLKRALKAGW
FT                   SLLQQGASALDAVEAAVMVMEDSEHFNAGHGAALNTDGEHELDASIMDGQTLEAGAIAM
FT                   ARTIRNPIRAARKLMHSGETVMLGASAADAFAQKSGLPMVEQSYFTTERRVKALASLKE
FT                   HAKAGTAALASEAEKHGTVGAVALDSHGHLAAATSTGGFNNKPSGRIGDTAVIGAGTYA
FT                   RDGVVAVSGTGKGEFFIRHAVGHEIASRMRYLGENLEDACQHVVFTDLAPHHIGAGLVA
FT                   VGADGSITAPYNTAGMFRGWINLDGHMVVASHDTLFEMHI"
FT   gene            complement(299936..300754)
FT                   /locus_tag="Avi_7323"
FT   CDS_pept        complement(299936..300754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7323"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7323"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39993"
FT                   /db_xref="GOA:B9K545"
FT                   /db_xref="InterPro:IPR007035"
FT                   /db_xref="InterPro:IPR027476"
FT                   /db_xref="InterPro:IPR036177"
FT                   /db_xref="UniProtKB/TrEMBL:B9K545"
FT                   /protein_id="ACM39993.1"
FT                   /translation="MKILISVDIEGVAGVYHPEQTRAGNGEYERARLLMTDEANAAIAG
FT                   AFDAGATEVFVNDSHGSFRNMPPDRLDPRARAIQGKPRYLSMMSGVELGVDGVCLIGYH
FT                   SRGQGFGILAHTINSFAFSRIFLNGQELGEAGIYGALAGEYGVPVIMGSGDDVFIAENK
FT                   DLFPKTVFVETKKASGGISGVSLSPSESCLAIREGARAAVEQARQMPKFTLTGPISVTI
FT                   ETQSTRLADLFCQWPTLARTGGNEVAFEAPSVEHAVRMINSLSAMSTMLR"
FT   gene            complement(300840..301742)
FT                   /gene="dppC"
FT                   /locus_tag="Avi_7325"
FT   CDS_pept        complement(300840..301742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppC"
FT                   /locus_tag="Avi_7325"
FT                   /product="ABC transporter membrane spanning protein
FT                   (dipeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7325"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39994"
FT                   /db_xref="GOA:B9K546"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K546"
FT                   /protein_id="ACM39994.1"
FT                   /translation="MSNTTSAPIAAAAQTSRAVRTPWSEFWRKFKRQPVALGALAFIVI
FT                   LMVLAIAAPVIAPYDAENFFDYDMINAGPSLSHWFGVDPLGRDIFSRILMGARISLATG
FT                   LLSVTLGGFIGTVFGLLAGYYEGWWDRVVMRICDVLFAFPGILLALGIVAILGSSMVNV
FT                   VAAVAVFSVPAFARLVRSSTLVLKNMTYIEAVRSVGASDFIILFRHILPGAFSSIVVYF
FT                   TMRLGTSIITAASLSFLGLGAQPPTPEWGAMLNDARADMVNAPHVALFPSLAIFVTVLA
FT                   FNLLGDGLRDAIDPKIDRK"
FT   gene            complement(301750..302670)
FT                   /gene="dppB"
FT                   /locus_tag="Avi_7327"
FT   CDS_pept        complement(301750..302670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppB"
FT                   /locus_tag="Avi_7327"
FT                   /product="ABC transporter membrane spanning protein
FT                   (dipeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7327"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39995"
FT                   /db_xref="GOA:B9K547"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K547"
FT                   /protein_id="ACM39995.1"
FT                   /translation="MFNYFLKRLFGLLPTLLIVAVLVFLFVHMLPGDPARLAAGQDADE
FT                   QTVALVRSELGLDKPLPQQFVEYFTRMLHGDLGVSIRTHRPVSVEIGERFMPTMLLTLT
FT                   SMIWSVSVGMIIGVFSAVFRNRWPDRLGMTVAVSGISFPAFALGMLLMQIFSVWLGWLP
FT                   TVGADSWRHYILPSITLGAGVAAVMARFTRAAFVDVIQEDFVRTARAKGLNEKVVIAKH
FT                   CLRNALIPIVTMMGLQFGFLLGGSIVVEAVFNWPGVGRLLVDAVNQRDYPVIQALVLMF
FT                   SLEFILINLVVDLLYGVINPTIRYK"
FT   gene            complement(302806..304359)
FT                   /gene="dppA"
FT                   /locus_tag="Avi_7328"
FT   CDS_pept        complement(302806..304359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppA"
FT                   /locus_tag="Avi_7328"
FT                   /product="ABC transporter substrate binding protein
FT                   (dipeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7328"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39996"
FT                   /db_xref="GOA:B9K548"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9K548"
FT                   /protein_id="ACM39996.1"
FT                   /translation="MKHRFSSRLASATVLAGILSMGAGQALAAGSVVLALNTQAETLDP
FT                   YNTNTTLTTAVTKSFYEGLFGFDKDLKVQPVLATGYTVSDDGLVYTIKLRDGVKFQDGT
FT                   DFNADAVKVNFDRVRNPDNKLSRFNQFNQIDKVEVVSPLEVRITLKQPFGPFINSLAHA
FT                   SAAMISPAALTKWGNKEIAFHPVGTGPFEFVEWKQTDYVKAKKFDGYWRKGFPKVDEIT
FT                   WKPVPDNNTRAAMLQTGEADFAYPMPYEQVATLKQNTKLTVTVSPSIIERYVSFNMLQK
FT                   PFDDLRVRQAINYAINKEALAKVAFSGFAKPAEGVVPEGVLYAHKIAPWPYDPARARAL
FT                   LKEAGYPNGFESTLWSAYTTTTAQKAIQFLQQQLQQVGIKVTLQALEPGQRVEWVQTAP
FT                   DPKTAKVRMYYAGWSSSTGEADWALRPLLATEAWPPKLSNTAYYSNPIVDDLIAKAMKT
FT                   TKEDEKKTFYADAQEQIMKDLPWAPLVTENNVSAAATKLEGVYVMPDGNIDSSDIALKQ
FT                   "
FT   gene            complement(304403..306283)
FT                   /locus_tag="Avi_7329"
FT   CDS_pept        complement(304403..306283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7329"
FT                   /product="ABC transporter nucleotide binding/ATPase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7329"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39997"
FT                   /db_xref="GOA:B9K549"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9K549"
FT                   /protein_id="ACM39997.1"
FT                   /translation="MTSSATLPQTAPSLLDNQVLAVDDLTVSFATSEGRVQAVRNISFA
FT                   VGRGETLAIVGESGSGKSVTSLALMRLIEHGGGRIDSGAMLFRPSNDKVLDLAKADTPT
FT                   MRSIRGADIAMIFQEPMTSLNPVFTAGEQIAESIRLHQKMNEASAKAEALRMLDLVRIP
FT                   EAKHVFGRYPHQLSGGMRQRVMIAMALACRPSLLIADEPTTALDVTVQAQILQLIRQLQ
FT                   DDMNMGVLFITHDMGVVAEIADRVLVMRQGEKVEHGASKDVFERPNHPYTQALLAAVPR
FT                   LGAMAGTDGPRAFDLVGADSTQTHAEQPPARFDLPPILKVRDLVTRFDVRRGLFNRVDR
FT                   SVHAVEKVSFDLHAGETLALVGESGCGKSTTGRSLLRLVNSQSGSVEFDGRNVLDLPAS
FT                   ELRGLRRSIQLVFQDPFASLDPRLTVGFSIMEPLLIHGIAKGEEARQRVAWLLERVGLS
FT                   AAHSERYPHEFSGGQRQRIAIARALALNPKVVVADESVSALDVSIQAQIVNLLLELQRD
FT                   LGISYLFISHDMAVVERVSHRVAVMYLGQIVEIGPRRAIFENPQHPYTKKLMAAVPIAD
FT                   PARRHLKRQFAVEDLPSPMRKKGDEPVVEALHEVSPGHFVARHSVGAFKM"
FT   gene            complement(306321..307262)
FT                   /locus_tag="Avi_7330"
FT   CDS_pept        complement(306321..307262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7330"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7330"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39998"
FT                   /db_xref="GOA:B9K550"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B9K550"
FT                   /protein_id="ACM39998.1"
FT                   /translation="MDIESVPSAQERMPMSQRIIQATLSPAHRQIADYVLDYPLRVAAM
FT                   RAEELAEIVHVSVPTVNRFARALGFAGYAQFRADLVLGYETALAPVEKLQRRSQAATSP
FT                   ADVFANNLAMITRNIERTHQALDTETLSRAIGLILSARRISIIGLGSSAWLGGLMQRRF
FT                   DLFCDDVRLLATVEGASFAARALRNVRAGDLVIAIAFPRYMADTVTLAKRMRDAGADVL
FT                   ALTDNASSPLVAHATMTLFAQVESDYFASCEASALALIESLSAAVSYASGRSMQAATQL
FT                   VDTVLPYLHSGPNHPHRASAKPSAEDDEPELD"
FT   gene            307726..308790
FT                   /locus_tag="Avi_7332"
FT   CDS_pept        307726..308790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7332"
FT                   /product="Transcriptional regulator/sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7332"
FT                   /db_xref="EnsemblGenomes-Tr:ACM39999"
FT                   /db_xref="GOA:B9K551"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9K551"
FT                   /protein_id="ACM39999.1"
FT                   /translation="MGRRVVRHQTVRPLEDRDAQGLSPEDIADHNGRTVSALLLREGPL
FT                   TRQELAARLKLTEPAITGILQRLLSAGLVSKGNRQTSTRYKAAEFSLVSSGAYGLGVER
FT                   CQNGGSLALCNLAGEMVLYQRFDQDEAFFAAVRQIVQAEMGFPAPIGVGVVMNADKDDA
FT                   FTTAFGELPSFTLSKPEAVLAGERLFGIGEPEGGLVVVLIDEQVQAGLIINGRFYRGTH
FT                   GRAGAIGAMRPGLAEGTLDVMASAASYRAFIAAQGENEVDRWIEQAASRLLDGVVTIAG
FT                   FISPGAMLLGGQLPADVIDRLIEKIADVRLGKERYFVPAAWIPPVRPLSFPDRDAAYGA
FT                   AVAPFIELLLPKPN"
FT   gene            complement(308759..309997)
FT                   /gene="xylR"
FT                   /locus_tag="Avi_7333"
FT   CDS_pept        complement(308759..309997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylR"
FT                   /locus_tag="Avi_7333"
FT                   /product="transcriptional regulator ROK family"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7333"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40000"
FT                   /db_xref="GOA:B9K552"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9K552"
FT                   /protein_id="ACM40000.1"
FT                   /translation="MSYSGANGEQAAALNRAIILNAIHRGGPISRTEIAKLSRLTKQAV
FT                   TRIVDKLLDEGLVMEARRRQGLRGQPAIELEIDPEGAFAIGANIDRDHLTIVAVDAVGN
FT                   VRGRIHHEARFLLPDAFVKLMEDAVSSFLRRKVIHESRLAGIGLAIPDWLGEVQVIGLP
FT                   DTYSQWNGFDVRAALSHITDHPIYIDNDANAAALGEIEYGLGTEMRSFFYILISACLGG
FT                   SLVIDGMRHKGAGGLGGEIGWLPTAVTTGPLAGETRPLGDMLSMFVLLDYLADNGVDVA
FT                   TPADLLTLDARGRALLSGWLKKMAVNLAEAVSDIGMVVDPDGIILGGRLPVRLIDELLL
FT                   YVHEEISRRGALAPSLHRAAASEDAAALGAAAMALADRLCLPSADSAHLSRSPLTTAIR
FT                   PASINSVLAAAVR"
FT   gene            complement(310077..313100)
FT                   /locus_tag="Avi_7334"
FT   CDS_pept        complement(310077..313100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7334"
FT                   /product="alpha-D-mannosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7334"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40001"
FT                   /db_xref="GOA:B9K553"
FT                   /db_xref="InterPro:IPR000602"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR011682"
FT                   /db_xref="InterPro:IPR015341"
FT                   /db_xref="InterPro:IPR027291"
FT                   /db_xref="InterPro:IPR028995"
FT                   /db_xref="InterPro:IPR037094"
FT                   /db_xref="InterPro:IPR041147"
FT                   /db_xref="UniProtKB/TrEMBL:B9K553"
FT                   /protein_id="ACM40001.1"
FT                   /translation="MSLTYTQRLERIEVRNAEFQFWRARKTVELTSWNFNGEPIAVGEA
FT                   WPHKTPPIGFTVDVTVPEGWPLADTYLYLNLGGESLLSITAQDGTTKRYGLDPYHREFA
FT                   APSQSFSLHAQSVPRLPFGEPVRAPKLERAELFWIDRSVDRMWLLMRQIAEALRVLEGH
FT                   DVVPYLLDAAEQAFYAIDWPSATADYVARTAPAVMQQKIWQLPDLKADPEGLTDAQRAK
FT                   LDQAYEALMARLGELRERFPPQGKVALTGHAHIDLCWLWPYDETRRKMRRTFHTALSIM
FT                   ETSKDFRFNQSTAHYYWQLEEDDPELLNKIVDRAKDGQWETLGGMWIEPDTNMPTGESL
FT                   TRQILYGQRYFEKRFGTRHSVCWLPDCFGFAGALPQLLKQGGMKSFFTIKVNWSESNHI
FT                   PADLFWWEGLDGSRVLAHSFDNPMEGYNGFVRPDCITPTWKNYRQKDRHDTTLLCVGYG
FT                   DGGGGPSPEMVVREEQLRVFPAIPEARWTRVHDFFEDAHAMAKTTPVSVWKGEIYLELH
FT                   RATLTTQSAIKKLHRKAERSLITAETLASLGHILGADKPRSMEPEWRVVLKNEFHDILP
FT                   GSSIAEVYVNAKVELEQVLMDGAAAQKAAVDAILSQLPEGNEGAVLVINPTLSPRPIRL
FT                   TLKDESIATNGVVPALGVSVLPASALDPKPGLKATQNTLENDIIKVTLADDGSIASILH
FT                   KASGREAVEGGANRLFAYTADKPRNWDAWDVEEDYGQKSEELSGHESIELVENTAHRAA
FT                   IRIKRRWRDSTIVQTLSLAANARRLDIFTEIDWHERRVMLRTENGVAVSAARATCEVAY
FT                   GVVERPTHSNTSWDEAMFEAPAHRFIDLSEPGFGMALLNDAKYGHSARGNVLGLSLLRS
FT                   PIYPDPLADEGYQSFTYALMPHEGTWYEGQVREEADDLNQPLIAIPVSGKAAGEWCPLQ
FT                   AAGLEVALSAIKPAEDGDGLIVRVYEPAGRRGGFQLKPSDGWTVSGALSILEEPMQAVD
FT                   AQALKPFEVKSWRLSKTA"
FT   gene            complement(313134..313976)
FT                   /locus_tag="Avi_7335"
FT   CDS_pept        complement(313134..313976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7335"
FT                   /product="ABC transporter membrane spanning protein
FT                   (sugar)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7335"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40002"
FT                   /db_xref="GOA:B9K554"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K554"
FT                   /protein_id="ACM40002.1"
FT                   /translation="MKTRTSERLGDLLSYIFMAITFAFFAWPLLWLLSLALRTRKEVFL
FT                   GVTRFIPKAPTLDNFAMILSSDKFISYLWNALKLSCLSAAGCLIVALPAAYAFSRFQFK
FT                   GKGAWMMALLSVQMISPLVIMVPLYRYMAAMGLLDSHFGTTMVYVALAVPVSTWILKGS
FT                   IDGIPKTLDEAAMMDGCTRFGVFIRVILPLSTPGIASAFIIAVISGWSQFLVPFLLITK
FT                   ESLTPIGVGIFQYAGTQNDSSIQLLAAACLVSVVPAIIAFLSLQRLILGAMTAGAVKG"
FT   gene            complement(313973..314815)
FT                   /locus_tag="Avi_7336"
FT   CDS_pept        complement(313973..314815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7336"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7336"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40003"
FT                   /db_xref="GOA:B9K555"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K555"
FT                   /protein_id="ACM40003.1"
FT                   /translation="MPLILVLGIFYLYPVLDVARLAFTRATLLGDDGGYTITTLINTLT
FT                   RAEIPQILWVTLTFTAGSVLAQQLLGLVIALVVVRAERRGLFGATILRTTALIAWVVPG
FT                   IAGGIIWKMLFNEAPFGGLNSLLRLVGAGPVQWLSDPNLVMWSVVLSNVWRGTAFSMVV
FT                   MYAAIKAIDPVLYEAAAVDGARADQRLRYVTLPQLKSAILVNLILITIQTLNTFDAIIS
FT                   LTGGGPGRVTEVLSLYTFNVVFRNYDLAAGAALSILMLVISLTLALIYAAFLPKGDDQ"
FT   gene            complement(314967..316262)
FT                   /locus_tag="Avi_7337"
FT   CDS_pept        complement(314967..316262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7337"
FT                   /product="ABC transporter substrate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7337"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40004"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B9K556"
FT                   /protein_id="ACM40004.1"
FT                   /translation="MKKNRHALTLVALLVAPVGGNANEMITGDTVGPADAPNKMTFRMT
FT                   TDGPRNNDPVVAEGYGKLFNQFIAKHPGWRIELQMMTGDISQEQARMVEQAKSGNAPDC
FT                   AAVDSFVLPVFKKAGVLKSFSPYFTKEEIDQLFPFIREGVTGADGQIYAWWWSTDLRVL
FT                   YRNKEIIPDAPQTWDETKKAALHSVKEGMEGILFNGSRYEGTTFDWLANFWAQGGKLVD
FT                   ESGKPIFGEGAEREKFVKAVNYYRDLVESGAAPKRVATIGNYDDFNAAAAAGTTALFVG
FT                   GNWQYGQLQAALEPEELAKWTFSPLPGPTKDQRSTGTGGWTVASFASDPAKVKMCADLA
FT                   RDVYMGPANEVQGQLPTRADLYEKYKIFSSDINKAFSEALKVGQARPGAPVYPEISNQI
FT                   QIMMGKVLTGTQATDAAVDEAFKASLAAFDRH"
FT   gene            316447..317445
FT                   /locus_tag="Avi_7338"
FT   CDS_pept        316447..317445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7338"
FT                   /product="ABC transporter nucleotide binding/ATPase protein
FT                   (sugar)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7338"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40005"
FT                   /db_xref="GOA:B9K557"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9K557"
FT                   /protein_id="ACM40005.1"
FT                   /translation="MAVVRIENLCKHYGALEVIHGVDLEVGDGEFLALVGPSGCGKSTF
FT                   LRMIAGLEEVSGGDIFIDGVRINDLSPRERDIAMVFQNYALYPHMTVAENMGFALKLAG
FT                   HSVADINARVAKASEVLGLEPYLKRKPAALSGGQRQRVAMGRAIVRDPKVFLFDEPLSN
FT                   LDAKLRVQMRSEIRELQKRLNATTIYVTHDQVEAMTMADKIAVFNKGVLEQLGTPLELY
FT                   HRPANLFVAAFIGSPQMNLVSGEAAQRHSATTIGIRPEHLVLSQDHDAWTGAVVAAECL
FT                   GSDTFMTIDSALYGKLLIRTSGSHEPRIGEIISAKPMEGCLHRFDEAGRSI"
FT   gene            complement(317614..319251)
FT                   /gene="attR"
FT                   /locus_tag="Avi_7339"
FT   CDS_pept        complement(317614..319251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="attR"
FT                   /locus_tag="Avi_7339"
FT                   /product="transacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7339"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40006"
FT                   /db_xref="GOA:B9K558"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:B9K558"
FT                   /protein_id="ACM40006.1"
FT                   /translation="MSRDDQVNEEEASLRRNRLNILTWERNAQDIESATHQARLRQLQT
FT                   YAGATFSPGAYVAEKAEIHTDRLVMGAGSWIAGHALVRGDVELGENVSINAYACMSGRV
FT                   RVGNGVRIASHVSIIGFNHGFDDLETPIYRQPLTSLGIEIGDDVWIGANAVILDGARIG
FT                   SGAIIAAGAVVSKDIPPQAIAGGVPARVLRMRGKDTASTRKTEVVEAALAAIDAAASTD
FT                   WRAVVERYRIGDDYSAPDASGKPVTSIRHLCDAIEIAAAFGDIGSIFDVDATIARLQAV
FT                   QDPQTGLFLDPYRETQQPLHHDPIALYNVLAVGYALERLGSAPLHLFRFIERLSASDLV
FT                   QWLDGLPWQTRAWHCGATVDAIATAVHFNGRYFGADANRHSLFGWLSLNCNPASGLWGT
FT                   VTPEDGLLQPVNGFYRLTRGAHAQFGIPVPYPNAAIDSVIANYRAHEGFRGQGFNACNL
FT                   LDTIHPLLLCLKQTPHRRDEAMEIATGIILQLSTRWQSGQGFPFADGHPPGLQGTEMWL
FT                   TTCWLSAKLLNLSSSLSFKPRGIHRYRG"
FT   gene            complement(319257..321104)
FT                   /locus_tag="Avi_7340"
FT   CDS_pept        complement(319257..321104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7340"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7340"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40007"
FT                   /db_xref="InterPro:IPR016624"
FT                   /db_xref="UniProtKB/TrEMBL:B9K559"
FT                   /protein_id="ACM40007.1"
FT                   /translation="MVYDPAQANPLYGNPLRSRDDVAKALLDLFTPLLPYFSQGGARVR
FT                   LGASGAIFDHAAADLEGFARPLWGIVPFAAGGGDFPHWDLYRRGLTHGTDPQHEDYWGD
FT                   VSDRNQRLVELAAIGFALAMVPQHIWEPLDDAAKATVSAYLLHARDREYVDNNWKFFRV
FT                   LVDLGLERVGVEFDHTKTIAYLDELEGFDIGDGWYRDGPVRRVDHYIPFAMHFYGLIYA
FT                   VLANEDDARKTRLRDRATVFARDIRHWFGPDGAALAFGRSQAYRFAAGGFWGALAFADL
FT                   DALPWGEIKGYYMRHIRWWSALPIADRDGVLSVGYGYPNLLMSESYNSPGSPYWALKFF
FT                   LPLALPADHPFWLAPETEAPSFNAPVPLEKPGMVAMHTPGNIVILASGQEHDKMRGSNE
FT                   KYAKFVYSTRYTFNIEANDRHFDAASFDGMLGLSDDGVHFRMRETLEEAMIADDRLYSR
FT                   WKPWADVTVETWLVPQNPWHIRIHRIATPRSLMTSEGGFAIARADFSRDRMEESAGRAV
FT                   WFGQTDISTIVDLSDHQRIGRAHVPIANTNLLWAKTNLPQLRGAVEPGQTVLVTAAFAL
FT                   PLGRAADEALAAPPTCPDLEVLEQQFRDVGRRVAAFDIG"
FT   gene            complement(321179..322459)
FT                   /locus_tag="Avi_7341"
FT   CDS_pept        complement(321179..322459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7341"
FT                   /product="sugar ABC transporter sugar-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7341"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40008"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B9K560"
FT                   /protein_id="ACM40008.1"
FT                   /translation="MYRQKFGISLTIAAAALGMVTVMAGGAFAQSAAPVTLKWALWDWD
FT                   KVAYYKPLIEAYQAKHPNVKFEPVDLGSQDYTQMIATQLTGGAKDIDVVTIKDVPGYAT
FT                   LVRANSIGDLSGFMTEQKIDKARYGGLIEELSIDGKVYAIPFRSDFWVVYYNKDIFDKA
FT                   GVSYPTNDMTWTQFDQIAVKLKGGMGVNKTYGALLHTWRSTVQLPGIMDGQHTLVGGDY
FT                   AFLKPWYERALKLQKEGAIPSYASLKTSNTHYSALFFNGTVGMLPMGTWFIGTQIAKVK
FT                   SGESKSKNWGIVKFPHPDGVAAGTTAAQIAALSVNNNSAHKDVALDFIKFVTGPEGAAI
FT                   IADTGTLPAVRTDDVSTKITSLPGFPQDENSKAALKAGKSYLEMAVSPNAAKIEVVLNR
FT                   VHDAIMTDNTSIDDGLKEMNDGVKAIK"
FT   gene            complement(322509..323219)
FT                   /locus_tag="Avi_7342"
FT   CDS_pept        complement(322509..323219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7342"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7342"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40009"
FT                   /db_xref="GOA:B9K561"
FT                   /db_xref="InterPro:IPR006938"
FT                   /db_xref="UniProtKB/TrEMBL:B9K561"
FT                   /protein_id="ACM40009.1"
FT                   /translation="MQWLEAIWTKEGKGIAKDAPKRTGVALFCEIIGREWWELVKLNLL
FT                   FLVAALPVVTLPAALFATASMCRAMVEDRNVYLLRDFAEAFRRYLAVATGWGLATGLAL
FT                   WIGSCAILTYGAQVRDSLIYAGPLAVSLVATGFVGVWSVHFIVLAVMSKRGVLEILRLS
FT                   ALATLLRPLPTVAALVFVAALWLVHVLLYPVSVFMPAMINFSLGMFAVSFAAHRAAALV
FT                   LAEPDAAYRTTKIS"
FT   gene            complement(323232..324341)
FT                   /locus_tag="Avi_7343"
FT   CDS_pept        complement(323232..324341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7343"
FT                   /product="ABC transporter nucleotide binding/ATPase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7343"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40010"
FT                   /db_xref="GOA:B9K562"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:B9K562"
FT                   /protein_id="ACM40010.1"
FT                   /translation="MASISLKKLNKSFGALKVVHDIDLEIADKEFIILVGPSGCGKSTT
FT                   LRMIAGLEEISGGQLLIGEDLMNDVPSKDRDIAMVFQNYALYPHMTVYKNMAFGLELRK
FT                   APRDVIETKVQEAAKILDITHLLNRKPKALSGGQRQRVALGRAMVRNPEVFLLDEPLSN
FT                   LDAKLRGTMRAEISKLHKRLNATFIYVTHDQVEAMTMADRIVVMKDGHIQQVDTPQRLY
FT                   DHPINMFVAGFIGAPQMNMLPSTIRRQEDGFVAVFNDHALPLPNTFDQSRIAPYLDRDI
FT                   ILGIRPENFHELAPGDIDPANTAPFEAVVELAEPMGSEVHLNLVVAGRSVVARVSPRFK
FT                   ARLGEQVRLTADMTNAQLFDPQTERSILY"
FT   gene            complement(324356..325528)
FT                   /locus_tag="Avi_7344"
FT   CDS_pept        complement(324356..325528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7344"
FT                   /product="Unsaturated glucuronyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7344"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40011"
FT                   /db_xref="GOA:B9K563"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010905"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:B9K563"
FT                   /protein_id="ACM40011.1"
FT                   /translation="MNAMFSNAPQPITDQQVTMALEIAVAQVRRNLPDFTYAAQNHSSV
FT                   GNRYPAVANDQWTAGFWPGEIWLAYEHSGDKVFRYAAQIQVQSFLHRIENRIATDHHDM
FT                   GFLYSPSCIAAWKLVGDEDGRKAALLAADQLIERYQPIGQFIQAWGAKGNPNEYRYIID
FT                   CLLNLPLLYWATGETGDEKYREIALSHARTTLAHSVREDCSTYHTFYMDPTTGAPVRGV
FT                   TKQGYSDDSFWARGQAWGIAGMALSYRYERIAEYRDAFERLLGFYLQRLPDDLVPVWDL
FT                   IFSAEDGEPRDSSSASIVACGLLEMADLVEDADAARYRDLARRMMKSLADHYAVKDPAL
FT                   SNGLVLHGTYSKKTPHNTCRGEGVDECVSWGDYYYMEALTRLSRNWSSYW"
FT   gene            complement(325533..326369)
FT                   /locus_tag="Avi_7346"
FT   CDS_pept        complement(325533..326369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7346"
FT                   /product="ABC transporter membrane spanning protein
FT                   (sugar)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7346"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40012"
FT                   /db_xref="GOA:B9K564"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K564"
FT                   /protein_id="ACM40012.1"
FT                   /translation="MRIAGRRINVSTIAIYATVIAVTIIMLLPFAWMLSASLKLDRDVF
FT                   VFPIEWIPAHPRWQNYVDIWTKIPLALFIYNTSKLTIIVTLLQLLTSSFAAYAFAKLHF
FT                   PFKNTLFLGYIATIAMPWQVYMVPQFLLMREFGLNNTHLALICLQAFTAFGVFLMRQFY
FT                   MSIPTELCEAARIDGMNEYQIWAKIMLPLSKPALSTLTIFTFVTTWNDFLGPMIYLTKT
FT                   ELKTIQIGLRMFISQYSAEYGLIMAASVVALIPVLIVFLALQRFFVEGVASTGLKG"
FT   gene            complement(326373..327335)
FT                   /locus_tag="Avi_7347"
FT   CDS_pept        complement(326373..327335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7347"
FT                   /product="ABC transporter membrane spanning protein
FT                   (sugar)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7347"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40013"
FT                   /db_xref="GOA:B9K565"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K565"
FT                   /protein_id="ACM40013.1"
FT                   /translation="MTVISPVLSGGSAENGKDASSKRRVRIVSKRRRRIENALIAYSFI
FT                   APNFLGFAVFTLGPILFAFVLAFMHWDGSNPITFAGLDNFWRLFEDKTFISAFWNTVIY
FT                   TVISVPATLACALGLAILLNQKIRGRDFFRTAMFFPYVASLVAVAVVWNMLFNPEMGPV
FT                   NMLLYTLGLDPNDMPGWAADRHWAMVTVILFGIWKSMGYYMVIYLAGLQGINAELYEAA
FT                   GLDGANGWQKFRHVTVPQLAPTTFFVTVMLTIQSFKVFDQVYMITQGGPGTSTLVLVYH
FT                   IYNEAFISWDLGYSSMIALVLFFLVLAVTVVQFRRQRED"
FT   gene            327547..329352
FT                   /locus_tag="Avi_7349"
FT   CDS_pept        327547..329352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7349"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7349"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40014"
FT                   /db_xref="GOA:B9K566"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="UniProtKB/TrEMBL:B9K566"
FT                   /protein_id="ACM40014.1"
FT                   /translation="MFSKHIGSLPPHLADFQPAAAADVHALLQRLGVEHLTALKAAGRT
FT                   ALEAEWPQIFASRYRDYTQTGNRSRFEDLYFRRRLMLNDLVLAECAKDTGEGGDDFIDA
FT                   IIDGVILICEESGWQLPAHNAYGRGGPRQPLPDPDDPVVDLFAAETAANLATLVWLLRP
FT                   ALAQRDPRLPARIEQEIHRRIITPYLTRHFWWMGQGNERMNNWTAWITQNVLIATFSLP
FT                   TSQEIRRAVLVKALGSLDAFLKDYAEDGACEEGVLYYRHAALCLFGAMTVLDQVVPDLC
FT                   RPLWQAAKIRNMAEYILNMHVSGRHYFNFADSSAVLEPCSIREYLFGKAVGSKALMDFA
FT                   AADLQQSADPLLSKEWNLWHRLMAATRLPDVKPAPAKPAAKGDIFYPGTGLFIARDNRF
FT                   DLAVKGGHNGESHNHNDVGSLTLYKNGQPFLIDIGVETYTAKTFSPQRYEIWTMQSAYH
FT                   NLPTFAGVMQQEGPECAARDVETAFEVEEARISLEIAAAYPKEAALCSYRRSVRLIRGS
FT                   HVEIIDEHDGDKPAVLSLMTCVAPRSQAGRLVLDGLGEISVSGAAEPIIEAIDIGDPRL
FT                   RQAWPERIFRILLPFETSRLSLTIT"
FT   gene            329364..330149
FT                   /locus_tag="Avi_7350"
FT   CDS_pept        329364..330149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7350"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7350"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40015"
FT                   /db_xref="UniProtKB/TrEMBL:B9K567"
FT                   /protein_id="ACM40015.1"
FT                   /translation="MRVTLTVVDAAGQNLAQSSADHEAFLVYRQPYRDGDQLLVDVSEP
FT                   GHIRLALDAAMAPAILYLPQGRFSFSIPFGARKIAYPPHAFCGDLHRLHAAKARPEEIA
FT                   AQRNLAFNPLDDHANSQAFPHVEANVETRGEAAFAVRNVIDGERANSNHGFWPFTSWGI
FT                   NRDPQAALTLFFGRPVTLREVVLTLRADFPHDAWWESAVLSFSGGEEARLALVKSSAAQ
FT                   CFSLPETRTEWVRLHSLVKADDPSPFPALTQVEVWGTEA"
FT   gene            complement(330153..331007)
FT                   /locus_tag="Avi_7351"
FT   CDS_pept        complement(330153..331007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7351"
FT                   /product="transcriptional regulator GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7351"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40016"
FT                   /db_xref="GOA:B9K568"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9K568"
FT                   /protein_id="ACM40016.1"
FT                   /translation="MAFYRAVEFAYDSSYIFHLERRKRLCLLRQGMKVVDGVTGQVKTR
FT                   AKGAGSLVAQVSDSLRKAILGGDYAPGDRLPSEMELTEAHGVSRTVIREAVTGLRYDGL
FT                   VEVRQGAGIFVLNHHQSRSNPSKLDRARLSSDLEVLEIRTPLEIEAAGLAALRRSPAQE
FT                   EAIFDCHAKLLACIEADRSIREADLALHMAIAAATNNPLFTQFLEMHGASAIPQSKVVA
FT                   ENRAAEQTAYRRLIHREHQAVVVAISDGDEKAARAAMQDHLRGSQLRYRDLLRDLRGIG
FT                   SET"
FT   gene            complement(331026..331283)
FT                   /gene="ych"
FT                   /locus_tag="Avi_7352"
FT   CDS_pept        complement(331026..331283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ych"
FT                   /locus_tag="Avi_7352"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7352"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40017"
FT                   /db_xref="InterPro:IPR008893"
FT                   /db_xref="InterPro:IPR036930"
FT                   /db_xref="UniProtKB/TrEMBL:B9K569"
FT                   /protein_id="ACM40017.1"
FT                   /translation="MEKENNSPVQLRRIDPSQNMRRFYTLALQPTLFGGASVIRNWGRI
FT                   GTTGQTLIETFDRKEDAQRVLSRLERTKRKRGYHDAGRLT"
FT   gene            complement(331392..331832)
FT                   /locus_tag="Avi_7353"
FT   CDS_pept        complement(331392..331832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7353"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7353"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40018"
FT                   /db_xref="GOA:B9K570"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/TrEMBL:B9K570"
FT                   /protein_id="ACM40018.1"
FT                   /translation="MLKGIDPVLNAELLHALMLMGHGDQLVLCDINHPAETIAKHTTYG
FT                   KLINLSGCGLEVATAAILTLFPLDTFVEAPVKRMQVVGDPGGQVPIFSAIQRVVDNAEG
FT                   RPVKIDALERFAFYAEAKASFAIVRTSDPGPYGCFIFSKGVV"
FT   gene            332202..333254
FT                   /locus_tag="Avi_7355"
FT   CDS_pept        332202..333254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7355"
FT                   /product="ABC transporter nucleotide binding/ATPase protein
FT                   (sugars)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7355"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40019"
FT                   /db_xref="GOA:B9K571"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:B9K571"
FT                   /protein_id="ACM40019.1"
FT                   /translation="MNIVNVGKAYGSLRVIHGVSVEIPDGEFVVLVGPSGCGKSTLLRM
FT                   VAGLEPITFGDVVIDGKVVNDLPPKDRDIAMVFQSYALYPHKTVAENMGFALKMRGETK
FT                   SFIDERVRKAAEILDLVPYLARYPRQLSGGQRQRVAMGRAIVRDPKVFLFDEPLSNLDA
FT                   KLRVQMRAEIKELQRRLATTMIYVTHDQVEAMTMADRIVVLRDGRVEQIGSPLALYDAP
FT                   ANMFVAGFIGSPSMNLIKGHIRASTTPFFETEEGIRLPLNSAPAGSDGRAAFYGIRPEH
FT                   FVLGGDVTANVTVLESTGTETQVFARLGQQKVIGVFRERLAEPSGQMIAMTPNPAMVHL
FT                   FDGETGLRLE"
FT   gene            333642..335015
FT                   /locus_tag="Avi_7356"
FT   CDS_pept        333642..335015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7356"
FT                   /product="ABC transporter, binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7356"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40020"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B9K572"
FT                   /protein_id="ACM40020.1"
FT                   /translation="MGLNNQNLHNVLFRGFLKPWEDYTGAKITWIDLAQADYNPRLQQA
FT                   IATGTVDFDLLEMGAPFEGDVCGKGLASEMPDWVKAQIDMEDYVDYLKAPVGTWGGKVY
FT                   RVSVDGDCHNFNYRKDYFTDADLAKAWKAEGHAGEWGVPKTWQQVQEATKFLKGKTIAG
FT                   ADAIGYLDAPKAWGGFGFYFLGSRATAYAKHPDDKAWLFDIDTMKPRINNPAWVRAIQD
FT                   VVDALPSEAGDQLNADPGTTAFQQFLAGTGSMVSWWGDVGQSAQTSDSSVVGDTIAFDI
FT                   LPGSDDVYNAKTGKWETLASGPNYAPNMAYLGWGVYVMARVDKDEKKKKAAWSAAAHLG
FT                   GKDLALWTAAYPSGFQCYRKSQFDIKEWVAAGYEEAFISNYLASQSKSYNHPNAAIEPR
FT                   IPGIFQYYSVAEDELAKVFAGRVKPQEGADAIAAAWEKITDQLGRDKQISLYKASLGV"
FT   gene            335160..336269
FT                   /locus_tag="Avi_7357"
FT   CDS_pept        335160..336269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7357"
FT                   /product="ABC transporter membrane spanning protein
FT                   (sugar)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7357"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40021"
FT                   /db_xref="GOA:B9K573"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K573"
FT                   /protein_id="ACM40021.1"
FT                   /translation="MSDTTMPAIRPIEGASLRQTGARRGRLLLAVATVLLLGVLVLQIL
FT                   DAAGVTSLGLVSWRPLLYAYIVWAVALCAAQIMIRGEAGQRAVFVLPAVLFTVAMVVFP
FT                   TVFGLYIAFTDWNLSAAAGRRFNGIDNLRTLFADFYFWNALLNMVYYVLAVLVQYAIAF
FT                   GLALLLNAEIKARKFFRVAFLLPLMLSPVAVSWMIGKSLMEYRFGPAATLARHLGWDNP
FT                   AFFSTPWLARLSLMAMDAWVSIPFMMILLLAGLQALPTEIKEAAKVDGASGWQSFKEIT
FT                   FPLMLPVSVTVIILRIIFQLKLADIVINVTAGGPGGATDTVSSFIFREYRDRSNVGYGT
FT                   MLAEFYLVIIIIFVSLILKVTSRWLQRSN"
FT   gene            336280..337200
FT                   /locus_tag="Avi_7358"
FT   CDS_pept        336280..337200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7358"
FT                   /product="ABC transporter membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7358"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40022"
FT                   /db_xref="GOA:B9K574"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K574"
FT                   /protein_id="ACM40022.1"
FT                   /translation="MARNPTRHSGPETRFRRPRFMTGSLLIYTALVFWAFISLFPIYWT
FT                   ITTSFKTAVNVTQGHLIPFVDFTPDWKGWRSLGLSPDTIFVASTVRDEFMRRFFNSVVA
FT                   SAGASFLAVVIGSLAAYGLSRFSYKFLWLRNKDISFFFLSQLILPPVVLAMPFLVLYKH
FT                   LMLLDTLTGLVLVYTLMVLPIVIWIMRDQFDTIPVELEQAALVDGCSIWGAFMRIVLPI
FT                   ALPGMVAAFILSVILCWNEYFFAALLTSSNAKTLPVMVASQTGSQGINWWSMAAIATAA
FT                   IMPLVLVGIFLERYIVKGLTAGAVK"
FT   gene            337242..337697
FT                   /locus_tag="Avi_7360"
FT   CDS_pept        337242..337697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7360"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7360"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40023"
FT                   /db_xref="GOA:B9K575"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/TrEMBL:B9K575"
FT                   /protein_id="ACM40023.1"
FT                   /translation="MLKNLHPALNADVLHALRSMGHGDTLVISDTNFPSDSVARQTVLG
FT                   RPLSMANLSAAEAVRVLLSVLPLDTPLQNSAGRMEVMGAPDDIQPVQREVQVEIDRAEG
FT                   KPSPMYGIERFAFYDLAKKAYCVISTGETRFYGCFLFTKGVIPPAGA"
FT   gene            337708..338634
FT                   /gene="rbsK"
FT                   /locus_tag="Avi_7361"
FT   CDS_pept        337708..338634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsK"
FT                   /locus_tag="Avi_7361"
FT                   /product="ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7361"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40024"
FT                   /db_xref="GOA:B9K576"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B9K576"
FT                   /protein_id="ACM40024.1"
FT                   /translation="MGKGVSILGIFVADTAYLAARLPVVGETITGSGFSVGPGGKGSNQ
FT                   AVAAARAGEESSVSFISKIGCDAFGDLALKTYADAGVLPKLTIMDDQPTGAAFIYVNDK
FT                   TGDNAIIVYPGAAGTITIEDVEAARQTIETSAIFVTQLEQPAEAAHHGLMIARKAGVTT
FT                   IFNPAPAEPFPDAIYPLCDYIIPNETEAAALVGFPLDTIEDARRAGDVLMARGVDTAII
FT                   TLGSRGVLFHSADASVAVPAIAAGPVIDTTGAGDAFVGGFAAALADGLAPLDAVRFGCA
FT                   TAGIAVTRRGTAPAMPERSEIEALLRG"
FT   gene            338738..339718
FT                   /locus_tag="Avi_7362"
FT   CDS_pept        338738..339718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7362"
FT                   /product="xylose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7362"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40025"
FT                   /db_xref="GOA:B9K577"
FT                   /db_xref="InterPro:IPR001998"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B9K577"
FT                   /protein_id="ACM40025.1"
FT                   /translation="MTQLKFATRLNSFASCPKAEWPDLSGKPTMLQMVKRAAKVDGLTD
FT                   LDLNYPDHVGEDPAVLARQIGDTGLAINGFAMRYYTNSAFKIGAFTNPDPEVRREAIDL
FT                   TKAGIDAARAAGSRLMTLWLGQDGFDYAFQADYHTLWQHEIDGIREVCAHDPDCQISIE
FT                   YKPNEPRSYSLMPDAATTLLAIRDVDMPNLGVTLDFAHVLYADEQPAFAAALIARHSRV
FT                   LGVHLNDGYAKRDDGLMVGAVHTQQTIELLRQIRKDGYDGAIYFDTFPDMTGLDPVHEC
FT                   EVNIQTVKRMLRIVDRLDQDNRLSGAIDRQDAVSAQAIVQELMLG"
FT   gene            339924..340874
FT                   /locus_tag="Avi_7364"
FT   CDS_pept        339924..340874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7364"
FT                   /product="ABC transporter substrate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7364"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40026"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9K578"
FT                   /protein_id="ACM40026.1"
FT                   /translation="MDWSQLEAKFGPFPKLPDGTKAGAVSKTLTNEYWRSLGEGYAAFG
FT                   KAKNVPVAYQAAQSEGDQLGQLTIAEGMITQGYNVLLVSPQTDSNLQPVIEQAKAANIP
FT                   VVDVNDAVIPQAEHYVGNVQRDNGVRVAKWFITNRPQGGKVAIIEGQAGVYAAVQRTDG
FT                   FKSTIGENGSFKIVASVPGNWDRQTSYDAATNILNQHPDLIGFYANNDGMALGVVEAVK
FT                   AAGLAGKVAVFGTDGISDAYASIKAGELTGTVDSFPVLTGEVALETALRLVAGQKLPRV
FT                   VATPQALITADNLARYQGKGVDVRAVLMEDAKAAK"
FT   gene            340939..342459
FT                   /gene="rbsA"
FT                   /locus_tag="Avi_7365"
FT   CDS_pept        340939..342459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsA"
FT                   /locus_tag="Avi_7365"
FT                   /product="ABC transporter nucleotide binding/ATPase protein
FT                   (ribose)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7365"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40027"
FT                   /db_xref="GOA:B9K579"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9K579"
FT                   /protein_id="ACM40027.1"
FT                   /translation="MVPRLGFETISKSFPGVNALTDVSFDVAPGEIHGLLGENGAGKST
FT                   LLRILSGVFRPTSGSVFVDGEAVAFRKPLDARQAGIAMIHQELQQVPHLSVAQNMFLGH
FT                   SLTHMGGLFVSRREQEQRAAEALSMIDRSIDVSAPISSLKVAQRQIVEIGRALLDKAKV
FT                   IAMDEPTSSLTPSEFDRLAEVIADLSASGVSIIYVSHKMDEVFRICQRASVMRDGKLVG
FT                   IVDMKTTSEKQVIAMMVGRELMQETHHSFVTDQVRLQASNLSSATKIKNVSFTLKRGEV
FT                   LGIAGLVGSGRTELLRLIAGVDRLSEGSITIDGKSVSLRNPRDAIAAGIGLVPEERKRE
FT                   GIIPLRPVSLNMALASLPSFSAAGLIRTGKLRASAQDLLKRVNLRPFQLDRPIRLFSGG
FT                   NQQKAIIARWLAAKSQILLFDEPTRGIDVGAKSEIYQLIEALAREGHSIIVVSSELPEV
FT                   IRLSDRVLVMREGQIAAEIARDQLTESAILAHAIPGASAGATAIAHPA"
FT   gene            342479..343456
FT                   /gene="rbsC"
FT                   /locus_tag="Avi_7366"
FT   CDS_pept        342479..343456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsC"
FT                   /locus_tag="Avi_7366"
FT                   /product="ABC transporter membrane spanning protein
FT                   (ribose)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7366"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40028"
FT                   /db_xref="GOA:B9K580"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9K580"
FT                   /protein_id="ACM40028.1"
FT                   /translation="MTASSSAASQSVPTFRRFSVSLRDAGTLIGLIVIMAVFAALVPGF
FT                   LSERNLTNILQQSSINACLALGMTLVIISGGIDLSVGPTAAIAAVMTATLLLGGTPIPL
FT                   AILAGLGVGAVCGFINGVLVAYIGLQPFIVTLGTLSTYRAIALIFTGGNPVLGIPPGFR
FT                   ALFNGTLIGLPIPVLIVAGVSVAAWVLLKKTPIGEYLMAVGGNEEAAYVAGVPIARTKI
FT                   TAYVISGGLAALASLILIGRLGAAEPILGNLWELDAIAAAAIGGASLMGGKGSIVGTIL
FT                   GAIILGAMRNGLTLMNVQAFYQLLATGLIILVAMMIDRATRGRE"
FT   gene            343453..344328
FT                   /locus_tag="Avi_7367"
FT   CDS_pept        343453..344328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7367"
FT                   /product="transcriptional repressor of rpiB expression;
FT                   transcriptional repressor of ribose catabolism (RpiR/YebK
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7367"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40029"
FT                   /db_xref="GOA:B9K581"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B9K581"
FT                   /protein_id="ACM40029.1"
FT                   /translation="MNADGFDMKAVGPRIRMMMPMLTPLEAKVVDTVFGMRDFSEETSL
FT                   KQIAENAGVSEAMVVKITKKLGFSGFRDFRSSVSQYNRQPTTEMHQELSVDDTSLEIVQ
FT                   KVFRTSIHALEETLAILDMAAFDQAADMIHKARNRDFYGVGGSAQIARDVAHKFLRIGV
FT                   RASVFDDSHMMLMSAALLADTDVAIGFSHSGNTIAVIEALQLARKNGASTIAVTNYGSS
FT                   ALAQSADVVLCSTAQGSPLMGENAAARIAQLNILDAIFVAVAQRDYQAAERNLDRTMSA
FT                   VTSKRRDRLP"
FT   gene            344325..345224
FT                   /locus_tag="Avi_7369"
FT   CDS_pept        344325..345224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7369"
FT                   /product="ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7369"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40030"
FT                   /db_xref="GOA:B9K582"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B9K582"
FT                   /protein_id="ACM40030.1"
FT                   /translation="MTFSPIVTVFGSLHYDIAVFGPDRPRQGETVAGTSWHPKSGGKGG
FT                   NQAVSAAQAGVSTFMIGAVADDEFGRFLLENLKRRQVDDRFVRRDAVASTGHATGMSVA
FT                   IFDAQGDYGAVIVSGANLTLGDQDVAAAADLLGRTTVLVLQNEIPDAANVAAARAVRQA
FT                   GGRVLINAAPARALSADLQNLIDIIVVNAIEAEMLAGVPVVETLDGALEAARRLLANFP
FT                   DVVVTAGGAGVAYASRGGDEIVLPAVKVKVESTHGAGDMFIGVMAATLATGKSMRDALS
FT                   LANIEAAKLVATPEAERL"
FT   gene            complement(345322..346077)
FT                   /locus_tag="Avi_7370"
FT   CDS_pept        complement(345322..346077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7370"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7370"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40031"
FT                   /db_xref="GOA:B9K583"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:B9K583"
FT                   /protein_id="ACM40031.1"
FT                   /translation="MPRHPFTFQRGFKQRGEGLPIHAHDEAQLTFAASGMVQVHTEEGR
FT                   WLVPSQLAVWIPARVPHRVDVLTDADLWMVHWEPSAAQEWAPPVPLDQTFALRVTPLMQ
FT                   SLLEAAFMADVSREKGELVAKLMLHELTSTAHAPTFLPLPTSTIGLRVADMALTDHQSL
FT                   MSIDEFASRAATSVRTLSRLFPSETGLTFKAWRQRARIVQSMDLLAKGKPIARVAADFG
FT                   FSSAASFSHAFRQVTAMTPTQFMGVKPLA"
FT   gene            346190..347104
FT                   /locus_tag="Avi_7371"
FT   CDS_pept        346190..347104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7371"
FT                   /product="zinc-binding oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7371"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40032"
FT                   /db_xref="GOA:B9K584"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9K584"
FT                   /protein_id="ACM40032.1"
FT                   /translation="MKAIIINEYGDNSVLKYADVKDPEPKAGEVLVKVHAAGVNPVDWK
FT                   IRSGAGQRMGMTLPIHLGGEIAGIVEKLGPGVTEFNRGDGVYGVIKQGGFAQYAIANTT
FT                   DVARKPSTLDFIETAATPLGALTAWQAMFDVAKLSTGQHVFITNSSGGVGSLAVQLAKA
FT                   RGAHVTAMASARNEEYVRSLGADEFVDYTRQPFENSVRDMDVVFDTVGGETFKRAFTTL
FT                   RQDGFLVTAVAFPSDEDKQHGVGVARVQCVPNSQELTQIRELIEAGKVKPYVATVLPFE
FT                   SVKEALEFSEDGHTRGKIVLQIA"
FT   gene            347511..348617
FT                   /locus_tag="Avi_7373"
FT   CDS_pept        347511..348617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7373"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7373"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40033"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR025230"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:B9K585"
FT                   /protein_id="ACM40033.1"
FT                   /translation="MQWNWQLPDWPNFSYDIENMAPLEQRFLQSSGEVIGAVRHFSDDD
FT                   SNQLRIELLSDEAIKTSEIEGEFLDRASVQSSLRRQFGLNTDNRPVRPQERGIAEMMAD
FT                   VYKNWSGPLQHEDLFRWHSMLMAGTRYIETICAYRRHNDAMQIVSGRLDKPIIHFEAPP
FT                   SSQVAAEMALFIDWFNRSGPGGSVPLSALTRAAIGHLYFESIHPFEDGNGRIGRALAEK
FT                   SLAQNIGQPSLISLAFTIERDRKAYYCELERHQRKLDITGWIVYFSQTILDAQQATIDR
FT                   IAFFIQKAKFYDRFRDRLNERQEKVIARIFREGIAGFKGGLSAENYISITATSRATATR
FT                   DLQHLVEIGAFTRTGERRHTRYTLTLQS"
FT   gene            complement(348707..350341)
FT                   /locus_tag="Avi_7374"
FT   CDS_pept        complement(348707..350341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7374"
FT                   /product="ribitol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7374"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40034"
FT                   /db_xref="GOA:B9K586"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006003"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:B9K586"
FT                   /protein_id="ACM40034.1"
FT                   /translation="MIEAPDTIATGLERYIIGVDVGTGSARAGLFDLSGTLVAVAKHDI
FT                   ALFRETGAIAEQSSTDIWDAVCTVVRQVAEGVDDPAHVIGLGFDATCSLVVLGEGGKPL
FT                   PVGSSELAERDIIVWMDQRAVTQAEKINTIGHDVLRYVGGKISPEMETPKLLWLKENRP
FT                   DTFKSAWQFFDLADFLTWKATGDLARSTCTVTCKWTYLAHEQRWDPSYFHAIGLEELAD
FT                   EGFARIGQQIVEPGTPLGQGLTEAAAAAMGLRNGTAVAAGMIDAHAGGIGTVGIGSGPK
FT                   DNMAYVFGTSSCTMTSTVEPVFVPGVWGPYYSAMVPGMWLNEGGQSAAGAAIDQLLAFH
FT                   PAAPEAAAKAREQGVARPVLLAQAAAAKVNALPDVVHLAKGLHIVPEFLGNRAPFADPH
FT                   ARAIIAGLGMDRDFDSLVALYIAGLCGIGYGLRQIIETQAASGAFIERVVISGGAGESD
FT                   LVRQVLADACGKPVVAAGLDEPVLLGSAILGAVAGKAFSGVSQAMEALSGVTKTYHPQV
FT                   GALANIHKRRYSHFTTLQQQGRALRDV"
FT   gene            complement(350398..351126)
FT                   /gene="rdh"
FT                   /locus_tag="Avi_7375"
FT   CDS_pept        complement(350398..351126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdh"
FT                   /locus_tag="Avi_7375"
FT                   /product="ribitol 2-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7375"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40035"
FT                   /db_xref="GOA:B9K587"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9K587"
FT                   /protein_id="ACM40035.1"
FT                   /translation="MTDIMKGKVAAITGAASGIGLACAKILLAEGATVVLIDRAKDKLD
FT                   TLCAELGERAKPLVVDLLNGPEVSAMLPRILEVAGGLDIFHANAGAYIGGAVAEGDPDA
FT                   WDRMLNLNINAAFRSVHAVLPHLIAQKSGDILFTSSIAGVVPVVWEPIYTASKFAVQAF
FT                   VHSTRRQVSQYGVRVGAVLPGPVVTALLDDWPKAKMDEALANGSLMQPQEVAEAVLFML
FT                   SRPRNVTIRDLVIVPNSVDL"
FT   gene            complement(351152..352411)
FT                   /gene="xylH"
FT                   /locus_tag="Avi_7376"
FT   CDS_pept        complement(351152..352411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylH"
FT                   /locus_tag="Avi_7376"
FT                   /product="ABC transporter membrane spanning protein
FT                   (xylose)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7376"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40036"
FT                   /db_xref="GOA:B9K588"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9K588"
FT                   /protein_id="ACM40036.1"
FT                   /translation="MSNISNPEPKSSQALDRSDERVTHDDGVLAMLRSFINRIKSGDLG
FT                   MLPVAIGLIVISTVFSILNPVFLAPNNLVNLLFDCATVGIISLGIVCVLLLGEIDLSVG
FT                   SMSGLASAIIGVLWVNSGLPVVVAIFAALVTGAAVGALYAVMYNRMGMPSFVATLSGLL
FT                   ALLGMQLYILGPTGSINLPYASPLVRFGQILVMPHWLSFTLALVPGIVMVVFGLSVRKR
FT                   RQAVNLSSKPLSGLLIKAAILTLGFEFAVYYLNLGRGVPWMFALFVALVVVVNYLLTKT
FT                   QWGRSMFAVGGNREAARRAGINVRRIYMSAFMLCSTLAALGGVLSASRLASSSQQAGTG
FT                   DVNLNAIAAAVIGGTSLFGGRGSAYSALLGIIVIQAISNGLTLLNLSSSLRYMITGAVL
FT                   AIAVIVDSLARRSRVSHGRA"
FT   gene            complement(352408..353241)
FT                   /gene="xylG"
FT                   /locus_tag="Avi_7377"
FT   CDS_pept        complement(352408..353241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylG"
FT                   /locus_tag="Avi_7377"
FT                   /product="ABC transporter nucleotide binding/ATPase protein
FT                   (xylose)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7377"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40037"
FT                   /db_xref="GOA:B9K589"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9K589"
FT                   /protein_id="ACM40037.1"
FT                   /translation="MVQNDQAAPKTGGPILKLRNISKNFGAVSALTDIDLEVWPGEVVA
FT                   LVGDNGAGKSTLIKVLAGVHQPTSGTIEFCGENVSLDSPSRALELGIATVFQDLALCEN
FT                   LDVVANLFLGHELAPWNLDEVAMEVRAWTLLKELAARIPSVREPIASLSGGQRQTVAIA
FT                   RSLLLDPKIIMLDEPTAALGVAQTAEVLNLIERVRERGLGVIIISHNMEDVRAVADRIV
FT                   VLRLGKNNGVFTPDASNQELVASITGATENSVSRRLTRKTNSQETSAPDTRGRPA"
FT   gene            complement(353313..354359)
FT                   /gene="xylF"
FT                   /locus_tag="Avi_7378"
FT   CDS_pept        complement(353313..354359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylF"
FT                   /locus_tag="Avi_7378"
FT                   /product="ABC transporter substrate binding protein
FT                   (xylose)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7378"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40038"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9K590"
FT                   /protein_id="ACM40038.1"
FT                   /translation="MKFHSMMMVSVAAAAMFAGSALAQEKATVAFLMPDQASTRYENHD
FT                   FPGFKAEMAKLCAGCTVIYQNANGDTALQQQQFNSVIAQGAKVIVLDPVDSSAAAALVE
FT                   LAQSQDVKVIAYDRPIPKKAADYYVSFDNAGIGEAIAKSLVEHLKAKGVPQGSGILQIN
FT                   GSPTDAAAGLIRDGVHKGLKDSGYKTLAEFDTPEWAPPKAQEWAAGQITRFGADIKGVV
FT                   AANDGTGGGAIAAFKAAGVNPVPPVTGNDATIAALQLIISGDQYNTISKPSEIVAAAAA
FT                   KVTVQFLKGEKPEAKTTLYDTPSQLFIPAVVTAENIKAEIFDKKIQTPAEVCTGEYATG
FT                   CKKLGITQ"
FT   gene            354596..355639
FT                   /locus_tag="Avi_7379"
FT   CDS_pept        354596..355639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7379"
FT                   /product="transcriptional regulator LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7379"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40039"
FT                   /db_xref="GOA:B9K591"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9K591"
FT                   /protein_id="ACM40039.1"
FT                   /translation="MNQKKTAKKTTIYDLAELAGTSASAVSAVLNGNWKKRRISTQLAE
FT                   KIRRIAEEQGYALNMQASLLRREKSQIIGMIVPKYDNRYFGSIVETFEDMARSRGLFPI
FT                   ITCTRRDPELEVEAARTLLSYQVEWLVSTGATNPDRITEICTSAGARSINLDLPGTAAP
FT                   SVISDNFAGARELTRRILKNCHSKTGKAAPLLFVGGRATDHNTLERVRGFRAAHQDMGV
FT                   PIDERHILTCGYAPEKAEKALQTLAMVEGEIPGGMFVNSTISLEGVMQWLKTSGYVADR
FT                   LPAMGCFDWDPFVALLGGDIEMVRQDVDGMLKAVFEIIDTGISQTTFIEVPPLFSGQAN
FT                   AEVKITP"
FT   gene            356152..356562
FT                   /locus_tag="Avi_7380"
FT   CDS_pept        356152..356562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7380"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7380"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40040"
FT                   /db_xref="UniProtKB/TrEMBL:B9K592"
FT                   /protein_id="ACM40040.1"
FT                   /translation="MKVTIIAAALLFNATALAQAASCENNFKVSGVPMVTALSYRSWQE
FT                   YPKANSAVVLKKLAQAVAAEGFSGIKVNKELSSIDAFQETSGSGRIQTLRVVARQKGAG
FT                   VRVDAVFDIQPGQLTSKDVVRTGICKIIDSAI"
FT   gene            complement(356732..357940)
FT                   /locus_tag="Avi_7381"
FT   CDS_pept        complement(356732..357940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7381"
FT                   /product="permease"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7381"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40041"
FT                   /db_xref="GOA:B9K593"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9K593"
FT                   /protein_id="ACM40041.1"
FT                   /translation="MTDRTSQFNSAAIDLDTAEPVAWSPATWFAVLSMAATSFALVSAE
FT                   FLPAGLLTPMARDLGISEGTAGQVVTATAFVGAITALLSNVLIGRLNRKTVLVGLSGLA
FT                   IGSNILAAVATDFWLLMLGRAGLGIALSGFWALSVAVVARLVGANATGRGMAIVTLGVS
FT                   LATIAAPSIGALISDWLGWRSAMSMTAGLAAIAMLLQVICLPTLPASTSNSLSDVFRLT
FT                   RRRGVQLGMLAILLLMTGHFAGSVYVRPFLEQVTLLETGPIALTLLGFGVASVIGNVAG
FT                   GRMADASIHMALAVTAALMASAALALVLWGSYVGVAFSLVTLWGFAFGMAPVVLPTNLS
FT                   RSAPDALEAAGSLMVVSFQVAITIGAVVGGYVVDHYGAAGPLTLTAALAALTVVLALTQ
FT                   PRS"
FT   gene            complement(358001..358990)
FT                   /locus_tag="Avi_7382"
FT   CDS_pept        complement(358001..358990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7382"
FT                   /product="transcriptional regulator AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7382"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40042"
FT                   /db_xref="GOA:B9K594"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:B9K594"
FT                   /protein_id="ACM40042.1"
FT                   /translation="MSDHSSQRLSPSNIPMDALSEVLQDFRLSGVNYGRCELRHPWSIA
FT                   LPHQQLLRFHFVSQGPCWIHTEAQGWQELNDGDLVLLPQGIAHRLASAPDVEGDSLKSC
FT                   QIKRLSNKVCELVREGTGATSTLFCGSMALSAYALDPLIALMPPIIKGCDVAGNDPVIG
FT                   PLLAAMTAEASQPQMGSATILSRMADLLVARLIRCWVNCSGAATTGWLAAIRDPHLGRV
FT                   LAAMHRDPGHNWTLESLAGVAGQSRSIFAERFSAILGEGAARYLARLRMQLARELLGQG
FT                   GMSVAEVASRLGYESEASFARAFKRITTLSPGVVRRTVSGRTDMVFGF"
FT   gene            359928..360227
FT                   /gene="nrdH"
FT                   /locus_tag="Avi_7384"
FT   CDS_pept        359928..360227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdH"
FT                   /locus_tag="Avi_7384"
FT                   /product="glutaredoxin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7384"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40043"
FT                   /db_xref="GOA:B9K595"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011909"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B9K595"
FT                   /protein_id="ACM40043.1"
FT                   /translation="MSRNERRQRRLRRPFCGQKSKPNEDMMTITVYSKPACVQCSATTR
FT                   ALDRQGLDYHIVDISVDEDAYAKVQGLGYRQVPVVIAGDTHWAGFRPDMINALA"
FT   gene            360238..360654
FT                   /gene="nrdI"
FT                   /locus_tag="Avi_7386"
FT   CDS_pept        360238..360654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdI"
FT                   /locus_tag="Avi_7386"
FT                   /product="nrdI protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7386"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40044"
FT                   /db_xref="GOA:B9K596"
FT                   /db_xref="InterPro:IPR004465"
FT                   /db_xref="InterPro:IPR020852"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B9K596"
FT                   /protein_id="ACM40044.1"
FT                   /translation="MGLIVYFSSASENTHRFVGKLGLRASRIPVSPRSGNPSITEPYVL
FT                   IVPTYSGDDGKGAVPKQVIRFLNDADNRSHLRGVIAAGNSNFGETFCLAGDVISQKCRV
FT                   PYLYRFELLGTDEDVANVKYGMERFWMSQLSSAL"
FT   gene            360696..362777
FT                   /locus_tag="Avi_7387"
FT   CDS_pept        360696..362777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7387"
FT                   /product="ribonucleoside-diphosphate reductase alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7387"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40045"
FT                   /db_xref="GOA:B9K597"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR013554"
FT                   /db_xref="InterPro:IPR026459"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:B9K597"
FT                   /protein_id="ACM40045.1"
FT                   /translation="MLNLYDEDGKIQLDKDALAAKQYFLQHVNQNTVFFHNLREKLDYL
FT                   VDEGYYEQAVLDQYAFNFVRDLFDHAYVKKFRFPTFLGAFKYYTSYTLKTFDGKRYLER
FT                   YEDRICMVALTLAQGNEALARDMVDEIISGRFQPATPTFLNAGKKQRGELVSCFLLRME
FT                   DNMESIARGINSALQLSKRGGGVALSLTNIREAGAPIKQIENQSSGVIPVMKLLEDSFS
FT                   YANQLGARQGAGAVYLNAHHPDIMRFLDTKRENADEKIRIKTLSLGVVIPDITFELAKN
FT                   NEDMYLFSPYDVERVYGVAFSEISVTEKYREMVADSRIRKKKIKARDFFQVLAEIQFES
FT                   GYPYIMFEDTVNRANPIAGRISMSNLCSEILQVSDVSTYNDDLSYKTMGKDISCNLGSL
FT                   NIAAVMDSSDFGRTIETAIRALTAVSDMSHISSVPSIEKGNDDSHAIGLGQMNLHGYLA
FT                   RERIFYGSEEGIDFTNMYFYTVTYHAIRASNRIAAERGTSFKGFENSKYASGEYFDKYT
FT                   QTEWLPATRRVAELFETAGISIPTQEDWLALKEVVMASGLYNQNLQAVPPTGSISYINH
FT                   STSSIHPIVSKIEIRKEGKIGRVYYPAAFMSNDNLDYYQDAYEIGPEKIIDTYAAATQH
FT                   VDQGLSLTLFFRDTATTRDINRAQIYAWKKGIKTIYYIRLRQMALAGTQVQGCVSCAL"
FT   gene            362792..363781
FT                   /gene="nrdF"
FT                   /locus_tag="Avi_7388"
FT   CDS_pept        362792..363781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdF"
FT                   /locus_tag="Avi_7388"
FT                   /product="ribonucleoside-diphosphate reductase 2 beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7388"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40046"
FT                   /db_xref="GOA:B9K598"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR026494"
FT                   /db_xref="InterPro:IPR030475"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:B9K598"
FT                   /protein_id="ACM40046.1"
FT                   /translation="MNIQMKTNTPTQTKPVRAINWNRINDDKDLEVWNRLTGNFWLPEK
FT                   VPLSNDIPSWAALKPEEQQLTIRVFTGLTLLDTIQTSIGAPTLMEDSITPHEEAVYSNI
FT                   SFMEAVHARSYSSIFSTLCSTSDVDDAYRWSEENEFLQKKSALILEHYRNPDPLKRKIA
FT                   SVFLESFLFYSGFYLPMFWSSRARLTNTADMIRLIIRDEAVHGYYIGYKFQRGLEPLSE
FT                   EQRQETKDFAFDLLLELYDNEAKYTEALYDGVGLTEDVKKFLHYNANKALMNLGYEALF
FT                   PPEACKVNPAILSALSPNADENHDFFSGSGSSYVIGKAVATEDEDWDF"
FT   gene            complement(364029..364340)
FT                   /locus_tag="Avi_7389"
FT   CDS_pept        complement(364029..364340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7389"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7389"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40047"
FT                   /db_xref="GOA:B9K599"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9K599"
FT                   /protein_id="ACM40047.1"
FT                   /translation="MRAIPHPALKDVTLTQVLYALSDPVRLGVVRQLSNEGRATCSALD
FT                   GGRPKSSMSHHFKVLREGGLVFTRTDGPTHLNELRREEIDERFPGLLDAVLAVSDEPG"
FT   gene            364439..365530
FT                   /locus_tag="Avi_7390"
FT   CDS_pept        364439..365530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7390"
FT                   /product="xenobiotic reductase A"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7390"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40048"
FT                   /db_xref="GOA:B9K5A0"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5A0"
FT                   /protein_id="ACM40048.1"
FT                   /translation="MSSLFTPFTLKGITLRNRIAVSPMCQYSAEDGIINDWHHVHLAGL
FT                   ARGGAGLVVAEATAVSPEGRITPGCAGIWNDEQIEPWKKAVHLMKAAGAVPGIQIGHAG
FT                   RKASANRPWEGDDHISGSDPRGWETLAPSAIAFGANLGKVPQAMTLADIERITADFVSA
FT                   AKRALAAGFEWLELHFAHGYLGQSFFSTWSNKRTDNYGGDFDGRARFLLETLAAVRDVW
FT                   PEHLPLAARFGVTEFDGSNDLEEGIEMVRRFKAGGLDIIDVSIGFSTPTANIPWGPAFM
FT                   GPIAQRVRREVGLPATTSWFISEPKQADALIADDFVDMVSLGRPLLANSHWPYQAALEL
FT                   GIDKPSWTLPAPYAHWLERYRTA"
FT   gene            366219..367574
FT                   /gene="gatA"
FT                   /locus_tag="Avi_7392"
FT   CDS_pept        366219..367574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="Avi_7392"
FT                   /product="glutamyl-tRNA amidotransferase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7392"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40049"
FT                   /db_xref="GOA:B9K5A1"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5A1"
FT                   /protein_id="ACM40049.1"
FT                   /translation="MNLVAKPFPQTITQAQGQFLEGLSPLSVVKTCLERIQEQNDKLGA
FT                   MIFIARAEALEEAQKAEAAIRAGKRIGPLHGIPVAIKDMIDVRGWQTTGGSHLLHGDHA
FT                   VNDARCVANLRSAGAIIIGKSNLHELTAGNHDNPWYGKVVNPLDAERGTGGTSSGSAAA
FT                   VAAGFCIAAIGTDTGGSNRSTAAATGLVGFKPTNGVIDPTGTMPTAPTFDTIGPIARNV
FT                   ADARLLHYAMAGIDTPEKRRVSVAGMRIGLCPDLYAAAVDPAIATAHDAFLALARRAGA
FT                   QIQVLPFRFAREVREAGLTILVYEFTAFYGPLVEAHPGRVGAAVLAFLSNGALISEAAY
FT                   RSALAYQAQIQGEFHRLLSEVDVLLTPVVPGLAPRLSDEQTAVGNDFMPYGLAGGHFRR
FT                   WANFFGVPALAMPVPMAGALPASIQITTPRNTENYLFSVCEALSRLETGSTC"
FT   gene            367608..368393
FT                   /locus_tag="Avi_7393"
FT   CDS_pept        367608..368393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7393"
FT                   /product="ABC transporter substrate binding protein (amino
FT                   acid)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7393"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40050"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5A2"
FT                   /protein_id="ACM40050.1"
FT                   /translation="MKKIAIVLSVIAATFGMTKPSSAADDVIRFGVAAEPYAPFSVKDA
FT                   SGKWQGWEIDLMDAVCNQMKAKCEIVDVAWDGIIPALLAKKFDVIWSSMSITDERKKVI
FT                   DFTDKYYYSPNVLVGAKADTRSFDVAKPETFKGITVAAQSSSLQATYMQQKFNGMSDLK
FT                   LYPTLDDEIADIQAGRVDLMAAAGIQIQDFLSKPEGQAYEIKVTLPHETMFGYGDGGGL
FT                   RKEDTALKDKLNAALKAVRASGEYDAITKRYFNFDIYGE"
FT   gene            368464..369186
FT                   /locus_tag="Avi_7394"
FT   CDS_pept        368464..369186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7394"
FT                   /product="ABC transporter membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7394"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40051"
FT                   /db_xref="GOA:B9K5A3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5A3"
FT                   /protein_id="ACM40051.1"
FT                   /translation="MDANMAWFTLLSFGDQGWSDELLQGAWLSIKISLSAYLIGLVLGL
FT                   VGAIAKLSKSVVARSFAGTYTTVIRSVPDILVIFLIYYSATDALSYLLSMSGLSVEFQL
FT                   NGFIAAAISLGVVQGGYSTEVLRGAIVAVARGQTEAAFAVGLTRKQAFFLVIIPQMLPL
FT                   ALPGLGNLWLIVLKESSLVSLIGFTELVLVGKMAAGATRHYLLFYAAVGVVFLIMSGAS
FT                   TLVFHYLEVKTSLTWRRK"
FT   gene            369188..369874
FT                   /locus_tag="Avi_7395"
FT   CDS_pept        369188..369874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7395"
FT                   /product="ABC transporter membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7395"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40052"
FT                   /db_xref="GOA:B9K5A4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5A4"
FT                   /protein_id="ACM40052.1"
FT                   /translation="MSDFGSYLSGELITGLQTTIVLFLASAITGNLLALPVALGRISTR
FT                   KWIRYPVIGFMLSFRGTPLLVQLYIFYFGVGQVLATVPAIRYSPLWPLLRSANGYAYVV
FT                   LSLNTAAYCAEIWRGAILGLPIGQSEAGRSLGLSKQRITVSILLPQAFRLALPAIGGQN
FT                   ILLLKGTALTAAITVFETMATANLVRAQTFRTYEPLLAAALVYFVLASIITSGFKYMET
FT                   RLASRY"
FT   gene            369971..370864
FT                   /locus_tag="Avi_7396"
FT   CDS_pept        369971..370864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7396"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7396"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40053"
FT                   /db_xref="GOA:B9K5A5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037424"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5A5"
FT                   /protein_id="ACM40053.1"
FT                   /translation="MLHGTTTKAADALDITQPAVSKILLQLTNKAGFPLFRNHRQRLIP
FT                   TPEAHMLYAEVRRLFETVRGISQIAKEIRELRSGRLNISALPAFGSTLMPSIIASFTKQ
FT                   YPDVAITLDIRSSSTIIQRAGRNQLDIGVASEVNDETPSVVRRALIATPPVCVMPKGHP
FT                   LSKLSVVQPDDFDGLNFVSLGVGDPMRKQLDELCEQRGVNRSLKVEAALSHSCINLVAN
FT                   GVGVTVVDRLSAWMAKDLPIEIRDFQPHLDINLSVYRPWGTIASSVADTFIEHLIQSTR
FT                   EYMNVVDRGIKALSEQ"
FT   gene            complement(371039..372187)
FT                   /locus_tag="Avi_7397"
FT   CDS_pept        complement(371039..372187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7397"
FT                   /product="Selenocysteine lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7397"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40054"
FT                   /db_xref="GOA:B9K5A6"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5A6"
FT                   /protein_id="ACM40054.1"
FT                   /translation="MLPSQRHAFSIPEDVIYLDAAYMSPIPNIATEAGCDGVLVKAAPW
FT                   DMTINSYYDEVERVRELAASFVGASIDDVGVIPATSYGIAVAAANVHVTPGSVIMMMDN
FT                   EHTSHRYAWYELAEKKGATVVTVPRRPDQEWGSALAAAIKGSTVPVSVVAGTIVHWFEG
FT                   MSVDIEVVADAAHAVGAALVMDGTQWVGAVPFDVSRIRPDFLSFATYKFLLGPYRLAFL
FT                   YADKKWQEAGKPIEFHSWNRKGGERPDFYLETMPDYLPGARRFDMGERSDFAVLPIAIR
FT                   SLELLQSWGSTAVFERLVHLNELIWKEAEARGFEGPRKDLRAPHISVIELGQRFRPDFA
FT                   RNLKDNKAFVTVRGTKMRITPHVYNEEHDIRRLFELVDSLTR"
FT   gene            complement(372196..373212)
FT                   /locus_tag="Avi_7398"
FT   CDS_pept        complement(372196..373212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7398"
FT                   /product="ornithine cyclodeaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7398"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40055"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5A7"
FT                   /protein_id="ACM40055.1"
FT                   /translation="MSSSPSRTGYSNTLLVIDGPTAESLVSIDEAIVLADLALRKTSDE
FT                   TAQQDIRRILTLPGAAGTCLSIMYGSASEAEPFGAKVQSVYPQNFENGLPSHQGGVLLF
FT                   NRQTGRPDALINATAITGLRTPAASAVATRALSRPDACELALIGYGEQAERHIATIRAV
FT                   RDISRVRVWGRNPEKAKFFADHQTRLGIPTVPYGTARAAVEGADIVCTVTSAKSPVLMG
FT                   EWLTPGTHINAVGASVAALQEVDLECVKRSRIWVDYMPMAMAAASDIFEPLEKGIIGPS
FT                   NLIGEIGAALNGTITGRTSTSEITLYRSLGVPAQDILFANFIFQKARGLGLGVEVSL"
FT   gene            373498..374628
FT                   /locus_tag="Avi_7399"
FT   CDS_pept        373498..374628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7399"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7399"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40056"
FT                   /db_xref="GOA:B9K5A8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5A8"
FT                   /protein_id="ACM40056.1"
FT                   /translation="MRVVVIGAGIVGSSVAYEAAKAGAQVTVLEAGRIAGGASTSSFAW
FT                   TNATGKRPQPYFALNVAGMRAHLDLAREFGHAPWFHQTGSIEWYSDESDWPAQLDNADQ
FT                   MRDWGYGVEWISKSRLTELEPEIDHGAIKQSPLVYYPEEGWVHPALYAAWLLRAAKEKW
FT                   NADIRPFSGVTSIDVQNGVAKAVKTVDGAAFEADAIINCTGSWAAHVLEGVPAIPMASN
FT                   MGIVGFTLPIATTLRRQFHMDDLDVRPDGAGRLMIHKVSVDSLVTKMQPLNTQGPEAAL
FT                   LLDAVRKVLPAIQPDDMESIRTIVRPIPGDNLTCSGWVPGVDGYYVAVTHSGVSIAPHL
FT                   GKAVAQEVVRGRLHESLTDFRPDRFLAAKNGMGQRA"
FT   gene            374625..374975
FT                   /locus_tag="Avi_7400"
FT   CDS_pept        374625..374975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7400"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7400"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40057"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035709"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5A9"
FT                   /protein_id="ACM40057.1"
FT                   /translation="MTITRIAKTERLSRVVIHEKVAYFSGLTADDRSQDTVGQTEQVLA
FT                   KANAFLVKIGSNRSLLVSATIWLRDIEDFDAMNSAWTAWIDKDEPPARATVQAVLGLPD
FT                   IRIEIQFTVALP"
FT   gene            375396..376295
FT                   /locus_tag="Avi_7402"
FT   CDS_pept        375396..376295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7402"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7402"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40058"
FT                   /db_xref="GOA:B9K5B0"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5B0"
FT                   /protein_id="ACM40058.1"
FT                   /translation="MFSKKVKWEETMTYKSIRALERGIDVLQYLNTVKGAAPPEIAENV
FT                   NLPRPTVHRILETLSELNLVYRSQLGDEYRLSSGVQRLAGNRSSVRLNWIDEIALPALL
FT                   ELTSEIIWPSDIAVCHKAAMIIQGTTHRISPMSCDVGMVGNRRSMLMSPLGRAYLSHCP
FT                   DDELKSILCALNASSASEDKGARDRAFIKEIIETGRRDGVSACNERPHPRCASLAAPIR
FT                   LNGKVLACMNVVWRANMLTIEDAMDQIRDPLLATRDRIEAQLHEQFARPALGSTSFPET
FT                   YTLRTGTRDRLPHSLALA"
FT   gene            376370..377011
FT                   /locus_tag="Avi_7403"
FT   CDS_pept        376370..377011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7403"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7403"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40059"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5B1"
FT                   /protein_id="ACM40059.1"
FT                   /translation="MTKTLGFLGAGRLAQMLAPKAIAGGWRVILSNSRGPETLADLVSQ
FT                   LGPNASAATSKDMVLAADIIILAIRWPQIADATAGLPWDGKTVIDATNNRLGPKPEDVI
FT                   VIGDAIASELVAGYLPGAKLVKAFNHEPIPVFDKTLPPAGDESVLFLAGADAEAKKQVA
FT                   QLMRDLKATPIDLGAIDEGGLLIAMGGPLTNKFKLYTPAEAEAETKAALV"
FT   gene            377643..378932
FT                   /locus_tag="Avi_7405"
FT   CDS_pept        377643..378932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7405"
FT                   /product="Acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7405"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40060"
FT                   /db_xref="GOA:B9K5B2"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5B2"
FT                   /protein_id="ACM40060.1"
FT                   /translation="MVAAKERTVVLATKSTQKQGTPLAQPEPGLTPEQIIQRAIDLRPL
FT                   LLDGQADAEERGTYSPEMHERFRKAGFYRILQPVMYGGYEFDLTVFSRVIVEIARGCPG
FT                   SGWCLCLASGHAVNAAALFDKAGQDIIFGNDGEFAAPARGVPGGTATECDDGWIIDGTW
FT                   DYCSGSPYSTHAIVGVRIAGPAKDGPPELGIAMVPRSGWEMIDNWRDFIGMRASGSNSI
FT                   RIDKQWIPKALLVRQNFFAVNIDGGTEGYKLHGNSMYSGRMFGFFQAEITSILVGVGFA
FT                   ALDEFERIVGLRAGAPKLGPPMPGVPDFHRPYGVALGMLEMASNALAAGTRSYLDYCER
FT                   GVKDPSAYTEFDDLRIQAGLQHAAHLSMDAVEILYSAAGTSTSAKNGSRLQRYYRDISM
FT                   ARTNPGLQFDKTAMQLAARRFPEGPQGPRP"
FT   gene            378983..379618
FT                   /locus_tag="Avi_7406"
FT   CDS_pept        378983..379618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7406"
FT                   /product="4-hydroxyphenylacetate 3-monooxygenase reductase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7406"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40061"
FT                   /db_xref="GOA:B9K5B3"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5B3"
FT                   /protein_id="ACM40061.1"
FT                   /translation="MQHHVHTNNDKVAADTKSVLPATDWTSEPQQIETSAVTSGGGLTA
FT                   AEEKAALKAKFISGMGRVAAPVSIVATDGPAGRAGVTISAMSSVSADGDRPTLMICLNQ
FT                   SSRTCQALEKNRHFTLNVLNARKHIPIADAFAGRFGTFLPDKFAMGDWKTSRFGIPELN
FT                   EATAVFHCQVNFTQIVGTHMLIIAEVDEVSEAEGARALVYCSREYRCP"
FT   gene            379820..382147
FT                   /locus_tag="Avi_7407"
FT   CDS_pept        379820..382147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7407"
FT                   /product="ferrienterobactin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7407"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40062"
FT                   /db_xref="GOA:B9K5B4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5B4"
FT                   /protein_id="ACM40062.1"
FT                   /translation="MCSKAGLCLAASCCALTLGMVCAGASAQDGAVKIAKTNRNPTTDA
FT                   QKLDCPGGDQTKRSKDPNTKNCPDLTLVDNGSSVGPSAAPGQGPGSGAGPGPGQGPGPG
FT                   TGPGAASGPDGLPPPPFGMIVPRKSFNLGPPLGGPPAVGNINPIFVMPPGMVGALKPDQ
FT                   ILIGLGDLAKPRPAPDGFNHIGTEIYTMGGSFGRNRETVQTGNSKDNFSTYFAGSRVQD
FT                   PSWRDNTDSKQYEFYGDLGWRNETSALHLSLSGQDLKSSGNGLTPAEMLAKDRSSSFIA
FT                   PSGDTDRRWKIQLSGEHETDSGWNVNGKTYIGHVSRTKQWADGETPQSCADNAATLCNM
FT                   MGSPYLTLSGDRFPLYSSSYRYASLTNYSEDAYTYGASLEGRVSDTLLGRANDFVIGAA
FT                   LDGSTTSGTVSRSLGEYTSDYVYTNDQGVYQTTSADLRALYFSLYAADQLAVTDRLTVG
FT                   SALRFNVSDLNRYNGSATNVTYDYDLNMHKTDYSVDPSIGLTYKFNSDLVGYAGYNRES
FT                   RAPTSFGTMCSNLASTCAFPNFPIADEPLLQTHSNNFEAGLRGQNTVLGDATLSWNVRL
FT                   FSQMTSDTYWLVLRETRPMFSNVGDSWRRGVRFNAALETGPWTIGLDYILQKSTFEKEF
FT                   TEFSSDNPSADAMGNITVPKGSEMPNIPNQILNVSVDYAVNDRLKIGALGTGVAGSYAQ
FT                   FDENNTLKKSDPYALFSLNASYKLSDNAEIFGLITNVFDTKYNAMAALIKVNSIPSLGL
FT                   TNSLGYIPGDGRAFYAGLRVTF"
FT   gene            complement(382376..383233)
FT                   /locus_tag="Avi_7409"
FT   CDS_pept        complement(382376..383233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7409"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7409"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40063"
FT                   /db_xref="GOA:B9K5B5"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5B5"
FT                   /protein_id="ACM40063.1"
FT                   /translation="MSENIRALSRGLNVLEFLSETGGATRQATVAHFGLSRPTIYRLLG
FT                   TLEKSGLISLGDDGVYRPTIATRALKEGLTDDVWALWAAEPILLELQKEVVWTSEITTF
FT                   DAYSCTMLKRDTTHSLNPYHINLLDFDDNHRSMLTSACGLAYLAFCPQQQRAQILEHLG
FT                   HFGDRTQSDSQRPDSQRGAGAHTRNLINKVISDGYAVEQRNSYPLIAAIAVPIRYDNRV
FT                   LACLSIVWLPRAVKLQDGITQFLPALKRAQSFIEQKLLDDASIEYDTNFTAKYVHHGQQ
FT                   HELI"
FT   gene            383454..384209
FT                   /locus_tag="Avi_7410"
FT   CDS_pept        383454..384209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7410"
FT                   /product="arylmalonate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7410"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40064"
FT                   /db_xref="InterPro:IPR026286"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5B6"
FT                   /protein_id="ACM40064.1"
FT                   /translation="MANAETNSGRGKGYGWRLSLGMLLPSSNPVAEPELTRMLPEGVSL
FT                   LTTRLKLAGSSREELLGMTGQIEGAVPLLCDAGVDRIVFNCTAVSTFDVEMGNMLRQRI
FT                   EKIAARPATSTADGVIAGLKALGAKRIALITPYISSVVERETAFLEHHGFEVVRAVGRD
FT                   LDEGKAMSSVEPGQWYRWALDHAGCGADVYFLSCTAIRVIDIVATLERDLGVPVLTSNQ
FT                   AMFWWCLRNAGLNDSPEAFGRLFTKHLPA"
FT   gene            384226..385377
FT                   /locus_tag="Avi_7411"
FT   CDS_pept        384226..385377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7411"
FT                   /product="Acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7411"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40065"
FT                   /db_xref="GOA:B9K5B7"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5B7"
FT                   /protein_id="ACM40065.1"
FT                   /translation="MSIRGKAFIVGAYEHPGRNLPDHSVQQIHAECAMGALSDAGLSIK
FT                   DVDGYFSNGQLGFGGISMAEYLGLRLSYIDSTFTGGSSYMAHVGHAAAAIAAGKCKVAL
FT                   ITQGAKVRGVIRGAKHTADTPEFPFETVYGETNAAIYALAARRHMHEYGTTAEQLAAVK
FT                   VAAAAYAQHNPNALLRKLVSIDDVMNSPIIADPLHRLDCCVVTDGGGALVLVAPEIARS
FT                   LKRQSVKLLGHAEAIRHGGDGPSDFASTAAALSGPRAFTEAGVSPRDVRYASIYDSFTI
FT                   TVIMTLEDLGFCGKGEGGAFVASGALGLDGLLPINTDGGGLCNNHPGYQGGMVRTIEAV
FT                   RQLRGEANPNTQVKNCTIALAHGTGGGMSRHASVTLVLGQEDA"
FT   gene            385841..387226
FT                   /locus_tag="Avi_7413"
FT   CDS_pept        385841..387226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7413"
FT                   /product="ScoB"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7413"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40066"
FT                   /db_xref="GOA:B9K5B8"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR014388"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5B8"
FT                   /protein_id="ACM40066.1"
FT                   /translation="MNKVFESTSDAVADIKDGASIAIAGFGVGHSYPNSLVLALQAQGA
FT                   KNLAIIANSLGAGGDFRPQILVQNGQVSRLVLSFSVRPGMPSPEEEKIAAGEIALEMVP
FT                   QGILVERLRAAGAGLPAFYSPVTVGTPLQEGKEVRRFGERDYVLEHALPVDVALIRGYR
FT                   ADRFGNVEFRGSSAHFHASFARAAKLTIVEVEHIVEAGEISPERVGLPGIFVSRVVQTV
FT                   AKYPAPAGRMGRRAPESGREYFGKPALTRTNMAKRAAALLPEGAYVNLGSGLPTLVAAH
FT                   TQDKSIFLHAENGALGYDLLQDPAQFDVDFFDAAGNFIKMRPGGAVFDSVASFEIARSG
FT                   KLSAILLGAYQVSEKGDLANWAVPGQSGGGIGGAMDLASSGSKVIVLMEHCDGKGKPKF
FT                   VRKCSYPLTALACVDTVVTDLALLVRQGNSFEVTAIAEGFTPDEIRALTPIDITFAQSL
FT                   EVM"
FT   gene            387340..387768
FT                   /locus_tag="Avi_7414"
FT   CDS_pept        387340..387768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7414"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7414"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40067"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5B9"
FT                   /protein_id="ACM40067.1"
FT                   /translation="MKLSQSVELKAPAAEVWTFISDFYNFHAWQPHIESTAPGPAKGER
FT                   IVKMKRGNTILDRIAVLDNEKRTLAYEMVPNQDLPPGAPKLEGFLATFVVGESGAGSKV
FT                   EYSIAVDVPSAIQEMAEKGIGSDISGALQGLKDKFEEA"
FT   gene            complement(388188..389435)
FT                   /locus_tag="Avi_7416"
FT   CDS_pept        complement(388188..389435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7416"
FT                   /product="Permeases of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7416"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40068"
FT                   /db_xref="GOA:B9K5C0"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5C0"
FT                   /protein_id="ACM40068.1"
FT                   /translation="MRLFPFHSPHPRYGRAILAACSLILCMNAAFPIYGASVINTSMVT
FT                   SLGWDRSLLGLLVSVNMAVTGITAPLVGSAVNRFGSRLVLIAGSLLLLLGASAMAFWVE
FT                   KPWQVVVAFGILMGLAMSAGGFVANQACVAAWFDKKRARAFAVLYATMGVGGFVAAPLI
FT                   SRSIALSDWRAGWLVFIGAGALALFLAIFVVRDTPPGASDANVAKFAQFDASGDQKGSV
FT                   YKSPALWLVITCIVTAGAGCSFYIAHGLALLHDSSFAPTDAAASLSLMAASTLLGNFAV
FT                   GAFSERLGTRNILAAGLLVFSLGILTLGYAHNSIMLYAYAVLLGAGYGAVQVSSMALLS
FT                   ETFDSRHFAAVSGFAISMMTIASAVAPIVVGQLFDHTHTYMPSVLTIAALNGIAAVLMA
FT                   TNRRAFLSGTPQVHAT"
FT   gene            389768..390919
FT                   /locus_tag="Avi_7417"
FT   CDS_pept        389768..390919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7417"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7417"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40069"
FT                   /db_xref="GOA:B9K5C1"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5C1"
FT                   /protein_id="ACM40069.1"
FT                   /translation="MIARATGMIGTLRARQADAEAGGRLLEVTHQEFMRAGFYRVVQPR
FT                   RFGGYEFDLTTYMKVMMEIARGCPSSGWVLALVSGHPIMLADFSERAQIEAYGDDGDYR
FT                   CPSVGSPVPVTLEKGGFRVSGGWDYASGCDVSTHAMVSGLTPEADGSMTPRLMLVDRSD
FT                   YEIVNNWDMIGMQGTGSRRLVVKDVFVPEYRTAPIVMWRGERGAAVHANPMYNGRKASY
FT                   FVIELGAVVVGAVKGALDIFEDILRNKPMRFSSKQRLYESHEFQQYYGDAQTKIDSAEA
FT                   LLLKVTERYLEACSLHQETGEGFTEETDRRLFAAAQEACRLAWDGLEIIFTTAGTSTGA
FT                   KQSMLARIYRDAAVQKTHFVQQRSRTAVNAARLHFGLAPLSPF"
FT   gene            391027..391692
FT                   /locus_tag="Avi_7418"
FT   CDS_pept        391027..391692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7418"
FT                   /product="gamma-carboxymuconolactone decarboxylase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7418"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40070"
FT                   /db_xref="GOA:B9K5C2"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5C2"
FT                   /protein_id="ACM40070.1"
FT                   /translation="MLSYSPAYVAAYLDFSVYSDEQGSISPKLRELIYVATNCSPTHMF
FT                   EKGFKNHARQALDLGASPSELLSVVATVSAMGIHSYLLAAEAIAEFAPGEIVVDEPSAT
FT                   MVRKEHLAVFGAVLEEVQAGIKLDPKFYQCWLNFAAAPMRGPDATLSMKEAHLIALAVH
FT                   AQVTQLNPVGVRQHVRAALEHGASAREVLDVCKQISSMGIHAMVFGLPIINSLTRGGV"
FT   gene            391694..392398
FT                   /locus_tag="Avi_7419"
FT   CDS_pept        391694..392398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7419"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7419"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40071"
FT                   /db_xref="GOA:B9K5C3"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5C3"
FT                   /protein_id="ACM40071.1"
FT                   /translation="MRGVERRYHAGDTECIGYYAAGDSAAKTGVLLLHEAPGLGPHMRR
FT                   RADMLASLGYHAFAADLYGAGQLVKEPAQARALVGALKAQPGLLLARIEAGLKALSDAA
FT                   RLDVGAIAVAGYCFGGWCGLELARSGVPVKSATVFHGALTSDRGAAGIKTSLMVCVGDA
FT                   DPFSPMSQIHGFQQDMSTAGVDYQLCLFGGVGHGFTDPDIHEAGPGFGYDAKADACSWG
FT                   AFISLLGGTPAA"
FT   gene            392484..393329
FT                   /locus_tag="Avi_7421"
FT   CDS_pept        392484..393329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7421"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7421"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40072"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5C4"
FT                   /protein_id="ACM40072.1"
FT                   /translation="MKFDGKLVLITGAATGIGRATARSLGQLGARVVIVDINEDGAKEA
FT                   AKSVPGGKAVAFRCNLANDQEVADLQRQVESSCGVVDILINNAAKPPVTGSILNVGLDQ
FT                   FQAAFDVNVLGYLRTIKAFLPGMLERNAGHIVNTSSALALLPDPPIRFMGPYITSKGAQ
FT                   LSLSYAYAHALSGTGVGISVFCPGITATAEMPGGVPPSPPPGMPAPEEFSIGVPTRRTV
FT                   RVPAEHAAKVLIEGLERDAFLICSQSNYQPDLIAFASAGYDPASIVGEALGEAKRSLGA
FT                   "
FT   gene            393334..393894
FT                   /locus_tag="Avi_7422"
FT   CDS_pept        393334..393894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7422"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7422"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40073"
FT                   /db_xref="GOA:B9K5C5"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5C5"
FT                   /protein_id="ACM40073.1"
FT                   /translation="MGRIKYLRMEDLQPEHRNIPRMTSNITRAVAHSPVLANLVAARGM
FT                   YFRHQSGLNPRLRELAILQVGYSTRSAYEWAHHIDVALSFGVSRDDIRAIGVESEGGET
FT                   HLEPLARVVLAATRELTDHITLSGERFDQLAQALSSEHLVDLLVTIGEYIGLVRVMAAI
FT                   EIDLEPEYIPFLQEFPLPGTGRL"
FT   gene            393954..394808
FT                   /gene="hpcE"
FT                   /locus_tag="Avi_7423"
FT   CDS_pept        393954..394808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpcE"
FT                   /locus_tag="Avi_7423"
FT                   /product="fumarylacetoacetate (FAA) hydrolase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7423"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40074"
FT                   /db_xref="GOA:B9K5C6"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5C6"
FT                   /protein_id="ACM40074.1"
FT                   /translation="MKLLSFEIQNRKSFGAVIDDGVIDLGRKFEGRYADLLAVLEADAL
FT                   REVEAACVGVKPDYALTDITFLPVIPNPPKIICIGVNYEAHRSEIGRDPSKKPMVFARF
FT                   PASQIGHMQPLVAPPESHTFDYEGEIAIIIGKPGRRISQADSWSHIAGYAPYNDGSIRE
FT                   WQGHTGQWTPGKNWYQTGGFGPWMSTRGEIPDNAPLHLKTRVNGQEVQSADASQMIFSI
FT                   PEIIEYCSIFTPLEAGDVIVTGTPGGVGVRRNPQLFLKDGDIVEVEISEIGILRNSIKA
FT                   EQL"
FT   gene            complement(395057..396568)
FT                   /locus_tag="Avi_7425"
FT   CDS_pept        complement(395057..396568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7425"
FT                   /product="monooxygenase FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7425"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40075"
FT                   /db_xref="GOA:B9K5C7"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5C7"
FT                   /protein_id="ACM40075.1"
FT                   /translation="MVGSVDVVIVGLGPTGATLANLLCSMDLTVCIVEADETMFTLPRA
FT                   THFDGEVMRVFQTLGLADKIKPDTHVNPGMTFINAQHEVILHWPRPAEMGPQNWHGSYR
FT                   FHQPALETVLREGLNRFPQAKVLSGCEVVSLEQGEDGVVAQYRTRKTGETASIKGRYLV
FT                   GCDGGRSPVRGMISSQLEDLGSHERWIVVDLLMNRDVDGLTDGTVQFCNPVRPTTFMRC
FT                   VKNRRRWEFMVMPGDDLEQLLTPEGIWGLLSPWLTPDDGEIERAVTYFFHAVMAKPWRV
FT                   DRVLLAGDAAHQTPPFLGQGLCAGIRDSSNLAWKLASVIKGTASEELLDTYEQERAPHV
FT                   RKYIENAIQIGSIIQTVDPELARERDENLAKGGRFITSINAQLGEGLHGSEPLPAGMIS
FT                   RQPILTSGRPLDDVVGNAFVVLGAQDVLDKVSQDTRRRWHDVGLVCLADEGGDYLAEIG
FT                   AMAIIIRPDRYILGIANSPQDLDRISELLPTLGQQTDMIGMAAQR"
FT   gene            complement(396552..398033)
FT                   /locus_tag="Avi_7426"
FT   CDS_pept        complement(396552..398033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7426"
FT                   /product="2-methylcitrate dehydratase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7426"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40076"
FT                   /db_xref="GOA:B9K5C8"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5C8"
FT                   /protein_id="ACM40076.1"
FT                   /translation="MTTLIDDVSKRIASGAPFRQDPLVSQGLSIHVLDTIGAWIAGRAT
FT                   REGHRLSRLRDEKSQSLAPLTRSTLDTIALRVATARLSEVDDVHMPSCTTPGAIVVMTA
FT                   LSLMADLADRADTILFIDALHAGYEIMTRLGDAVSGPDILHKGIWPTYLLAPVTTAAVT
FT                   AKLLGLDWERTSHALAIALSTSSGRPGGSVSGGVVGGAGTSARWLLAGLAARTGCIAAL
FT                   SASKGFNGDRSFMDGEWPARSHGVTLEKDILLNVFEGQAAVLGTSIKPYCAAKHAIAAI
FT                   DGFQMLLKQGVPLDTVSKVVVKAPPVHAGMIGHHDVSLSRLSRITSCSYNLALAAFWPD
FT                   KLLDIERTDAVADPAVVEFAKKVEVVADPELAHQCPQNYPASIDLFINERIIASIAISD
FT                   ALGDPAKPFDLDLARGKFRRLARGIIRESLAMHIEQCCLDLNNPTAGPELAAIMTEIDN
FT                   SLTPKTVADHDREDMQNAGIISAAELERRDYGRVS"
FT   gene            398288..398731
FT                   /locus_tag="Avi_7427"
FT   CDS_pept        398288..398731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7427"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7427"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40077"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5C9"
FT                   /protein_id="ACM40077.1"
FT                   /translation="MHMRPHLNEIDIILMCEAARRCAEANSWSVTIAIVDEGGALLRLE
FT                   RMDGTGSATSEIAIGKAKMAAISRRKSKDMEERIAERPVFLKLSYGLPIQGGLPIMVEK
FT                   WCLGGIGVSGVQSHQDESIAQAALDALLSNAETISAILPAKAL"
FT   gene            398827..399360
FT                   /locus_tag="Avi_7428"
FT   CDS_pept        398827..399360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7428"
FT                   /product="ring-cleavage extradiol dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7428"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40078"
FT                   /db_xref="GOA:B9K5D0"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5D0"
FT                   /protein_id="ACM40078.1"
FT                   /translation="MQQVSISHVGLFVHDLALMREYYINVLGFIVTDEVPGRMCFLSRN
FT                   IEEHHQVALFAGRTADTPQVQQLSFKLDTLEEVREVHRRLVDAGTKEMRCVSHGIAWSI
FT                   YFPDPEGNRLEYFTDTEWYVKQPCADPVDFTLPADEIYRISEATNRAHEDFQPLHEWRD
FT                   RFNEKLKQKILETQ"
FT   gene            399505..400440
FT                   /locus_tag="Avi_7430"
FT   CDS_pept        399505..400440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7430"
FT                   /product="fumarylacetoacetate (FAA) hydrolase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7430"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40079"
FT                   /db_xref="GOA:B9K5D1"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5D1"
FT                   /protein_id="ACM40079.1"
FT                   /translation="MKLAFFDSYKLGVVRGDVIIDVSSAVETIAHVGPHDLMQGLIERF
FT                   DEFRSALEAAADAGEPISLASVALRAPLPKPSNIVCMAVNYMEDGTLAEPPAINAFHKA
FT                   PTAVIGPGGTMVLPDIPARTFEGEAEMALVIGKRAHQVSAENWRDYVFGYVNFIDGSAR
FT                   GTLPEKNNYFQMKSRDTFAPIGPWIVTADEIPDPQSLQVRLWVNGTLKQDFNTDDMAHK
FT                   IPRCIEWLSHIQVLEPGDVVATGTNHRGLNALQDGDSVELEIEGLGRLAINVRDDLKRT
FT                   WPRDTRVELMAKGVKGPAVQLTGKHAPVSP"
FT   gene            400596..401369
FT                   /locus_tag="Avi_7431"
FT   CDS_pept        400596..401369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7431"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7431"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40080"
FT                   /db_xref="GOA:B9K5D2"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5D2"
FT                   /protein_id="ACM40080.1"
FT                   /translation="MSSLTKMLLILDLFSVDKPIWSADEIIQYCGHSRPTGYRYVKELC
FT                   DAGLLRRAEGGYSLGPRVIELDYYIRQCDPLLIACRPVMVRVAQESGCDVLLASMYGTK
FT                   IMAVHQELAHETGQIAFGRGRPMPLFRGGGSKVLLASMTASQLKKLYDRYGAEIAEAGL
FT                   GATWADFRKQMLKYRNDGHVVSIGELDPNAAGVAIPIPVGDALDPAALVILTTRSRFDL
FT                   MEKALLVDMAMNAARQIETSMRGNREVQAKALLLS"
FT   gene            401388..401936
FT                   /locus_tag="Avi_7432"
FT   CDS_pept        401388..401936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7432"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7432"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40081"
FT                   /db_xref="GOA:B9K5D3"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5D3"
FT                   /protein_id="ACM40081.1"
FT                   /translation="MRLTDLQLEDMSPAQKNVAEEAKSGRRGHIPAPLRAWIHSPELGA
FT                   RAQRLGEFVRYNTELGADLSELAILVVARDWGAVFEWDAHKREALKAGIEPHVIEAIRT
FT                   RTSPAFPSNKARIVYCYTKTLLETRFIPSPLHDEAVTVLGQAGLAELVGVVGYYTFVAM
FT                   TLNAFEIGVEEGSGDLGVS"
FT   gene            complement(401961..403052)
FT                   /locus_tag="Avi_7433"
FT   CDS_pept        complement(401961..403052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7433"
FT                   /product="ABC transporter membrane spanning protein
FT                   (branched chain amino acid)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7433"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40082"
FT                   /db_xref="GOA:B9K5D4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5D4"
FT                   /protein_id="ACM40082.1"
FT                   /translation="MTSTNIVPTQENPPTGWRIQTRTRLSSAFTIGLILVFAVLAFAPF
FT                   FVSRGTVQNLFYILTMLTLAQSWNLLAGYAGLISVGQQLFVGCGAYALFAMVILLGVNP
FT                   LIAIPLAGVFATIVALPTALFTFRLHGSYFAIGTWVIAEVGRLVFAQWKTLGGGTGASL
FT                   PREATREMFGVSTISALFGMKPAVALDSLAYWLALLLTGFTIVFVYRLLRSKQGLGLAA
FT                   VRDNETAATALGVDALRLKLTIYLLTAALTGMTGALIYLQKARISPDAAFSLTDWTAYV
FT                   LFIVVVGGIGTIEGPIVGVIILFFLQNLLSDFGSWYLLLLGALAILTMLFAPRGIWGLF
FT                   SERTGIEFFPVRRLLRGRTKNKN"
FT   gene            complement(403063..403926)
FT                   /locus_tag="Avi_7434"
FT   CDS_pept        complement(403063..403926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7434"
FT                   /product="ABC transporter membrane spanning protein
FT                   (branched chain amino acid)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7434"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40083"
FT                   /db_xref="GOA:B9K5D5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5D5"
FT                   /protein_id="ACM40083.1"
FT                   /translation="MNWLDTILQGALLGGLYALFAAGLSLVFGIMRLVNLAHGDLIVLA
FT                   SFLILMLANTFGINPFLAALIAIPLMFGLGWLLQTYLLNRTLGKDILPPLLVTFGLSIV
FT                   IQNGLLEGFTADSRRLSTGVLETASLPLAGLNIGIMPLLTFGSAIIVIIALNQLIYRTS
FT                   LGRAFRATSDDPVTAGMMGVRPHRIFAMATGLAMVVVTIAALYLSTRANFDPTAGPSRL
FT                   IYAFEAVIIGGLGSLWGTLAGGVVLGIAQTLGAAINPEWQILAGHIAFLIVLLVRPRGL
FT                   FPRAND"
FT   gene            complement(403913..404638)
FT                   /locus_tag="Avi_7436"
FT   CDS_pept        complement(403913..404638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7436"
FT                   /product="ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7436"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40084"
FT                   /db_xref="GOA:B9K5D6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5D6"
FT                   /protein_id="ACM40084.1"
FT                   /translation="MMTSLLETRGLTAFYGDFQALFGVDLRLDAGEMIAVIGANGAGKS
FT                   TLMRAIVGVLASEPDAILHQGVSIGALAAPDVMARGIALVPEGRKLFPSLTVEENLLIG
FT                   QYGRTVNGPWSLASIYELFPILQERRHRPATALSGGQQQMVAIGRALMSNPEVLLCDEL
FT                   SLGLAPVVIKDIYAAFPRIRAAGAAIIIVEQDIGQALKQADRVYCMMEGRITLTGRPSD
FT                   LDRNDIHAAYFGAESHELA"
FT   gene            complement(404635..405354)
FT                   /locus_tag="Avi_7437"
FT   CDS_pept        complement(404635..405354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7437"
FT                   /product="ABC transporter nucleotide binding/ATPase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7437"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40085"
FT                   /db_xref="GOA:B9K5D7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5D7"
FT                   /protein_id="ACM40085.1"
FT                   /translation="MPILELSGVSKSFGAIVVADNIDFAVQEGEALGVIGPNGAGKSTL
FT                   FNLISGNLSVASGTIRFDGRDVTTMPPMQRCFAGMGRTFQIPQPFERLTVFENLLVAGA
FT                   FGAQSSEAEMTDFCADILVETGLIAKANALAGSLGLLERKRLELARALATKPKLLLLDE
FT                   IAGGLTEGECRQLVATIRSVHQRGVAVIWIEHVLHALTAVVERILVLNFGRVLGIGEPQ
FT                   AIMASREVREIYLGLEV"
FT   gene            complement(405413..406807)
FT                   /locus_tag="Avi_7438"
FT   CDS_pept        complement(405413..406807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7438"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7438"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40086"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5D8"
FT                   /protein_id="ACM40086.1"
FT                   /translation="MKDGCVALTVGGCGLCCRRLPHSDRAQRAGRRMAMGRPIFTRRDF
FT                   IKTTAVSGAVLATSGLAAPAIAKDVAIKLGYVSPQTGPLAGFGEADKFVIDAFMTATKA
FT                   MGLNYQVIVKDSQSNPNRAAQVAKELIVDDEVNLMLVSSTPETTNPVSTTCEGEGVACI
FT                   STVAPWQSWFIGQQGNPSDPASWKPFNYAYHFFWGLEDIIAVYTGMWSQLATDKKVGGL
FT                   FPNDGDGNAWGDKVVGFPPVLEKLGYSLTDTGRYQNLTDDFSAQINAFKQKNTDILTGV
FT                   MIPPDLTTFWNQAKQQGLKPKIASIGKALLFPQAVEALGNAGHNLSTEVWWTPTHPFKS
FT                   SLTGQTSAQVAAAFTKATGRPWTQPIGFAHALFELAVDVMKRAEDVSDANSVAKAIGET
FT                   KLDTLVGPIAWGSDKLPPFASKNVAKTPLVGGQWRLKTGGGYDLVVVENGLIPSVPLGG
FT                   KLEPLA"
FT   gene            complement(407029..408786)
FT                   /locus_tag="Avi_7439"
FT   CDS_pept        complement(407029..408786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7439"
FT                   /product="2,4-dichlorophenol hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7439"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40087"
FT                   /db_xref="GOA:B9K5D9"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5D9"
FT                   /protein_id="ACM40087.1"
FT                   /translation="MADITTDVLIIGTGPAGSAAAALLSTYGINNMVVNRYRWLANSPR
FT                   AHITNQRAMEVLRDLGRDVEDEAYLFATHQELMGENIFCESLAGEEIGRLKAWGNHPLS
FT                   KAEHLMSSPTKMNDLPQTFMEPLLFKAACSRGTQARMSTEYLRHEQNAEGVLTTCKDRL
FT                   SGHELTIQSKYLIGADGAKSLVAEHADLPFEGKMGVGGSMNILFKADLTKYVAHRPSVL
FT                   YWVMQPGADVGGIGMGLVRMVRPWNEWLIVWGYDINGPEPEVTEELATGVARQLIGDPD
FT                   LEIELLAANTWTVNNYYATRTSNGRVFCVGDAIHRHPPSNGLGSNTSIQDSFNLAWKLA
FT                   MVLKGQAGEGLLESFNVERAPIAKQIVSRANQSIGETGPIFAALGMSEGVDPEQMQKNL
FT                   EARTDGTEAAEQQREAIRKAIAFKKYEFDAHGIEMNQRYRSDAIVTDGQIEPDFLLDAD
FT                   LHHQPTTWPGARLPHAWLYKHVGGAEVSTLDLCGHGKFTLLTGLGGKAWIDAAAAVGSE
FT                   LGMEINAHMIGPRQTYVDPTGDWARLSEIRDTGCVLVRPDHHVCWRSTAASGTPADDLR
FT                   RVLRQILAL"
FT   gene            complement(408815..409888)
FT                   /gene="macA"
FT                   /locus_tag="Avi_7440"
FT   CDS_pept        complement(408815..409888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="macA"
FT                   /locus_tag="Avi_7440"
FT                   /product="maleylacetate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7440"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40088"
FT                   /db_xref="GOA:B9K5E0"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR034786"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5E0"
FT                   /protein_id="ACM40088.1"
FT                   /translation="MSYFREEFASTWPALRVRFGVGVRHDLVAEITRLECHRALILTTP
FT                   EQAHVAEEFAARCGDHAAGIFTRARMHTPVDISEEATAYARDIGADCLVAIGGGSTTGL
FT                   GKAIALRSDLPQIVVPTTYAGSEATAILGQTENGVKTTLTSAKVQPEVILYDAELVRSL
FT                   PVGMTVTSALNAMAHAAEGLYAQNRTPLTTLMALEGLRAFRDALPRVLKDPSDLKARGE
FT                   TLYGAWLCGTVLGQVGMALHHKLCHTLGGSFDLPHAETHAVILPHAIAYNSVAAQGELR
FT                   PLAELFGGQEPGAELYDFARTSHAPMALKDLGLKESDLDRAADLAAQNPYWNPRPVERD
FT                   AIRRLLQAAWTGEPPVA"
FT   gene            409990..410940
FT                   /locus_tag="Avi_7441"
FT   CDS_pept        409990..410940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7441"
FT                   /product="transcriptional regulator LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7441"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40089"
FT                   /db_xref="GOA:B9K5E1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5E1"
FT                   /protein_id="ACM40089.1"
FT                   /translation="MKIDSEHLEILAVIVEKGGLTEGAEALGKSQPSVSRTMALLEERI
FT                   GTPLFEAGRRPLRPTELGNQLARLGAKIRTQNLEASRLVQRYRQGQAGRLRLGGTPIFF
FT                   DGVVAGMVAEFQNRHSDVQITQTYGYFEDLSAGLRSGALDLAILPMHANMIPADMQFTP
FT                   LLAGRNVIVGSATHPLARRGAITLADIEPYSWIAPPPDSPLFRDLQRSLKSIGLDDFKV
FT                   SFSGGTLASIFSVVLGSDSLTVLPYSVVFTHQRVIPLQALPLRIEHPDRQLGLLTATER
FT                   MPPPALERFVAFVTEKFKHLSTRMEHEQQVTRRRG"
FT   gene            complement(410951..411283)
FT                   /locus_tag="Avi_7442"
FT   CDS_pept        complement(410951..411283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7442"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40090"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5E2"
FT                   /protein_id="ACM40090.1"
FT                   /translation="MPNLKIYVDETIFEASRASFHEALPRIRDLLCEAFQVAPSACQLA
FT                   VIPVVGLPDQPQLNIELLILPHTKRTETVIRAAAEKLRDLLNTATGAHGAVRIAHLDPV
FT                   TYVALK"
FT   gene            complement(411297..412133)
FT                   /locus_tag="Avi_7443"
FT   CDS_pept        complement(411297..412133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7443"
FT                   /product="dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7443"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40091"
FT                   /db_xref="GOA:B9K5E3"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR007535"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="InterPro:IPR039390"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5E3"
FT                   /protein_id="ACM40091.1"
FT                   /translation="MNYFVEEDSVAIVNARMGNDTNPRLAEIMSALVKHLHAFVKDTRL
FT                   TSEEWEIAIGFLTKTGQICTQERQEFILLSDVLGCSMLVDAITNRRPKGATESTVLGPF
FT                   HVENAPIRDHGTVISLDGKGESCLFEGRILDLDHQPIEGACVDVWSDNADGFYDVQQPD
FT                   IQPKWNNRGRFITGADGSYRFVGIRPVSYPIPDDGPVGALLEHLGRHPWRPAHMHYMIS
FT                   APGFRKLVTHTFVGGDEYLSSDAVFGVKETLVAPYERLQDAATLWRSPFDFVLTPE"
FT   gene            complement(413058..416144)
FT                   /locus_tag="Avi_7446"
FT   CDS_pept        complement(413058..416144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7446"
FT                   /product="alpha-D-mannosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7446"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40092"
FT                   /db_xref="GOA:B9K5E4"
FT                   /db_xref="InterPro:IPR000602"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR011682"
FT                   /db_xref="InterPro:IPR015341"
FT                   /db_xref="InterPro:IPR027291"
FT                   /db_xref="InterPro:IPR028995"
FT                   /db_xref="InterPro:IPR037094"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5E4"
FT                   /protein_id="ACM40092.1"
FT                   /translation="MRAYRDRQRSLEQLSRHIEVWADELEAYELRERIPLGAFLASTPE
FT                   GLTTHMGVGDAWPNRHGIHTFLLEDAIMIPEEPGVELRLDFGGESLVRLIGLDGEILES
FT                   FAANPCHRRFDVPRGIPFKIRAESAARSLFGVPNRNPVLSMAEIYRYYPEIRALRRRLL
FT                   ILRNTADTVKDKELARTLYEAAEIVLSGLRLPTATQDVGPRLASRTWARDIWERSFEPT
FT                   DIPNALTQEALASVETATVRLDAMLTELRNAYPKQGRVLVTGHAHIDYAWLWPQPETVR
FT                   KIVRTFNSVNALLKRHDDFRFLQSSSLYYQHVEQEDPALFEEIKQRVSEGRWEVIGGML
FT                   VECDTNMPSAEAFLRQFLHGQRYFQKHFGITSRTAWLPDTFGFTAAMPQIMRHAGIDTL
FT                   VTIKVSWNETNSLPDNLFRWQGNDGSRVLVHTFDAYDNDGYNMLMTPAALCEVWGKHVA
FT                   KDMTDTVIASYGWGDGGGGPDPDQIETLPLLNLMPAIPTVEHGAIEPHIQALAMDLEAA
FT                   ALPVWRGELYLEYHRATLTTQARTKQLNRQAEATLVAAEAISVLDALEGGAPAVNNLEP
FT                   QWELLLRNQFHDILPGSSIREVYQQTEPELEGVIDDATTLIQTRLQAIAARHSGDLDGL
FT                   LVANLSGSRKTAFQIESASPLPAALQAQELNGRYVAAIERNLKPLSLGFVSSSSPRRVT
FT                   TDGKTMENDFVRLTLDEAGRIISLIDKRSDRELMDGPGNQLLLYRNDLPRNFDAWDIEP
FT                   GFELGEEEWLSLETMEVTANGPHLAEITITRRFSASMIRQKIRLWSNSPRMEFVTDLDW
FT                   HDRRTYLRAAFPVTVLAEDAVFDQAIGITRRPTHDNTSWQKAQFESCGHRFVSLSETDW
FT                   GAALLSADKYGFSAKGNRLTLSLVRGPMFPDMLADEGHHHFVYALLPHDGRWWSEEVQA
FT                   EADLVNAGLHFTPATATENYDIAPIGFSGQSVRVHALKPAEDGEGHVLRLSESAGRRGA
FT                   FHLALPGGCKPTLINAIEVPLDDMDDPLSRPFGLASFLF"
FT   gene            416575..417717
FT                   /locus_tag="Avi_7450"
FT   CDS_pept        416575..417717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7450"
FT                   /product="extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7450"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40093"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5E5"
FT                   /protein_id="ACM40093.1"
FT                   /translation="MPMQRREFLKYSATGVGLAVAGARPAFAAPGVLDIFFNSDTNVID
FT                   FWTQVIKPGFEAAHSGVTLNLVPGGGGSAMNSLADRAMAAFKAKKDPQVDMLEAVTPFY
FT                   PTGSLEAGLWVDFSKAGLSNYDKVNPVVVQSPALLPYRGSQVVMMYNADKVKAVPTTFK
FT                   ELVAWIKANPGQFAYARPDLGDSGACFIERALQEVTGLNPDLFLPENYTPAYAEPLFSK
FT                   LWPLLKDIQPSLFNGGEYTSGNTASIQMLASGAVSMTVAWSDMALQAMSQGVVPETTSV
FT                   AQLQDLAFTGGFSGIVVPTVAANKDMVLKLADYLITADIQNHVVTDLGGFPGIKWEFMS
FT                   KELQDKFAKVAPKSIPLFPGTWEPALFEGWYRNVASNIKR"
FT   gene            417721..418590
FT                   /gene="potB"
FT                   /locus_tag="Avi_7451"
FT   CDS_pept        417721..418590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potB"
FT                   /locus_tag="Avi_7451"
FT                   /product="ABC transporter membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7451"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40094"
FT                   /db_xref="GOA:B9K5E6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5E6"
FT                   /protein_id="ACM40094.1"
FT                   /translation="MVMQTHGLSEGSRWTGLAFVAIPVLSIVIFLFYPAALTIVSTFWR
FT                   EGRDGVHALNFDSYVFFFTDAYSLANLGRTLWTTFVSLALLIAINLPIALYMRFTRGPL
FT                   ASLIQGLALFPMFVPGIIICYALIRYLGPNGWLQSLLSLIGFHHYASPYLTPWGPVIGL
FT                   LWDGMPLTLLILISGLSGISDASIEAARDVGAGRLRILVRIIIPQIMHSLLIVSALNFL
FT                   GFFGQALMPFMLGPTSPEMMGPFMLRTFASVRDPLQASTQATITFLICSLAGIAYVRSI
FT                   ARKPQDGE"
FT   gene            418593..419408
FT                   /locus_tag="Avi_7452"
FT   CDS_pept        418593..419408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7452"
FT                   /product="ABC transporter membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7452"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40095"
FT                   /db_xref="GOA:B9K5E7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5E7"
FT                   /protein_id="ACM40095.1"
FT                   /translation="MFLSSRRHDVFGLIILLFLIVFIVLPVLTVFLWAFAEQWFYPSVL
FT                   PTKWGFRFWSAVLARPDVWAALWTSVELSLTVTALSAIICLPAAYAFARMDFPGKSVFM
FT                   LSFLMANAFPRFALIISIAVLFLSFNLVGTFTGVVIIQLLNTLLLMIWLPAAAFRAVSR
FT                   DMEEAARDVGANRWQVFRHITLPQAFPTIAAALLMTFVWTFYETEGAWLVGAPRIRTMP
FT                   LLMMSMINNQLVVQYGAVLSVMLWVPSLAAILMARRVIGGEAFAKGLGG"
FT   gene            419448..420491
FT                   /gene="afuC"
FT                   /locus_tag="Avi_7453"
FT   CDS_pept        419448..420491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="afuC"
FT                   /locus_tag="Avi_7453"
FT                   /product="ABC transporter nucleotide binding/ATPase protein
FT                   (iron)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7453"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40096"
FT                   /db_xref="GOA:B9K5E8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5E8"
FT                   /protein_id="ACM40096.1"
FT                   /translation="MSTLALENVSKNYSIVTAIEPLSLTIDDGELVCLLGPSGSGKSTL
FT                   LRIIGGFETPSGGKVLIDGVDVARTPPEKRPTAMVFQSHALWQHMTVFENIAFGLTLRG
FT                   LPKAEIARKASDALAMVGLADYGKRLPAHLSGGQRQRVAIARCVVLEPKILLMDEPFAS
FT                   LDQHLRDRLREEVRQIQKKLGITTVFVTHGQDEALSVADRIVVMSMGRIEQVGTPREIY
FT                   STPNSPFVASFIGDMNSHSIQINQGGAHLGGVAIDAPIEAGEALLTVRPEDIVLSPSDD
FT                   QQGACVRRIVNYGSFLKIEAQAQDGTVWKVQTPKDADIKEGVFYTPVVARYTVFRDNKA
FT                   VHHAGPA"
FT   gene            complement(420492..421757)
FT                   /locus_tag="Avi_7454"
FT   CDS_pept        complement(420492..421757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7454"
FT                   /product="transcriptional regulator ROK family"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7454"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40097"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5E9"
FT                   /protein_id="ACM40097.1"
FT                   /translation="MTLLDRFDGGFARDGEDIIAGSRIEDARIHNRRLVFETIFQRGPI
FT                   SRVEISAIVGLKPQTISSITRELLEQELIVEAGRSSGLRGQPQIYLEANAEAGFSIGVH
FT                   LDQNQCHILVFDLKRQERARKSMRCDTANPDVTVRMLAQTITTLLHDNALPAERIWGLG
FT                   LVLPTFGSDVYDFDFSMRHWEAWRDASFAEDLQRLTGFAVLVENDGTAAAIGERLHRHD
FT                   AQEASFAYFYIGHGAGAGLIIDGYPFKGVGGNAGEIGLLPILGLGANPVWPDNPSSAVQ
FT                   GGVLSIGGLAAACGLSEQSMDEQSILSLLERRDHRLMDWLASAASVLRDVCAVIEVMFD
FT                   PGFIAVGGALPRALVERLVDRAYPLRPTPSARRDRALPRLLPATLIEDAAVTGAAMLPI
FT                   FVTTSHNFRHLYFRQILADDRS"
FT   gene            complement(421804..422682)
FT                   /locus_tag="Avi_7455"
FT   CDS_pept        complement(421804..422682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7455"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7455"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40098"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5F0"
FT                   /protein_id="ACM40098.1"
FT                   /translation="MESTMKLATAPDAWGVWYADDPRQTPWERYLDEVRDSGFTATETG
FT                   PWGYLPTDPSHLTDALGSRGLSVCGSALVHLLAPADAMETLRPRLEQTCGLLKAMKAEW
FT                   VVLMDDSDLPLPGQSRALSPHDWASMIRNIKDAARYVTEEHGLSFVFHPHVGSGVETEA
FT                   EVIRLLEETSEDSVGLCFDFGHHAYTGADAVAFMKRYADRIPYYHFKNVDPVLLAHIRQ
FT                   NNINFIEGFQSGVMCELDKGMVDFAEVRDFLATRGFDGYAVYEQDMYPCPPEKPFPIAC
FT                   HNRQVLRELGI"
FT   gene            422937..424013
FT                   /locus_tag="Avi_7457"
FT   CDS_pept        422937..424013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7457"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7457"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40099"
FT                   /db_xref="GOA:B9K5F1"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5F1"
FT                   /protein_id="ACM40099.1"
FT                   /translation="MVKLGLVGLGEVAQLIHLPILQRLTEMFTLAGAYDPSPSVAQSIS
FT                   TRWSIERVFDSVDAMIASPDIDAILIMSPDQYHGRHARAALKADKHVLIEKPCCLTMED
FT                   LAALSGVVEQTDRIAMVGYMRRFAPAFLEAKRRLPAFADITYVRVRDVICEGPWYFRQT
FT                   DTVVTPKDDIPASLIEESRQLRGTMMDSVLGPNAPAELQTAYSVLTGLSSHSLSAMRDL
FT                   LGSPKRVIAAEIKQGGSQITALFDYGHFTAIYECMIGDVVRFEAGFEINSRYNRLAFEY
FT                   PTPYIRNLPMVLDIQNSTDHDNSLTRLGPFHQDPFDVELRAFHAAVTQGGENRTPPSES
FT                   MADLDLFAAIISAARKTD"
FT   gene            complement(424178..424789)
FT                   /locus_tag="Avi_7458"
FT   CDS_pept        complement(424178..424789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7458"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7458"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40100"
FT                   /db_xref="GOA:B9K5F2"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5F2"
FT                   /protein_id="ACM40100.1"
FT                   /translation="MELTLILKSIVLGLAVAAPLGPIGALCINRTLERGFWAGVAGGFG
FT                   TALADAVYASLAALGFSAFAATLATIDTPLKIIGGLFMVWLGWKSLKPKPLADAAKVGA
FT                   RDLFGTIAATFFLTITNPVTILSFAAIFAGLGLADASGTTNAFFVVAGVFLGSLLWWFL
FT                   LSGGIALARQRLPPSFARWVSCLSGLILISFGLFALGSIA"
FT   gene            complement(424795..425244)
FT                   /locus_tag="Avi_7459"
FT   CDS_pept        complement(424795..425244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7459"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7459"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40101"
FT                   /db_xref="GOA:B9K5F3"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5F3"
FT                   /protein_id="ACM40101.1"
FT                   /translation="MDIIDRKIVSLLAEDARRSLADIGNIVELSASAVNERIRRLTASG
FT                   AIRRVTVDADPSAFDLPVIAFVWIALAADADEASFRTYAASQSAIAECHHVTGQWSYLM
FT                   KVHVASLAEIEAFLAGMKQNRFLARSETIIALSSVVPGPFMPKGS"
FT   gene            complement(425400..425609)
FT                   /locus_tag="Avi_7461"
FT   CDS_pept        complement(425400..425609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7461"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7461"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40102"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5F4"
FT                   /protein_id="ACM40102.1"
FT                   /translation="MLLRGPHNLRDILATPILKQTGSYEQASYASRNTSDVVQQHCARF
FT                   LRQDKAALVVKILNQVWEAAYRVG"
FT   gene            complement(426136..427674)
FT                   /pseudo
FT                   /gene="tnp"
FT                   /locus_tag="Avi_7463"
FT                   /note="transposase; Frameshift (pseudogene)"
FT   gene            complement(427750..429228)
FT                   /locus_tag="Avi_7466"
FT   CDS_pept        complement(427750..429228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7466"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7466"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40103"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR023875"
FT                   /db_xref="InterPro:IPR025404"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5F5"
FT                   /protein_id="ACM40103.1"
FT                   /translation="MTETCFLEGRGDLSEWREAARRCLQAGIEPKAIDWQLIGDEQGLF
FT                   GADASRSKEGSTPSPAERTGETAQMSVPATFLRLAEAVVCHSDPGRFALLYRLLFRLRQ
FT                   ERHLLEVKTDADVALAYRMQKSVGRDYHKMTAFLRFKEVPLPVGVAVRRRFLAWFEPDH
FT                   FIVARVAPFFQRRFNDMDWIILTPRGSASWDGQTLLTSTEPAVKPDIRDETDDLWRIYY
FT                   ASIFNPARLKVKMMMTEMPKKYWKNLPEAELIPGLIAGAEAKLIDMAQRQASEPLPFHH
FT                   RLQDAAARVPAAPVAEADTIDALRQEARRCNRCDLSCRATQTVFGEGPVDAKIMVVGEQ
FT                   PGDQEDLAGRPFVGPAGRVFDEALAQAGMDRRALYVTNAVKHFKYEPRGKRRIHQRPNI
FT                   AEVQQCRWWLTQEIEMVKPKLIVAMGAIALFSLTDRKDRLEDVRSRPIVMDDTRHLFVT
FT                   VHPSYLLRIPDEIKRNEELARFREDISQIGRLVC"
FT   gene            complement(429225..430457)
FT                   /locus_tag="Avi_7467"
FT   CDS_pept        complement(429225..430457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7467"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7467"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40104"
FT                   /db_xref="GOA:B9K5F6"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023874"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5F6"
FT                   /protein_id="ACM40104.1"
FT                   /translation="MKKSLKERLAILSDAAKYDASCASSGTTKRNAAAAGGLGSTEGSG
FT                   ICHAYAPDGRCISLLKILMTNFCIYDCAYCINRSSSNVERARFSVEDVIWLTLEFYRRN
FT                   YIEGLFLSSGIIRSSDYTMEEMVRIARELRTTHNFHGYIHLKSIPEASPQLIEEAGLYA
FT                   DRLSINIELPTDAGIGKFAPEKRPDNIRQSMGNLRLKIEEMADPTLQTKRRKRFAPAGQ
FT                   STQMIVGADAADDATILGTSARLYGSYGLKRVYYSAFSPIPDSSKNLPLIKPPLMREHR
FT                   LYQADWLYRFYGFDIAEITAARPDGMLDLDLDPKLAWALGHRDRFPVDINLADKEALLR
FT                   VPGFGTKTVTSILSTRRFKRLRLEDIGRLGVSLKKVQPFITAEGWTPHRLIDRADLRAM
FT                   FMPKPEQLSLL"
FT   gene            430561..430713
FT                   /pseudo
FT                   /locus_tag="Avi_7468"
FT                   /note="transposase; Incomplete gene (pseudogene)"
FT   gene            430710..431300
FT                   /locus_tag="Avi_7470"
FT   CDS_pept        430710..431300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7470"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7470"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40105"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5F7"
FT                   /protein_id="ACM40105.1"
FT                   /translation="MSLNPGKFQLPLAQNRGARHCVRIFANEIRRRSSGRLGEKWHLDE
FT                   AVVSIRGKKHWLWRAVDQDGFVLDVLVQSRRNAKAARHLMRQLLKGQGRAPRVMITDKL
FT                   RSYGAAKWELTPGVEHRSHKGLSNRAENFHQPVRRRERIMKRFKSQRHLQRFVSIHDPI
FT                   ANLFHIPRNDITSGHHRELRAEAMSLWAKIARA"
FT   gene            431287..431502
FT                   /pseudo
FT                   /locus_tag="Avi_7471"
FT                   /note="transposase fragment; Incomplete gene (pseudogene)"
FT   gene            431762..432781
FT                   /locus_tag="Avi_7472"
FT   CDS_pept        431762..432781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7472"
FT                   /product="transcriptional regulator LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7472"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40106"
FT                   /db_xref="GOA:B9K5F8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5F8"
FT                   /protein_id="ACM40106.1"
FT                   /translation="MVKERVTGLKDVAAAAGVSVTTVSRMLNGSLDLPGETRKRIEDAI
FT                   VALKYQPNPHARRLSRGRSDTIGLVVPDIANPFFATLVAAVEEEADLRGLALSLYATLN
FT                   RPGREMAYLSLLERNHVDGLIFITNHPDQGELAAIINRTGKVVVVDEDVPDATVPKLFC
FT                   DNRQGGELAGQHLAGFGHSHVLYIGGPDVMISTERRFTGFEAAMRAKHGENAVIERYCG
FT                   DYTAEFGRQAARRFLEGGREATAIFASSDEIAIGVIEVLRAEGISIPEQISVIGFDDVG
FT                   PLHLFAPPLTAIRQPVRGMGSRALSLLLDTDWQQPAKASEELLPVEIVVRNSVAPPAK"
FT   gene            432816..433775
FT                   /locus_tag="Avi_7473"
FT   CDS_pept        432816..433775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7473"
FT                   /product="ABC transporter nucleotide binding/ATPase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7473"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40107"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5F9"
FT                   /protein_id="ACM40107.1"
FT                   /translation="MMTRTFTRRTINAALAVTALTGLSLTAGIANAAQKTFALVQINQQ
FT                   ALFFNQINQGAQKAADAAGAKLVIFNANNDPAAQNSAIETYIQQKVDGIAVVAIDVNGI
FT                   MPAVKQAADAGIPVVAIDSILPAGPQKAQIGVDNAKAGADIGKFFVDYVKKDMGGKAKL
FT                   GVVGALNSFIQNIRQKGFEDTIKGVSGITSAGVVDGQNVQDNALAAAENLITGNPDMTA
FT                   IYATGEPALLGAVAAVQSQSKQDSIKVFGWDLTAQAIAGIDAGYVAAVIQQDPAAMGEA
FT                   AVKALKTISDGGKVEKTIAVPVTIVTKANVEPYRAVFK"
FT   gene            433772..434587
FT                   /locus_tag="Avi_7475"
FT   CDS_pept        433772..434587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7475"
FT                   /product="ABC transporter nucleotide binding/ATPase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7475"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40108"
FT                   /db_xref="GOA:B9K5G0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5G0"
FT                   /protein_id="ACM40108.1"
FT                   /translation="MISGGQLPTAVPGAGGVDLPRQPGEGGAREPRISLRGIRKTFGSH
FT                   QALRGVDLDLFPGECLGLVGDNAAGKSTLTKVISGTYIPDDGTITLDGEAVRFSGPAEA
FT                   RSRNIEMVFQDLSLCDHIDVVGNLFLGRELTKGPFLDRARMLVEARKMLDALEIRIPRL
FT                   TAKVEKLSGGQRQAIAIARAASFNPKVLIMDEPTSALAVAEVEAVLALINRVKARGVSV
FT                   VLITHRLQDLFRVCDRIAVMYEGTKVAERQIGSTNLEDLVKLIVGGERH"
FT   gene            434584..435588
FT                   /locus_tag="Avi_7476"
FT   CDS_pept        434584..435588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7476"
FT                   /product="ABC transporter membrane spanning protein
FT                   (sugar)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7476"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40109"
FT                   /db_xref="GOA:B9K5G1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5G1"
FT                   /protein_id="ACM40109.1"
FT                   /translation="MTAYTERAKGSAFADFITENAQVLSIAIFFFACMVFFSVTTDTFL
FT                   TLGNILNVVRQAAPILIVAVAMTLVIVTGGIDLSVGSLVALINATVAIVLATGLSWPLV
FT                   VLLMLVLGGVIGLIQGWFIAYQGIPAFIVTLAGLSILRGVALYITQGYSIPINDVPGFF
FT                   TLGRGEFLSLPVPALIAIAVTVFGFVLVSSTKYGRQVVAVGSNLEAARRVGMPAKWIVA
FT                   SVYLVSGVACALAGLLIAARLGSGSSNAAVGFELQVIAAVVLGGTSLTGGRGTMLGTLL
FT                   GTMTIAVIGNGLILMHISPFFTQIVTGAIILVAIWLNTRIFSANFRFGAAKKG"
FT   gene            435592..436659
FT                   /locus_tag="Avi_7477"
FT   CDS_pept        435592..436659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7477"
FT                   /product="resiniferatoxin-binding
FT                   phosphotriesterase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7477"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40110"
FT                   /db_xref="GOA:B9K5G2"
FT                   /db_xref="InterPro:IPR001559"
FT                   /db_xref="InterPro:IPR017947"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5G2"
FT                   /protein_id="ACM40110.1"
FT                   /translation="MTSELSEAHIRSGKVMTVAGPICVDEMGVTLMHEHILNDCRCWWH
FT                   QPKTPERQYLAEGFVCMEILGELRQDPFVNKHNITLDDEPLAITELMDFAKAGGKTVVE
FT                   PTCQGIGRNPLALRRIAKASGLNIVMGAGYYLASSHPAKVAEMTVEAIADEIVQEALVG
FT                   VDGTDVKIGLIGEIGVSSDFTAEEEKSLRAAAQAQLRTGLPLMVHLPGWYRLGHKVLDI
FT                   AAEEGADLRHTVLCHMNPSHDDLTYQGELASRGAFIEYDMIGMDFFYADQQVQCPSDED
FT                   AARAIVKLVEMGHLDRILLSHDVFLKMMLSRYGGNGYAYILRHFLPRLQRHGLGADALT
FT                   TLMRGNPRSVFQAAA"
FT   gene            436690..437460
FT                   /locus_tag="Avi_7478"
FT   CDS_pept        436690..437460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7478"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7478"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40111"
FT                   /db_xref="InterPro:IPR010768"
FT                   /db_xref="InterPro:IPR017027"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5G3"
FT                   /protein_id="ACM40111.1"
FT                   /translation="MTKKILLVGESWVSSATHYKGFDQFGSVTFHLGAEPLVKALEGSE
FT                   FELTYMPAHEAVEKFPFEMAGLDAYDAIILSDIGANSLLLPPAVWLHSKTVPNRLKLIK
FT                   AWVEKGGNLLMVGGYFSFQGIDGKARWRRTPVEDVLPVTCLPYDDRVEIPEGSTADVIK
FT                   PDHPTVAGLTGEWPLLLGVNEVEVRDGDDVEVVVRLPKDQGSHPLLVTGTFGKGRTVAW
FT                   TSDIGPHWLSPAFCEWEGYGKLWKNILGWMTQAR"
FT   gene            complement(437466..438362)
FT                   /gene="rbsK"
FT                   /locus_tag="Avi_7479"
FT   CDS_pept        complement(437466..438362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsK"
FT                   /locus_tag="Avi_7479"
FT                   /product="ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7479"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40112"
FT                   /db_xref="GOA:B9K5G4"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5G4"
FT                   /protein_id="ACM40112.1"
FT                   /translation="MRAWVIGNVAIDEIMSVPTMPEAGASIFGQQQSTDLGGKGANQAI
FT                   VLGRAGLDTTLIAAVGNDLRGSMIRQSLSLEPIDSRLIELVDKASDISMIFTTPDGENA
FT                   IITTTDCATSVRPEHVTSVLQTAKPGDLAILQGNLTDDTTAALLHEAKRCGMITAFNPS
FT                   PLRPGFAALWSLIDIAFLNQGEADKLTGESGEAATQCLRDAGVGTVIITLGGKGAILAD
FT                   RTGTTTIPAVPSVAVDTTGAGDTFMAVALASSSLRHVMPDGLALRHAAQAASITVSRRG
FT                   TRSAFPSQTELAAIFAT"
FT   gene            438409..439251
FT                   /locus_tag="Avi_7481"
FT   CDS_pept        438409..439251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7481"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7481"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40113"
FT                   /db_xref="GOA:B9K5G5"
FT                   /db_xref="InterPro:IPR005137"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5G5"
FT                   /protein_id="ACM40113.1"
FT                   /translation="MLDISDNTSSTMREIFGRDKALIGMIHCPAFPGAPRYRGASMTEI
FT                   YDACMLDAEALIEGGMHGLIIENHGDIPFSKPDDIGPETSAFMSVVTDRICRAVGVPLG
FT                   INVLANAPIPAFAIAMAGGAKFVRVNQWANAYVANEGFMEGRAAEAMRYRSMLRAEHIK
FT                   VFADSHVKHGAHAITADRTIQELTRDLAFFDADAVIATGQRTGNSATMEEIEEIGAATH
FT                   LPLLVGSGVSKDNIVEILKRTNGVIVASSLKHGDVWWNPVDIERVKAFVATAQPGLKA"
FT   gene            439257..440552
FT                   /gene="amaB"
FT                   /locus_tag="Avi_7482"
FT   CDS_pept        439257..440552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amaB"
FT                   /locus_tag="Avi_7482"
FT                   /product="N-carbamoyl-beta-alanine amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7482"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40114"
FT                   /db_xref="GOA:B9K5G6"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5G6"
FT                   /protein_id="ACM40114.1"
FT                   /translation="MAQAGKGLLEVNGERLLARLDQFAAIGATPKGGVNRQALTALDRQ
FT                   ARQLLADLGQTRGFSVYQDPIANLFLRREGQNPDLPPLLIGSHLDSQPSGGRFDGALGT
FT                   LCAFEVLETLEDNGIDTVRPVEVVAFTNEEGCRFAPGCMGSMAFSQGAIPAAWHTARAT
FT                   DGALFSDDLAATLADLQGAAMRPLGFPVFAYLEVHIEQGPSLEKEGLPIGIVTGIQGTR
FT                   WLQVTISGQTAHAGTTALSYRKDPMRAAVSGLNVLYNDIMPQDAHSRLTVGRFSLEPGA
FT                   INAIPAAVTFSLDIRHPNVEQLDLIEAKIRKVLQDLAVENGCGLEMELLFDMAPARFPD
FT                   HLVTILEGAVVKAGFAHKSMVSGAFHDALFINRVAPSAMIFTPCRDGLSHNEEEYVMPA
FT                   DSVAGAQVLLTASSQLLSNLATQASVVVAHLR"
FT   gene            complement(440590..443673)
FT                   /locus_tag="Avi_7483"
FT   CDS_pept        complement(440590..443673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7483"
FT                   /product="Acr family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7483"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40115"
FT                   /db_xref="GOA:B9K5G7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5G7"
FT                   /protein_id="ACM40115.1"
FT                   /translation="MNISAFSIRNPVPAILLFALMTVCGLIAFEKLKIQQFPDMDLPTI
FT                   KISATLDGTAPSQLETEVARKIEDKLATLNKLDHITTTITDGSVSISVSFSLEKDGEQA
FT                   LNEVRNAVDSVTDLPSAMQTPSVSRVTVQSSVLQTYAVRSSKLNETELSWFVDNDMTKA
FT                   LLKAQGVGEVDRFGGVDREIHVDINPDLLTSFGVTAADVSSQLKLVQENASGGRGDLNG
FT                   LHQTVRTLGAVNSVKDIAALSIPFSNGKSVRLDQIAKVTDSFSERSSLAYMGQTPVIAV
FT                   EVKRSNGYSDTGVATDLTRVMAAFAAEHPEVEIVQAYTTVQPTIDNYEASMHMLYEGAA
FT                   LAIVVVFLFLRDLRATLLSAVALPLSIIPTFLVIYLANFSLNTISLLSISLVVGILVDD
FT                   AIVEVENIERHLRMGKKPFDAAMEAADEIGLAVIATTFTLVAVFLPTAFMAGIPGLIFK
FT                   QFGVTAAVAVLASLMVARFLTPMMAAYMMKATPKVEVDGVIMKTYLSIVRACLRHRFLT
FT                   SLGIIVFLVVSLSAVSLLKTGFFPASDNAQTQVTLTMPPGSELSDTEAMSLKAVKLISG
FT                   LENIKRVFTVVGSSTSGGGADSSTTSDVTTATLVVDLTPINDRKLKQSQIEQQMRNVLQ
FT                   ELAGVRVEVGNGGNGTELQLTLASDDPILLDQTAAVVGEQLHGLKGIGGITSSAARQAP
FT                   EIQISPNFARAAALGITSDTIADVVRVATDGDYSTSRSKFNLPQRQIDIRVRLDPKYIR
FT                   NLDAISQLQLSGTNGKVSLGAIAGIRIGGSPSEIDRIDRSRNITFTIQLNGRALGDVNK
FT                   EAMALPGLSHLPPGVHVVQQGELERMSELFTSFALAMGIGIFCIYAVLVLLFHDFMQPA
FT                   TILMALPLSLGGALFPLIATGTSFSMPAVIGLLMLMGIVSKNSILLVEYAIMARRNGMD
FT                   RYEALIDACHKRARPIVMTTIAMGAGMAPVALSLSGGDTSFRQPMSIVVIGGLLTSTVL
FT                   SLLVIPVIFTFVDDLLGLVKRPFMKSQKDVADGESVNG"
FT   gene            complement(443670..444725)
FT                   /locus_tag="Avi_7484"
FT   CDS_pept        complement(443670..444725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7484"
FT                   /product="HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7484"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40116"
FT                   /db_xref="GOA:B9K5G8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5G8"
FT                   /protein_id="ACM40116.1"
FT                   /translation="MGFSKTDQAQTTQSAALTVSVTTPQTLQWADTIAVSGWLAAWQEA
FT                   IVAAETGSLKITDILVDIGSVVQKGDVLARLSDASAIADVHKQEAAVASAKATLAKAKA
FT                   DSVRAKKVTGSGALSDQDTLGYYITEQTDAADLASDEASLESSKITLSQTTITAPDSGI
FT                   VSSRSADLGNVVSAGTELFRLVRQGRVEWQAEVPSYQLPRIHPGAKATIHDQSGHDPSG
FT                   HDPSGKSFEGTVRLVSPIVSNDTGRGTIYVTLPNDPDIRVGLYESGTIELAVTPALTLP
FT                   ETALVYSDGINYVFRVNADNRVTRLRVDIGRRNNGRVEILSGIEAQAQIVEAGGSFLSD
FT                   NDLVLVKAATK"
FT   gene            complement(444788..446260)
FT                   /gene="nodT"
FT                   /locus_tag="Avi_7487"
FT   CDS_pept        complement(444788..446260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nodT"
FT                   /locus_tag="Avi_7487"
FT                   /product="nodulation protein T precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7487"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40117"
FT                   /db_xref="GOA:B9K5G9"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5G9"
FT                   /protein_id="ACM40117.1"
FT                   /translation="MTPAHDNALQPNNKLHGKWWLSLIVVPLSACVAVTQSNVDISKLA
FT                   NRWHATLPHSGSTAQLVDWWNTFNDPALSELLRTAEANSPTLESAVAEIEEARATLASS
FT                   KADYFPSLTGSGSYDRSGTRGSKANRVAPSTTGTGELDASWELDFFGKTRNTVEAARQR
FT                   VAEETADWYDARVTLAAEVADDYVQYKGCRQLQGIYAAELVSQQQTVKATEVSTASGLK
FT                   SSSDLALIKASAASTSSSLKSQVADCEVLIKSITELVAVDEDKVRDILNKSSSKIPRPA
FT                   KLSVDAIPANVIRQRPDVNALEKEAAASLADVATAKADLYPSFSLSGTLTASHSTSSGT
FT                   SLPWSFGPAVSIPIFDGGSLRATVKYKEAAYKAAIASYKSGVLTAINAVETAMVNVDST
FT                   ERQIGDAVVAAKNYRAYFKAIDTNWKAGGASVLDREDARRELQAAELTLVENQRDAVRD
FT                   WIALYKAMGGGWTPNATGGEMASDVDAKGVKQ"
FT   gene            446416..447102
FT                   /gene="chvI"
FT                   /locus_tag="Avi_7488"
FT   CDS_pept        446416..447102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chvI"
FT                   /locus_tag="Avi_7488"
FT                   /product="two component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7488"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40118"
FT                   /db_xref="GOA:B9K5H0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5H0"
FT                   /protein_id="ACM40118.1"
FT                   /translation="MTNVLLIDDDTELTTILSEYLTGEGFTVFAVVNGKQGLAEIAARR
FT                   IDMVVLDIMMPQMNGIDVLQRIRRVSEVPVLMLTARGDDVDRISGLNLGADDYVAKPCS
FT                   SGELVARLRAILRRVGPDKDVETEQLRSGDLVLNPANRTAEWRGLPFELTGTEFILLEV
FT                   LVRNAGQLISRQFISKQAFGRPLVAFDRRIDVHISSVRQKLGRREDGQSWIQSVRGQGY
FT                   QLIRDV"
FT   gene            447102..448373
FT                   /locus_tag="Avi_7490"
FT   CDS_pept        447102..448373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7490"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7490"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40119"
FT                   /db_xref="GOA:B9K5H1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5H1"
FT                   /protein_id="ACM40119.1"
FT                   /translation="MTRLFRKFFIFVWLAMTVSIVGIISLDRVFHLFPLKSERQQERIS
FT                   FVLQTIGEVLEQKGLVEAGKFAQAWVTFANPVIVSISSVPNLQCATGNDETLTIYRHHD
FT                   GACFRLSSQLRHYNFIEDALPDALPWIATVIASTLSALWITRYLVGPVAKLRNGLSALA
FT                   KGDFHTRIGGNFGKGQDEITALAMDFDVTAARLQELQEAQQRLFHDVSHELRSPLSRLQ
FT                   AVLGMLDKNPGRIDMIASRMGREVMRLDALVDEILTLARISSPEHAPPERQTIDLIDLI
FT                   TRIVDDACFEGQDRGVDVTYSGCDSFIATLNGELIYRAIENVVRNAVKFTTDDSTVAVT
FT                   AQAFRDVLSISVTDNGPGVPACDLERIFLPFSRSEIGETAKGHGLGLAITRKALELHHG
FT                   SAVASLTQEGHLLMTLKVPASPGL"
FT   gene            complement(448472..448729)
FT                   /pseudo
FT                   /locus_tag="Avi_7492"
FT                   /note="transposase; Incomplete gene (pseudogene)"
FT   gene            complement(448734..448928)
FT                   /pseudo
FT                   /locus_tag="Avi_7493"
FT                   /note="transposase; Incomplete gene (pseudogene)"
FT   gene            complement(449507..450397)
FT                   /gene="gstR"
FT                   /locus_tag="Avi_7497"
FT   CDS_pept        complement(449507..450397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gstR"
FT                   /locus_tag="Avi_7497"
FT                   /product="transcriptional regulator LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7497"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40120"
FT                   /db_xref="GOA:B9K5H2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5H2"
FT                   /protein_id="ACM40120.1"
FT                   /translation="MDRFTALKVFCAVIEARSFTKAGNNIGLSRPAISKNIRELEAHVG
FT                   VTLVNRTTRGVMPSEAGSRYYQIVSELLWRHEQADEVASQSGAELRGTLRVTMPVTLGL
FT                   HLILPVLPQFNEENPECSLDLCLSEEKQQLVEGNFDVAVRASQRLEDSTLMSRCIGSVT
FT                   YAICAAPSYVQKSQSLKSPKDLEDHQLVVHGANIGDQKWRFSAQGESCYVSVRAQHKSN
FT                   CSEAIKSLTVAGMGIARIPRPYVSRELAEGRLVELLSDWTMEPLTIYAMYPQSNFLPRR
FT                   TRLFIDFMSRALKVY"
FT   gene            complement(450527..451267)
FT                   /locus_tag="Avi_7498"
FT   CDS_pept        complement(450527..451267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7498"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40121"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5H3"
FT                   /protein_id="ACM40121.1"
FT                   /translation="MLDLRASCESGAAPYGRMVGPMQKLKRLQASIPMICPPSTRSPRT
FT                   VIIAAPHDVVADCRFSRDWLSSEELHRLGHFRSALDQRRFEAAHLLKRSVLARQRCAFQ
FT                   SQPLQRLGQASPGPDGSCGARYRTDARPGWVGRRSSESCAASRRTVGAAILDRHRSHAK
FT                   AQRTAFALDPRLLQMCASEDGFQARSPEFAVSGSWCPADDHHLIAVAGGGIQRLWHISR
FT                   TSKDLGIRLCSSVFWPLTNICEIG"
FT   gene            complement(451681..452448)
FT                   /locus_tag="Avi_7500"
FT   CDS_pept        complement(451681..452448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7500"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7500"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40122"
FT                   /db_xref="GOA:B9K5H4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5H4"
FT                   /protein_id="ACM40122.1"
FT                   /translation="MSDFKWRHFQGEVILWAVRWYCRYGVSYRDLEQMMGERGVAVDHS
FT                   TIYRWVQKYAPEIEKRLRWHWRRPQSTSSRVDETYVKVRGKWTYLYRAVDKFGNTIDFY
FT                   LSPTRNAKAAKRFLGKALNGLKDWEKPRVINTDKAPTYGIAIAQLKAEGKCPDELVHRQ
FT                   VKYLNNVVEADHGKLKQLIKPVRGFKTLKTAYATIKGFEVMRALRKGQAAIFNLTKDIR
FT                   GEARIVERAFGLGPSALTEAAALLAQNLQAHTA"
FT   gene            complement(452804..453727)
FT                   /gene="pecM"
FT                   /locus_tag="Avi_7502"
FT   CDS_pept        complement(452804..453727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pecM"
FT                   /locus_tag="Avi_7502"
FT                   /product="regulator protein pecM"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7502"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40123"
FT                   /db_xref="GOA:B9K5H5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5H5"
FT                   /protein_id="ACM40123.1"
FT                   /translation="MDNKSRQRFDLLITALVPLVWGSTYLVTTQFLPPGIPLTAAALRA
FT                   LPAGLILVLLQRKMLQGHWWWRAALLGVLNIGAFFYFLFLAAYHLPGGIAALLMSIQPV
FT                   IVLIYSAILFRNPVRATQILACLCAALGVALVALRSDVMLNTQGVTAGLAGAFSMATGM
FT                   VLAKKFGRPDNMSLLALTGWQLTFGGLALVPFALMTESFPETLTLRNIGGLSYLSLLGA
FT                   LVTYALWFRGIARLPALTVSFLSLLSPLTAAILGAIFLGQTLTWIQFGGGMLVLVSVYL
FT                   SQPQVSFFGLGSAFRKQLSSKPAQGG"
FT   gene            complement(454438..455295)
FT                   /gene="orfB"
FT                   /locus_tag="Avi_7504"
FT   CDS_pept        complement(454438..455295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orfB"
FT                   /locus_tag="Avi_7504"
FT                   /product="IS3 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7504"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40124"
FT                   /db_xref="GOA:B9K5H6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5H6"
FT                   /protein_id="ACM40124.1"
FT                   /translation="MKRDILMTNAAQPSVKSTPYWWDGCTFPTLSTKPVSATCDVAIVG
FT                   GGYTGLSAAIELARAGLHVQLFDRTSLGQAASSRNGWVVNPKRNYRLYKEMDLQLRNKV
FT                   PKRRVKAKLRSDRTAATRSNDVWAMDFVHDQLATGRKIRVLTVVDTFSRFSPAVDARFS
FT                   YKGEDVVQTLERVCRQVGYPATIRVDNGSEFISRDLDLWAYHRGVVLDFSRPGKPTDNS
FT                   YIESFNGKFRAECLNAHWFMSLDDARAKMEDWRRDYNEFRPHSAIGNKVPISLMNGSSA
FT                   PTPT"
FT   gene            complement(455324..455677)
FT                   /locus_tag="Avi_7505"
FT   CDS_pept        complement(455324..455677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7505"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7505"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40125"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5H7"
FT                   /protein_id="ACM40125.1"
FT                   /translation="MSKLTFIDQNNLPEPRKGQPLPDRLVEGDPQFLTWDIAQTTDGLV
FT                   SCGVWEVTPGAYRSIKGETFEFCVILSGVSELIEDGCEPRRISAGDSFVMHPGFTGVWK
FT                   VIETTRKLWVSRD"
FT   gene            complement(455701..456381)
FT                   /gene="nocM"
FT                   /locus_tag="Avi_7506"
FT   CDS_pept        complement(455701..456381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nocM"
FT                   /locus_tag="Avi_7506"
FT                   /product="ABC transporter membrane spanning protein
FT                   (nopaline)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7506"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40126"
FT                   /db_xref="GOA:B9K5H8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5H8"
FT                   /protein_id="ACM40126.1"
FT                   /translation="MDINIITYAVPFLLTGAKTTLLIAVFGIGFGLPFGVLLALGRGSH
FT                   NHVLRRTCDFYCAIFRGTPMLVQIFVIYYGLAQISFVRQNPILWWMIGNGLHAAILAVI
FT                   LNTCAYTAEIFRSALLSLPRGLIEAAEACGMSGWHIFIRVKFPLALRQALPAYSSEVAI
FT                   IVKESSLASTITVLEITGYAKRLMSETFAIMDIFIITAAFYLAINVIALMALKFIERRL
FT                   SFSR"
FT   gene            complement(456383..457096)
FT                   /gene="nocQ"
FT                   /locus_tag="Avi_7507"
FT   CDS_pept        complement(456383..457096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nocQ"
FT                   /locus_tag="Avi_7507"
FT                   /product="ABC transporter membrane spanning protein
FT                   (nopaline)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7507"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40127"
FT                   /db_xref="GOA:B9K5H9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5H9"
FT                   /protein_id="ACM40127.1"
FT                   /translation="MLNDIWELLIGKGWALALLRGGAVTIAIGLLGMLLGLVIATPLAL
FT                   LRWRRVVVISQLIDAYSVIVRGVPGLLVIYLLFFGSVDWVRAITSMFGYQNAAENAYPM
FT                   IIGVIAIAAISCAYSIEVIRGALQSVPVGLIEAAHSLALPGKVTFFRVIFPLALRLALG
FT                   GLNNVWQMTIKDTSLISVIGLQELMRTAAIAAGITRSPLLFYGVAALLFFTLTGVSQAM
FT                   FARAERYLNRGFNGC"
FT   gene            complement(457157..457975)
FT                   /locus_tag="Avi_7508"
FT   CDS_pept        complement(457157..457975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7508"
FT                   /product="ABC transporter substrate binding protein (amino
FT                   acid)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7508"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40128"
FT                   /db_xref="GOA:B9K5I0"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5I0"
FT                   /protein_id="ACM40128.1"
FT                   /translation="MSITKIIQSTLASTLLLIAATSAAYAEEGVLRIGTEGDAPLFSMA
FT                   DANGNVTGFDADIANGICAELKVKCKFVVQAFSSLIPSMDSDRFDVIISGLGITEERAK
FT                   KIDYSIPYATTPLYFVVPKSSPLAGLKSLTEIEKSLTGKSVGVVTGTTYAKFIEKRIPG
FT                   ADLKTYDATTQQTADLASGRLDAAFGDSPTWMDFLASADGANFTKIDVKIMSMDDPDVL
FT                   GHGMGVGMRKGNSALKAKVDAALCKMVTDGKVKDASMNWFKDDYTIPCKK"
FT   gene            complement(458014..458790)
FT                   /gene="nocP"
FT                   /locus_tag="Avi_7509"
FT   CDS_pept        complement(458014..458790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nocP"
FT                   /locus_tag="Avi_7509"
FT                   /product="ABC transporter nucleotide binding/ATPase protein
FT                   (nopaline)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7509"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40129"
FT                   /db_xref="GOA:B9K5I1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5I1"
FT                   /protein_id="ACM40129.1"
FT                   /translation="MTDVLKVHDLVKAFGSVNILNGINFRMREGEVISLIGSSGSGKST
FT                   ALRCVNFLETPTSGQIEVMGEAISVITNERGEREIVNACNIREFRRRIGMVFQSFNLWP
FT                   HRTVLGNVTEALIYVLKKQKHEAQEMALSALSKVGMVDFRDRYPHQLSGGQQQRVAIAR
FT                   VLAMAPKLMLFDEPTSALDPELVGEVLKVIRTLADEGATILLVTHEMRFARDVSNRMIF
FT                   LHKGIVEQDDTPEELFRNPASGAVERFLSSVMPAAA"
FT   gene            complement(458809..460212)
FT                   /gene="bioA"
FT                   /locus_tag="Avi_7510"
FT   CDS_pept        complement(458809..460212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioA"
FT                   /locus_tag="Avi_7510"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7510"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40130"
FT                   /db_xref="GOA:B9K5I2"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5I2"
FT                   /protein_id="ACM40130.1"
FT                   /translation="MMTNIAEITDMDRRTVLHPFTYLKDYASGATEPTIMETGKGVRIK
FT                   DATGREYIDGFAGLYCVNIGYGRTEVAEAIARQAYKLAYYHSYAAHTTEELARLSDRLI
FT                   RMAPGNMSKVFYGLSGSDANETQAKIVWYYNNLRGLPRKKKIIARERGYHGCSVVSGSM
FT                   TGLSFYHDHMDLPISGILRTGVPHFYRGAYPGETELAFSERRAHELEALIIAEGPDTVG
FT                   AFIAEPVLGTGGITPPPAGYWPKIQAVLKKYDVLLIADEVICGFGRTGAMFGSDLYGME
FT                   PDLVTVAKGLTSAYVPLSASIISQKIYDVMEEATPRVGSFSHGYTYSGHPIGAAAANAV
FT                   LDIVEREDLAGQAAQKGAYLLNRLKAEFEQNPIVGEVRGVGMMAAIEFVADRGSKLSFD
FT                   PALKVGGRISQAARDRNLIARAMPHGDILGFAPPLVMTEAEIDEMVAITKAAVDEVLKQ
FT                   LDSEGAVIG"
FT   gene            460437..460913
FT                   /locus_tag="Avi_7513"
FT   CDS_pept        460437..460913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7513"
FT                   /product="transcriptional regulator AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7513"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40131"
FT                   /db_xref="GOA:B9K5I3"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5I3"
FT                   /protein_id="ACM40131.1"
FT                   /translation="MQLDRLDARLLNILQTHNRHSTEELGALVGLSATAVQRRLKRLRE
FT                   NGVIEADVSIIRPKDVGRPIAMLVLVSLERERADIVDRFKQSIRQTPEVMNGYYVTGDS
FT                   DFVLIVTAQSMEDYEGFTRKFFYENPDIKGFKTMVVMDRVKVGFSVPIDFDDFS"
FT   gene            461338..461610
FT                   /locus_tag="Avi_7514"
FT   CDS_pept        461338..461610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7514"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7514"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40132"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5I4"
FT                   /protein_id="ACM40132.1"
FT                   /translation="MSTVDVEDLLAERGFIVSRETVRLWMNRFGRHFSDCIWGDRPKPN
FT                   DKWHMDEAIITISGKKYWLWRAIDADGDVKAAKRHQADTKPGARC"
FT   gene            462221..463141
FT                   /locus_tag="Avi_7515"
FT   CDS_pept        462221..463141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7515"
FT                   /product="carboxyphosphonoenolpyruvate phosphonomutase
FT                   (CPEP Phosphonomutase)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7515"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40133"
FT                   /db_xref="GOA:B9K5I5"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5I5"
FT                   /protein_id="ACM40133.1"
FT                   /translation="MSEYLSDENLYYVPEIFDCMSTKAAEINGFKMVMISSSDFSCAYT
FT                   GIPDLKLLTVDEYAGMAERITNMTDMPLFIDADEGFGRPLQTFQGCRRLAKAGAQAILI
FT                   TDLAANGRPGLLPIEEAVYRFRAAKDGLAGTDCLLLARCDHSVDNDFDEFVERCNRYLE
FT                   VGADIICPLELNRSQKYGSKIAAAKKVAEHVKAPFWYPNMEKEKAEDIASLREYGYKFA
FT                   GVHYAFRAAMLAILDAGRHVFESGTNEYIATAHDHTGYKFHYSPMSAFFRGGEWVDRER
FT                   QYVSNPDEALAVRLEKHFTGPTDKF"
FT   gene            463236..464933
FT                   /locus_tag="Avi_7516"
FT   CDS_pept        463236..464933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7516"
FT                   /product="ABC transporter substrate binding protein
FT                   (oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7516"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40134"
FT                   /db_xref="GOA:B9K5I6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5I6"
FT                   /protein_id="ACM40134.1"
FT                   /translation="MPECLQTGEKPSIEGGKKEHFYRSIKSQNAAIAIKKMGNEIVMKT
FT                   AIKRRNFIKAGASLAAFGLLGDFANQAMAKSVEGGTLKIGTSNELNYNMLCFAMTGGPY
FT                   DYVYSWPIYESLFKPNANGTIDPWLAESVESDAKALTYTIHIRRGVTFSDGSVLNATVV
FT                   KWNLDHYLKVGAKRVALLGSITSVDVLDDYTVRLVLSKWSSFIPAALSRECGYMFSQQH
FT                   YEKYGDDYCQQHPVGTGPFVLKEWVRDVSKSFVRNEHYWGGKVLLEAVQYTIYNDSLVG
FT                   QAALMSDEIDVMIGLGLNGVKTLAANGFDAPIEPLQDHASLLVFNSLNTSNDDPMGNLL
FT                   VRQAISHAINRKSIIEAAFLGYADIASQFGIGSHFVNKDIVGYDYNVAKAKELLAKAGF
FT                   PQGFSTKIQAAASDTNKIVLQIMQADLAKVGIQAKIELLTGAASNKAETGWGSGMWYHT
FT                   SSVYVDVAMQMSSMFPKGLTGGVLGLTTMLRPDDVSDALVRAVSSTSDAESVKAVGEAN
FT                   KMMIDTYALYVPIAQYSTIYVLSKRVKASGIGATFFSVASLSTAYLDT"
FT   gene            464930..465883
FT                   /gene="dppB"
FT                   /locus_tag="Avi_7517"
FT   CDS_pept        464930..465883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppB"
FT                   /locus_tag="Avi_7517"
FT                   /product="ABC transporter membrane spanning protein
FT                   (dipeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7517"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40135"
FT                   /db_xref="GOA:B9K5I7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5I7"
FT                   /protein_id="ACM40135.1"
FT                   /translation="MITYLLKRLAIAGFLMLLVSALVFLLMRGLPGDPALIALGDSASA
FT                   DAIEAYRNRMGLNDPLIVQYVHWITGILLRWDFGKSVLNEQNVSLMISQRLPNTLTIGI
FT                   PSIILGIILGLPIGILSAITRGTWIDQSFTLIVNAFLGTPRFLVAIFGVFILAFKLRLI
FT                   PLQGYTPPWVDLAAYAHKAIWPVFINSIYIFAVLARYTRSNLLEVMTQDYIRTARANGL
FT                   SETRVIFRHALKNGLIPVVTIIGLQMPQIIAGAVIIESIFNIPGVGQLVLNGVLNRDYL
FT                   VVQAAVLVISMATIASNLMVDLTYALIDPRIKRMAW"
FT   gene            465891..466778
FT                   /gene="dppC"
FT                   /locus_tag="Avi_7518"
FT   CDS_pept        465891..466778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppC"
FT                   /locus_tag="Avi_7518"
FT                   /product="ABC transporter membrane spanning protein
FT                   (dipeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7518"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40136"
FT                   /db_xref="GOA:B9K5I8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5I8"
FT                   /protein_id="ACM40136.1"
FT                   /translation="MTKTSATVNEPIQRSAGRMLAGRLFARGLIVQACFAILVLFGLLA
FT                   LFADLVAPYDPNAQDLVAALHTPSAAHWLGQDSLGRDVVSRIIYGGRISMAVSVMAGIL
FT                   AAIVGIGFGLYAGYVGGKPSRFIMGCTDVLLSVPNLVFSLILVAILGSGVLSVVLAIGI
FT                   GFIPTYIRMVNGLVLSLREHDYILAARLIGQKPHSILLRHLLPNSFPTLIVLFTINLGN
FT                   GVLTESTLSYLGVGIGPPTASWGSMVSDVYPYLMSAPWLVVSPALCIILVIIAFNVVGD
FT                   SLRDALDPRLKGKL"
FT   gene            466778..467803
FT                   /locus_tag="Avi_7520"
FT   CDS_pept        466778..467803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7520"
FT                   /product="ABC transporter nucleotide binding/ATPase protein
FT                   (oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7520"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40137"
FT                   /db_xref="GOA:B9K5I9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5I9"
FT                   /protein_id="ACM40137.1"
FT                   /translation="MTQTPHLLEVKNLRTSFFTEDGEVKAVNDVSYHLDQGEVIAIVGE
FT                   SGCGKSITQLSVIQLVQSPPGRILGGEVIFDGQSLLQYKPKSKEMRSVRGAGIAMIFQE
FT                   PMTSLNPVLTVGQQLSEVIKVHARVSKKQAWQRGVKALEAVGIPDPAARMKNYPFEMSG
FT                   GMRQRVMIATAVACNSKVLIADEPTTALDVTTQAQVMELLLDLVDSHGKSLIIITHNLG
FT                   LVSRYAKRVYVMYAGKVVESGTTEQLLTAPKHPYTQGLLNSMPKLEGNKNDDLVPIQGA
FT                   PPRLNGLPDQCAFLPRCPAAQSRCADSSFPPLRTVGAQDHTAACHLAEMDADRLIAGVR
FT                   T"
FT   gene            467800..468792
FT                   /gene="moaD"
FT                   /locus_tag="Avi_7522"
FT   CDS_pept        467800..468792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaD"
FT                   /locus_tag="Avi_7522"
FT                   /product="ABC transporter nucleotide binding/ATPase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7522"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40138"
FT                   /db_xref="GOA:B9K5J0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5J0"
FT                   /protein_id="ACM40138.1"
FT                   /translation="MKEQVMSDDPLLVVENLRKYFPIRQGFTREKIGDIKAVDDVSFSI
FT                   HKGQTFGLVGESGCGKTTTGKSVLGINNPVEGKILYKGRDLARLSECEFRPYRRELQLI
FT                   FQDPYGSLDPRQSAASILDEAIQSGGEGLTAGEMRARVHDLLDIVELGNAMGRRYPHEM
FT                   SGGQRQRLGIARALACKPELIVCDEPVSALDVSIQAQIINLFKSIQKELGITYLFVAHD
FT                   LAVVRHISHHIGVMYLGRLVEVTNAEQLYSDARHPYTKALLSAIPITDYYAEQKRERIV
FT                   LRGEVPSPMNKPSGCPFHPRCAQATAECKEIVPELRSVGQNHTAACHHV"
FT   gene            468870..470054
FT                   /locus_tag="Avi_7524"
FT   CDS_pept        468870..470054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7524"
FT                   /product="aromatic-amino-acid transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7524"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40139"
FT                   /db_xref="GOA:B9K5J1"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5J1"
FT                   /protein_id="ACM40139.1"
FT                   /translation="MLDTLTMPPPDKILALMPIFRQDSRSHKLDLGVGVYRDASGITPV
FT                   LRAVREAEARMLQHQTTKAYIGPAGDALYCDLMTKLVFADHAPVERIRAIQTPGGAGAL
FT                   TVICGLIAKAAPNATLLVPDPTWVNHLSIIEDNGLAVKRWPYLDPTTGGVDFEALKQTV
FT                   CSAKAGDVILLHGCCHNPTGTDLNQAQWRELGALLAEKGVVPFIDIAYQGFGDGLDEDA
FT                   FGVRYLATLVPEMLVASSCSKNFGIYRDRTGVAFVLGQTQKQAEIAAAQMVVRARIAYS
FT                   MPPDHGSRIVSTILQDADLSADWRAELEDMRNNIIGLRQALAKAFQLRTQSNHYDFLIA
FT                   NKGMFSKLGVTPQQVERLRNEFAIYMVEDSRINIAGLRHEQINNFVEAVVSVTR"
FT   gene            complement(470060..471931)
FT                   /gene="nocR"
FT                   /locus_tag="Avi_7526"
FT   CDS_pept        complement(470060..471931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nocR"
FT                   /locus_tag="Avi_7526"
FT                   /product="transcriptional regulator LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7526"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40140"
FT                   /db_xref="GOA:B9K5J2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5J2"
FT                   /protein_id="ACM40140.1"
FT                   /translation="MDHYGIELKPLAKFVLACQNPSISNSSRALGIAPSVLSAALHGLE
FT                   DRLHMKLFERKGRYLGLLPSAFWLYRNAAVLLHLEEFSRRSLAIPANRMEKLSVRIDLN
FT                   FSIGRMTKAVSCAIQQMGLQHPETFIACQFLDTASAASGGFIRESMDHIPAEHCATIEI
FT                   GCHNEHSFREEPGTELLYRDPWIAVSATDPVTDIKADADILAVVRMSAHQMQVVAHYAD
FT                   QHGLSARLKFVDAGPAELGRLLSDFPHMRFLLPSSMVANRLGISRIYRESLVPPLVSMV
FT                   RVGTSGALETKARRFIGLLRENMEGEEQNVVFDPQLTARQMHYFNLVHRCGGISAAARV
FT                   ANLAQSSVSAQLHSMEAVLGTPLFERSKEGATPTDAGINLWPLMAEVEKRQDRLSRQSG
FT                   DIAAHTQHRVSIGMLPSSGHDSALTEKIAEALTMISIQHPSLKMEITEASNTILHDKVR
FT                   SGELNLAIVGVVQPQFPRVLLGPSEPLSVVANPRFNFGGRSEINLAEVCELPLVLGARH
FT                   LSIHQSFAAATHARNLEPHSKIEVGSLALAIAMVRRASLCTILPASSVQKDLETGRLVA
FT                   IKINQEEISGTLSIIFSADRELSGAERAVMKTLVDVFGKKLHEGLAR"
FT   gene            472246..473613
FT                   /locus_tag="Avi_7527"
FT   CDS_pept        472246..473613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7527"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7527"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40141"
FT                   /db_xref="GOA:B9K5J3"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5J3"
FT                   /protein_id="ACM40141.1"
FT                   /translation="MSDQSCRTMMAVLQKQGELLIVDEEIDPVYDLSALLSLTHETHAV
FT                   RINKVKGSAFPVFGNLLSSLDRIALALDVPRASIQSTLLASVQKPVAPVVVENAPVQQQ
FT                   RFEEGVLARLPVPTFFDKETGPYISAGMMIARDPETGLGNASYARLKILSPTEALIGIA
FT                   PNHHLAIMARKAADKGEALPFAVVLGAHPAIQLAACLYLGLGDDEMHCAGALLGEPVRM
FT                   ARCYNSDILVPAEAEIVIEGHIHANTPIVEGLVSEYHGMYEDYGSGVLATFESMSARED
FT                   AMFQVILPGYHAEHIYIAAVPIAVSLKAQLARVILNVGEVAVTASGCGRTNVVVQIDKP
FT                   RPGQARRAMAICWGAVSIVKSVTVVDSDVDPWDINAVELAKSTRMRVDRDILIIPGMTA
FT                   DRSEPQEEAGMVAKIGYDATCKAGDRKEGYDKALPPQASYERMSRVIAAIKPEGAV"
FT   gene            473610..474185
FT                   /locus_tag="Avi_7528"
FT   CDS_pept        473610..474185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7528"
FT                   /product="3-polyprenyl-4-hydroxybenzoate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7528"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40142"
FT                   /db_xref="GOA:B9K5J4"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5J4"
FT                   /protein_id="ACM40142.1"
FT                   /translation="MKRLIVAITGASGACYGVRALEMLRDIDGIESHLIISPAGLRTAI
FT                   EEEAVESADQIRQLADVVHSHKDIGASIASGSFRAQGMLVAPCSIKTLSSIVHCYNDDL
FT                   ITRAADVCLKERRRVVLMVRETPLHAGHIALMDQATRNGAIIMPPVPGFYTQPKTLADL
FT                   VSQTVGRALDLFDIDHPSVRRWKQEGDT"
FT   gene            474294..475919
FT                   /gene="dppA"
FT                   /locus_tag="Avi_7529"
FT   CDS_pept        474294..475919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppA"
FT                   /locus_tag="Avi_7529"
FT                   /product="ABC transporter substrate binding protein
FT                   (dipeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7529"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40143"
FT                   /db_xref="GOA:B9K5J5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5J5"
FT                   /protein_id="ACM40143.1"
FT                   /translation="MANILKNCENIASRSVRAITVTLALLGASAAIYGTSIQSAVAEEQ
FT                   PVKGGEMTIINGSDIKSWDPAIIGGTYPGGPMDMLDAIYGFLVYVDVDGKVQGGMAKSL
FT                   TSADAKVWTLTLRDGVKFTDGGSYDAEAVKFNWERQAMPDTLSPSQGFVASWIGGVKIV
FT                   DPLTLEITLPKPDRNFGSSLAQLAPFIASPQALKAAKTKTDIKPVGAGAFVLDSWNQGV
FT                   SMSMKRNPQYWDQPRPYLDTLKFAIIPETNSRIATVVQGGATMMAGYPYQFGSNAKAAG
FT                   VTTHEIPIPGLYRAYFNQKSGAFTDQRAREAFYEAINPSKLMQAYTQVSGYDIPTNYFT
FT                   KSSPFYDPTYKLPTYNPKHAQELFDQLAKDGKPFNIKLVTYSNSDLKRLASYLQQALSA
FT                   YDNVTVNLQLVDQAMLSPTCKGQMNFDFCVDGGVLVANGAEPIISNLLNSNGNDNWGKY
FT                   NSIDMDKELAEANATMDAAAVKAAYAKVQKRVATDLPLYIFGAETRFLLLRDTTGGIVP
FT                   SNGGILQKQYLYVCKDACASKTAK"
FT   gene            475985..476917
FT                   /locus_tag="Avi_7530"
FT   CDS_pept        475985..476917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7530"
FT                   /product="carboxyphosphonoenolpyruvate phosphonomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7530"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40144"
FT                   /db_xref="GOA:B9K5J6"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5J6"
FT                   /protein_id="ACM40144.1"
FT                   /translation="MFDKRPRTTFRELFSKEQVFTPCVWDCYSAKAAEMAGFKAILLSG
FT                   ASLGFSMSGVPDMGLHNQEELIWATDRIADYSPLPLIIDADDCFGDVAQAYRTCRRLAK
FT                   AGAAAILLEDTPNERGYARFGRAMEAATLAGKVDGNVDHPVVSQELWLAKIKAALDACA
FT                   GTDCVVIARTESKLEKGLDDAIERCVRAEELGAEMTYVHGLRTLEECQKVAKALPGWKM
FT                   FGDVATVGGKAFVELEDIAALGFNMVTMHYLEKGSMYGMMDFGRRVFADRSTRYSDEHT
FT                   MGGYSREEQRQMLERDIGWMDAEEEWKKI"
FT   gene            476889..478061
FT                   /gene="dppB"
FT                   /locus_tag="Avi_7531"
FT   CDS_pept        476889..478061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppB"
FT                   /locus_tag="Avi_7531"
FT                   /product="ABC transporter membrane spanning protein
FT                   (dipeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7531"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40145"
FT                   /db_xref="GOA:B9K5J7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5J7"
FT                   /protein_id="ACM40145.1"
FT                   /translation="MRKKNGKKSESLSHNCRWRAANGNFCASGAHVLEYAPLRFSKSPF
FT                   SPRQHQFSNRLLPFVETEPLKGGNDVTMQAMPYVKAISTRLLAGIPVFLLVTFGATALS
FT                   NLAPGSPAQLILGDNATAEQVAALNQTYGYDLPVWERYLKWLGDLFHGDLGQTLFSQQP
FT                   VLQVVMDRATVTFEVAALAMLVSMLGIPLAMFTASHPGKLTDRAFRSVASVVLAVPTFV
FT                   IVVLLSYLFAIVLRWLPATGWVNFSENPLANLWYVALPVLCLSLHQTAYLYRVARNEFV
FT                   TTLQEDFIQVARAKGLPLGYILFRHVLRPSMPQILTVMGLSLTYMLAGSFVVESYFAVP
FT                   GIGWTVLTAVKSHDIPLVQAILSLTVVVFVTIFMLVDIGYAIIDPRVNVT"
FT   gene            478058..478978
FT                   /gene="dppC"
FT                   /locus_tag="Avi_7532"
FT   CDS_pept        478058..478978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppC"
FT                   /locus_tag="Avi_7532"
FT                   /product="ABC transporter membrane spanning protein
FT                   (dipeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7532"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40146"
FT                   /db_xref="GOA:B9K5J8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5J8"
FT                   /protein_id="ACM40146.1"
FT                   /translation="MSTPGTPSPSMADKNSDLSAIVRANMPWSARLRLPGASPFELVAL
FT                   GFLILLVLTAIFVNFIPGLVSPRFPYGDFSQPPEWSLNGLLGTDDIGRSILSRVLYGAR
FT                   ASLMIVGVATCISVFAGLLLGMLAGFYRGIFERMVDLYANTMSALPSILVVLAFVTATG
FT                   PSVLTIMLTLGILDIGTYARVAKAGVISQSNRDYVLAARAMGARDSRILLKEILPNLVP
FT                   ALTAVMPTLMAGLIITEGSLSFLGYGIPAPAPSWGGMIASSTDLLSRFPLLILGPVMAI
FT                   ILTVYAFNTVGDYFAQRLNSRERES"
FT   gene            478980..479993
FT                   /locus_tag="Avi_7533"
FT   CDS_pept        478980..479993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7533"
FT                   /product="ABC transporter nucleotide binding/ATPase protein
FT                   (oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7533"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40147"
FT                   /db_xref="GOA:B9K5J9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5J9"
FT                   /protein_id="ACM40147.1"
FT                   /translation="MASDISQPPILSCERMSCTIAAKPAPLQVLHDINFSVPRRTTLGI
FT                   VGESGAGKSMLIKSIMGISPTPVRVEGRIVLDGIDLSTLKPKARSQMIGRKVGIVFQNP
FT                   MTSLNPYATIGRQIEEAGRFHLGLSRTQAQERAIELLTVVGIADAKDCYGYFPHQFSGG
FT                   MKQRIMIATALMCHPDLLIADEATTALDVTVQKEVLDLLQILQEERQMSMILVSHNLGV
FT                   VAGRTDNILVLYGGHIVETGPTAEVFRNPRHPYTGALLSAMPRMDQPAHARLHTIPGQP
FT                   PSLANQPKGCPFAPRCPSAQALCHEIMPPMTMDGDHHFACHFPLNDTSALREVSHG"
FT   gene            479986..480963
FT                   /locus_tag="Avi_7536"
FT   CDS_pept        479986..480963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7536"
FT                   /product="ABC transporter nucleotide binding/ATPase protein
FT                   (oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7536"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40148"
FT                   /db_xref="GOA:B9K5K0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5K0"
FT                   /protein_id="ACM40148.1"
FT                   /translation="MVDPLLNVSGLSVDFSRGAKMMRAVDNVSFSLAPGETLGLVGESG
FT                   SGKTTIGRALLRLLPQADTRWKGAVDYQGTDLAKLSSGDMRRMRGKLQMIFQDPLSSFN
FT                   PRRRVEDIVAEGLVILGVAKPERDRRVRAALKDVGFDLDAVAGRTPHQFSGGQCQRIAI
FT                   ARALAVEPELIVCDEPVASLDVSVQAQVINLLQDIRETRKLALIFISHDLAVVKNVSDR
FT                   VAVLYRGRIVEIGLGEEIYALPAHPYTRTLLEAVPVVDASRKVTPERKRMEVPSRNQPL
FT                   SGCAFRTRCPRATELCANKEPVLRLAFRGQMVACHHPHDEPVSA"
FT   gene            480974..481495
FT                   /locus_tag="Avi_7537"
FT   CDS_pept        480974..481495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7537"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40149"
FT                   /db_xref="InterPro:IPR012659"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5K1"
FT                   /protein_id="ACM40149.1"
FT                   /translation="METADDFANNAWTAMCNLYRAPNVAQFCIRLQDGYGIDVPLLLLL
FT                   FYADQQGIGTDIQDLNAFLTDATSWREDVVKPLRTIRQGMKGRYTEHDEVQLRETVKAL
FT                   ELRAEQVHVSRLARSFMSHAKPTDESQATETYLESCGVPEGQRGAALLFFQAAAHGAHI
FT                   QNHDQGRRLL"
FT   gene            481492..482868
FT                   /locus_tag="Avi_7538"
FT   CDS_pept        481492..482868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7538"
FT                   /product="allantoinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7538"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40150"
FT                   /db_xref="GOA:B9K5K2"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5K2"
FT                   /protein_id="ACM40150.1"
FT                   /translation="MSDFDRVVRGTLVTEDGITENGFVAIRDGIIAALGSGSAPAAREV
FT                   DDFGSALILPGIIDGQVHSRSQKDQEDFIWSTRSAAAGGVTTIVDMPYDAGGKLICTAE
FT                   LLTEKAESAAEQARVDFALYGTIRPSDGPKHIAEMADAGAAGFKFSTFETDPNRFPRIP
FT                   TPLLYAAFAEVAKTGLIAGVHNENDECVKVWSEAVKATGRTDYLTHGESRPPIAETLAI
FT                   AEVYEIAAATGCPAHIVHCSVGRGYELAQAYRAQGVDATIEACIHYLVCSEEEDVSRLL
FT                   GRAKCNPPIRSAKEREKLWQHLAAGHITIVSTDHVSWSLAAKSATVMLENSSGMPGLEV
FT                   LASLLLDGLTDRGLPLTFAAKLLCGNPARLFRLTAQKGALSIGLDADIAVFAERPRIYD
FT                   AAASGHNVVGWSPYEGKRIRHTAIATFLRGQMIYDGKDVLAAPGTGRFIKPTRALSKVA
FT                   "
FT   gene            482873..484132
FT                   /gene="amaB"
FT                   /locus_tag="Avi_7539"
FT   CDS_pept        482873..484132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amaB"
FT                   /locus_tag="Avi_7539"
FT                   /product="N-carbamoyl-beta-alanine amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7539"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40151"
FT                   /db_xref="GOA:B9K5K3"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5K3"
FT                   /protein_id="ACM40151.1"
FT                   /translation="MANMQSVPSIDRTKLQADFDALAALTEPGRPWTRRSFTPLFLEGR
FT                   AYLKTRFEEEGLSVRLDAAGNLIGRWEGAQRHAPVLMTGSHSDTVPSGGRFDGVAGVLS
FT                   GLAAIRALRLAGYRPQHPIELVDFLAEEPSDWGLSCIGSRGMAGALTDHHLALLGPNDE
FT                   PLREAIDRIGGNVSQLSSARRDDIFSYLEIHIEQGPVLEAKHIPIGVVTAIAGIGRVKV
FT                   RFEGIAGHAGTSPMDMRADAALAMARFALAVRDAACAMQGKGHFTATIGVLTIEPGGAN
FT                   VVPGASEAIVDIRAEDDGMMDSFIEALEGLANKAATDEKCQVALFERLSKTRAVACDSS
FT                   LRVVLESAASDLNLPTLSLASGAGHDAAFMAQVTKSAMIFVPSRDGKSHTPDEWTDNEA
FT                   IALAADVLVRALVHLDSNTP"
FT   gene            484241..485854
FT                   /gene="hutH"
FT                   /locus_tag="Avi_7540"
FT   CDS_pept        484241..485854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutH"
FT                   /locus_tag="Avi_7540"
FT                   /product="histidine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7540"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40152"
FT                   /db_xref="GOA:B9K5K4"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005921"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5K4"
FT                   /protein_id="ACM40152.1"
FT                   /translation="MTTIILDGDSLTIKQTVQIARENAQVEIAAAARAEIIKKRAYIEE
FT                   NWLTENAPPTYGFNTGVGKLKDYKINQADNEQFQLNIVLSHCSGIGKPASEEIVRAMMA
FT                   VRINAFCVGVSGLRIEVVDRLVQMLNSGVHPVVPIQGSVGASGDLAPLAHMVSVLIGYE
FT                   DAEAIYKGERMSAPKALELAGISPVSFELKAKDCLALINGNSLCAGMGALTLHDAEELM
FT                   KTADAIGALSLEAIRGEQAAFDARIHEVRKQPGQILTAENIRRMVEGSRRASESARAVH
FT                   LEDDILHPTYHPRVQDQYSFRCLPQVHGSCRDQLEHAKTVLTRELNAATDNPLVFWNEN
FT                   GALEFLSGGNFHCEPIAFAMDLLAIALIEIGNISERRLFALCDTTLNYGLPPNLAGKPI
FT                   GLNYGYGIISTAAAAVASENKTLAFPSVADTIPTKSSQEDHVSMAAWSCRKAQQVLDNL
FT                   PKIIGVECLLATKAIFLTRHALGSFKLGRGTQPLYDALAAVIPLQDGDGYMQKQIKPAF
FT                   AMVTEGKVLNVVETAIGPLR"
FT   gene            485953..486312
FT                   /locus_tag="Avi_7541"
FT   CDS_pept        485953..486312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7541"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7541"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40153"
FT                   /db_xref="GOA:B9K5K5"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5K5"
FT                   /protein_id="ACM40153.1"
FT                   /translation="MTRSSRDPLYRRHRFPAEVIAHAVWLYFLFPLSLRIVADLLAARG
FT                   ILVSHQTVRLWAEKFGRHFANDFRKRSTGKLGDKWHLDEVVITIGGKKHFHLFASIYDP
FT                   IANRACRKFSGLIVC"
FT   gene            complement(486526..488442)
FT                   /locus_tag="Avi_7543"
FT   CDS_pept        complement(486526..488442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7543"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7543"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40154"
FT                   /db_xref="GOA:B9K5K6"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5K6"
FT                   /protein_id="ACM40154.1"
FT                   /translation="MARADLTALTDDGLTQLSNAGLVKRAQRELANGTGPELAELDDGT
FT                   IEARFADGTLTRLAPGRELADASCTCPSSGVCRHRVMLAMACRETRTQDRDGQPDVAVA
FT                   WNPATLDLEGFEAALAPSAKAELNRLLGTRHSVRLVYGQVPAARLPMASVRFLVPGDLG
FT                   YARCDCIQQRNCVHVALAIRAFRAADDTSEAVVGGASAIAAGTADTGALATACTELLAQ
FT                   LLDVGVTAGLTAHALLIERCRRQAEKLGASQMLLVLEGLVEQIESYSARSARYDERAAL
FT                   RLGVELVARTKASDAATALGLGEPFETAMSKSRLVSLGGRLRQEGLDVRASVLLADSDT
FT                   GATMLLERLFSALPNETGPLQASVLRRQFSPGLPVLGVGRGQILTSVARRRADGLLALG
FT                   SGTGGKTQVMPRDGNFTFASPLAARHVDAVTSDFSKRAISLIRPRKRVDDIHVFEVEEA
FT                   LGQSWSAGAQIWEGAVRLANEGGTLHLEREFDAGAPAATGVLAAAMEGRWGRIRYIAGP
FT                   VRLDGDALVCEPWSLSADRFIVPDLDTPEEMMATVTPRQVSQQSDILDEVERLLSGSIH
FT                   AGSRARAHREAVGKPLKARLTAAGFVSLASRLGDWMVAEPGRATSTFCDVAVWLLTLKE
FT                   SHV"
FT   gene            complement(488445..489587)
FT                   /locus_tag="Avi_7544"
FT   CDS_pept        complement(488445..489587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7544"
FT                   /product="von Willebrand factor type A (vWA)
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7544"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40155"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5K7"
FT                   /protein_id="ACM40155.1"
FT                   /translation="MSQAAALDPLTRWRLILGEASDAACSAAGCTMSGDAMAMDAALDW
FT                   LYGRDDEDGARNISRQGGRGPSALTTPQWINDIHRLFPKETIERLERDAIEHYAIDDIV
FT                   TNPDVLSRAEPNETLLKAVLRTKHLMSPDILVMARKLVQEVVRQLMEKLSREMAVAFSG
FT                   VVDRRRHSRFKIASDLDFRRVLKDNLKHYNAESRQLTVERLHFFARNRRHMKQWQVILL
FT                   VDQSGSMLDSVIHSAVTAACLWGLPGVKTHLVAFDTSVVDLTSDVDDPCELLMKVQLGG
FT                   GTDIQRAVGYAADLITQPENAIVILISDFYEGASEAMLLQRVAELTAQRTLVLGLAALD
FT                   SDAEPAYDREMARRLVSAGAEVGAMTPGELAGWLAAKIGR"
FT   gene            complement(489584..493573)
FT                   /gene="aceF"
FT                   /locus_tag="Avi_7546"
FT   CDS_pept        complement(489584..493573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceF"
FT                   /locus_tag="Avi_7546"
FT                   /product="dihydrolipoamide acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7546"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40156"
FT                   /db_xref="GOA:B9K5K8"
FT                   /db_xref="InterPro:IPR008893"
FT                   /db_xref="InterPro:IPR025406"
FT                   /db_xref="InterPro:IPR036930"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5K8"
FT                   /protein_id="ACM40156.1"
FT                   /translation="MERYELVEGTSSKFWQVSLDGTTLTVTYGRIGTQGQTKEKEFDSV
FT                   DAAIKEKNKLVKEKTGKGYALSGSGPAPVKTATPKPKAAEKKEMPVQQAAALALAERPV
FT                   TSAEAPAAAVPPEAPAEPAPAPLVIESSEELEKLLGDPLPTRTEPQTTYYLEADAWKAL
FT                   RNTLQVTLPKATEKEKASAQWLEERLGEDGPKAPAGGGAVGWLKSKLGGKQEAFMGVEE
FT                   ARTWITHILNATNRLSITLGGGDEKSRPVDLLCLRYFFHWLARTSGAPIVAEAALPLVG
FT                   TENQARRSYENSAWSSALSLALRDALVKAPAEEYEQVVDVFMQACDEQVDWKRRAYFAF
FT                   VLGDDRVGEHDLKALAVLNGAAVSGLDVGATLEMVPLIAEAPPSAVVRWRTKRTYFIYY
FT                   TYFDLPLEDIAATVIGAADLYRESALPALEWLLHYAYDAQRTLVARIVLATGEDAALGL
FT                   LLPFLHEKWIRAALDEATEANPANVFRQYVTSLAAGRSDPVIRSRVLDMTKRYPADTLK
FT                   QWLQGNNKALSQLDRLLEAQNVTLAGNDALPAVLQDPPWRKKAKKSDDLVLSLKPAETQ
FT                   FRYEPDGPPGHENHWRISQAKVIANTDELIELITEFEAKPFPDWYGVPARSRPLPQRGD
FT                   DEGDVLGFIYERVMQIHRAKSYAINSSGWNTLFAGIDRQPDALALVLWSCPGVATGYFA
FT                   DDVYPRMMARFGERGLPGLLRQIEGDPIGMIDRAKDVDASEIAPHAARALLKLKKARVP
FT                   AMQWLRTHRQTAVTRLIPDAVGDKGIAREAAEHALRWIAGDRNDGRAAIEAVAQDYTTQ
FT                   DAKVPEAVSEVLDRDPLQRYPARIAKLPTWFKPAAMTRPLLKQGGALSDEAMAAIAEML
FT                   SFSTPEGIYGGIDIVKEFTTPESQAGFAWDMFAAWLADGAPSKDGWALRAVGWMGDDEC
FT                   ARKLTRLIRKWPGEAAHARAVTGLDVLADIGTDVALMNLNGIAEKLKFKGLQEKAREKI
FT                   AVLAEARELTPEELADRLAPDLDLDDRGGMDLIFGDRRFRVGFDEFLKPWVKDETGKRL
FT                   KDLPKPIKSDDQELAAEATKRWAALKKDARAISSLQITRLENMLSTSRRAAPEVFWTFF
FT                   ASHPLIGHLTQRLVWGVYADHDPSTAPTTIFRVSDDLSVTDAQDETLDLDFSAQATGFI
FT                   GTVHPLHLPAGGLDAWGALFGDYEISQPFPQLGREIHLLLETEKDTSEISRFEGLKVES
FT                   PRLRGMAARGWRLGAPQDSGCIWWLERPVQFPDGSTHAAMFYFSDGIFTGGGDWEDKEQ
FT                   TLGKLSLEQPYARTKTSERKFDELDAVTVSELLRGLALLAETAVK"
FT   gene            complement(493596..495890)
FT                   /locus_tag="Avi_7548"
FT   CDS_pept        complement(493596..495890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7548"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7548"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40157"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5K9"
FT                   /protein_id="ACM40157.1"
FT                   /translation="MAQDRGGRLTVVGVRHHSPACARLVSQTVERLKPRFVLIEGPADF
FT                   NPHMNDLRLPHTLPVAIFSYHAAAERSFASYSPFCAYSPEWEALQSAWKVGATPLFCDL
FT                   PAWHPDFGNRTNRYADPHTVRAAAAEAALGHALGEDGLDALWDALAEQAPVAELDERLD
FT                   RYFDLLRPEGAEDPRELAREKFMAGHAAWALREAGIGKVVLICGGWHAEAIRRLTEEMD
FT                   GEKPDMPEPGEHERVGSYVLPYDYQRLDRFTGYASGMPSPAYYEHVRERGLGFAADWAA
FT                   NAITHGLRDAGQVVSTADRIAWQAHAEGLARARGHSAILRVDLLDAALATLVKDGLEAP
FT                   AAWTQAGAVRSGTHPALVAMLKAMTGNRRGRLAAGTRRPPLLDDIDARLLEADMVPGPT
FT                   ARRLELDWNEPADRGQAHMLHALRLLRMPGLERLEGPSAIETRAPLEVFRLIRHRDAEG
FT                   VLIEASRWGGTLPMASSGLLADRVARAGDDLDVLTSCLSDALFAGLLVLESELTGKIAS
FT                   GIARSHEIGEIGKAGLQAVRLYRFGHIFGSHAHQALGRLCEQIFARVLWLVGDIHNEDE
FT                   GRRSLNALIACRDMMRDCPSLDIDSEALVGTLARCVANRSTISALAGAALGTMIACGRS
FT                   DISGIASQMRHFSRPTQLGDFLAGLFALSREEIAADLPVIDAVTQLVDDWGDDEFLQAL
FT                   PALRQAFSFFPPREREKLAQVILRTHGRGEARAQIEAMQWMRQRSSTETQAAALALEAV
FT                   VERRLTRAGLI"
FT   gene            complement(495898..496989)
FT                   /locus_tag="Avi_7549"
FT   CDS_pept        complement(495898..496989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7549"
FT                   /product="moxR-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7549"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40158"
FT                   /db_xref="GOA:B9K5L0"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5L0"
FT                   /protein_id="ACM40158.1"
FT                   /translation="MQDKTGIASIQRPPAEIAYRAELEALIRADRGPRPPGWNLSLKSV
FT                   KSFILGGNGATTKLVASPSLVERAMVTLATSRALLLIGEPGTAKSFLSELLAAAISGDS
FT                   KLTIQGGASLTEDQIKYGWNYALLVSEGPSRRALVPAPLHTGMSHGKVVRFEEITRCPL
FT                   EVQDSLLSILSDRVLAVPELSGEDGMVFAREGFNIIATANTRDRGVNDMSAALKRRFNF
FT                   ETVFPIRDADEELELVKRESAKLLARSGVPVTPSDDLLEVLVTCFRELREGLSSEGSME
FT                   RLSSVMSTAEAVSVAHAVGVRGHYLRGDSGRPEDIVECLAGTAAKDNAEDLKKLVRYLE
FT                   QKASKRPGAAWKALYEARHLLTP"
FT   gene            complement(497289..498467)
FT                   /gene="purA"
FT                   /locus_tag="Avi_7550"
FT   CDS_pept        complement(497289..498467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="Avi_7550"
FT                   /product="adenylosuccinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7550"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40159"
FT                   /db_xref="GOA:B9K5L1"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5L1"
FT                   /protein_id="ACM40159.1"
FT                   /translation="MSTAYAVLGAGWGDEGKGLMTDALASAGSVVVRANGGAQAGHTVQ
FT                   RPDGTRHVFHHVGSGALRGATTYMSRFFIHNPLLLLRELSELDKIGVRPSLFADPNGLV
FT                   TTPWDMMINQIAEEARNSGRHGSCGLGINETIRRSERDGFKLQFSDLANLTKMDEIVRR
FT                   IQKEWVPSRLTELGFLPSEAWQARLVSPVIAERFTQDVEDFSRVVWPNDGTVAAVASAS
FT                   DRLIFEGAQGLLLDQDHAFFPHVTPSKTGIANPSILAAEWGVGEIKAIYMTRAYATRHG
FT                   AGPFPRATPEMVYPDATNIPNLWQGTLRFGALDLDLLAKTILEDEARSSVRVETSFAMT
FT                   CLDQIADQAVWWRSNIRETGAGKDLLEAARRHLQCPLAGKSFGPCREDVTFG"
FT   gene            complement(498464..499396)
FT                   /locus_tag="Avi_7551"
FT   CDS_pept        complement(498464..499396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7551"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7551"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40160"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5L2"
FT                   /protein_id="ACM40160.1"
FT                   /translation="MGDGRFDPTDWDSFTTRTTAGKTRDAVFSSRSLHDSLNPAKAKGL
FT                   MRESRDGTVNPSSNPIIIGLDVTGSMGTIPDYMVRDGLPAFFTSIYERKPVSDPHVMFM
FT                   GIGDVVCDRAPLQVSQFEADIRIAEQLKDLFLEGGGGGNSSESYTLPWYFAAMHTSTDA
FT                   FEKRGKKGFLFTVGDEEVPPLLKAEEIERVMGVRPQMDYTAEQLLDLVSRRYHVFHVVV
FT                   EQGSHFQSYPDRVRNSWQSVLGQHVLMLSDYTKLAEVVVSTIQIVEGEHAADVASSWSG
FT                   DTALVVQKATKGLSPATKSGGLRWFGGKK"
FT   gene            complement(499389..500414)
FT                   /locus_tag="Avi_7552"
FT   CDS_pept        complement(499389..500414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7552"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40161"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5L3"
FT                   /protein_id="ACM40161.1"
FT                   /translation="MDTADEILAIPVNEPERLFQAPDQITGQYHRLAKLWHTDHAGGQR
FT                   DVFEHLTLLRDEANLHVSQGRWQVPGLLELAGRKIRYFKSYPFELGTAYVGNSIIAYVV
FT                   EKDFLSLAHRAEAAIRGLTFANDRMATEMLLRLPQIKSAFDTDQGQRVLVMEKPAGLVR
FT                   LSDLISHFGSKVDPRHVAWVMSDLLNTACYLGSFRQLAHAGLCTDTVFISPKGHVAVIL
FT                   GGWFYSTPLNEPLVALPEWTDQLLPAAARNTERASGAIDLELIRGIGREMLGETSGVSI
FT                   GEDNAIPQAMRDWLQRPSGLDAKGEYRAWIKALEDSFGARRFTELSVNASDVYGKDAHN
FT                   G"
FT   gene            500590..501249
FT                   /locus_tag="Avi_7553"
FT   CDS_pept        500590..501249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7553"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7553"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40162"
FT                   /db_xref="GOA:B9K5L4"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5L4"
FT                   /protein_id="ACM40162.1"
FT                   /translation="MVDCAIFTLKDQALHLLLPERAKNLQTGQRALVGGRLHLNVDRSP
FT                   EDGAMRVAREKLGIDVRYLEQLHSFGGLDRDEGWTVTIAYIAIVQMDQIPVSLQSDLFP
FT                   VDKIPKLAFDHNEIAAMAIARMRSKSSYSSLPAFLLPPEFTIDDLRHVYQQVTGAKLVK
FT                   TTFRDQVLRQGFVEKTGKMSTGRTYRPAELWRLADRTVANFNRVVSREAGYRRAIK"
FT   gene            complement(501813..502559)
FT                   /locus_tag="Avi_7554"
FT   CDS_pept        complement(501813..502559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7554"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7554"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40163"
FT                   /db_xref="InterPro:IPR009412"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5L5"
FT                   /protein_id="ACM40163.1"
FT                   /translation="MPCAAPLSQLFSRPKHRHAVPARVFSCTILVDFRTEDQDDMCNTL
FT                   RVRWTIIPQTAPQPWIVCSGCGGLRAFQSSGKIRLNANGRKLDAWLIYKCLTCEKTWNR
FT                   PIFERQNVRDIDPVVLEALQSNDPQWIRTETFNLEALRRKSQRVDEFSEFRIEKAILHE
FT                   ADHWTKLQIELVVLFPTSTRLDRLLASELRISRSRLQTFHDSGMLQTNSDRPDVLRRRI
FT                   KTGIQVIIDLSTEAERVKLWRPLATL"
FT   gene            503466..505427
FT                   /gene="vgrG"
FT                   /locus_tag="Avi_7557"
FT   CDS_pept        503466..505427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vgrG"
FT                   /locus_tag="Avi_7557"
FT                   /product="vgrG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7557"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40164"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5L6"
FT                   /protein_id="ACM40164.1"
FT                   /translation="MDDVLSPTDFIQASRVLKLLSPLGEDQLLPERMTVDEGVNRLFEI
FT                   TVSVRAKREAVKPEELIGKLVDVSLEIRQGELDGDGVRRPFNGLVTNLFEGPPVTRGLR
FT                   SYTLTIRPQLWLLSRRSDCRIWQNMTSMQVMETLFSEHGIPAAASAPLHKTPPSREFSV
FT                   QWNETDLDYLLRRFEQDGLFYWFEHETGVHRLKVSDSKVAWSKPSAAAEGVDKVRLAQG
FT                   SSDRNHINEWMRQFSYVPGQRAGADWNFETPSTVPLNVTPSLIQMPGAKQRELYEYPAR
FT                   ISDIKEAEVAETFRTQATEADHERVTGQSNVRFLEAGRRFTPYEEPHPEHKYEEHVITR
FT                   IVHRVVDRSYETASNEMEYANAFEAIPSRVPLTPHRETKRPRIEGTQVAIVAGPSGEEI
FT                   HTDKYGRIKLWYPWDRKAKKDGSDTCWVRVAQNWAGGQWGGQIIPRIGMEVMVAFIDGD
FT                   PDRPLVTGVVPNPKNAVPYDLPTNKTKSVFRTNTHKGKGYNELTFEDEKDREEVYVHAQ
FT                   KDQNIKVENNYSKRINTNKVESVGHNKATEVTNNHYEVVGGDMDIRVGPSNKWSITPQQ
FT                   ADTMAAGIGQATYAFGEKGQSPIGEGNLHIVVQKNKSQKIGDTHTEDVGRLKIIDVGDE
FT                   YSLRAVNNVVIEAGKNLS"
FT   gene            505592..506602
FT                   /locus_tag="Avi_7558"
FT   CDS_pept        505592..506602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7558"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40165"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5L7"
FT                   /protein_id="ACM40165.1"
FT                   /translation="MRFLLRLIGFILLLTALSCSEEKKEDVSSNFSPEGRAIMEKENLS
FT                   DEQISNLKLVEIDYSKAPSEMRAIAYKIFLRQSLTQPDLKALGENINKSFPERKPNGLY
FT                   RYGRTLLVTAVENQNLDAVNALLEAGADPYVSTDPNNESEQIRSWNFLYLAMKQEGQKL
FT                   PDSDYFDKTYANQLLQLYLKHGGDPNYRWPDGQSLLEFTVGDNFEGFKILLQAGADPWK
FT                   RGEQDTPLAVQCVTLMRKPSCIQYLAENGYYDKTPENYMYDMIDAATNELEAGARTDPE
FT                   EVGQSYSEYGRYADAVKLLLQRSHYPLGEGSTLYRLLYVESGTYRKKLQEKRDGN"
FT   gene            506592..507974
FT                   /locus_tag="Avi_7559"
FT   CDS_pept        506592..507974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7559"
FT                   /product="phospholipase A1"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7559"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40166"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5L8"
FT                   /protein_id="ACM40166.1"
FT                   /translation="MATDDFSSAGTAELDPAVQKADQRPSNNTTTVSGDTSMDRCLRRA
FT                   AWLIFDVYDQQYSQMTIQTRPMLADVRKNWSKVFDNQNKRAGYRAVLYRPNGSDGDRAT
FT                   LCPPALIFRGSDLNKEELSGLAITIEIEYHWDLGLLSANPANKPPHRFEFVFAPNPDVA
FT                   QLKPSELAGVGFTPTSIVKNDAGNITLRAISPTWIQIPVTVAAQWNASITVWTKDQGDW
FT                   ATNFRQGVGLRTTQYDDLTVADARKAAQIAMNEWGGRLMIIGHSLGGGLASLAACVAQK
FT                   ENPTLKLAARTFNAAGLHPATAARQKTSLSAATVRSFAVEDEILTTLQKRSCPIPLITH
FT                   ILRWAGKTMPEAITGHAFERRRPGMDDLWPVQAQEFPMLTEAERIAASCSTLSDFVKRY
FT                   VETIWSALPLGTAWNLYKLKGESEGIAKRADRSVGLHLMPDVVHTYPDRFERYLPPAKP
FT                   GK"
FT   gene            507987..509033
FT                   /locus_tag="Avi_7560"
FT   CDS_pept        507987..509033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7560"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7560"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40167"
FT                   /db_xref="InterPro:IPR018683"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5L9"
FT                   /protein_id="ACM40167.1"
FT                   /translation="MHLKTKLPFQHLYFRHWGRDDREMAVLIVKAGLRIPYGGIAEDLL
FT                   SPQPDLLLTDLFHREINDSPLRQESDLAPFKPKTDVTFNAVACSPEEKEIDSWPVSIAV
FT                   DGRLSHSFHVFGERFWEPQTRAARRKWKLSSVKPTTSIPLTYERAYGGVAPISYEEHTT
FT                   HAYNPIGRGLISDYLLEMNREVAAPQIALVGEFAAERPTESMTVCGCGPIQKSWLPRLS
FT                   LAGTFDDAWVRERHPRMPLDYDFAYWNAAPLPMQAAPYLIGDETIRLTGFRHDPRPYVF
FT                   RLPGMALGIKIRREGLQDITEHMLNLDTVHCDIADGVQERHTLSMTWRLTLAEPDDIRE
FT                   IEMFARRP"
FT   gene            509109..509534
FT                   /locus_tag="Avi_7561"
FT   CDS_pept        509109..509534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7561"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7561"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40168"
FT                   /db_xref="InterPro:IPR025425"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5M0"
FT                   /protein_id="ACM40168.1"
FT                   /translation="MSHSAARYTDKNNAIVCLSPDVCLTPRGSKDVAVPYMILSKLEAS
FT                   ERTVKNVSFGGDEAFTMNSRTSTVTGNEAGTSGGVQSGVNTGWCRPQSNKTSFFVNGHQ
FT                   VIQDNCLHEMNCSGPDGSSNTLGKLMFVDTDGRGRDG"
FT   gene            complement(510082..510786)
FT                   /locus_tag="Avi_7563"
FT   CDS_pept        complement(510082..510786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7563"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7563"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40169"
FT                   /db_xref="GOA:B9K5M1"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5M1"
FT                   /protein_id="ACM40169.1"
FT                   /translation="MSYDRKDIAHLADEYVLGLLEPTQAEEIENAMERDPELKAAIAAS
FT                   RDRFLPLDTSMAPRPVSEDLWKRIEASLPVQDNRPAKPNTHIANDNGSRRWKLAALTSL
FT                   AASLLLVVGLVYSLTRAVEPLVVAVLVNEAGEVQAVVEDFGNDQTSVRLLADFVVPRDK
FT                   TIQVWTLPSRDVGPVPLGLLEGVRSARLHGPTLPKPRNDQLYELTLEQAGGSPTGRPTG
FT                   PILAKGFARMPR"
FT   gene            complement(510783..511328)
FT                   /locus_tag="Avi_7564"
FT   CDS_pept        complement(510783..511328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7564"
FT                   /product="ECF family sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7564"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40170"
FT                   /db_xref="GOA:B9K5M2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5M2"
FT                   /protein_id="ACM40170.1"
FT                   /translation="MGSRPVNLDEALDGCAKGDRLALRHIFDQEAGKLIAVAQRIVRRR
FT                   ELAEEVVQDSFIRIWTHAYQYRSDSGSARGWIYAIVRNRALNLLRDGKREHSVEEVETL
FT                   QGDQQTDEIMAAWHRLDRNSRLYDCLGALEDTKRQGILMAYVGGYSHGEIAGRLRIPLG
FT                   TTKSWIRRGLLALRECMA"
FT   gene            511533..512321
FT                   /locus_tag="Avi_7565"
FT   CDS_pept        511533..512321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7565"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7565"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40171"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR025507"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5M3"
FT                   /protein_id="ACM40171.1"
FT                   /translation="MQTIRFTLAASISVIATATSAFAAPVLALSGDKTLVIFDTEKPSV
FT                   TKTMDVTGVDKLVGIDYRSGNKTVIGVTPDHRIVSINLETGAASEVAKMDKMLTMTDAP
FT                   VVVDFNPMADRLRFMTGTTNHRVHPDTGAVTVDGVLAFEEGDMHKGETPNIVAAAYTNS
FT                   IGKPEKTAMYNIDATIGALIQQTKPNDGTLKAIGKLGLKDKPATYAFDIQGMEGGKNAA
FT                   YLVASKMLYTVNLETGAATEVGAISGLENEVRDIAVLPAT"
FT   gene            512660..513391
FT                   /gene="tnp"
FT                   /locus_tag="Avi_7566"
FT   CDS_pept        512660..513391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnp"
FT                   /locus_tag="Avi_7566"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7566"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40172"
FT                   /db_xref="GOA:B9K5M4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5M4"
FT                   /protein_id="ACM40172.1"
FT                   /translation="MHGWSPQQIAGRMRLEQHPIFVSHETIYKFAYSADGHAIKLWRHL
FT                   PEHRAKQRPQHARRKHGQRFGPELNILHRPNVVAERKQFGHWECDLIQFRKKYGKANVT
FT                   SLVERVSRFTILLRNNDRQSRPVMDGIIQALMSLPHLARRSLTFDRGTEFTDWPYLQAG
FT                   IGTQTWFCDPQSPWQKGTVENTNRRARKWLSRDVDPLSVAAADLMEICNRLNQTPRKCL
FT                   GYRTPAEVFRKKLLAQMRHAR"
FT   gene            complement(513930..514610)
FT                   /locus_tag="Avi_7569"
FT   CDS_pept        complement(513930..514610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7569"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7569"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40173"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5M5"
FT                   /protein_id="ACM40173.1"
FT                   /translation="MDEKPQIVLAVDVGGSHVKIMNSVDGVESKAVSGPEMDAAAMAEA
FT                   VETLASGMDYDVIAIGYPGPVVHNRILTEPHNLAAGWTGFDFAKRFGKPVRIVNDALMQ
FT                   AMGSYDGGRMLFLGLGTGLGAAMIVNYVTQPMELAHLPYRKGRSYEDYLGQASLKERGH
FT                   RKWEKHVLRAVEQLSAALEPDYVVIGGGNVTKLKTLPTNARHGDNANAFKGGFALWLDS
FT                   RFQT"
FT   gene            complement(514622..515998)
FT                   /locus_tag="Avi_7570"
FT   CDS_pept        complement(514622..515998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7570"
FT                   /product="glucose 6-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7570"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40174"
FT                   /db_xref="GOA:B9K5M6"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5M6"
FT                   /protein_id="ACM40174.1"
FT                   /translation="MMQGRSDALVVFGVTGDLAYKMILPSLYQMVRRGQLNEPVIGVAL
FT                   DDWDIDRLAARAHDGISKQFGTVDEAVFARLKGLLRYVSGDYKSPATFDRLREALGPAT
FT                   HPLYYLAIPPSLFETVIKASKAAGLAENARLMVEKPFGRDLASAQALDSVLHSVFEEDA
FT                   VFRIDHFLGKEAVQNLIYFRFANAFLEPVWNRTHVESVQITMAEDFGIAGRGKFYDEVG
FT                   CIRDVIQNHLINILLLLTIEPPVNNGSDELSDEKVQVLRAIRPLSTHDLVRGQFQGYHD
FT                   EPGVAPGSPVETFAAVRLFVDTWRWKDVPFFIRAGKHLPVRATEVVVRFRRPPVALFDE
FT                   VTAAEANYLRFRVGPQVAIGIGTRRKAPGEGMVGECVELGALDDTTDDMMPYERLIGDA
FT                   LNGRRQLFTRQDAAELAWRVVDPVLDLREQPDVYLPGTWGPADAMKDFAPPGGWVDPQP
FT                   "
FT   gene            complement(515995..517008)
FT                   /locus_tag="Avi_7571"
FT   CDS_pept        complement(515995..517008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7571"
FT                   /product="6-phosphogluconate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7571"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40175"
FT                   /db_xref="GOA:B9K5M7"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5M7"
FT                   /protein_id="ACM40175.1"
FT                   /translation="MQLGMVGLGRMGANMVRRLIKAGHECVVYDVNPQNVASLEAEGAV
FT                   GAASYADFLAKLATPRAVWLMLPAAITGKVARDLAGEMTSGDILIDGGNSYYRDAVDLG
FT                   TELGSQGISFVDVGTSGGVWGIDRGYSLMIGGEKKAAQHLDPIFAALAPGKDGAGATGG
FT                   TADAGTEGYLHCGPPGAGHFVKMVHNGIEYGIMAAYAEGLNILKAADAGSEARDADAET
FT                   APLRDPQYYRFNLDLVAVTEVWRHGSVIGSWLLDLTASALKQDPQLSNYGGRVSDSGEG
FT                   RWTLQAAVETGVPAPVLSSALFGRFTSRDNDEFANKLLSAMRHAFGGHVEKPESTS"
FT   gene            complement(517027..519432)
FT                   /locus_tag="Avi_7572"
FT   CDS_pept        complement(517027..519432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7572"
FT                   /product="glucan 1,4-alpha-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7572"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40176"
FT                   /db_xref="GOA:B9K5M8"
FT                   /db_xref="InterPro:IPR006425"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015220"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5M8"
FT                   /protein_id="ACM40176.1"
FT                   /translation="MTTLVDFAPGNPGIQARWTSSAKSGLGTALSARSPVWFTLSHGVL
FT                   NEVYYPRVDSACIRDLGLLVIGPEGYFSEEKRDCTTTTHQVESGVLAFHVVNMSRDGRY
FT                   RIEKQIISDPARATVLQRITFMPLVGNISDYKVYALLAPHLVNAGMDNSAWIGEQDDTT
FT                   LLFASGRSRYLALGSSLPWAERSAGFAGQSDGYTQLLQNGSLDPQYQRADDGNTALTGQ
FT                   IPFTESANTAILALSFGQSETEAGAKALASLRDGFEAAFGMYCANWRGWQKGLYDLDRE
FT                   TAKPINMYRVSTAVLAAHRAADRRGAVVASLSIPWGASKGDDDLGGYHLVWPRDLVESA
FT                   GGFLAAGDWKEAIEILEYLREVQLASGRWPQNLWLDGKPYWLGVQMDECAFPILLADLL
FT                   YRNGHLPETLLTRFLPMIRKAAGYIIANGPATSQDRWEEDGGYSPFTLAVEIAALLAGA
FT                   DILDRVGEPDVAQHLRETADCWNEQIENWTYTSDSTLCDAVGVGGYYVRIGGLDVTDVA
FT                   TGSQGQTIIRNRAADTSILPTRDVISPDALALVRFGLRAADDPRILDTIKVIDHQLKID
FT                   LPQGPLWYRYTGDGYGEHPDGSPFDGIGQGRPWPLLAGERAHYELAAGHRDVAERLLET
FT                   LEASAGTEGLLPEQSWDGADLPERELFLGRPSGSAMPLVWAHAEYIKLLRSLNDGTVFD
FT                   MPPQTVERYVKDQTPSTLRIWRFNNQISTIPHGKTLRLELDASAMVHWSATGWHEVADT
FT                   RTRETGLGTHVVDIDLADGAIGQELVFTFFWEEADLWENANFKVQIIA"
FT   gene            complement(519622..521025)
FT                   /locus_tag="Avi_7573"
FT   CDS_pept        complement(519622..521025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7573"
FT                   /product="transcriptional regulator GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7573"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40177"
FT                   /db_xref="GOA:B9K5M9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5M9"
FT                   /protein_id="ACM40177.1"
FT                   /translation="MKTWTPDLSRSDGPRYLAIADVIEMDLKSGRLLVGDRLPPQRDLA
FT                   KRLAIDFTTVARGYVEAQKRGLVATHVGRGTFVTGGPEKERRGFVSEAALDARRMSVVD
FT                   FSMNMPPEPDDPDLLARMQEGLSAVATNMIPLLRYQGFGGAGMDKEAAASWLSRRGLVP
FT                   SQERIFVTPGAHPALLAIFGLLAKPGEMVLSENITYPGMRSIAAQLRLNLTGLPMDADG
FT                   IIPGAFAEICETAKPKALYLNPTLQNPMTLTIPEKRREEICAVARKYHVPIVEDDAYGF
FT                   IPLHSPAPLAAMAPDLTWHIGGLAKCIGAGLRLAYVVVPDTKAAWPFASAMRAASVMAS
FT                   PLSAALATRWIEDGTADSILRFIRTEAAARQALVAEVLPAGSYQSDPISFNIWLPLTNG
FT                   WTRSTFGTHMRASGIGVVASDAFTVDGVAEEAVRVCLGGPIRRETLKGALEFMGHALEG
FT                   SPQMAGTFF"
FT   gene            521364..521846
FT                   /locus_tag="Avi_7575"
FT   CDS_pept        521364..521846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7575"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7575"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40178"
FT                   /db_xref="InterPro:IPR023847"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5N0"
FT                   /protein_id="ACM40178.1"
FT                   /translation="MPAITAPAHADGDFFVDYEEKVFEDIQANEGEKALITFHTVAFEG
FT                   SIGLVNLLQAKRLKRKGYDTSILLYGPGVTLGIQRGFPKLGSEAFPGHLNFNNQIKGFL
FT                   EEGGKVYACRFALQALYGHGEPALIPGITPISPLDVLDLMLIHRRAGAVILDTWTL"
FT   gene            521926..522969
FT                   /locus_tag="Avi_7576"
FT   CDS_pept        521926..522969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7576"
FT                   /product="amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7576"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40179"
FT                   /db_xref="GOA:B9K5N1"
FT                   /db_xref="InterPro:IPR000132"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR023919"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5N1"
FT                   /protein_id="ACM40179.1"
FT                   /translation="MEKSRTVRAAAAQIAPDLTSRDKTLARVLETIREAAGKGAELIVF
FT                   PETFVPWYPYFSFVLPPVLSGREHLRLYDEAVTIPSVTTEAVAAAAREHGIVVALGINE
FT                   RDHGTLYNTQLVFDADGELVLNRRKITPTFHERMIWGQGDASGLKVVDSKIGRIGALAC
FT                   WEHYNPLARYALMAQHEEIHVAQFPGSMVGPIFADQMEVTIRHHALESGCFVVNATGWL
FT                   TDEQIRSITPEEGLQKALRGGCMTAIISPEGKHLAPPITEGEGILIADLDMSLILKRKR
FT                   MMDSVGHYARPELLHLVIDDRPAHPMVAAHPFLETAPTGSNTDGYQTPAFDGNADQRIA
FT                   VVRREAR"
FT   gene            523043..524014
FT                   /locus_tag="Avi_7577"
FT   CDS_pept        523043..524014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7577"
FT                   /product="Biotin synthase-related enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7577"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40180"
FT                   /db_xref="GOA:B9K5N2"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016779"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5N2"
FT                   /protein_id="ACM40180.1"
FT                   /translation="MTVMVPVHTAPAFESPYLVEKPDDAGNSRISRDGHVIGEVSFPLR
FT                   PRFYERSTADGIPYSQIAVLHGRDVLATTVLQTCIRYQSRTKTCQFCAIGQSLAAGRTV
FT                   AHKTPEQLAEVAKAAVELDGVKHMVMTTGTPKGDDRGAAVLAESARAIKAAVNIPIQAQ
FT                   CEPPEDDIWFSRMKDAGVDALGMHLEVVTPEIRARIMPGKAQVGIEKYMASFKAAVEVF
FT                   GRGQVSTYMLAGLGDTREAILDICERLVAIGVYPFVVPFVPISGTPLESHPAPKPDFMH
FT                   SILGPLSKMLVESGLKAVDIKAGCGKCGACSALSTYERMLTR"
FT   gene            524011..524553
FT                   /locus_tag="Avi_7578"
FT   CDS_pept        524011..524553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7578"
FT                   /product="GCN5 family N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7578"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40181"
FT                   /db_xref="GOA:B9K5N3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR024035"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5N3"
FT                   /protein_id="ACM40181.1"
FT                   /translation="MMIEPFSPFHTSEFQVKFATSTWERREAHALRRDVFCREQQIFES
FT                   DDRDAIDDRATPIVALSMLGVAADRLVGTVRIHEEQPGLWWGSRLAVHEDFRKIGALGA
FT                   TLIRLAVSSANAMGCQTFLANVQVQNGLLFRRLHWDVVEEFEIYGKPHLRMKADLSWYP
FT                   PCATPEAGFVALAKRAA"
FT   gene            524556..525542
FT                   /locus_tag="Avi_7579"
FT   CDS_pept        524556..525542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7579"
FT                   /product="selenophosphate synthetase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7579"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40182"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011413"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR024030"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5N4"
FT                   /protein_id="ACM40182.1"
FT                   /translation="MADFRRDIDLDALAEKLRSSGGIAAKHDIGSVTARLGVKGKSVAV
FT                   GDDCAALPEGDGYLLFAIEGFMNAFVAADPWFAGWCGVMVNISDVVAMGGRPTAVVDAV
FT                   WADGEADAAPVLDGMRAAAEAYGVPIVGGHTNIRTDRSQLSVAILGRAKRLLTSFDARP
FT                   GDVLVAAVDHRGRYRPPFDNWEAATDAPAERLRGDLEILPQIAEAGLALAAKDISQGGI
FT                   VGTAIMLAECSGVGIDINVAAIPLPEDVSLDRWLATFPSFGYLLSVPPEHVTAVLTRFE
FT                   TRDITAAIIGTVSVGSAVAITNGSKRIVIRDHAATPLMQLGPAEHCT"
FT   gene            525563..526696
FT                   /locus_tag="Avi_7580"
FT   CDS_pept        525563..526696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7580"
FT                   /product="WbdA; mannosyl transferase A"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7580"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40183"
FT                   /db_xref="GOA:B9K5N5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR023986"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5N5"
FT                   /protein_id="ACM40183.1"
FT                   /translation="MLTHSTNPRGGVVHAMQLSEALTALGHAVTLHAPDPKGTGFFRSP
FT                   ACGAACFPVPPALADMTALVEQRIADYIGHFEQADNRDFDVFHAHDGISGNALATLKSR
FT                   GLIPSFVRTIHHIDQFEDPRLMVLQDRSIQRADAFLAVSAAWQAILRDSYGVDAKVVGN
FT                   GVDNRRFSPAWSGEQTALRDRIGLHAGAVFLSIGGIEARKNTLGILDAFRQLRAVKPDA
FT                   QLVIAGGVSLLDHRDYQEEFQSHLRALRDDAAAVHIIGAVSDDDMPNLYRLADALVFPS
FT                   LKEGFGLVVLEAMASGVPAIVPSIAPFIDYLSGDDALWCDPLHSASIAEAMALALVPEI
FT                   RERIIPRGLEVASRFTWRRVAEAHLSTYATLKEAAHA"
FT   gene            526698..526976
FT                   /locus_tag="Avi_7582"
FT   CDS_pept        526698..526976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7582"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7582"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40184"
FT                   /db_xref="InterPro:IPR023846"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5N6"
FT                   /protein_id="ACM40184.1"
FT                   /translation="MRFVITWPDGQEETCYSPSLIIREFFTEGESYPVADFVERSRKAL
FT                   TIASDRVEAKYGFACSSANDQLARIETAALPFLERADARVRCETFIL"
FT   gene            526988..528259
FT                   /locus_tag="Avi_7583"
FT   CDS_pept        526988..528259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7583"
FT                   /product="flavin-containing monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7583"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40185"
FT                   /db_xref="GOA:B9K5N7"
FT                   /db_xref="InterPro:IPR024000"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5N7"
FT                   /protein_id="ACM40185.1"
FT                   /translation="MTRSLKPHYSAVVVGGGQAGLSASHYLRKHGIDHVVFEKKTVAHK
FT                   WKDERWDAFCLVTPNWQCQLPDHPYDGADPHGFMVKEEIVAYVDRFVKKVDAPVLEGTS
FT                   VTALEKTGELFQIESTAGTITADSVILATSLYSQPFVPRAAERIPDGIAQIHTADYRNP
FT                   AQLPPGGVIVVGSGQSGCQIAEDLHLAGRKVHMVTGNAPRCARFYRGRDVVDWLADIGQ
FT                   YDITIAHDGMAKKKHDTNHYLTGRDGGRDIDLRKFALEGMALYGRMTGVSAGKMLFETN
FT                   LKSNLDSADRVYNGINALIDRHIAEKGIHAPAGGPYVALWEPQSETTELDFEAEDVTSV
FT                   IWATGFTPDWSYVGLPIFDGTGYPIQRRGVTGIKGVYVLGLPWLWTWGSGRFLSVGKDA
FT                   EYVVDHLARQLEQAKRPQMQAANG"
FT   gene            528320..529129
FT                   /locus_tag="Avi_7584"
FT   CDS_pept        528320..529129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7584"
FT                   /product="yype IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV) B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7584"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40186"
FT                   /db_xref="GOA:B9K5N8"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5N8"
FT                   /protein_id="ACM40186.1"
FT                   /translation="MDRALEPHLLIGMPHLTPHGLSETWLMKELGHRHWLMLARDLSMD
FT                   NADFGTADGEEVYAAICATSLTDARFELVRANDILTIQSLISAVSRTQTSTTHLLSIAG
FT                   RSVGRIELVSAFVHRAVQGSNRSIARVTAPRPQTRPYEVSLLAQHAAHIRNGRLQTYWG
FT                   LPLDAAEALRTFRFAPSTAQEFNGAGLFYFAEFQAVADRALEAWFPGRKPAVRRDIFFL
FT                   GNIDPHETVSFDLMGWSDDHDILHGKLRRESGDLIATIFMSSKDLPW"
FT   gene            529444..530520
FT                   /locus_tag="Avi_7585"
FT   CDS_pept        529444..530520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7585"
FT                   /product="Catalase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7585"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40187"
FT                   /db_xref="GOA:B9K5N9"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5N9"
FT                   /protein_id="ACM40187.1"
FT                   /translation="MTAATPVRYSPDLETVKPGEQETVSALIKQFDIILEKTAGDYGHA
FT                   VRSVHAKAHGILEATMIVRDGLPAELAQGLFAKAGEYPVYMRLSTNAGDILPDAIALPR
FT                   GLAIKVVGVEGPRLPDANGDTQDFVMVNGPVFQAPNPEKFLSSLKLLARTTDKMEGTKA
FT                   VLSSVLQTVNKGLEAVGISSSTIQSLGGAPNVDPLGETYFSVTPFRYGDYIAKFRLKPV
FT                   SPDLTKRTGTEIDVSVRGDAIRETVQAEMQDTHGEWEFQVQLCRDVDAQPIEDPTVEWK
FT                   EDEAPFVSVATVTSMPQDSWSYTKVQKVDQQMRFSVWTGLADHQPLGGINRVRKDTYQH
FT                   SAEFRAKFNGCPFHEPRQ"
FT   gene            530551..532887
FT                   /gene="fdhF"
FT                   /locus_tag="Avi_7586"
FT   CDS_pept        530551..532887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdhF"
FT                   /locus_tag="Avi_7586"
FT                   /product="formate dehydrogenase H alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7586"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40188"
FT                   /db_xref="GOA:B9K5P0"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="InterPro:IPR041953"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5P0"
FT                   /protein_id="ACM40188.1"
FT                   /translation="MAVLKPPFFLFNLPSKERPAMADPIENPEAEGPAGGWGSVKSIAR
FT                   MLGDNKPSPAILETLYRLNKPAGLMCVSCAWPKPANYHPFEFCENGAKATISDLTSARC
FT                   TPDFWNRHTVAELRNWKDYDLEQTGRLTHPLRYDAGTDRYVEVTWDKAFSDIGTTLKSL
FT                   PCESVVFYSSGHAGLEASYLYALLARVFGNNNLPQSSNMCHETTSVGLQKVIGSPVGTI
FT                   VWEDLEKADAFFFFGQNPGSNSPRFLHPLQEAKQRGARIVTFNPVVEQGLVSFVNPQSP
FT                   IDMLTGRETQISDEYLQVRAGGDISAILGLCKVVIEADDVAVANGQKRVLDVAFIDEHT
FT                   TGFDSFIALVRTTSWADIERESGLTEAAIRRAGEIYISAERVIGVYGMGLTQHSQGAIN
FT                   VAMLVNLLLLRGNIGREGAGCCPVRGHSNVQGQRTVGIAEKTKLIPMDTLKELFDFDPP
FT                   TEDGTTIVDAVKGLMAGKIKAFISLGGNLVRAVPDQTEMERAWARQELTVIVSTKLNRS
FT                   HLFPGKQAYIIPCLSRAEIDEQTTGNQAVSIEDSFSHISGSIGKRPPASKHLKSELAIV
FT                   AGIAKATLAVRPKLKWDEWQGDYSLVRDLIEATYPEDFKDYNARMFQPGGFYRGNAAHE
FT                   RLWKTEEKKAVFTTPTQLNALSFEDADGRFRLVTMRSNDQFNTTIYGYSDRFRGIEGTR
FT                   DVLLMCESDIATSGLQPGQVVTLVSDFGDGIRRALGGLTVTAHNLPKGTIGTYYPEANV
FT                   LIAIDHHDEMSKTPASKAIPVRIET"
FT   gene            complement(532931..533443)
FT                   /locus_tag="Avi_7587"
FT   CDS_pept        complement(532931..533443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7587"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7587"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40189"
FT                   /db_xref="GOA:B9K5P1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5P1"
FT                   /protein_id="ACM40189.1"
FT                   /translation="MPALHALAIRPATPNDIDFVMRVERLPGYPERVGTYSVQEHESRM
FT                   ADENYEYLIGICGEKPVGFAVLRPDDGMGNVVIRRLAVEQSGRGMGSVFVQRICAAVFS
FT                   DPTIGRLILDVLPSNTIARRVYTKLGFVEEGLMRSALRYPDGRRADLLLMALLRDDWLS
FT                   GASMLVR"
FT   gene            complement(533454..534329)
FT                   /locus_tag="Avi_7588"
FT   CDS_pept        complement(533454..534329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7588"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7588"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40190"
FT                   /db_xref="GOA:B9K5P2"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010140"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5P2"
FT                   /protein_id="ACM40190.1"
FT                   /translation="MTWFSYHGGHSGQFCDHAKSTLADVIETAIDRGFTHYGLSEHCPR
FT                   YRDEDLYPGEERLGVAGLARQFADYVDHAFKLRDAYADRIELLIGFETEKLPPDTWLAK
FT                   MEAIRNAHPFDYIVGSVHDIEGCWLDYSAQATETLKSELGGTDALQIAYFQSATDMVER
FT                   LRPDVVAHLDLVRKYEPAGFEFSDKVLREVDTLLEAIKAYGGIVDVNCAAFRNGFGPVY
FT                   PLPHILNRARHMGIRVTLGDDSHGVDTVGVGLEQSVAAIRAAGFESIAYLTRSNGWLQA
FT                   DIDDVAPGKI"
FT   gene            complement(534339..535175)
FT                   /locus_tag="Avi_7589"
FT   CDS_pept        complement(534339..535175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7589"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7589"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40191"
FT                   /db_xref="GOA:B9K5P3"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5P3"
FT                   /protein_id="ACM40191.1"
FT                   /translation="MKIAILADPHIGSQNDVFVENWKAVVKTVNGYEDVELAIVLGDLT
FT                   LDGANIEADLAFGAAQLKAINAPVLVLPGNHDIGDIARDSTQPADDARLAAWETHFGAW
FT                   YWQCDAVEGWRLIGLNSQIIGSGLPAEEQQWSALENMLKERGDRKPVLFLHMPLFLEDW
FT                   NEGDRPAWALKTEGRLRLQRLIMEHGVFAVVSGHMHRTLHLQQKNEPVLIWTPASSFLA
FT                   RDESMPSQPGKELLGVTLLDFGKDDISVEFIDIDGLMKSYIEDYNGSIYRSPAKTA"
FT   gene            complement(535272..536615)
FT                   /locus_tag="Avi_7590"
FT   CDS_pept        complement(535272..536615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7590"
FT                   /product="ABC transporter substrate binding protein
FT                   (sugar)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7590"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40192"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5P4"
FT                   /protein_id="ACM40192.1"
FT                   /translation="MIRTCPAATGQVRKSRPLHLVGNTMKMKNIFAVAALTVFGTAPAF
FT                   AADPVTLTFYHTRLAFMQPILEGFKKAHPEITINEQAPAENYSAGDQSVIRGMMTGSTP
FT                   DVYLASYSSIPTLVGVMKDRGETSSLDPMLDKEGKDWQAANYAPAILDLAKVDGQQYAM
FT                   PFTASLPLLYVNKDLVEKAGGNVDQFPTTWDGVIDLAAKISKLGNGVSGIGFSVGGLSD
FT                   DWYWQMMVMSAGDQMLDAKATGIGYDNKAGLEALRITQDLAVKTGMSVYADPKPAQQQF
FT                   FAGKIGMVVESPSDLVAYETAIGDRFTMRTVRFPLIDAKKGGLPAGGNALMVFSKDAAK
FT                   RAAAWEFVKYMTSASVQADVSKASGYMPVNVQAAKALESFYAEHPNFQTVFKSMNTAMP
FT                   WFAYPNNTADGVWKGVAPILDQLQRGKITPEAAMPKIREHVAGVMAAK"
FT   gene            complement(536612..537439)
FT                   /locus_tag="Avi_7591"
FT   CDS_pept        complement(536612..537439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7591"
FT                   /product="ABC transporter membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7591"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40193"
FT                   /db_xref="GOA:B9K5P5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5P5"
FT                   /protein_id="ACM40193.1"
FT                   /translation="MVRSPLRAMLSHAVLLGGAFLMVYPFFWMWRASTQAPGEIFGSLH
FT                   DAPPILTSITDNYTRALFDSPLPRFMLNGVIMTGGILLFQILTTVTCAYALAKFTFRGQ
FT                   HLLFAIVLISLSVPAQATALPIFMVLAKFGLLDTYAGVMMPYLTSGFAIFMFYQFIRSF
FT                   PDEILLAARLDGMSEIEIVVRIILPAMKPAIAAFAIFSITFHWNDLYWPMIVIRSIDLS
FT                   PPTLGLLFFRSQEGGDSFGPLMACATLITAPLILLFLAAQRGFVQGVTMTGVK"
FT   gene            complement(537439..538359)
FT                   /locus_tag="Avi_7592"
FT   CDS_pept        complement(537439..538359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7592"
FT                   /product="ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7592"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40194"
FT                   /db_xref="GOA:B9K5P6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5P6"
FT                   /protein_id="ACM40194.1"
FT                   /translation="MTSLSELHSQSSAAASKRFSYAAIAHLFAAPAFLLLIATVVAPIF
FT                   VVVLISLTDYRLGRLTLNFVGLGNYVRMINDPFFWAALRNSALYTAIVVPVSVFGALCV
FT                   AVLLDGRRRSRRFYEIVYFLPVTSTLTAMSIVWSYLLNGHIGPLASLLDALGLPALDFF
FT                   ADGTLALIGLAIIGIWHLFGFNLILFLAGLTVLSAELKEASALDGMDGFCDRLRYLTWP
FT                   LLAPTTIVVVVLSCIQSFQVFDTVAVLTNGGPYGATEMLLHKINTDTFTGLKAGYGSAL
FT                   TVVYLLLIGTFSIVHVGLSNRKAHF"
FT   gene            complement(538343..539536)
FT                   /locus_tag="Avi_7593"
FT   CDS_pept        complement(538343..539536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7593"
FT                   /product="ABC transporter nucleotide binding/ATPase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7593"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40195"
FT                   /db_xref="GOA:B9K5P7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5P7"
FT                   /protein_id="ACM40195.1"
FT                   /translation="MVGHSIDIVNLEKCFERVQVLKRINLQICEGEFLTLLGPSGCGKS
FT                   TLLRLLAGFEPCTDGHIMIAGRDVSSLPPKRRGIAMVFQNYALYPHMTVRGNLTVPLEM
FT                   ARLSFSQRLPGASLLSSKVRGIRNDIETDISQIAKQLGLDMLMERKPSQLSGGQRQRVA
FT                   VGRAMVRHPGVFLMDEPLSNLDAKLRQQLRDEIVDLHRRTGITFIYVTHDQTEAMTMSD
FT                   RIAVMEGGEIKQCGAPAEIYDQPNYLSVARFVGTTAINEMPVTVSKGAVSINGRALHLT
FT                   LPGIADGSYQLAIRPERLHPTENGNGDFSLRVEQVEFAGNDVGIRCDGTEIGAGTVRVQ
FT                   LRPESFARLATGRKIGERIALQIASDAALIFDQSGRRVPVSLPLAAPVEEACYDVSV"
FT   gene            539865..540536
FT                   /locus_tag="Avi_7595"
FT   CDS_pept        539865..540536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7595"
FT                   /product="transcriptional regulator TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7595"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40196"
FT                   /db_xref="GOA:B9K5P8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041474"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5P8"
FT                   /protein_id="ACM40196.1"
FT                   /translation="MTEEKQTQKQPRRRHPRRPDLSQNRILEAAVVEFAANGLTGTRVE
FT                   AIAERAEINKRMIYQYFGSKELLYQAVIEKVYRDVWDAEAALNLEQLPPRDALIALVTF
FT                   VWTYYLEHPEFITILNSENQLKAIHFKKSRAIREGAASSRPLVDDILRRGEADGTFRLG
FT                   IDPIQLSLTITSICYYYFTNQATSSIVYGQRMMTRAALERRLAFNIQTVLAIVSPDRSA
FT                   L"
FT   gene            540758..541576
FT                   /gene="prxC"
FT                   /locus_tag="Avi_7597"
FT   CDS_pept        540758..541576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prxC"
FT                   /locus_tag="Avi_7597"
FT                   /product="non-heme chloroperoxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7597"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40197"
FT                   /db_xref="GOA:B9K5P9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5P9"
FT                   /protein_id="ACM40197.1"
FT                   /translation="MAFIEAKDGTQLHVKDMGKGRPVVLIHGWPLTGDMFEYQSLALLE
FT                   AGFRVITYDRRGFGQSGHPADGYNYDTFADDLASVIDSLDVQNVSLVGFSMGGGEIARY
FT                   LSRHGASKVSKAVLVASVAPYLLKDASNPDGVDASVFEGMKNDIRKDRFAFLQSFAKTF
FT                   YGVGLVTSPVSQGVLDWSFILGVMASPKATIDCVDAFGKTDFRPDLAAFTIPTLVIHGT
FT                   ADKTVPIDPAGRAAANGIAGAKLIEYEGEPHGLFATAPDRLNRDLIEFLG"
FT   gene            complement(541652..542314)
FT                   /locus_tag="Avi_7599"
FT   CDS_pept        complement(541652..542314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7599"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7599"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40198"
FT                   /db_xref="GOA:B9K5Q0"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5Q0"
FT                   /protein_id="ACM40198.1"
FT                   /translation="MTDHTHFDFAKLNERERYKLLIGTVIPRPIALVTTVSKDGQPNAG
FT                   PFSFFNVLTHDPAIVAIGVENYSDMRFKDTARNIRETGEFTVHICDNALVDRMEVCAIK
FT                   FGPEVDEMEEAGLATVPGRMVRSPRILAAPAALECRRHTTLQVGPAREIILGEVIGVFV
FT                   RSDAVNPANLHIDQQLMDAVGRMGGHTYARTRDQFDIKTLTPQEWEIRKIGEKLTTE"
FT   gene            complement(542316..543740)
FT                   /gene="pepQ"
FT                   /locus_tag="Avi_7600"
FT   CDS_pept        complement(542316..543740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepQ"
FT                   /locus_tag="Avi_7600"
FT                   /product="proline dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7600"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40199"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5Q1"
FT                   /protein_id="ACM40199.1"
FT                   /translation="MTIHANTSGTYRIGSLLADFQPDFDFAAPLPLPVEEFEDRLRRIR
FT                   RQAVEAGHDALVVHTGGVGWFHTSNHYLRYICDWMREGVLIIPTDVDRPMVLLSFFTQS
FT                   VLLPPGGEPVLVEDIWQIGPIGREYADRPGDSVIKTAEKCAELLTGIGLARGQVGRIGD
FT                   RTSLTFWAALDELMPKAKFVADNAILDRMQKIRSPREIEMFRAAAQLVSIATQAAYHVT
FT                   KPDVTDHEIYAAFTQGQLSFGGETGDGYQIGINEFGTHCGKPYGHVVRLGDLINLYVSN
FT                   ITYRGYTAQTARMIAVGDITKRQEEVLAACTDGVKRAEKLIRPGALMRDVNNAAFEPMI
FT                   ERGMLSSPEARTMPYNWAPMEDGSARLIPRQYVKNIDWEAQGRTLMHVYPATHGPHNPN
FT                   LGHSVGMAGGQNSFNISSHNYDRMEEGMVFVLHTQWLEPMSAGCNVGDMYVVTKDGFEN
FT                   LSRHTPLETHRIAAEA"
FT   gene            complement(543769..544590)
FT                   /locus_tag="Avi_7601"
FT   CDS_pept        complement(543769..544590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7601"
FT                   /product="ABC transporter membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7601"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40200"
FT                   /db_xref="GOA:B9K5Q2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5Q2"
FT                   /protein_id="ACM40200.1"
FT                   /translation="MHNHRENPIPTLLYKAFVFGFGSLSLIYLVAPIIIVITMSFTSGQ
FT                   TLKYPPEGFSLRWYEALIDPVRSGTEHIAAGNSLKIAGLAVLGSLLFAVPATIGMARMR
FT                   RSTVNALEPFLLAPLVLPSLVYGLAALIVANFVGFQPSLWLTVVGHVVVFGPLMYRAAS
FT                   VVAQGINPSLAEASAVMGATWHTTLRRVILPLLTPGILAGAFLVFIQSLDNVSVSLFLA
FT                   DAQTTVLPLRMFALIEESLDVRVAAMSGILIGLTLVVMLVARRVLAPSRQA"
FT   gene            complement(544583..545410)
FT                   /locus_tag="Avi_7602"
FT   CDS_pept        complement(544583..545410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7602"
FT                   /product="ABC transporter membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7602"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40201"
FT                   /db_xref="GOA:B9K5Q3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5Q3"
FT                   /protein_id="ACM40201.1"
FT                   /translation="MKASGFPYVVPMLLLSVAFFATPLAVLVGFSFIGPDGLSLHNYAR
FT                   FFGDAFNYRVLVNTATLGLQTIASTTLLGVPIALFYWHSGKTARQVIIFLTLIPMLTSN
FT                   VVRTFAWIVILGRQGPISEAFVALGLADRPFTLMSTELGLVMAMCQIDLPLIILPLIAI
FT                   LSRTPVQFTEAAQVSGAGPWRIFVTVLLPMMLPGLLAGWILVFASTSASFVTQAVIGGA
FT                   RNVYVPQLIYREVGTLFDWPMASAIAVVLLLSTGILLVVMTMISRHRRLVGHA"
FT   gene            complement(545420..546460)
FT                   /locus_tag="Avi_7603"
FT   CDS_pept        complement(545420..546460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7603"
FT                   /product="ABC transporter substrate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7603"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40202"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5Q4"
FT                   /protein_id="ACM40202.1"
FT                   /translation="MQNFNITRRHFGLLAAGAAAAATLPFAARAAGGTAVAATFPGNWE
FT                   DGYRFVLTPLVKEAGFDLTVAPALAQDQLAKVMASPGNPPYDTLLMSPGQMAVAIENDL
FT                   IQKIDPSKLKNWSMLDPAFQGEYGPTVTVEVNGIAYNPDLVPAPKGYRDLFENPAYKGL
FT                   VSWTGFASNTGVMAYTEIARIFGNGPTDMDAVFKLFKDNPEQIKGVVASTNHQMTLFQQ
FT                   GEIAVFMCSTGNVARLKSMGLKAEFVQPETGSPAAPVNIHLTKGAKNIDAAYTYMDAAI
FT                   SKAAQDKLKLPPTEMFPTNKEVALTPGIEAYVKREQLATLVYPDWAAINKNRAEWIRQF
FT                   DALVAG"
FT   gene            complement(546481..547722)
FT                   /locus_tag="Avi_7604"
FT   CDS_pept        complement(546481..547722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7604"
FT                   /product="ABC transporter nucleotide binding/ATPase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7604"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40203"
FT                   /db_xref="GOA:B9K5Q5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5Q5"
FT                   /protein_id="ACM40203.1"
FT                   /translation="MQIAAFTAMIDTVGNIVDRPNLCLVPQSLERFGNTGQLKGTFMAE
FT                   TSKAAEGKHLSIRGLTHSYGGQNAISDISFEIEAGEIVALLGPSGCGKSTVLRAIAGLI
FT                   QPKSGVIKLGGQDLANVSARSRGIGMVFQNYALFPHLTVAENIAYPLACQQVPRAKRRE
FT                   RVEEMLSLVQLKSYGNRLPRELSGGQQQRVAVARAIAGRPSLLLLDEPFGALDRALRFD
FT                   LQVELLHLQKTLGITTLIVTHDQEEAQSLAGRLVLMNKGNVEQIDTPMAVYDRPKTLFV
FT                   NTFIGQANVLHGTVERLDADATSIALVNGKAIALPRRLNFTIGSKVTMTFRPEDVRLSA
FT                   NPSDLALPARVTVSVPLGPTLVHDLLLDDGTGLRASQVRSPSTFIPEPGAQLFAEIDTA
FT                   RCHAFPSEPEASSQ"
FT   gene            548168..549157
FT                   /locus_tag="Avi_7606"
FT   CDS_pept        548168..549157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7606"
FT                   /product="ABC transporter substrate binding protein (amino
FT                   acid)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7606"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40204"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5Q6"
FT                   /protein_id="ACM40204.1"
FT                   /translation="MIASRFASIHADKKLNGDHMRSVTKSLKDSLAGIAFALLATSTLA
FT                   AEGTAIKMVPDAEVTKLPGIAFDQSLADRLPSAIRDKKAIKVATDLTPPISFQAEDGKL
FT                   IGIDADIAAALGVILGIDVQMTNVGAGAAIVPAVVSKRFDMTISGINDDVELEKQVDVI
FT                   DYMFDATTIMTIKGNPLGIKSMEDLCGKKVAAPVGTFQARLVEAASAKCSKPINIISIP
FT                   KMPDVLQAVRTGRADATVNGFATSVYTTKNQTGKGVGLQALPDVRLAVGYLGMLTSKDN
FT                   PELRDVVIASLQHMVDSGAYKAIMEKWGLGPLAVTTVKFNDAASMPVN"
FT   gene            549161..550033
FT                   /locus_tag="Avi_7608"
FT   CDS_pept        549161..550033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7608"
FT                   /product="ABC transporter membrane spanning protein (amino
FT                   acid)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7608"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40205"
FT                   /db_xref="GOA:B9K5Q7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5Q7"
FT                   /protein_id="ACM40205.1"
FT                   /translation="MSLFAQPVSMAIAPPIGKPIRWGQITSGTSAILALALLITIVARN
FT                   QSVQWGEIPRYMVDPVILSGVVLTLQLTSGAMVFGIAFGCIVAVMATSQNIVLKALAIA
FT                   FVWWFRGVPLIVQIFFWFNIALFIPEVGIGSYSISINALVTPALAGFLALGLHEAANMS
FT                   EIIRGGLTAVDRGQREAASSLGLRPLQTLRTVVLPQAVRLIVPPTGNQAIGMLKASAIV
FT                   SVIGMQDLLTQAQAIYARNFLVIELLCVASLWYLLITTLASIGQYFLEKHLAPKGRNAG
FT                   AQKDQPRRG"
FT   gene            550112..551242
FT                   /locus_tag="Avi_7610"
FT   CDS_pept        550112..551242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7610"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7610"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40206"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5Q8"
FT                   /protein_id="ACM40206.1"
FT                   /translation="MRLGIDGQKLPEAKKRGPLKSLDHVRELSLSGIFFSTVLDMSETL
FT                   DPGELRDIRAKADELGLYLEAGIGKINPYCSAEAPEFRAIGDGDVILGFIRMIEASAAI
FT                   GCRELWVSPGNFKSEYRGRLANDRFRTDVTWDEQLTAIEKVLQKLAPVARANGVHLNME
FT                   THDEITSFEILRLIEAVGEECMGVVFDTANGLQRAEHPVFAAKRVAPYVRQTHIKDAYV
FT                   GHATGGLDFQTRPVGRGIVDFATIIPILAKANSELNLSLEVAASVEDKPRKANPRQCIE
FT                   INDPIWRAGHPDLTAEELEAYLALVDAFEKRVAAGEIPDWETYEANQYGYPSYQHQSYG
FT                   FNEAITFIKTSARHIEEVCTQNSIPLSTPSTKQHAA"
FT   gene            551525..552277
FT                   /locus_tag="Avi_7611"
FT   CDS_pept        551525..552277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7611"
FT                   /product="transcriptional regulator GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7611"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40207"
FT                   /db_xref="GOA:B9K5Q9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5Q9"
FT                   /protein_id="ACM40207.1"
FT                   /translation="MKKVTRRQSAKVAPKAGGAADTAENANDDVTERIRITLATAIGEG
FT                   ALKPGVKILEDAIADHFGVSRTVVRGALGVLESDHLLERKKNRGTFVAEPGIEEAKALF
FT                   EARRKLEHVILELVIDRATVDQLDALEKLTDEEEHIHHHGDEKSKTVLSGKFHVVLAEL
FT                   GGNAVMTEMLSKIVARLSLVMSLYEEERKDDCGADHHRLIVSAIKAKDLAKAQQLMDHH
FT                   LADIEGRVRLTEGQGDRHTFLAVLENFS"
FT   gene            complement(552863..553261)
FT                   /locus_tag="Avi_7612"
FT   CDS_pept        complement(552863..553261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7612"
FT                   /product="nikR protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7612"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40208"
FT                   /db_xref="GOA:B9K5R0"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR014160"
FT                   /db_xref="InterPro:IPR014864"
FT                   /db_xref="InterPro:IPR022988"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5R0"
FT                   /protein_id="ACM40208.1"
FT                   /translation="MQRITITIDDDLMTELDRMIEAKGYQNRSEALRDLARAGLKQASI
FT                   EEGHIANCAGVLSYVYDHEARDLASRLTTTFHDHHDLSVASMHVHLDQHRCLEISVLRG
FT                   KTEEVRHFADHVMAERSVTYGELKIIPA"
FT   gene            553410..554990
FT                   /gene="nikA"
FT                   /locus_tag="Avi_7613"
FT   CDS_pept        553410..554990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nikA"
FT                   /locus_tag="Avi_7613"
FT                   /product="nickel ABC transporter periplasmic nickel-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7613"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40209"
FT                   /db_xref="GOA:B9K5R1"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR011980"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5R1"
FT                   /protein_id="ACM40209.1"
FT                   /translation="MIKTCFRHAALALTLAFCSPLTNAQAGETLNFSWPMNVGPLNPHL
FT                   YSPNQMFAQNMVYEPLVRYQADGTVKPWLAQSWEISNEGRTYTFQLRDGVRFSNGEPFD
FT                   AAAVKANIDAVLANRSRHAWLELANEIESADVVDSSHVRITLKHAYYPLLQELSLPRPF
FT                   RFIAPSQFRQGGTKDGIAQPIGTGPWVLQETRLGEKDVFVRNDRYWGGKPAFDSVTVKV
FT                   IPDPNSRAIAFETGDIDLIYGADGPISPDTFERFRKMGTYTTELSQPLETLVLAINTNL
FT                   GATKELAVRKAINHAVDKDKMIATVLYGTQQRADTLFAPNVPYANIGLKPYQFDRSVAE
FT                   KLLDDAGWKRLDPKGIRQKDGKPLSIELCFIGTDAISKSMAEIVQADLGKVGIQVILTG
FT                   EEESSILSRQRDGRFGMIFNRTWGPPYDPHAFVSSMRIPSHADYQAQLGLPDKAKIDQE
FT                   IGDVLISTDEHIRQDLYRDILTRLHDEAVYLPLTYVTAIAVAKKELGPIPFGAMSSEIP
FT                   FDQIKQKTN"
FT   gene            554994..555938
FT                   /gene="nikB"
FT                   /locus_tag="Avi_7614"
FT   CDS_pept        554994..555938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nikB"
FT                   /locus_tag="Avi_7614"
FT                   /product="nickel ABC transporter permease subunit NikB"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7614"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40210"
FT                   /db_xref="GOA:B9K5R2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR014156"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5R2"
FT                   /protein_id="ACM40210.1"
FT                   /translation="MGAFILRRILLLIPMLLGASLVIFLMLRLGPSDPAMDYLRLSKVP
FT                   PTPLALADARQMLGLDRPIATQYIDWLGHAFRLDFGVSYATQRPVLPDLLYYLPATLQL
FT                   AGLALILTFAISIPMGVWASRHRNKLPDHIVRLVSFLGVSMPNFWLGFLLVLVFSVQLG
FT                   WLPAMGRGGFAHMIMPAIAIAFMSLSINARLLRASMLEAAGQRHVLYARLRGLSRQRVE
FT                   RGHILRNALLPIITATGMHVGELLGGTLVIESIFGWPGVGRYAVSAILNRDYPVIQCFT
FT                   LLMVGIFVTCNLLVDIAYAWADPRIRLSAGHVE"
FT   gene            555935..556810
FT                   /gene="nikC"
FT                   /locus_tag="Avi_7616"
FT   CDS_pept        555935..556810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nikC"
FT                   /locus_tag="Avi_7616"
FT                   /product="nickel ABC transporter permease subunit NikC"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7616"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40211"
FT                   /db_xref="GOA:B9K5R3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR014157"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5R3"
FT                   /protein_id="ACM40211.1"
FT                   /translation="MSQTSALHSPTRPAGFWRSSSLGVKACGVIVLLLVVATIAGPWIS
FT                   PHDPNFVELSQRLQPPDLSHWLGTDHLGRDIFSRLVAGARVSLGSVAIALGLIMVTGIV
FT                   LGGTAGVIGGRTDQLIMRIADVFLTFPTLVLALFMVGMLGTGLTNVILAIALSHWAWYA
FT                   RIVRGIVLSLRHREFLLAARMSGAGPIRTFIDHLLPATLSQLVVLATLDIGHIMLHVSG
FT                   LSFLGLGVTAPTAEWGVMINDARQYVWTAPSLILWPGLTLFISVMAFNILGDALRYRLD
FT                   PHLRVEHGHQ"
FT   gene            556807..557595
FT                   /gene="nikD"
FT                   /locus_tag="Avi_7617"
FT   CDS_pept        556807..557595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nikD"
FT                   /locus_tag="Avi_7617"
FT                   /product="nickel import ATP-binding protein NikD"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7617"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40212"
FT                   /db_xref="GOA:B9K5R4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015857"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5R4"
FT                   /protein_id="ACM40212.1"
FT                   /translation="MIQTLSIHNLTVYPSHADGHPALVDHLSLELKRGRILALVGASGS
FT                   GKSLTCSASLGVAPAGVTVTNGTLALDGKPALPADLRGKTVATIMQNPRSAFNPVRTMR
FT                   HHVVETLKATGRLPPDNDLQQALAIMHDVGLEEPQRILEMHAFEMSGGMLQRMMIALAL
FT                   MSGAPFLFADEPTTDLDLIVQMQVLDLIERVARQQGLGVLLVTHDMGVVARLADDVAVI
FT                   DQGKLVETGSVMDIFHAPQHPVTRMLVQAHLSLYGLELAQ"
FT   gene            557592..558386
FT                   /gene="nikE"
FT                   /locus_tag="Avi_7618"
FT   CDS_pept        557592..558386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nikE"
FT                   /locus_tag="Avi_7618"
FT                   /product="nickel import ATP-binding protein NikE"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7618"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40213"
FT                   /db_xref="GOA:B9K5R5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014137"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5R5"
FT                   /protein_id="ACM40213.1"
FT                   /translation="MILLQAKHLSKHYQHYSLLGASPARTVVEGVSLSIANSETVALLG
FT                   RSGCGKSTLARLLAGLEQPDKGEVCFNGTALGKLAKADKAAFRRSVQMVFQDSPSAVNP
FT                   RFDIRAIIDEPLRHLTNLNEADREHRLREVLDMVELPLAIASKLPGQVSGGQLQRVCIA
FT                   RALACSPKLIILDEAVSNLDLHLQTSALSLLKDLQHKTGIAYLFVTHDLRLVERFASRV
FT                   LIMDAGRIVEETATGALGHVSHPASLLLKSAILPAYPRQLHN"
FT   gene            558560..558955
FT                   /locus_tag="Avi_7619"
FT   CDS_pept        558560..558955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7619"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7619"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40214"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5R6"
FT                   /protein_id="ACM40214.1"
FT                   /translation="MAATASDMAKLVRIICAIALLCVGFSHKTPVIESVIPLSEVASYT
FT                   LPDGTLPVLCLPTQDDNGKHHSHDLGTGCEACRITASIVLPTPADSIGQAIVVATEIHI
FT                   PIRREAFYRQLFPPNASPRGPPTGTIA"
FT   gene            559070..559768
FT                   /gene="fnrN"
FT                   /locus_tag="Avi_7621"
FT   CDS_pept        559070..559768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fnrN"
FT                   /locus_tag="Avi_7621"
FT                   /product="transcriptional activator Crp family"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7621"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40215"
FT                   /db_xref="GOA:B9K5R7"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5R7"
FT                   /protein_id="ACM40215.1"
FT                   /translation="MGEVSPVFPIDFVISAEIGSKSQMCKLVAPRTRVFLHDFPRSSEF
FT                   LLQDGCIALYQSLYDGRRQILDILGPGSFLGLSIGSSVNCCAETLAFTQIQPVAQLTDH
FT                   ALGSALKHMLRRSQALVTLLGRKTAQEKVAFALLDLAERFTLTSKASQLRKTTFRLFLT
FT                   RADLADWLGLTLETVSRCLNSFKRSGILTFNHPEIITIADENALRCLASGQPSLAGQKS
FT                   AKGDVSLQPS"
FT   gene            559787..561076
FT                   /locus_tag="Avi_7622"
FT   CDS_pept        559787..561076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7622"
FT                   /product="ABC transporter substrate binding protein (iron)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7622"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40216"
FT                   /db_xref="GOA:B9K5R8"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5R8"
FT                   /protein_id="ACM40216.1"
FT                   /translation="MLVVLLLFSLTGAVLVMVMVIAFDHLIIRRVKPLKLALNRQPFTI
FT                   VVGAGSPTRQDLTQGNIMKKLVFSAFVGLMAMTASAFADITVTDVKGRTVTVPKVPERV
FT                   VLSFYYEDYLAIAGPGALDKVVALSLSPWKDWRPNQFAAYEKALPKLASIPDIGSTEDN
FT                   TFSIEKVIAAKPDLLILAAWSYDALGEGTKQLEAAGIPIVTLDYNAQTVEKHVASTLAL
FT                   GKLMGTQDRAEKLAKNYKDAMADVQARIQKAGPTEKKVYVELAQKGPDEVGNSYGDTMW
FT                   GALVDRLGGHNIAKGQIGNWGPLSPEYVLAQKPDLIFLGGSEWLNKPQSVQVGFGADPA
FT                   VTRQRMKAYLGRPGWSDLPAVKEGGAHAIYHGGARTLSDYVYAQYIAKQLYPDAFKNVD
FT                   PAKNIADYYNNWLPIKADGVFVLPYEANGQ"
FT   gene            561073..562137
FT                   /locus_tag="Avi_7623"
FT   CDS_pept        561073..562137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7623"
FT                   /product="ABC transporter membrane spanning protein (iron)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7623"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40217"
FT                   /db_xref="GOA:B9K5R9"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5R9"
FT                   /protein_id="ACM40217.1"
FT                   /translation="MTTFSAEIDGMRDGYRRASARRTLVMIGALICLVLLMVLDLTTGP
FT                   SGMPLAEVWHGLLAGPAGDDRMVATILWQLRMPQTVMGVLVGACLGLAGLQMQTILGNP
FT                   LASPFTLGFSAAAGFGAALAIMFGSLIPLPGFIVIPACAFVMTLVACALVYLIARLRGA
FT                   TPEILVLGGIAVLFFFQSLQSLLQFLASPEVLQQIVFWLFGSLLKSSWTSVTVSAAIAC
FT                   ACLPFITRSTWALTTLRLGDANARSLGLSVEKIRRNTFLIVALLTAGAVSFVGTIGFVG
FT                   LIAPHVARALVGEDHRFSLPLAALTGAIILIGACVFGKFISPAAVIPVGIITAIAGVPM
FT                   LFVVIAKRGQRGLT"
FT   gene            562134..562919
FT                   /locus_tag="Avi_7625"
FT   CDS_pept        562134..562919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7625"
FT                   /product="ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7625"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40218"
FT                   /db_xref="GOA:B9K5S0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5S0"
FT                   /protein_id="ACM40218.1"
FT                   /translation="MTARLVLRDVSVQHGRTTIVSGVSTSIAAGQIVGLIGPNGAGKST
FT                   LLNAIAGQVPAKGKVLWNGKPVGARDIGFMPQQCQVRADLSVLEVILLGRHEQLGWQIA
FT                   SDMLAAASRILAFFGISDLATRSMLTLSGGQQQLVLLAQRLLREPQLLLLDEATSALDV
FT                   RHQMHVLKRLRDYVERTGALVLIAVHDLNLAARHSDTVMLLNGGRLIGHGAFDKVITPD
FT                   ILRSVYGIEAEFIPSQSGIPVILPLSPTSIETSPMEETP"
FT   gene            562916..563839
FT                   /locus_tag="Avi_7626"
FT   CDS_pept        562916..563839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7626"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7626"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40219"
FT                   /db_xref="InterPro:IPR007410"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5S1"
FT                   /protein_id="ACM40219.1"
FT                   /translation="MKSRTSRFATIVIATLVFVSPALAHEFKVGDIDIGHPYARAMLPG
FT                   AKVGGGYLKLTNEGGTDDRLVSATSDRAGSIQLHEMKIDAGVMIMRELQGGIVIPKGQT
FT                   IELKPGSYHVMFMNVQQPFKEGETVKATLTFEKAGSVEVEFSVGSPAGGAPEMKHDGHA
FT                   KHGDHAAMQMPPQSADPQEAIPAKLKAAFETADKPLSVAPVVVQGDWAIAGWTQEGRGG
FT                   RALLKNKGDVWSIQLCSGDGLKQADTLKAIGLSENDASALSAKLADAEAHVDAKTLVLF
FT                   ASFEGTVMVEGAEDHGGHDAHKDHGK"
FT   gene            563836..564495
FT                   /gene="sco1"
FT                   /locus_tag="Avi_7627"
FT   CDS_pept        563836..564495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sco1"
FT                   /locus_tag="Avi_7627"
FT                   /product="electron transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7627"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40220"
FT                   /db_xref="GOA:B9K5S2"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5S2"
FT                   /protein_id="ACM40220.1"
FT                   /translation="MTRSPLIILALAVAGLFVTSLIGVMIWVAYDSPRPGPFRTQFELT
FT                   DDRGNPVGPSIFHGSPALVYFGYTHCPEVCPTTLYEVADWLKTLGSEGKDLKAYFFSID
FT                   PERDTPEVMHGYVTAFTDRITGITGKPEEMKKVVDGWMIHASKLPSEDGDYHMSHTVSL
FT                   LLVGADGRLKDMIPYGLDKQQAITKIRELLSNGPGAKTVGQQLSDSLILPSPGQRS"
FT   gene            564492..565277
FT                   /locus_tag="Avi_7628"
FT   CDS_pept        564492..565277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7628"
FT                   /product="intracellular protease/amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7628"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40221"
FT                   /db_xref="GOA:B9K5S3"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5S3"
FT                   /protein_id="ACM40221.1"
FT                   /translation="MNRRDFNVLFTAAGAGLLLNNGIASAQTPPPSPDGPVFAMLVHPK
FT                   MILLDLLGPMTVFNITRGKIHLVWKDQTPVSTDVGIPVTATTTFKKCPRNVDVFFIPGG
FT                   LVGSTELMEDAETLDFVREMAAGAKYVTAVCTGSLVLGAAGLLKGKRATTLWNVRDLLP
FT                   TFGAISVNERVVEDGNLITGGGTTAGIDFGLSVVARLRGEDLAKRIQLIIEYDPKPPFD
FT                   AGSPDKAGPDIANAFLKIRKPAMDDAKAAAQRAARKLSL"
FT   gene            complement(565611..566639)
FT                   /gene="moaA"
FT                   /locus_tag="Avi_7629"
FT   CDS_pept        complement(565611..566639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaA"
FT                   /locus_tag="Avi_7629"
FT                   /product="molybdenum cofactor biosynthesis protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7629"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40222"
FT                   /db_xref="GOA:B9K5S4"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5S4"
FT                   /protein_id="ACM40222.1"
FT                   /translation="MLTPGTALPSSCGLIDRFGRRVTYLRLSVTDRCDLRCMYCMPENM
FT                   TFMPKRDVLSIDELERLAVAFIRSGVTRIRLTGGEPLVRKGIIDLIRSLGRNLQGGPLQ
FT                   ELTLTTNGTQLARYAEDLAQAGIRRLNVSLDTLAPERFRTLTRGGSLTTVLEGIDAARA
FT                   AGLAVKINSVALRDSTEQEIHDLIAFAHGPGMMLSLIETMPLGDIGVDRIDQYLPLNEL
FT                   RKTIETRWSLTDIPLRTGGPARYARIAETGGTIGFITPLTHNFCEGCNRVRVTAAGVLH
FT                   TCLGQEDAVDLKAVMRRSPHDQDLFAAINQAILDKSRGHDFAIDRTNAPTTISRHMSAT
FT                   GG"
FT   gene            complement(566633..567988)
FT                   /locus_tag="Avi_7630"
FT   CDS_pept        complement(566633..567988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7630"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7630"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40223"
FT                   /db_xref="GOA:B9K5S5"
FT                   /db_xref="InterPro:IPR021163"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5S5"
FT                   /protein_id="ACM40223.1"
FT                   /translation="MTIPIAAAAKAASPFRIAIVGAGPSGFYAAEALLRAPINIQVDMF
FT                   ERLPVPYGLVRFGVAPDHPKLKQVTAVFDRIASMPGFRFVGGIDVGIDVTIDTLFDCYH
FT                   AVILATGAALGRKMGIPGESLPGSHQASDFVGWYNGHPDYRDCCFDLSGERAVIVGHGN
FT                   VALDIARILLKTTDELRHSDIAAHALEALAESKIREVQVVGRRGLLETRFSAKELQEFS
FT                   MLSDCDPVLDPDDPVPDVAALPDGTDAEKRAAVSMLASFSTQISDRKRRCVFRFHLQPH
FT                   AIEGRDRVERMVFSRGSSLSGDKSMPVSIDCGLVFSSIGRRSAPVPGVAYDEARGVHAN
FT                   VAGRGPHQATYVCGWSKRGPQGTIGTNRACAVETVQHVLADLSSNGHRVLADADALIAR
FT                   LAGKHGVHIDFASWQAIDAAELEQGRLAGKPREKFLSVDQMISVVTKRRTAC"
FT   gene            complement(567985..568290)
FT                   /gene="fdxA"
FT                   /locus_tag="Avi_7631"
FT   CDS_pept        complement(567985..568290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdxA"
FT                   /locus_tag="Avi_7631"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7631"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40224"
FT                   /db_xref="GOA:B9K5S6"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5S6"
FT                   /protein_id="ACM40224.1"
FT                   /translation="MTYVVTDQCSGCRYTECVTVCPVECFHIDEEMTYIDPDNCIDCGG
FT                   CAPVCPVGAIHASYLLPADKQEWIEINRRRAAETPVVASRLPPLPGAEERRQALTS"
FT   gene            complement(568363..570489)
FT                   /locus_tag="Avi_7633"
FT   CDS_pept        complement(568363..570489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7633"
FT                   /product="reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7633"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40225"
FT                   /db_xref="GOA:B9K5S7"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5S7"
FT                   /protein_id="ACM40225.1"
FT                   /translation="MARSVVVGACPHDCPDTCSILTTVEDGKALAVRGNPDHPFTRGRL
FT                   CVKVNNYQDRVYSDKRLLYPMRRVGPKGSGQFVRISWDDALEEIAIRWKDIIASHGAQA
FT                   ILPYSYLGTQGILNGLNVGDPLFNKLGASVSERTFCDSGSCTAYMMTIGHTPGVDPESF
FT                   VHSKYIILWACNTLSTNSHHWPFIEEARKSGAKLVVIDPVRTRTARLADWHIPIRPGTD
FT                   GALAMAMMHVIITENLVDRDYVDKHTLGYDELVERVAEYTPEFASLETGIPVDDILKLA
FT                   REYATTPAAVVRIGVAVERHAGGGQTVRAIACLPALIGAWKHVGGGLLQLPIWAFPVNW
FT                   GGLMRPDLQPEKMRVINSWRLGQALTGALELDPPIRALFVYNANPMAMVTEQEKLEQGL
FT                   GREDLFTVVSEHFITDTARYADILLPATTQLEQKDIMFSWGHLYLSYNNPAIEPLGEAV
FT                   SNTELFRRLAGALGIDDPFFFRSDDEMIEASMDWASPVLEGITLDQLKQSGYMRLNMPA
FT                   ADRWAPHRDGNFPTPTGKCEFKSTLAESGNFVAPLFRQGYGGDQSGEAVDPLPHYIRPN
FT                   ESPATHPVLAQQYPLSLISPKSHAFLNSNYGNLPAQIAQAGEEQAVLLHPDDASERGII
FT                   AGAPIRVFNDRGMFEAFATLSPDVMRGVVVAPSGYWQRSNRKGATVHAVTPPAYADLGR
FT                   APTFSDALVQVAMA"
FT   gene            570675..571589
FT                   /locus_tag="Avi_7634"
FT   CDS_pept        570675..571589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7634"
FT                   /product="transcriptional regulator AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7634"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40226"
FT                   /db_xref="GOA:B9K5S8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5S8"
FT                   /protein_id="ACM40226.1"
FT                   /translation="MLGHSVDKYVTGSMLETSNAHGWTNMLAERWSHAPGELPSLVPRE
FT                   TEIAILLRGRSVVDRIGGGMRQYTQARPGTIWLCPAGIEEEFINVTESIDDCLHIFLSG
FT                   QPFDETILREHDIDPARVELRYESIASDPFIEFIATEILKEMAEESPAGRLLMETLAIS
FT                   LSAHLIKRYSATDLRPKQPSAQDRPLDQKRLSRVKDYIDAHLENDFTVVDLASIACMSV
FT                   AHFARSFRAATGKTPHNYVRDLRLELAKQRLTRDDSHIAEIAFAAGFSSQANFTKAFRS
FT                   ATGLTPAKFRVMTALRTPQRNKN"
FT   gene            572212..573078
FT                   /locus_tag="Avi_7635"
FT   CDS_pept        572212..573078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7635"
FT                   /product="AraC-type DNA-binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7635"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40227"
FT                   /db_xref="GOA:B9K5S9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5S9"
FT                   /protein_id="ACM40227.1"
FT                   /translation="MCNVYVALDPETPSKMDFRGAVTDHPFDEIGISNIASLKQTIART
FT                   TSGIRRDTNAYCFLNLQVAGTCRIRQGNRDAITMPGEFTVVDSSEPFLLDYTSDTWEQY
FT                   AFKIPKHMFDSHVGHEFVARTVTDRTPIGKVVVDFLASIARNPENLRHSSINMTKTIID
FT                   LVAMSLRASTPERDDDRRRTFRSPLRQSVLRYVELNFADPEISPAKVAAHFGISTRYLH
FT                   KLLEEHGETLGQIILAKRLDRCASELRKGTCLTISEAAFRWGFNDMSYFSRAFRRRFGV
FT                   APRDYRR"
FT   gene            complement(573139..574389)
FT                   /locus_tag="Avi_7637"
FT   CDS_pept        complement(573139..574389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7637"
FT                   /product="Acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7637"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40228"
FT                   /db_xref="GOA:B9K5T0"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5T0"
FT                   /protein_id="ACM40228.1"
FT                   /translation="MSIDFNLNADQIALRDGARAFANTVLKGVRKTIAQYSRPDERFYA
FT                   IKPFFEQGVHAGFVNALLPKEAGGSDIPTLDFALAAEELTSVDVNIPSALLGSGLCIKP
FT                   VAMFGTKEQKKRLLTDFAEDGTRLGALAFTEVTGGANFDSPDPRFGVKTSATLEGDEWV
FT                   INGEKHYTTNGTGWDGNNCHLYAVVCRTDLTRNAEESLAVIMVPGNTPGVRVAGLLDTV
FT                   GHRATISPRMTFENVRVPVNNILGEPGDGIKIVSTNFAWTAALIGAACVGVMRAAYDYA
FT                   LQYARADSHSGPHPIIEYPTVGYMLADMKMKIEACRYMTWKACHQYDQSKGAEHELAVM
FT                   TKVFCSETCVDVVYDAMRVVGVDSYTDMHPLAELMNDAMCFPLYDGGNMGARRRNLHSI
FT                   IKSSSYSSLTAPYATFA"
FT   gene            574970..576937
FT                   /locus_tag="Avi_7641"
FT   CDS_pept        574970..576937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7641"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7641"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40229"
FT                   /db_xref="GOA:B9K5T1"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5T1"
FT                   /protein_id="ACM40229.1"
FT                   /translation="MPVFKFSKLVRELLTVRSDNPDLLKAQYRAFSSQMPMMYFILLSS
FT                   SWALAITHFQSSPLYLTVGMPLLFTCLGGLRMVFWLRNRSVEPTAEMAHAAMTCANRLA
FT                   IVIAITFAVWCYMLLPYGDEYERSYVSFYMAITVMSCIFCLMYLRSAAVIVTIIVSVSF
FT                   IIFFISLEKIICIAVAVNIILVCAGIISVLLTNYRNFEQMVLSQHRAEALSNENLRLAH
FT                   VDSLTELPNRRAFFSYLEFELTKASTVGSRVALGLIDLDGFKPINDLYGHSTGDRLLVE
FT                   VGKRLLDLPEGHKIFRLGGDEFAVIATNSLDDEQFLSAANALIERLHHPFHMAEATVQI
FT                   SASMGIAIYPDLTLTPDRLLDQADYALYHAKNTRRGSAVLFNACHERQININASIEQTL
FT                   KQADISHEMSVVYQPIIDIRQGKPVGFEALARWESPTLGCVSPAEFFPIAERAGIVGLL
FT                   TRPLLRKALDAASQWDRDLRLSFNLSAYDLNLSESATLLIDIIENGKFDAGRIDFEITE
FT                   TAFTHDFTQVKRSIEMLRSRGCGISLDDFGIGYSSLTRLHSLPLTKIKIDRSFVVGLDK
FT                   TPASYKIVKSVLALSQDMGLECVVEGIETHDELAALQKLGGILVQGYICSPPLRESDVA
FT                   EFIARTADTSAFQASGVFNF"
FT   gene            complement(577013..578740)
FT                   /locus_tag="Avi_7643"
FT   CDS_pept        complement(577013..578740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7643"
FT                   /product="sensory methylation accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7643"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40230"
FT                   /db_xref="GOA:B9K5T2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5T2"
FT                   /protein_id="ACM40230.1"
FT                   /translation="MGLLSIVFGSDIKAIFDAINRSQGVIEFDIQGNILDANDNFCKTL
FT                   GYAKSDIIGKHHRIFLDPEEVKTKAYADFWAKLVSGQFDQRQYKRFTKSGDPIWIEASY
FT                   NPVFRGGKPYKIVKIATDITASTNKAMDGDGKMEALLRSQAVIEFTPTGQILTANENFC
FT                   KAMNYDLSEIIGKNHSMFCEQAYIASPDYKEFWRKLGADEFQSDEFLRIGKGGKKVYIQ
FT                   ATYNPITDEKGKVVKVVKFAIDVTGRVNAIAAIGAGLERLSDCNIRMTIDEPFIPTFEH
FT                   LRKDFNMSIGKFQETLAQVLAETAAVSANSHDMLKGSTSLAKRSEQQAAALEQTSAALE
FT                   EITATVRESSARSKDTRNLVRDARQAATESVKVVNFTVAAMSRIEGASKEISNIITVID
FT                   EIAFQTNLLALNAGVEAARAGESGKGFAVVAQEVRELAQRSAKAAKEISELIAKSTNEV
FT                   KDGVRLVGETGSALNRIESFVQSIDVNIEAISTAASEQSTSLTEISTAVNALDQMTQQN
FT                   AGMVSGMNAISEALSSGAAKLSELANRFQLNRRSAIREPGSSAAMRDNDRRESNRSAA"
FT   gene            579230..580588
FT                   /locus_tag="Avi_7645"
FT   CDS_pept        579230..580588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7645"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7645"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40231"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5T3"
FT                   /protein_id="ACM40231.1"
FT                   /translation="MKTVLFCLALFLLPISSAFADCPAPIDNSFAAAANAKFDCSSSLP
FT                   LKGHETDRKFQVHYDFPKTLPDTSKLPWLTIDPFKNPADYMQAVLNYVTKVNARPEIDW
FT                   RIQDNKVEEWCDAPWFFMLREPLHGMTTERWSRPKELHALQTDWERTFAVGIYNDVACY
FT                   GFGQIWADPAFPKTLDFAFADGAVAAKMLFTSAKPSSVPYLAGSKEWDVAGEKDGSTMT
FT                   MRLLQFDLSIKDKRSPNGWFFGTFVYNAMQPGDTPYQRLVPVGLIWGSDPALNAKAYLE
FT                   QAMSPTESWVNPAVATMFYPLPRQHLGLFGRANGPVDNPMSACITCHQRALDWGTAVLP
FT                   DSPEAAQAAELLPDVPTDPYNDSAVAAYFRNIGSNSPVPDTQSLDYVLQVSKGISAFRN
FT                   WVKTDFPDHAASTSDVPPYPFKPGNTITVTPVDITAPGAEKLELDPTGKLFLR"
FT   gene            580634..582223
FT                   /locus_tag="Avi_7646"
FT   CDS_pept        580634..582223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7646"
FT                   /product="TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7646"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40232"
FT                   /db_xref="GOA:B9K5T4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5T4"
FT                   /protein_id="ACM40232.1"
FT                   /translation="MLSLNIFGRFLIVDSHGCDRSPRGSKARGIVALLAMSQGYSRNRT
FT                   WLQDKLWSDRDSKRGSDSLRQTLVDIRRAFGPYQTILKADREKVALDPTRFSIKYRLMP
FT                   ASNDWNNEQDAFADLDIRDPEFEDWIRNLRASLADKARISPPHALRSHTAPKPAIFFQF
FT                   LSDNQPSSELTSSRLMTLTTTSLRDLDDFEIFPRHAAIGGTLPPLPVKGLTVAVRTVTL
FT                   GRDSHVAIALSHAGTGQLYWSRTTQISASHTELLHHESGILVQAILSTLRERKDQLGIS
FT                   HSGAMLANHARALIFRFDRQSLRDADVNLRYAYDRDPRPQYLAWRAFLRNMAQFQHCSS
FT                   AFLDDKITSTELVQEALREDAGSASILGIGAHLEYLGGGSSRGSLRLAERAVSLDPLNA
FT                   VNLAILSNTELVLDKLRDSQGSALSALALTGGGEHRAFVEFFCCMSAAALGEYATAIGH
FT                   AEAALILRPAFRAPLRYLIALYKQAGMIEQMDRAVSRLQQFEPDFLPARFLDSDYPVTT
FT                   MRRIRLIDAIAS"
FT   gene            582859..584745
FT                   /gene="acoR"
FT                   /locus_tag="Avi_7648"
FT   CDS_pept        582859..584745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acoR"
FT                   /locus_tag="Avi_7648"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7648"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40233"
FT                   /db_xref="GOA:B9K5T5"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5T5"
FT                   /protein_id="ACM40233.1"
FT                   /translation="MGFADHVKEIERVGQGSNTGRDAIVVESWRRCLETYQLDPAQARE
FT                   AVIVSQTRLREHRQQAEDLVHIARSGLERLYRQVAEQNYVLLLSDRQGVTVEFLGDPSF
FT                   NNNLRKAGLYLGSEWSEPRAGTCAVGACLATGEALTIHQTDHFDITHTPLSCTAAPIYD
FT                   TQGALAAVLDISLLSSPILKTSQNMARHLVSSTVRRIELANLMANSRHDLVLRFAGAPE
FT                   FLDVDPEAAISVDGAGRITGMTHGGARLLAASRGIDWRQPELVLGQPVADFFEAGLDEL
FT                   ASLTRASLPQDRRIAVRDGSVLFAHAIEPQQRVAGTPLVRALRSPPAMNLLGGSVEIMD
FT                   SLRRKIAKLAPSALPILLQGETGTGKEYLARIIHEVSGLSGRFVAVNCAAIPEQLIESE
FT                   LFGYAPGAFTGALVKGRKGLVEEAVGGTLFLDEIGDMPYAAQSRLLRVLAEGEVLPVGG
FT                   SVARKVEFRVVSASHRSLADMVATGAFRQDLYYRLNAAVLSLPRLCERGDLPWLLDKLL
FT                   EKHAPVNRSLRLSNTARLLILNHRWPGNIRELDNAIAFAAALCDDGLIEVTDLPEQLAA
FT                   NVQLPGDDSPEAELRAVLAACHGNVSEAARRLGIDRTTMHRRMRRFGIDRPH"
FT   gene            584910..585983
FT                   /locus_tag="Avi_7649"
FT   CDS_pept        584910..585983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7649"
FT                   /product="zinc-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7649"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40234"
FT                   /db_xref="GOA:B9K5T6"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5T6"
FT                   /protein_id="ACM40234.1"
FT                   /translation="MRALRFHAAKDLRLDDIAEPKRPGPGQVLVRNRFVGICGTDLHEY
FT                   SYGPIFIPTEPHPFTGAHGPQVLGHEFGGFVEAIGEGVTSVVVGDRVSIQPLVMPRSGD
FT                   YFADRGLFHLSTQLALVGLSWDGGGMADAALVNDYNVQKIPEEMSDEEAALVEPTAVAV
FT                   YACDRGGVTAGTSVLVTGAGPIGMLTLLAARAAGATQLFVSDLNDSRLALAKGVLPDVI
FT                   TINPQRDNVGDVVRLQTEGNVGCDVAIECVGNEHALKACVDAVRKQGVVVQTGLHPHEN
FT                   PIDWFQVTFKDLEIKGSWAYPTHYWPRVIRLIASGQLPAMKIVTKRVTLDTAVKEGFDV
FT                   LLDPAGAQLKILIDLSK"
FT   gene            586099..587901
FT                   /locus_tag="Avi_7650"
FT   CDS_pept        586099..587901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7650"
FT                   /product="flavin-containing monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7650"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40235"
FT                   /db_xref="GOA:B9K5T7"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5T7"
FT                   /protein_id="ACM40235.1"
FT                   /translation="MLDISPATKIDTVLSKLGKALESGDIDAAVNLFQTDCYWRDLVTF
FT                   TWNLKTLEGHEQIREMLKSQLGAITPSNFVQDPKEPATDAGGITDGWFEFETGVARGYG
FT                   HIRLKDGRIWTLLTTMTELKGHEEPKGIRRPMGAEHGHDRNRMTWKEKRESESAELGYS
FT                   AQPYVVIIGGGQGGIALGARLRQLGVPTIIIEKNERPGDSWRKRYKSLCLHDPVWYDHL
FT                   PYIPFPENWPVFTPKDKVGDWLEMYTKVMELNYWSSTTCKSAQFDEATGEWTVIVERAG
FT                   KEIVLKPKQLVLATGMSGKANVPNFPGQDVFKGEQQHSSQHPGPDAYAGKRVVVIGSNN
FT                   SAHDICAALWEAGADVTMLQRSSTHIVKSGSLMEIGLGDLYSERAVQGGMTTRKADLIF
FT                   ASLPYRIMHEFQIPIYNRIREQDADFYKALEEAGFMLDFGDDESGLFMKYLRRGSGYYI
FT                   DVGACDLVIDGSIKLKSGVDVSHLTENAVVLKDGTQLPADLVVYATGYGSMNGWAADLI
FT                   SRDVADKIGKCWGLGSDTTKDPGPWEGEQRNMWKPTQQDALWFHGGNLHQSRHYSQYLS
FT                   LQLKARQVGIDTPVYGMTRPHHLS"
FT   gene            complement(588203..588877)
FT                   /gene="menG"
FT                   /locus_tag="Avi_7652"
FT   CDS_pept        complement(588203..588877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menG"
FT                   /locus_tag="Avi_7652"
FT                   /product="demethylmenaquinone methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7652"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40236"
FT                   /db_xref="GOA:B9K5T8"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5T8"
FT                   /protein_id="ACM40236.1"
FT                   /translation="MIHIKKIPERPSQQEIDAIAKFSPATLHEAQGRRGALSSRIKPVD
FT                   YRMKLCGPAFTVKSAPRDNIMLQLAINYAQPGDIIVVSGGEYEEAGSFGDVLANACLAK
FT                   GIGGLVTDTGVRDTLQLRDLGFPVFSLSVCIKGTVKETLTAVNDPIVIGDELVFPGDII
FT                   VGDADGLVVVRRQEAVDVAALAQAREDAEAGYIAAYKAGKSVIEVSNLEPVLRAKGFSV
FT                   EA"
FT   gene            589053..589952
FT                   /locus_tag="Avi_7653"
FT   CDS_pept        589053..589952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7653"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7653"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40237"
FT                   /db_xref="GOA:B9K5T9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5T9"
FT                   /protein_id="ACM40237.1"
FT                   /translation="MRYFARIAELGSFTRAASELGVAQPALSLHVRALEDQLGLQLLNR
FT                   TSRGVVVTEAGQTLLVHAQAILRAVEQAEAATREQAKYPSGDVSLGILSSLSPILSIPV
FT                   LEACDRRFPKIRLTISEGDSQTLRTATDIHAHDLAVNLLDVAKPTAVPLFDERLYAVGP
FT                   LNAFTQRQNDLPLREALSLPLIMPSQRHGIRILLEKQALILGQKINIVRVIEGVASTKA
FT                   AIRAGLGLTILGRGAVYADHQAGQLSVIPLRAPELFRRLVLDMPVNHPPTKAVLEVRQI
FT                   LMEVIKRLGGEGHWSCLA"
FT   gene            590128..590547
FT                   /gene="accB"
FT                   /locus_tag="Avi_7654"
FT   CDS_pept        590128..590547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="Avi_7654"
FT                   /product="acetyl-CoA carboxylase biotin carboxyl carrier
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7654"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40238"
FT                   /db_xref="GOA:B9K5U0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5U0"
FT                   /protein_id="ACM40238.1"
FT                   /translation="MDLDKIKTLIDFVGQSRISELSVTENGTTVRISHYPHAQDAIAIG
FT                   PKDSVAETPKPSASGGVDTVSAPVFGIFHRAPNPGANPFVSVGDSVEVGQSLFIVEAMK
FT                   VFNTITAERAGKVVRLLVEDGQEVDAGQPMLEIAG"
FT   gene            590544..591917
FT                   /gene="accC"
FT                   /locus_tag="Avi_7655"
FT   CDS_pept        590544..591917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="Avi_7655"
FT                   /product="acetyl-CoA carboxylase biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7655"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40239"
FT                   /db_xref="GOA:B9K5U1"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5U1"
FT                   /protein_id="ACM40239.1"
FT                   /translation="MTSDTKRPFDTVLIANRGEIALRIQRACRELGLRTVMICSEADRD
FT                   APYGATGDEFICIGPSAPGRSYFNQSAILLAMRASGAGAVHPGYGFLSENADFAEAVEQ
FT                   AGLTFIGPPASAIRIMGDKIAAKRAMIEAGVPCVPGPDTALGEDMADIAEIAAKIGYPV
FT                   IIKAAGGGGGRGMRIVRDAAALADAVSITREEARRAFGNPELYMEKFLEKPRHVEIQVL
FT                   CDNFGNAVWLGHRDCSMQRRHQKVVEEAPSPGIPADVAATVGARCVAACQRIGYRGVGT
FT                   FEFLYENGEFYFIEMNTRLQVEHPVTEMTSGLDIVCEQLRVALGLPMMLTQADIQTNGH
FT                   SFECRINAEDPYTFAGSPGKITALQLPSGEGVRVDTHVVEGYTVPAHYDSLIAKLIVHA
FT                   PTRDEAIVRMRAALDALKIDGITTNIALHKAIFEDAGFCAGGADIHHLEKWLSKRSAA"
FT   gene            591914..592357
FT                   /locus_tag="Avi_7656"
FT   CDS_pept        591914..592357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7656"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7656"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40240"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5U2"
FT                   /protein_id="ACM40240.1"
FT                   /translation="MTTRTRSKSRSAADFTSPEVIATLTAWLEQAGVSTIAIERDDQQI
FT                   KIVMAGGAAQISLQTRDKQKPASSVAVKAPCVGHFLAHHPARADEAAKDGPVVKAGDTV
FT                   GFVKIGPVLLNVIAPQDGILGEALVKSGTLVGYGDPLFLVEQP"
FT   gene            592357..593067
FT                   /locus_tag="Avi_7657"
FT   CDS_pept        592357..593067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7657"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7657"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40241"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5U3"
FT                   /protein_id="ACM40241.1"
FT                   /translation="MATMDMKTLTHPAVIASSTADMPKISAIGTKAFVVDAPGPFDLAS
FT                   QRRIWALSAIVQDWPDVQEIVPGMTNLLLVLHHTPEDHAAIASRLLEAWNAAQGMDLTG
FT                   KTVEIPVTYGGDHATDLPALCDLSGLSDRDIVKIHAAGTYTVFALGSAPGFGYLHGLDP
FT                   RIHMPRKTVPSLKMARGCLTIGGMQTGVAVLTGPNGWNSIGFADVPMFDPMAASPALLA
FT                   PGDTVRFIAERIEL"
FT   gene            593064..594062
FT                   /locus_tag="Avi_7658"
FT   CDS_pept        593064..594062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7658"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7658"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40242"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5U4"
FT                   /protein_id="ACM40242.1"
FT                   /translation="MIEVLTTGPLNTVQDLGRFGFRNIGVTTCGAMDPVALKIGNLMLG
FT                   NDEGAAGLEIQTFPFRLRFEKDGFVAITGADCAATLDGKAMPPWWALPVFAGQELELKT
FT                   PTKAARAYLCFSGGIDVPLVMGSRSTSLRGAFGGYHGRFLAVGDRLALGEAQALPIPSS
FT                   GFGVMPPEVALQDHFPAVENGILPIRALPAGEHDWFGEESMRFWAQDWKISSQSDRTGY
FT                   RLSGAPVKLKEHVEMRSHGVVTGVVQVPPAGEPIIQMSDANTAGGYPKMAGVIDIDLWR
FT                   LGQARIGSRIRFVQSTLAEAKAAEQAVAGYLADIRNTVPLLTDALATMTKR"
FT   gene            594078..594845
FT                   /locus_tag="Avi_7659"
FT   CDS_pept        594078..594845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7659"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7659"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40243"
FT                   /db_xref="GOA:B9K5U5"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5U5"
FT                   /protein_id="ACM40243.1"
FT                   /translation="MKIDLNSDMGEGFGPYRLCDDEALMDVVSSANIACGFHAGDPEMM
FT                   LRMVRLAKARGVGIGAHPGFPDRLGFGRRDIPVSAEELRAQVLYQLGALSAIAASEGLS
FT                   VDHISFHAAMGNRVNHDPALCDLVLAAVKTVAPEIIVFCMSGSEIERSALRCGLKTLTL
FT                   FLADRAYDANGALVPRGVANSVIKEEMAVRARVKQFLETATVTTIDGQTIAMPARSILV
FT                   HSDTPGSLELAKIVRSEIEATGATLATARDVIA"
FT   gene            594894..596108
FT                   /gene="aatA"
FT                   /locus_tag="Avi_7660"
FT   CDS_pept        594894..596108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aatA"
FT                   /locus_tag="Avi_7660"
FT                   /product="aspartate aminotransferase A"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7660"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40244"
FT                   /db_xref="GOA:B9K5U6"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5U6"
FT                   /protein_id="ACM40244.1"
FT                   /translation="MSMPKPMIADRLKNVAVSASAAMTQRARELAAQGIDVVSLSSGEP
FT                   DFATPAHAIEAAHAAALAGDTKYPPLDGTAALRAAISRKFKRENSLDYDPSQIVVAGGG
FT                   KQVIFNAVMATCNPGDEVVIPTPSWISYADIVRFAGGVPVPVECPQQNGFKLRAEDLEA
FT                   AITPKTKWLFLNFPNNPTGAACSRQDMAAIAEVMLRHPDVWIMTDDIYEHLIYDGFEFC
FT                   TIAEVEPRLYDRVLTVNGASKAYAMTGWRLGYCGGPKDLIKAISNVNGQNAGGTSTITQ
FT                   AAAMAVLDGPQDLLKERANIYKGRRDYVLSRLAEIDGLRAHKPEGAFYIFPSIAGLIGK
FT                   TTKGGRKIENDADFVSALIDEQHVATVQGAAYGMSPFFRISYATSMERLTAGCDRIAQF
FT                   CKDMK"
FT   gene            complement(596173..597078)
FT                   /gene="nac"
FT                   /locus_tag="Avi_7661"
FT   CDS_pept        complement(596173..597078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nac"
FT                   /locus_tag="Avi_7661"
FT                   /product="transcriptional regulator LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7661"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40245"
FT                   /db_xref="GOA:B9K5U7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5U7"
FT                   /protein_id="ACM40245.1"
FT                   /translation="MDIRRFKSFIVIVDTGSITRAADILHIAQPALSQQLASLEEHFGT
FT                   KLLLRSQQGVVMTDAGAQVYRHAQMILRQMDQAHADVLAAGKHLAGRVSVGLAPFSSAA
FT                   TLSFELLAETRRLYPGIVLHLTESVGQAYSQMLMNNKLEIALIHGTGPMKGVHFDPLLR
FT                   EDFFLVAHEDFGIEADDKPLSVANLEELPFLLPPPYNFVRRAVDMAFARSRTKLNVIGE
FT                   VEVIRTLTRAVSGGVGATIMPKAVADRITAEASSQIICRTLSPQIEETLSLCVSEHAQL
FT                   SDSAVAVRDILLRLTRQLKN"
FT   gene            597318..598070
FT                   /locus_tag="Avi_7662"
FT   CDS_pept        597318..598070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7662"
FT                   /product="short-chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7662"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40246"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5U8"
FT                   /protein_id="ACM40246.1"
FT                   /translation="MPFSDYKTALVTGASSGIGAAIVERLCAENVEVHAVARSGDLLKQ
FT                   LSEKTGCIAHVIDVTDRAALADLTSKIPFDILVNNAGVDRPKKFLEAEDGDIDLLVDVN
FT                   LRAVLHLCRMVVPGMVARDRGHVINISSIAAQYNFGGNSSYHATKAGVSMLSNQLRIDA
FT                   FGKRVRVTEICPGRVATDIFTHVHGDDPSVRERFIDGFELPQASDIADAIAFAIAAPIA
FT                   VNIGHMEITPTLQVMGGLQTAKPEERKP"
FT   gene            598067..598774
FT                   /locus_tag="Avi_7663"
FT   CDS_pept        598067..598774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7663"
FT                   /product="ABC transporter membrane spanning protein (amino
FT                   acid)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7663"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40247"
FT                   /db_xref="GOA:B9K5U9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5U9"
FT                   /protein_id="ACM40247.1"
FT                   /translation="MKGFDLSAILGNPDYVSMLLHGIEMTFIIAIGSWVLAMTLAVLLL
FT                   ALRFSPGGIGNAIVTAYVSYHRNVPTLVQLVLWYFGIFTLMPSGLSAWLVNHNAETIFA
FT                   VIGLGLCQAAYFSEDLRSGLRSISPGQMEAARALGHGYLSAMRYVMIPQGVRNALPPLI
FT                   NHTVSLFKNSSLAIVVGASELTHAVKEIENITFRTFESYLIGTVLYLFFSLLIMAGGAY
FT                   LQWRVDHARGVRA"
FT   gene            598771..599523
FT                   /locus_tag="Avi_7664"
FT   CDS_pept        598771..599523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7664"
FT                   /product="ABC transporter membrane spanning protein (amino
FT                   acid)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7664"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40248"
FT                   /db_xref="GOA:B9K5V0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5V0"
FT                   /protein_id="ACM40248.1"
FT                   /translation="MIHDIIKIVQDYWLLLLIGQYPNGPLGGLANTLILSVFSIALAFP
FT                   LSILLALARMSKWRTLRWPVTFLVYVTRGVPLLMLILWCYFLVPLLTGADVPSFITMLT
FT                   TLVVYQSCFLSEVVRSGIVALGHGQMEAAKALGHSYPSAMRYVVLPQALYNVIPSILST
FT                   FVSTIKDTTLGSVINVPDLTFAANQVNNDLLTQPFQVYLILALIYYVICWSLTHAAKRL
FT                   EGSISRRRAGLSGKGEDAPSITPQLVSE"
FT   gene            599529..600296
FT                   /locus_tag="Avi_7665"
FT   CDS_pept        599529..600296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7665"
FT                   /product="ABC transporter nucleotide binding/ATPase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7665"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40249"
FT                   /db_xref="GOA:B9K5V1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5V1"
FT                   /protein_id="ACM40249.1"
FT                   /translation="MPLSKPAIEKQQTITLSKVRKSYGNYEVLKGVDAHVNRGEVVVIC
FT                   GPSGSGKSTLIRTINRLEEISSGSISFEGQEVHVPMRTKQLNALRSQIGFVFQSFNLFP
FT                   HLSVVDNVAMSPVRVKGVAPDVAHDKAIRLLDRVGLADKANAYPAQLSGGQQQRVAIAR
FT                   ALAMEPPVMLFDEPTSALDPEMVGEVLAVMKSLAADGMTMMCVTHEMGFARDVADHIWF
FT                   IDAGQILEIAPPETFFTNPTHPRAQRFLSELRH"
FT   gene            600370..601209
FT                   /locus_tag="Avi_7667"
FT   CDS_pept        600370..601209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7667"
FT                   /product="ABC transporter substrate binding protein (amino
FT                   acid)"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7667"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40250"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5V2"
FT                   /protein_id="ACM40250.1"
FT                   /translation="MNMKCITLGLALAATTAIAAPASADQLADIMAAKTLRCATFADVP
FT                   PFASPDPKTREMAGFDVDLCNAIAAKLGVKAEIKPVSVEARVPEVKLGRVDITVANLAY
FT                   TLSRAEQIQFSDPYYLAKEMLIVPADTAGKTKADFSGKRLASTKGSTSEMSIKLNKSDP
FT                   LTFQDTASAYLAVQQGKAEGMVANTMTTTKFVNESQTKGKRMRMIDDPMLYQPIGVGMK
FT                   KDEPALTAKINDTLRALDADGEINKIWNKWLGPDTEYKMTRTDKVVKLSELKFDPIP"
FT   gene            601422..601793
FT                   /locus_tag="Avi_7669"
FT   CDS_pept        601422..601793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7669"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7669"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40251"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:B9JTB0"
FT                   /protein_id="ACM40251.1"
FT                   /translation="MTRRRFDLTDFEWTVIQPLLPNKPRGVPRVDDRRVINGILWRFRT
FT                   GSPWADVPDRYGPYTTCYNRFVRWRKAGVWDHVLGEISKAFDGDIVMIDSSCVRVHQHA
FT                   ATGKRGINTMAAWDVPVAA"
FT   gene            601790..602185
FT                   /locus_tag="Avi_7671"
FT   CDS_pept        601790..602185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7671"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7671"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40252"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5V4"
FT                   /protein_id="ACM40252.1"
FT                   /translation="MTTKIHAVVDADGRPIRLALTAGQAHDGRMAEPLLQTISKGAILL
FT                   ADKAYDTNAIRAFAKQRQAWANIPAKSNRKGSFPFSQWVYRQRNLVERFFSKLKQFRGI
FT                   ATRYDKDPLNFLAAVKLAAARIWIRSL"
FT   gene            complement(602286..602615)
FT                   /locus_tag="Avi_7673"
FT   CDS_pept        complement(602286..602615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7673"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7673"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40253"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5V5"
FT                   /protein_id="ACM40253.1"
FT                   /translation="MQLCQDIRNGVTGRRDAQRTYGVSANLIQLWLTQFDRGDLTFQLV
FT                   QPFAAEFETLRANFDAALSQFSETMCAVSDAAGAIDNGSREVIASADDLSTEVAMDQNA
FT                   AQMEA"
FT   gene            complement(602711..604411)
FT                   /locus_tag="Avi_7674"
FT   CDS_pept        complement(602711..604411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7674"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7674"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40254"
FT                   /db_xref="GOA:B9K5V6"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5V6"
FT                   /protein_id="ACM40254.1"
FT                   /translation="MAHDRNEVLQALQSIVGQDNATNDPSSIASYAWNGGVGSMPGPKF
FT                   LKNWPIAVVMPNSAEDVAAIIKCCLARGLSFRPLSSGNGGTYLSASENVVVMDLCRMNR
FT                   LIKMDAANQMAVIEPFVTAGRLQAEAMKVGLNCHIVGAGPSHSPLASATSFLGVGITGA
FT                   STGANFRNILGIEWVTPQGDIVRMGSLGGDDDWFSEEGPGPGLRGMIRGLIGANGGLGV
FT                   FTRIGYKLYPWAGPKRLNLTGQSPMRGMALEPNMRLFLPVWDTIEQMRDASFHLNRTGV
FT                   AFALLRMPPNHIGWTLTATNAEYARRREAGDLPECARPENRFGWQILTIGHSAGQTAYQ
FT                   EKTVQHIVASTGGRMIPIEQKDTEVLLRTLVTSLYVSRVFRGAGSGGTSFGVMETFNLL
FT                   PDVIKASEDIMAKDRMPGRNFAADGKEGCWVWPTESRQLWTENILASQAGTVKGIGAGW
FT                   KGFLKHLDMVDRNPRLGLMGFMAGPLIELFGPRYSNVTSWMRLIKQRVDPAGLADATVH
FT                   VSAKQLPIAKRWPTLQKIAFSKAGAPVLHLVCLLLGVISKKEKLPERRG"
FT   gene            complement(604414..605730)
FT                   /locus_tag="Avi_7675"
FT   CDS_pept        complement(604414..605730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7675"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7675"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40255"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5V7"
FT                   /protein_id="ACM40255.1"
FT                   /translation="MTHISPTLEKLHDKLGSCTRCTFCKWVPEVRSQDFAEICPSVQHG
FT                   KFFSHTAGGKLIAAYALLHNRVEYTPDFIQNVYSCSMCGGCDTSCKTLLADFVEPLDSL
FT                   YALRQKVTADGHAPEPLREMLAHLRTLGNARGLPAAMRGEWFAGLSLKQTKTHQAPVLF
FT                   HVGDVAFDRDEWPFIRHIASELQRRDVDFVIGGVDEPDSGGLAYDIGDQDLAADLAQKT
FT                   AEWLRKSGAGTLIVYSDDAFSAFRNIYPRLGVSLGNIKVIHIAQWLAENPLTVAAGQKR
FT                   DTVTYHDSCRLGRLGEERHPWEGETVMAYNSIPMRVPEGELYLGVNGVYEEPRQLLRAV
FT                   DAEIVEMERIREFAFCCGAGGGGKQASPDFARAAARNRLQEAESTGAEFLVTSCTACSS
FT                   HMKEVAQEAGSSIRVYGLVEYLHTRQTASAPDASHKAGE"
FT   gene            complement(605730..607205)
FT                   /locus_tag="Avi_7676"
FT   CDS_pept        complement(605730..607205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7676"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7676"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40256"
FT                   /db_xref="GOA:B9K5V8"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5V8"
FT                   /protein_id="ACM40256.1"
FT                   /translation="MAATASLAAVRQKLIRRADVASLRAIGLDAEEASLAPYMPANPSG
FT                   REAPPLAVVRPRSTEEIVAVIGWARKTGTALTTFSSSSGARLRGATAERPTVFVDLSGM
FT                   NHLLQIDQQDAVAVIEPGVTFGAIDALLAPQGLRAFKPLLPRASKSVLTSYLDREPNLQ
FT                   SSEQWDVLDPFGGAQLVFGTGDVFRTGSAAISGTLDEHWKAGLRYLTAMGPAGTDFLRV
FT                   VQGSQGTLAILNWAAILCERLPAREEARFVGADSIAPLARLSAELHRRRIGMASFIASN
FT                   LHLAAVLESEPDRIADLAARLPAYTLYIQLTASCDFPDDKIAYQLADVTQLCADAGLVA
FT                   SPDLAGHSASRIAELQANPPDSNYKDRIAGAHRSVFFLSQMDRAEQFIALARERLGANV
FT                   AIYVQPRLHGRNCHVELVLPFDPASIEQTSAADALADELAKACSATGGFFSRPYGAWAD
FT                   MAFARNPTVKPLLRETKSIFDPDRILNPGRLCF"
FT   gene            607733..608221
FT                   /locus_tag="Avi_7677"
FT   CDS_pept        607733..608221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7677"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7677"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40257"
FT                   /db_xref="GOA:B9K5V9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5V9"
FT                   /protein_id="ACM40257.1"
FT                   /translation="MDSKTPPLLPRFLRAIYWFDEALRASQELQGQTPVTRAQGMLLIN
FT                   IALGERRPTRLARTMGVTKQAVSLMLGDLTAAGYIFIKPDPEDARASLIEFSPQGQTEL
FT                   ENIFATLEHLEDHLATVLGQDRMSVLRAALGMDWGTPPALGSKEAHTPDATESAIQKK"
FT   gene            608583..609776
FT                   /locus_tag="Avi_7679"
FT   CDS_pept        608583..609776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7679"
FT                   /product="Permeases of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7679"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40258"
FT                   /db_xref="GOA:B9K5W0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5W0"
FT                   /protein_id="ACM40258.1"
FT                   /translation="MTNLDTKGTRTALIVGHAAGMIDMVSLPIWVGGLVGGYGYSSAQA
FT                   GGLVTTFLIGVVIASCGLATLFHRFSMRWVPGAGFSGAALAFAALWMASGFGNFLALHL
FT                   CAGLCIGTALSAVHGTIGRTSNAHRTFAYATIGFGIFSVIFMGFATQVIAAMQPRNLFL
FT                   IFAGVMAIAAAVNWLLFPHSATMPKAEKKPSPNSGRVPRFEPVVWFLIAALLGMNFNQA
FT                   MNFSFVERIASDHDWPTSTINGILVGVAFLSLIPAPLAVFFEKKLHPVYVGIVGVLLQA
FT                   ALSLGITHALDVPGFAASAIFIPFVMIFSHTFLFGLMSRVEPTGRAVAANPAITMGGGA
FT                   LGPLVGGILVQTMGYHGLSLATALVATCVVAGLMLVLMRLLPSHASNALAPKRHWPL"
FT   gene            609978..611372
FT                   /locus_tag="Avi_7680"
FT   CDS_pept        609978..611372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7680"
FT                   /product="porin B"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7680"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40259"
FT                   /db_xref="GOA:B9K5W1"
FT                   /db_xref="InterPro:IPR007049"
FT                   /db_xref="InterPro:IPR038673"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5W1"
FT                   /protein_id="ACM40259.1"
FT                   /translation="MKTHLKQLVILSAAYGVLASGLPAVAADANTPADPSIAKAPDPQA
FT                   PPPGPLTGLGHTLHDAGFDVRINFVNLYANASDFGFDPGHSGNFGFLMFDTTYHISDMF
FT                   KINWQETVNIPRHNANQYLFQVSNAFYATDPSLDSSTDLTRLTLQGDFFDGKLEVEGGR
FT                   LNMWPEFFRSEFCGGKGCISQTRALVLSAPGNTVAQWGGRVGYNLTPDLSLGGVITENN
FT                   TENWQTGSGWNWGRGDSDGYTAVVHLAQRQNFLETAKPLNYEIGGYRSSASYTDALYGT
FT                   GWGNPTFGANQTVIEHDGGSNGVFAQVRKVLWSDPDGSPFPENIAVSGGIFHTFGDGQS
FT                   YPWEAYGSIEYGGFWKANPLTSIGATVHYIGLSEKRAQYETNARRFLTGIYDRQPRDTF
FT                   QFDLHGRTGIGPAGFLEFGASYVKDPNTTYLADYSTSRMKNGWTIYAAIVFDLGTTLGL
FT                   SPPPQP"
FT   gene            complement(611605..612105)
FT                   /locus_tag="Avi_7681"
FT   CDS_pept        complement(611605..612105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7681"
FT                   /product="CbaR"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7681"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40260"
FT                   /db_xref="GOA:B9K5W2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5W2"
FT                   /protein_id="ACM40260.1"
FT                   /translation="MKTGARCPQDRISSPTTTRDGVEILDISNYTPFFLSSINNALSRG
FT                   ASSVYRERFGIGISEWRAVSMLAIEPNITAGRICDVINLDKAAASRALATLDEQGYLDS
FT                   EVSETDPRKKRWRLNQRGYDLHEEIMRIALAREETLIEGADPQDLEATIRVMRIMLKNV
FT                   QNL"
FT   gene            complement(612135..613373)
FT                   /locus_tag="Avi_7682"
FT   CDS_pept        complement(612135..613373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7682"
FT                   /product="ferredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7682"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40261"
FT                   /db_xref="GOA:B9K5W3"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5W3"
FT                   /protein_id="ACM40261.1"
FT                   /translation="MNQVAIIGSGQGGFQLAASLRQEGFSGEITLIGEETGLPYQRPPL
FT                   SKAYLKDGRAESIELRPDSFFHRNKIGLIAGDPAIHIDRVTRTVATKSGARIGYNHLVL
FT                   ATGARNLIPPIRGLEGSDVFALRTAADADALREALARGRRHPVVIGGGFIGLEFAAVAA
FT                   SIGHSVTVVEATERLMARAVSRAMSGFFQTFHEMHGVSLHFGDPVNEILRSEDGGVVGV
FT                   RLLSGAIIPGDMVLLAVGVRPNVELARNAGLEIANGIAVDAYLLTADPAISGLGDCAAF
FT                   PDPVTGELTRLESVQAATDHARTIARRLTGKSEPYEALPWFWSDQGPWKLQIAGLAVSG
FT                   DEDHPLEGENGRRLVFRFKSGKLRAVETVNAAAEHMAARQLLKSPEGVTADELVQCNYD
FT                   ITALSKSRKARAA"
FT   gene            complement(613702..614919)
FT                   /locus_tag="Avi_7683"
FT   CDS_pept        complement(613702..614919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7683"
FT                   /product="cytochrome P450 hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7683"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40262"
FT                   /db_xref="GOA:B9K5W4"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5W4"
FT                   /protein_id="ACM40262.1"
FT                   /translation="MIEGHRVFEPAEGIPVWDIDPYDEAVLADPNAYYAELRAKGPLVY
FT                   IPKYSILASGRYEETKEIFSDHARFVSSRGVGLNDFRYGTPWRPPSIILEVDPPEHART
FT                   RKVMARALSPKAISKFKEDFRVKAVEIVDALLEKRRFEAVVELAEAFPTAVFPEALGMV
FT                   DHDPRPLVDYGAMVFNSMGPDNALRRKAGAMIPEIVPWIMSACARSRLRPDGMGAIIYE
FT                   AADAGEITQEEAGLLIRSFLSAGVDTTVTGIGNALWCLASNPAEYERLKVDPSLARPCF
FT                   EEVLRYTSPVHTFGRTAAVDTEIAGLKIAEGSKIICVLGAANLDPEKWEAPESFRIDRR
FT                   PAGHMAFGAGIHGCVGQNIARLELETLLTVMAAKVDRIEFDGEVVWRPNNAIHALDRMP
FT                   LEFIAK"
FT   gene            complement(615296..615505)
FT                   /locus_tag="Avi_7685"
FT   CDS_pept        complement(615296..615505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7685"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7685"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40263"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5W5"
FT                   /protein_id="ACM40263.1"
FT                   /translation="MAGWAAPCRKTRGGQPRYIDLAIETTPMLGMRFELCLRQAEGLLN
FT                   SVLDMMATDLAVPEHTTLSRRARI"
FT   gene            complement(615820..617247)
FT                   /gene="attK"
FT                   /locus_tag="Avi_7686"
FT   CDS_pept        complement(615820..617247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="attK"
FT                   /locus_tag="Avi_7686"
FT                   /product="NAD-dependent succinate aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7686"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40264"
FT                   /db_xref="GOA:B9K5W6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5W6"
FT                   /protein_id="ACM40264.1"
FT                   /translation="MSINFNGDYTMTIDGKAVSATSSFEVFNPATEEVIAKAPDASREQ
FT                   LEAAVSAAKAAFPAWSARPLSERQAFVARLGDAIEAHAEEFMRLLTREQGKAFKGAEWE
FT                   VGGSAFWCREIAKQELPLHVAEKTDGRTVETRRVPLGVVGGITPWNFPILLAVWKIAPA
FT                   LVAGNTMVLKPSPYTPLCTLKLGEIVRDILPPGVLNVVSGGNDLGSWLTQHKDISKISF
FT                   TGSTATGRKIMEACSGNLKRITLELGGNDPAIVLPDVNVKETAEKLFWAAFQNSAQFCV
FT                   AAKRLYIHEDVYDELAEALVAYARTVKVGDGAEQGTDLGPIQNRMQFEKLKNLLADAKD
FT                   KGLHFLLGGEVEDRKGFFVPVTIIDNPPEDSRVVVEEAFGPVLPLLKFKDIDDVIHRAN
FT                   NTEYGLAASVWSKDIAAARGIAERIEAGTVWVNEIHSFSPHVAFGGHKQSGIGIENALE
FT                   GLSEYTNSQTLVINAAA"
FT   gene            complement(617309..618811)
FT                   /gene="fadD"
FT                   /locus_tag="Avi_7687"
FT   CDS_pept        complement(617309..618811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD"
FT                   /locus_tag="Avi_7687"
FT                   /product="long-chain-fatty-acid-CoA-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7687"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40265"
FT                   /db_xref="GOA:B9K5W7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5W7"
FT                   /protein_id="ACM40265.1"
FT                   /translation="MQQSRISDLAYNAAQRFGDKTALTLPGLRSFSFQEIDDLAGRMAG
FT                   AFAARGLRAGDRIVLHLPNGWQWVVAYHAIARLGAVVVPANFLLSAEEVAFILDNSEAA
FT                   ALIVPADRRASFKTKAHVFTLGEAPEAEELTTLLDGEYRLPVERRPDDLFTIGYTSGTT
FT                   GRPKGATMTHAGLFASLAGTATIHVRHDGDAVLTSLPFPHVYGNIVMNATFLVGSRLIT
FT                   TPRFDAAEALRLISAEKATLFEGVPTMFYQMLAHPNIANAGLTSLTRCTVGGQTMPTAK
FT                   IDAVTSRFGCPLLELWGMTEVAGPAITHSPYWSPRPGSIGLPMPGLEVRLADLEEPKRE
FT                   ATPGRPGELLVRGAMVTKGYWRNEAATIEAIDPDGWLATGDIARTDADGYIFVVDRKKD
FT                   MIITAGYNVYPAELEQVIAMHPAVAMVAVAGIADEEKGEIAQAFVVPHRDVALSEEALL
FT                   NHCRKHLASYKIPRRVIFVEDLPKNSTGKVLRRSLREANVPA"
FT   gene            complement(619051..620067)
FT                   /locus_tag="Avi_7688"
FT   CDS_pept        complement(619051..620067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7688"
FT                   /product="transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7688"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40266"
FT                   /db_xref="GOA:B9K5W8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5W8"
FT                   /protein_id="ACM40266.1"
FT                   /translation="MTQARTPSGFALAIVLAYQKRGMTEQPALLAAGIDPATLHADGRI
FT                   TADQLERLSDHAMRELDDEALGWFSHRLPWGSYGMLCRASLPSATLGIAITRWCRHHNL
FT                   ITQDVTLSLETRRNLAEVRIEEKSELGAFREFCLVSLLRNLQGVASWLGDTRIPLVDVA
FT                   FPFDAPAHAESYRYLFNGPASFGADQASLRFDAAYLGLPVLRDDAALRQMLRRPLPLMV
FT                   RQYRRDRLLSREILRLLNDMPAAGIDDLAEKLNLSTRSLHRHIKQEGTSFQALKDLSRQ
FT                   RLAERLLASTQWPIKRIARECGFDAEASFVRAFKSWTGQTPRAFAVAARQGTSSHKS"
FT   gene            620258..621793
FT                   /gene="mccB"
FT                   /locus_tag="Avi_7689"
FT   CDS_pept        620258..621793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mccB"
FT                   /locus_tag="Avi_7689"
FT                   /product="3-methylcrotonoyl-CoA carboxylase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7689"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40267"
FT                   /db_xref="GOA:B9K5W9"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5W9"
FT                   /protein_id="ACM40267.1"
FT                   /translation="MAEAVADLALKTAQAALGGGEVARRRHTGRGKLLPRERIDRLLDP
FT                   GSPFLEIGQLAAHGLYDGEAPSAGIVAGIGNVEGRRCMVVANDATVKGGTYYPMTVKKH
FT                   LRAQKIAAENRLPCLYLVDSGGGYLPLQDEFFPDENHFGRIFYNQAQMSAAGIAQIAVV
FT                   MGSCTAGGAYVPAMSDETVIVREQGTIFLAGPPLVKAATGEIVTAEDLGGGDVHTRISG
FT                   VADHLAENDSHALHIARRIVSTLPAQEDAASQFDEPIYPAEELYGIIPSDTRKPYDVRE
FT                   VIARLVDGSRFDEFKARYGTTLVTGFAHLYGMQVGIIANNGILFGDAALKGAHFIELCV
FT                   QRRIPLLFLQNITGFMVGRAYENEGIAKHGAKLVTAVATAAVPKLTLVIGGSFGAGNYG
FT                   MCGRAYSPRFLWMWPNARISVMGGDQAASVLATLRRDGVAAKGETWPQQEEDAFKNGIR
FT                   AQYERQGHPYYSTARLWDDGIIDPAQTRRVLGLSLSTALNAPIGETRFGLFRM"
FT   gene            621801..622601
FT                   /locus_tag="Avi_7690"
FT   CDS_pept        621801..622601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7690"
FT                   /product="Enoyl-CoA hydratase/isomerase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7690"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40268"
FT                   /db_xref="GOA:B9K5X0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5X0"
FT                   /protein_id="ACM40268.1"
FT                   /translation="MIYKTLDLELNGAVATVWMNRPDLHNAFDEMLIEDMTLAIEALSE
FT                   NDSVRVLVLAGRGASFSAGADLAWMKRQGAATLADNTADAAAMGRMFMALRNCPKPLIA
FT                   RIQGAAIGGGMGLVAACDIAVAAPDAVFATSEVRLALIPAVISPLVAAAIGERQCRRYF
FT                   LTGERMGVEKAHVLGLVHEIAEKDGLDAAVARIVADVLKGAPGAVTEAKALITQISDRR
FT                   FDEALVSEMAERIAARRGTDEAREGLSAFLEKRKPGWIADRKEG"
FT   gene            622613..624601
FT                   /gene="accC"
FT                   /locus_tag="Avi_7691"
FT   CDS_pept        622613..624601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="Avi_7691"
FT                   /product="acetyl-CoA carboxylase biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7691"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40269"
FT                   /db_xref="GOA:B9K5X1"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5X1"
FT                   /protein_id="ACM40269.1"
FT                   /translation="MFQKILIANRGEIACRIIRTARRMGIATVAVYSQADADARHVRLA
FT                   DEAILIGPAPARESYLVAENILAAARRTGAEAIHPGYGFLSENDEFAEACAANGIAFIG
FT                   PPAAAIRAMGSKSAAKELMGKVGVPLVPGYHGADNDPARLRREGDHIGYPVLIKASAGG
FT                   GGKGMRRVDRADDFADALASCQREARNAFGDDHVLIEKYILKPRHIEIQVFADSSGHCI
FT                   HLYERDCSVQRRHQKVLEEAPAPGMTAERRAAMGAAAVTAAKAVNYVGAGTVEFIVNSD
FT                   GSFYFMEMNTRLQVEHPVTEMVTGLDLVEWQLRIAAGHPLPLRQEDVPLMGHAIEARIY
FT                   AEDADAGFLPSIGTLRHLGLPQQNAHVRIDSAVETGDAISPHYDPMIAKLIVHGADRKE
FT                   ALDRMSEALSAIQIVGLTANIGFLHRLIKTPSFAEADLDTGLIEREQDRLFALSPVPAG
FT                   VWYLAALQELLRDISANPASPWALADGWRLTGRAERRIALCCKGETVTVTAVFSGEGWT
FT                   LALSGTDEPSTFAQGHASQNGPATALDVRIGERRYDATIMIDGNHRHVFYTGQTFVVER
FT                   LPDLQRATDTNSGSGGLRAPMPGAIIALLAEPGVSLKTGEPLLVMEAMKMEHTIVAPSD
FT                   GTLASFHFAVGDQVVAGAELVDFQPAA"
FT   gene            624612..625535
FT                   /gene="hmgL"
FT                   /locus_tag="Avi_7692"
FT   CDS_pept        624612..625535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmgL"
FT                   /locus_tag="Avi_7692"
FT                   /product="hydroxymethylglutaryl-CoA lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7692"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40270"
FT                   /db_xref="GOA:B9K5X2"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027167"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5X2"
FT                   /protein_id="ACM40270.1"
FT                   /translation="MHQTSGDNIVIVEVGPRDGLQNEAAIVSTDVKIELVKRLARAGLD
FT                   HIEATAFVSPKWVPQMADSTDVMTACASAAELSHVTLSALTPNLKGFEAAITAGSREVA
FT                   VFASASETFSRRNINCSIDDSFTRFEPIFEAARAVGIPVRGYVSCVIACPYEGAIDPHA
FT                   VARVSRLLLEKGAREVSLGDTIGVGTPAKVKRMIEAVAAEAPLSVLAGHFHDTYGMGIA
FT                   NIQAALDAGIRVFDSSVGGLGGCPYAAGAAGNVATEEVVYLLQDLGLCRDIDLPRLAET
FT                   AAWISHITGLTDVSRVTKALMGSSKS"
FT   misc_feature    complement(624887..624936)
FT                   /note="serC leader; predicted by Infernal"
FT   gene            complement(626117..626932)
FT                   /locus_tag="Avi_7693"
FT   CDS_pept        complement(626117..626932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7693"
FT                   /product="transcriptional regulator MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7693"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40271"
FT                   /db_xref="GOA:B9K5X3"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5X3"
FT                   /protein_id="ACM40271.1"
FT                   /translation="MQNTHLKIAEAARMSGVSQSTLRLWEQQGLIEPARTPSGQRLYDS
FT                   AVLERIARIAWLRSERGLNPAAIKEELGHPETGQKGLDVAEPVTDTAAIGTKVRQMRRL
FT                   SHQTLDAVARATGASVSQLSTFERTSQGISITVLHDLAKHFGTTVADLNGHPTQQQSAS
FT                   VVRDGEWMTWPTTSMGVSIHSLAAGARQMECHRFDLAPGASSEGAYRHEGEEFIFVLAG
FT                   ALQIVLDGDQFYDLRTGDSFYFESSRPHSWRNPADVQATLIWINTPPTF"
FT   gene            627075..628355
FT                   /gene="argD"
FT                   /locus_tag="Avi_7694"
FT   CDS_pept        627075..628355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argD"
FT                   /locus_tag="Avi_7694"
FT                   /product="acetylornithine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7694"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40272"
FT                   /db_xref="GOA:B9K5X4"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5X4"
FT                   /protein_id="ACM40272.1"
FT                   /translation="MQNSQLAARRTNAISRGVGVTTQIYAERAENAEIWDVEGRRYIDF
FT                   AAGIAVVNTGHRHPKVIAAVKAQLDCFTHTCHQVIPYENYVRLAERLNQAVPGNFEKKT
FT                   IFVTTGAEAVENAVKIARAATNRSAVIAFTGAFHGRTFMGMTLTGKVTPYKVGFGAMMP
FT                   DVFHVPFPVELHGQTMEDSLAVLDKLFKADVDPERVAAFIIEPVQGEGGFYEVPRLFMQ
FT                   KLRQIADKHGILLIADEVQTGFARTGKLFAMEHFGVVADITTMAKGLGGGFPIAAVTGR
FT                   ADIMDAPGPGGLGGTYGGNPIGIAAGNAVLDVIEEEQLADRATSLGNRLKQRLHSLSDA
FT                   VPEIADIRGPGFMNAVEFNLPGSKTPDAGFTNKVRTIALEKGLILLTCGVYGNVIRFLA
FT                   PLTIDEKTFAEALDILEETLRVCSKDS"
FT   gene            complement(628382..628708)
FT                   /locus_tag="Avi_7695"
FT   CDS_pept        complement(628382..628708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7695"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7695"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40273"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5X5"
FT                   /protein_id="ACM40273.1"
FT                   /translation="MSSVAFKVLSTVNAPYGTDLSAAQLASKISDFASVENVDASAFSF
FT                   YSEVKADLQQQFLDEKGIDKEVAFEIAQTFLQLAGYPLALEHRTENRFPLFGPMPKPTL
FT                   IPQA"
FT   gene            complement(628837..628989)
FT                   /pseudo
FT                   /gene="orfB"
FT                   /locus_tag="Avi_7697"
FT                   /note="IS3 family transposase; Incomplete gene
FT                   (pseudogene)"
FT   gene            629087..630115
FT                   /locus_tag="Avi_7698"
FT   CDS_pept        629087..630115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Avi_7698"
FT                   /product="IS1111A/IS1328/IS1533 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7698"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40274"
FT                   /db_xref="GOA:B9JXH6"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:B9JXH6"
FT                   /protein_id="ACM40274.1"
FT                   /translation="MTISTIGLDLAKHNFHVHAVDAAGSVVRTAALRRGEMIKFFQNAK
FT                   PCLVGMEACATAHYWARELMKLGHEVKLIPPSYVKPFVRRGAKNDAADAAAICEAVRRP
FT                   HMRFVSIKSESNQGFLMLHRARGLLVRQRTMTVCAIRAHLAEFGIIFGQGRQRIETIMP
FT                   SIEDVAASLPEQARFALNSLIRMVGELNTQIEGIEMKLAEVGRSDPVSSLLSSIPGVGP
FT                   ITSTAIAATVPDARMFRSGREFAAWLGLTPRQNSSGGTTRLGAITKQGDAYLRHLLVIG
FT                   ARNIVRYPKARAKVGGAWIDALLHRRRPMIVAVAVANKLARIIWAMMTSGEMFREAHAK
FT                   IV"
FT   gene            complement(630217..631296)
FT                   /gene="orfB"
FT                   /locus_tag="Avi_7700"
FT   CDS_pept        complement(630217..631296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orfB"
FT                   /locus_tag="Avi_7700"
FT                   /product="IS3 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Avi_7700"
FT                   /db_xref="EnsemblGenomes-Tr:ACM40275"
FT                   /db_xref="GOA:B9K5X7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B9K5X7"
FT                   /protein_id="ACM40275.1"
FT                   /translation="MKASKFTEAQIAFVLKQAHDGTPIGEVCRKAGISDATFYNWRKKI
FT                   HWPNAVRDEAPAAVGRGKCQTEADRRRSLFRQGHPPGCAVKKALRPDGKRHLVDRIKTD
FT                   WKVSIRRACSVLKIDRSLYVYKSKRGDQAELKLKIKDICQTRVRYGYRRVHVLIRRDGW
FT                   VVNPKRIYRLYKEMDLQLRNKVPKRRVKAKLRSHRTAATRSNDVWAMDFVHDQLATGRK
FT                   IRVLTVVDTFSRFSPAVDARFSYKGEDVVQTLERVCRQVGYPATIRMDNGSEFISRNLD
FT                   LWAYHRGVVLDFSRPGKPTDNSYIESFMYRRPRGRKRLLTSSGHHSGAFMYTAFGCDRY
FT                   YGRWPRWSTRIEASSTGRA"
XX
SQ   Sequence 631775 BP; 136861 A; 177625 C; 179740 G; 137549 T; 0 other;
     ccgaatcggc gctaataatc aatggcgaaa ttttactggt ttcgcggaat ttagcgccga        60
     tagcaaaaaa tgggttttga catggcgaaa atcgccccga aaactgatgc cgtgattgag       120
     gggttgactg ccttgatgga gcgtcacgct gacgcgcttt ccagccagtt gcaagcacat       180
     catttgaaag ttttcccgcc gacctccgaa aaggggatta ggtccttcgg cccgtctgaa       240
     gcgtccaagt tgcttggcgt tggggagtct tatctacgac agattgcttc ggaaatgcca       300
     gagttgaatg tcagcatgag ccctgggggc cggcgcattt tctcgattga agatatacac       360
     gtgatccgca aacatatgga ccagattggt cgtggaaacc gtcgctatct tccgcatcgt       420
     cgagacgggg agcagcttca agtcatttct gttatgaatt tcaaaggtgg ctcgggcaaa       480
     acgacgaccg ctgcgcattt ggctcaatat ctcgcaatgc gtggttaccg agtgcttgct       540
     atcgatctcg atcctcaggc aagcctgtct gcgctctttg gcagccaacc ggagacggat       600
     gtcggtccaa acgagactct ctatggcgcc atcagatatg atgatgagca agtgccgatc       660
     gaacaggtcg ttcggggaac atatattccg gatcttcatc tcattcccgg caatctcgaa       720
     cttatggaat ttgagcatga cactccccgc gccttaatga agcgcaagga aggcgatacg       780
     ctcttctatg gccgcatcag tcaagcgatt gaagacattg cagataatta tgatgtcgtc       840
     gtcatcgatt gccctccgca acttggttac ctcacgcttt cagcattgac ggctgcaaca       900
     tctatccttg ttacggttca tccccagatg ctcgatgtga tgtcaatgaa ccagtttctg       960
     gcaatgacct cgaacttgtt gagggaaatt gagagcgccg gcgctgagtt caagttcaat      1020
     tggatgcgtt atcttatcac tcgtttcgag ccgagtgatg gaccacaaaa tcaaatggtt      1080
     ggctatctca ggtctatttt cggtgagaac gtcctcaatt ttccaatgct caaaacgacg      1140
     gctgtctcag acgcgggcct gacaaaccaa accctttttg aagtggaacg cggtcagttt      1200
     acccgatcaa cctatgatcg cgccttggag gctatgaacg ctgtcaatga tgagattgaa      1260
     tctcttatca aaaaagcatg gggtagaacc acatgagccg gaagcacatc cttggcgtct      1320
     cgacggatgc ccaagacgca aagccctctg acaaccgggc aggtaaaacg cggtcaatgc      1380
     ctcttcttgg ggtcgccaga aaggaacgcg acccggcaac aaagctgact gcgaatatcg      1440
     gaaacgcact gcgtgagcag aatgaccggt tgagtcgcgc tgaagagata gagcggcgtc      1500
     ttgctgaagg ccacgcggtt atcgaattgg atgtctcgac ggtagatcca tccttcgtgc      1560
     aggaccgaat gcctggcgac atcgacggac ttctcgaatc gattcgagag cagggccagc      1620
     aggtgccaat cctcgtgcgc cctcacccgg atcagccggg ccgatatcag gtgggcttcg      1680
     gtcaccgtcg gcttcaggcc gtttcagaat taggtcttcc ggtcaaagcg gttgttcgcg      1740
     atttgacgga tgaacaattg gtcattgcac agggccagga gaataatgaa cgccaggatc      1800
     tcacctttat tgagaaagca cgttttgcac atcgcctgaa taagcaattt tcacgcgaaa      1860
     tcgttattgc cgcgatgtcg atcgacaaga gtaacctgtc gaagatgctt ttgctggtcg      1920
     acaccctccc cccggagctg atcgatgcaa tcggccccgc accaggtgtc ggccgaccaa      1980
     gctggcagca actaacggaa cttatcgaaa aggccccctc gccttctgac gtatcgaaat      2040
     acgcgctatc gaatgaagtg caagcgctgc catctgcgga gcggttcaag gctgtgttgg      2100
     tcagccttaa gcctccgcgg gtctctcgcg gacttccgga gattatgtcg acccctgatg      2160
     gggatcgatt ggctcaggtt tcgcaaagca aatccaaatt ggaaatcacg atagacagaa      2220
     aggcgacgcc tgatttcgcc gccttcgtca ttgatcactt gcctgcgctt tatcaggcgc      2280
     accgagcaca aaaccagaag aaataaggag agtagtcagc aaaagaaaag agctccccca      2340
     acgtcgccgt cgtggaagcc cttctgtctc tctagcaaga acagaatcgc atttcctcga      2400
     atcctcgtca agagtttttg cgccattttg gtgagtgatt ttcttttgcc tgctgaaagg      2460
     taaaagatga tggagactgg aaatgtaacg acgcccttcg ggcggcgggg tatgacgctt      2520
     gcgctggtgc gtcggcaggt cgccacaagc gacattaagc cgggcaaacg tgcggataaa      2580
     tggaaaatat tcagggatgc ttcagccgca atggacttgc ttgggataca atccaacagt      2640
     cttgcggttc tcgatgcctt attgagcttt tatccggaga atgagctgcg gcaggatgca      2700
     cagcttgttg tttttccctc aaatgctcaa cttgctcttc gggcgcacgg tttggccggg      2760
     gcgactttac gccggcatat tgccgtgctt gtcgatgcag gcctgatcgt tcgtaaagat      2820
     agcgccaatg gaaaacgcta cgcgcgtaag gataatgccg gtcaaatcga ggaggcattt      2880
     ggcttcgatt tatcacccct tctcgcgcgc tcagaggagc ttgcgattat ggcgcaacag      2940
     gtgatggctg atcgcgccac ctttagaaaa gccaaggaaa gccttaccat ttgccgccga      3000
     gatgtccgca agctgatcac ggctgcgatc gaggagggcg cgcaaggtga ctggcacgag      3060
     atcgaatgcg cttatatctc tctcgtcggc aaaatatcca gaaccccagc tctttctgag      3120
     gtcgcattgg ttttagatga gatgaatagt cttaagagag acatcattaa gcgactggaa      3180
     aatcaggtta attcagaaaa aaatagcgcc aatgccgctc aaattgagcg gcacatacag      3240
     aattcaaaaa ccaactacat aactgaattt gaacctcgct ctcgaaaaga gcaagaagcg      3300
     actgaggagc aaaacaatcc gcctaaaaga ctgccgataa agtcatttcc gcttggaatg      3360
     gttttgaagg cttgcccctc ggtttgcgat tacggaccag atggaaagat cgcaaattgg      3420
     cgtgacttaa tgacagctgc ggtggtggtt cgatctatgt tgggagtaag tccgtccgcc      3480
     tatcaggaag cctgcgaaat catggggcaa gagaatgcgg caaccgccat tgcatgtatt      3540
     ttagagcgtg caaattttat caattcggca ggaggttatc tgcgcgatct aacccgtcgg      3600
     tcacagcagg gagaattttc tctagggcct atgatgatgg ctttgttaag gaccaacgga      3660
     gaagcgggta tgaagaccgg gtaaaagatt gaatgaatcc tccaaaagga ggcggattgg      3720
     agtcaaaatg cgtgcaattg agcgggtgat ttggtggtca gctgaccaca aacataagta      3780
     attgaaagtg aaaggttttt tcaatgccgt ttggaaaccc agattgtgag tgattattta      3840
     cacggaaatg cggattgcgg cgaaattggt cggtataagc gggatattgg gcttctgcct      3900
     tgatcatcat aatagaaaaa gagtgcagat tgtttgcggt atctctaatc cggatacatc      3960
     cacaccacta ttctggcggc cgggtaagac gtcaaaataa gatcaggcct gcggcataca      4020
     ccccaggtag ttatcctgaa tggtgatgtg atcggccaag tgcttggcat catgccagac      4080
     gccccagatg aaactcgagg cgcgcccgga aagtccggga agaccgagga agtagaggcc      4140
     tctctcagaa gagacgcctc gatgatgtct agggcgcccc gcttcgtcga aggccttcac      4200
     tttcaaccag ctatagtcgg acctgaaacc ggtggcccag atgatggtgg tgatgcctgc      4260
     cgcggtaaga tccagttcga gaatcggatt agtaatacaa tcggccgttg gaccaagaat      4320
     gcgggcttcc ggctcttgcg gaaggttgag accgttcaat gcaacgaaag catccgcctc      4380
     gtcgagcagt gatagatagg tctggtcacc acgatcgaga ttgttggcaa ggtcttcagc      4440
     gaaggataat ttgccgttct taaaattttc ggtcatgcca accagaacca ttccttgtgc      4500
     tgcaagccga cggaagtcga tagtttctcc gcctcgcgca ccactgacag cgaccgtaac      4560
     atggttgctt gtctgcaatt cctgcacctg ggcatcccat ttgccgagaa caccaagcca      4620
     ccaggcgcag tcatacccgc gataggtgcg tggaggacga tcatgcggac caaccgaaag      4680
     ataagttttg cggcccactc gcatgagttc ctccgcaatc tgcactcccg acgagccagc      4740
     gccaatcacg agaacggccc cctccccgag ctggtgagga ttgcggtatt cgctggaatg      4800
     tatctggttg atattggcgg tcggcggaac gattggcggg atattcggca actggaacgg      4860
     accggtcgcc acaacgacgt agcgtgcttc gatcactccg ttagctgtct ccacacggaa      4920
     acccgggcga ccgcctagac gctcgacgtg agttacctcg gttccactgc gtattggtgc      4980
     gttgtacttt tttgcatagg tctcaaaata gtcagcaacg ccttctttgg gaacaaacgc      5040
     atcggcattg ccgggaaagg tcaggtttgg aaaacgatcg tgccaagccg gaccattggc      5100
     gaccagagaa tcccaacgca tggaacgcca gcgctctgct atccttcctt tttcaaggac      5160
     aaggtgtgcc acattgttcc tggtcagatg ctcactcatc gcgatgcccg cctggccacc      5220
     gccgacgacg agtgcatgta ttttttcgac aggcattgtt tcgtcctttc tataaattga      5280
     agtgtgtgct ggcccctggg gtgttgccga aagccgaaga ataggggcag ggccaacgag      5340
     aatttttatt gctgtggctg taggagtaaa tttggctgca ttattcgttt ttctcggtcg      5400
     tcgggcacct cattaagtcg gcatccctcg cctctacgga tgctcgccaa gacagtctcc      5460
     atctcttctt tggacgttaa ctgtttaaga atagtcggtc gatgcgggct gtctacaact      5520
     ctatgatgat agtggaccga aatctcaatc tggtagaagc tcttaggttg gtatgagcga      5580
     tatacaaaga gaggaaattt ttggcgagat taacaacgca gtaaaagacg aggggaggaa      5640
     aagtctgcgc gccggtgagc agccgatgct tacgtaagtt cgcaatggcc aattgcaagg      5700
     aacttgagaa ggggccttgg gaaaaacagt ggctttagga ttcccttaaa tcgatctctg      5760
     ctaaatttgc tggatattct gtctgatcgt tgcgcaagat gagctgatga tattgaacca      5820
     ccagtttggc aatcgtaaaa atagttttga tttggacgct gcagccgcgc tggatgaagc      5880
     ttgggacctc gcttgcaagg ggcgttccgt tcgcgcattt tctttagcaa attcagtttt      5940
     ggcttcggca gaacagcgcg gtgatcaagg tcttatagcg gggagttctc agcaatgtgc      6000
     ctggtattgc tttcaacttg gtgagacaga gacggggcta gtatacgtgg agaaagcaat      6060
     ttctctgtgg aagtcccttg aagagccaat gcttgaggca caagctctta gtatcggtgc      6120
     ttggctgcat ctggaactcg gtaatctaga gcaggctgtc gagtttgccg cagaagcact      6180
     caacattgcc gaccaaagcc gtaatctccg atctcggtct ttggctataa atgtgattgg      6240
     cgtgatattc tggatgacgc gtcaaccatc tcttgctgtt gactattgca gtcgtgccgt      6300
     ggagctagcc cgagaggcat acgatattac attcgaatgt tggtggttga ttaatctcgg      6360
     tggagcgcat gcagaggatg cttatctcgc tcaggaagcc gataatcaaa aattcgaaac      6420
     gtcgataagc agcgcaatag atattacgaa acaagcgctc agcctcgctc aatcacttaa      6480
     agacgcctgg gccgagaggt tgtgtatcgc aaatttagca gagtatttta atgcggttga      6540
     ggctttttcc gccgccgaaa tgttattgga gcggtaccgt gacattccgg gagacgatta      6600
     tgtccgcggt gaggggcatt atctggttac actgggaagc acgctcgttt cgttaaagcg      6660
     ctacgaagag gcattggtac cacttgagca ggcccacttg cttgccgggg aaaatttcaa      6720
     tcttgagacc ttaatgcatg cctgtctgtc tctttcaaag gctcatgaat atcttggagc      6780
     attcgagtct gcgctggatt ttcataaaaa gtatcacaag ctccatcagc agttcactgc      6840
     ggagcggatc cagcgaaatg cccgtatggc ggagatccgt tatgaaacga aaaagctcaa      6900
     agcaatgctt gatacagagg cagagcgctc tgcagaaatt gcccggtcat tagaggccct      6960
     gcaacagcaa accagtgtcc tgaccgaagc ggcgaatacg gacccgttga caggactttc      7020
     caatcggcgg catttggaga cgataatatc tgacattaat actcaaagcg cgagttatgc      7080
     gctggcgatc cttgatgtcg atcacttcaa gaaaatcaat gatacgtttt cccatattat      7140
     tggtgatcgt gtgcttgtgc aaatcgggac gctggtcaaa gttgttgttc gtgaaacaga      7200
     tatcgcagtt cgcttcggtg gcgaagagtt cgtcatactt atgacggacc taacactcgc      7260
     ccacgcggaa agggtttccg aaagactgcg aatgacaatt accaactttg actggtccga      7320
     aattgccgat gggctgaatg tgtccgtcag tatcggagtg gcaatgtcag acgatgcagt      7380
     cgacgccgaa gcggttttgc aactggcgga tcggcgcctt tattgggcaa agcagaccgg      7440
     tagaaataga gttgtttgtt ttctgccgtc tggaaatcgg tttgaacaaa cgaccagcgc      7500
     gattacggat tgaggaagcg atccgattct gcggactgcc tcttagcctt cgcgacgttg      7560
     cttttctctt gccatgaatc tccgcttccg ccggagtgaa aatgcgtacg gaatcccgta      7620
     caaaacccgc catggcgcac tcgattttat gtcatcaata accgaaaccg ctaatccgct      7680
     atcatgcaag gctaaaagct cggggtgtgg cgtggaaagg gatttcgacg cgatgagcgg      7740
     gataaaccat tatgatcttc ggtcgtgagg ggactatgcc gaggcgcatt ttgacaggtg      7800
     gcagaattgg accagcagtc gcaattgcaa tgcaaaatcc tggtgaaaca accggtctga      7860
     atcgggttcg tggccgaaaa atcctatttt cacgggctaa atattgtgat cagcaattca      7920
     cgggatgcga attttctggt tcaaacgaac aaaattaaag tcccgcggct ttggtcaaat      7980
     tgaccctgaa acgatccctt ctccgctggt acctacgggt catctcggct gaggcatgac      8040
     cgagttgctt ctggatatag cgttcgtcga cttcggcgga ggaggcgaga ccggcgcgca      8100
     gggaatggcc ggagaatttg aaggcgcgtt caatctcgct gagatcgcca cgaaccccgg      8160
     cagccatggc agcccgcttg accagccttg ccacttcctt atcgttcaaa cggtttggcc      8220
     caatggactt gccttgtcct gtgacgcggc ggaagagggg gccatgggca agtctggcaa      8280
     aggtgatcca gctttcgaca gcgaccaccg ggcaggtggt atcggaggat ccgcggccga      8340
     tttcgacctc gcgccagccc gtcttgccgc gcagggtgac gagcatgcct ttgtcgaata      8400
     tttcgatcca gccgcgcccg tcttcggttt ggtcaggttt gatgtcgaga ccgacaatct      8460
     cggaccgccg cagaccaccg gcataaccga tcagcagcat ggcccgatcg cgcaaacctc      8520
     tcagcgttcc ccgatcgagt gtctcgatca tcgcgatgat atcctcggcc aacaccgctt      8580
     ccttctgcac gggcgggcgg gcgtggctgt ttcgaatacc ggccatgacg gtggcgatat      8640
     gccgatcctt gcgatcgagc gtgagtccgc gctgcgcgta gttccaagac aatgaggaga      8700
     ggcgacgttc gatggtcgaa accgcgtttg tcttggcgcc acgcgtcggt gttccaacgg      8760
     cattgcctga ggcgcaggcg gtgatataga ggccaacggt ctgcgggtcc ggggggaggg      8820
     gccgcaaatt caaccgtcgg caccaggcgc taaaatgctt ccaatcgcag gcataggctt      8880
     tacgcgtgtt ggcagaacgt gccgcctcca cataatcgcg ggcgcggctc gccaggctgg      8940
     tgagatgcgt cggcgtttgg tcctcgttga ctggagagag caggggaggg gcctgcagcg      9000
     agaggccggc ggccgacagc ggcggcgcgc aaacattacc ctcaaccgcc gtgctgagcg      9060
     gcggcgctga ggtctgctcg acgtgaattt cggtgtcttt ctcgacgatc tgggccattt      9120
     ctctataatg acaataacgg ccgataatgc aagattattg gacgtattta tgtggtgacg      9180
     atatgcgcgg tttgttgcga tatttctgat atatactgcg caccagattt ggaaacatgc      9240
     gtatgggttt ggtgctggct gttgatttct gcgccaaatt tatcacgttt gtcgttacgt      9300
     aatgagccga gacttgcgtt gaattgatca atcgtttcag atcaataatg atggcaggcc      9360
     ggatcaggcc gaagcggaaa tacggctcat ttcaaagcga aattcaacag acgcccacag      9420
     accgtctgct ggaggcgctg ttcgatatcg gccttgatct accgctcgac gtgtcggaac      9480
     agcgcgggtc cttctataat gcgatgctgg aattcttcct gcggctgcgg cgctatgaag      9540
     aagccgatgg catggctgac aaggcgatgg cagcctatct tgaggccgag tgcccgatcc      9600
     tctgtttcta tatcgcgctg catcagtcgg tactcagcct tctgacatct gatttggatc      9660
     ggatggggcg atctttgctg caggctgggg cgatgctagc caaggccggc ttcgatagcc      9720
     cctgcgatca gcggctggat cgtcttcttg aagcctgtca tgcctatgaa cagggtgaac      9780
     cggaagcgct acttgctttt ctggacactg aaatggctgt gttgatggag ggcgagttgt      9840
     ggccaagcat tgccgatatc gtcatctatt acgggagcta tgcgctcagc gttcatatgt      9900
     cgacccgcgc ggctctccgg tttctcgacc gctggaaggt ctaccagccg cttaatcggc      9960
     agtttcgcct ggcgctcgaa gtgcccaagg cgcaggtatg gcaaaacggc aatggctggg     10020
     gcgatgccgc tcgtctgttg atgccgctca gggccggctt cgatctggta tgggtcgaaa     10080
     ggggcgtgtc gcaaagctgg tggtgggtcg cgttgaggcg aaataggccc ttgcgtttac     10140
     gctctgttaa ccttttgcag tccgaagagg cgcgcgagca gatcgttctg atcgttgatg     10200
     gtccaatcac tggtgaaacc gagcccttct tcagccagag catagcctca aaacccgcaa     10260
     tcgttcgtcg cgccgttttg aacgattgaa agcccccgat cttcggcatg ttcttcttca     10320
     ctctgaaatg gtcgctctcg atcctttgct gtagatgctt ggtgacataa tggaccgggt     10380
     ctggacgcag gagcccatca tcgacggccg ttttgatcgt tgaggggaag gtattggcgc     10440
     catcggtgcc gatcttttcc ggcgacagca ggggctcgtc cttcaggatc ttgcgtaaga     10500
     accgtttagc ggcatcgagg tcgcgctttg tggttagcag gaagtcgacc ggattgccgt     10560
     gcttatcaat ggcgcggtac aggtagcgcc acttgccgcg gatcttgacg taggtttcgt     10620
     caatgcggac cgaaccgcaa tggggtctgc gaaactggcg cagccgcttc tcgatcattg     10680
     gcgcgtaggc aaggacccat cggttgatcg tgctgtgatc cactgcgaag ccgcgctcgt     10740
     gaaacatctc ctccaaatcg cgatagctca gaggatagca cacgtaccag gcaacggcct     10800
     gaaaaatgag catgcctcga aatggcgccc tttgaaatcg ttctttgatt ggcgcttcag     10860
     cttttcggca atggcattca gaatcatggc tactctccac aagattggga gcggcaattt     10920
     ctccgctgat gttcaacagg ccgttaacca agaaaatttg cgacataccc ccaaaaaaat     10980
     ctcaaatcat tcgacgacgt acagatgcgc ttgccggaga gttggcagat gatgggggta     11040
     agcatcctat cttaggcgca gcttgcaaag tcatcgcgag tcgggctggt tcgctgcaga     11100
     gagtcatgca gcaggctctt taactcgttg attgataaac atttatcact cgatctttcg     11160
     gccagcgtga gctgcggttc cgatccttca agtcagccga tcaatggact tatgacattt     11220
     gaacaaaccc aaaggatggt ggcaggatcg ctggaggtgc tgaccagcgc atgccccatc     11280
     atactgtcga aatagcagct gtcgccggca ttgaggacgg tgggggcgta gagatcggta     11340
     tgcagagtga cgctgccctc gagaacgtag acgaattcct ctccaggatg gacgaccaat     11400
     gtctcgaatt cctgtaccga atgcgcgttg atccgcgtca gtagcggaat gatctttttg     11460
     ttggcaatgt ctgcacagag gagctcatat tcgtaatgac tggttttcag ctttgagcct     11520
     tcgccgacac gggtgacggc acggcgtccg ctgactggtg agctaggctt gtgggcgaac     11580
     agttcagata catcgacacc caggccgctt gccagactga ggatcgtctc ataggtcggc     11640
     gacatctggg cgttctcgat tttcgagagc gtcgagggtg cgagagtact cctttcggcg     11700
     agttcgccga tgctgaggcc cgcgttcttt cgcagtttgc gcaaaattac cgaaagagat     11760
     ttcgtacccg ctcgcggcga gctgcgctga gaggtctccg tctccatatg cgatcttccc     11820
     attgtcacgt ctcaggtgca tcacttgtag acattgtttc ttatgtaact tccgatggcc     11880
     catgccacag agccgcaact tctgcaagga tcaacctgat ccccgctccg cgacatcagg     11940
     ttgatgccca tctttgctgc gctagaagtt ccattctctc cagatcgctc ttttgtaggc     12000
     acacgccctc ccgcatcgaa cgctcgcgtg tgaccagccg gcgatcgcct ggcaggcgag     12060
     agacctttgc cagtcggagc cgttcgacca gatgccggac gcggcggctg aattgcgcat     12120
     tgcggccaac atccggatcg atcagaataa cgagctggcc cgtatgcggc gtctgtgccc     12180
     cgggatagtc ggaccagtcc acttcgtagg aaaacttgcc tccggtcaaa gcggcgctca     12240
     tcacttccac cagcatcgaa atggccgagc ccttatagcc gccgaatgtc agcagtgcgc     12300
     cgccatccag caccgcatgc ggatcgacgg ttggctttcc gctccggtcg atgcctagcc     12360
     caggcggcag gctgaagcct tcgcgcgcgg caatctgcac atcgccattg gcgatggcgc     12420
     tcgtggccat atcgacgacc atggggacca tgccgtcaca gggcgcggca aaggcaaccg     12480
     gattggtgcc gaaaaccggc accttggcat cgaaaggcgc ggtacaggca aagctgttga     12540
     ccatcgcgat ggccagtagc cgctcttcgg cgaagggcac gacatccggc cagagcgcgc     12600
     tgaaatgatg ggaattgcgg atcgaaagca gcgcgatgcc ttcctgcctt gcgcgctcct     12660
     tcaaagactg tgccgcaaaa tcgagcgcga cctgcgtaaa tccgttacgg gcatcaaccc     12720
     gcaggaagcc cgagccaccg gtctccagaa ccggcacggc ggcaggatcg acccaaccgc     12780
     tgcggatgga acttacatag ccgggcattc tgaaaatgcc atgtgaaagc gcgccatcgc     12840
     gttcgcatcc agcacaattg gcgctgagga tgttcgccac gtgctcgctg gctccagccg     12900
     ccaggaaaat gcgcttgagg aggttctgaa gggcttcgaa cggcaggcgg caggttcccg     12960
     ctgcgaaatt cgttttcaat gtcatagggc aacttcgcaa atgtttctta taggaaagat     13020
     aggcgcgaaa tgatgtaatc acaagcggat tattccttga ccgcctatga gtaaagtttg     13080
     ttcgatttat cagcacctaa aatgtttttc ttagaatgtt attttttatc agtagtatag     13140
     cgctttgatc gaatgcgaaa atcatgattt taagaaattt ttattgacaa tatgctctct     13200
     taaaatacga taggaaatta atttctgatc agaaaaacat aaggccttcc taaaagggtg     13260
     acataaaaaa gggaactgag taatgggcat gatgagcaga atgtcatcgc gattgttggg     13320
     aatgacggct gccgccgcac ttttgggcgc tggtatggct tttggcgcct cgggcgatct     13380
     cgtcgttaat gcgccgaccg caccatccac ccttgatcca gcctgggcct gtggtgttcc     13440
     ggatatcggg tttctgcaga atttctatgt gcggctggtc gatttcggca tcaaaaagaa     13500
     tgctgcgggc agcgaggaag tagattacgg cgcggttcgg ccctatctgg caaaatcttg     13560
     gacgatcagc gatgatggaa agacctatac gttcaagctc aacgacaatt acaagttcac     13620
     ctccggaaag ccagtcgacg cggctgctgt caaatattcc ttcgagcgcg gcctcaagat     13680
     gggcggctgt ggccagtatt tcctgaccga tgggttcctc agcccgagca ttatcgaatc     13740
     gatcgaagcg cctgacgcga ccactgtcgt catcaaattg atccagtcca atgccaattc     13800
     cctcgccgac tgggcgacgg gagcggcttc gatcgtcgat ccgacggtcg ttgaagccaa     13860
     tggtggcgtc gttgctggca agccgaacga atacatgtcg tcgcatgttg ctggctccgg     13920
     gccatatgtg ctggattcct attcgcctaa ccagtcggcc catgccacgg ccaatcctaa     13980
     tttcggcggc gagccgccgc tggcgaagtc gatccagatg aactggattt cctccgctcc     14040
     gaccttgctg ctacaagccc gaagcgggca agcggatgtc acctatggtc tctccaagca     14100
     ggcggtatcg acgcttaagt cttcgccgga tgtcaaggtt gaggcctttt ccaatccctt     14160
     cgtccagcag atgatgttgc caaacacaaa ggcgccctgg gacaacccga aggtgcgcga     14220
     ggccgtcgcc catgccgtcc cttacgagga tatcgtgaag aaggtcgcgt tcggatacgg     14280
     aacgttctat ttcggcccgg tgccaccaag catggccggc ttcaatgccg aactgagcaa     14340
     accaatccag tttgatcttg ccaaggcaaa gacattgctg gcggagagcg gtgtgaaact     14400
     gccggtcgac gtcgaagtcc tcgttcagga aggcgacact acgcaacagc agattgccac     14460
     cgtcttgcaa agcacctggt cgaagcttgg catcaacctg aagatccgca ttgcgccagg     14520
     tgccgaatat caggacctga cgcagggcca taaggtgcag tcgctgatgc ggctcgatgg     14580
     tcctggagtc ttcgaggccg gttactactt cggctacgac gtcatgtgca agacgcccta     14640
     taacctgaca gaatcctgca atccgaaaat cgacgagttg gtcgtcaaat tgcgggcgac     14700
     gttggacaag gtcgagcatc agaagatcct tgacgagatc accacgctgt ggcgagcaga     14760
     ctatccgaag ctcctcttct tcgaagacca gccggtcatt gtcttgagca acaacgtcaa     14820
     gtcgttccgt ttcgcgccgc tcacagactt ccgcttcatg ggtaagtaaa tcgcctctaa     14880
     ggcagttgtt gaacgccgat atttccctct cggcgagcga cagaaacaac gtcgtgtcgg     14940
     gcgcacagag acgaagcctt ctgcggcaca tcaggagaaa atacgcatgg ctacccgaat     15000
     tggtgtcgat atcggcggca ccttcacaga ccttgtttac ttcgatgaag aaaatggcag     15060
     aacggttgaa ggaaaagttc ccaccgttcc atcagcgccg gaggaaggtg ttgcacatgc     15120
     gatccgtgct catgtgcccc aggacattat cgacagcgct gcgtatttcc tgcatggaac     15180
     aacagtgggc ctcaatgctc tgcttgagcg ccgtggcgcc aaagtcggcc tgatcacgac     15240
     acagggcttc cgcgacgtcc ttgaaatccg gcgcggcgac cgcgcggaaa tgtacaatct     15300
     gttctggaag caaacggtgc cgctcgttcc gcgccgcctt cgtctggagg tcgatggacg     15360
     cattcggggc gatggcgcgg ttctatcccc ggtgacgcga gaaagtgttc tggcggccta     15420
     tgaactgctg gcggcagaaa aggtcgacag tattgccgtt tgcctgatca gcgcctttgc     15480
     caatccgcag cacgagctcg agatcgaagc cattcttcgt gatgcggggt atgaaggcgg     15540
     catttcgctc tcccacaaga tctccggaga ataccgggaa tatgagcgca cgtcgacaac     15600
     ggtcatcgac gcgttcgttc gcggtcgcat gtcgaattat ctcaggcggc tggaaaacac     15660
     gctgcgcaat ctcggcttta aggggcagtg cctgattacg cgttccggca gtggctccat     15720
     gacattttcc gaggcggaag accgaccgtt cgaaacgatt atgtccgggc ctgtcggcgg     15780
     cgctcagggg gcaggtgagc ttgccaagat gcttgggcgg aaggccatga tcaccgccga     15840
     tgtcggcgga acgagtttcg acacggccgt catcatcaat ggcgaacccc aggttctgtt     15900
     tgagggcatg atcgacaata tgccggtgca gaccccatgg gtcgacgtgc gctcgatcgg     15960
     ttcgggcggc gggtcgcttg cctatgttga tgtgggcaac ctcatgcgtg tagggccaca     16020
     aagcgccggc gccgttccgg ggcctgcctg ctacggcaaa ggcggcaccc agcccgcgct     16080
     cactgacgct gcggcctacc ttggcatgct cggtccgggt aatctcgcct ccggcatcca     16140
     tctcgatatc ggcaaggcgg aggctgcact tgcccctgtc gcatcggcaa tcggacaaga     16200
     tatcgaaatg acggcggcgg gcgttctgcg cattgccagc tcggccatgg ccaatgccat     16260
     gcgggagatt tctctggacc agggtttcga ccctcgcgag atgacgttgc taccctttgg     16320
     tggtgcggga ccgctgatgg cgaccctgct tgctgacgag ttgaagatga acgagatcgt     16380
     cgtgccacca ctcgctggca atttctctgc ctggggactt ctcggggcgg acatggtgca     16440
     gtcggcagca cgtacccgca tcctggatct gacggatgac agcctgaaga tcgccaatga     16500
     ggtgctggaa gggctgtttg tcgcgatccg gtcgcgaagc gagcgttcgt tcgccgaagc     16560
     ggtcaatgcc gttcgtctcg acctgcgcta caaggggcag gagcaccggc tgtctatcgt     16620
     tgccgataac gagaatggca ggatctctga gggcgcggag tccatcaaga cgaagttccg     16680
     cgccgaatac agcaggacat tcggcagcac gatgaacgac gaaatcgagg tggtttccat     16740
     tcgtgccacg gtgcgcgtgc ccttgccgcg gcgggaaatc cgcttcacgc acgagccgga     16800
     agccgttgca gagttccaga tgcttgaggc tttttcgttc gagaaaggaa agcgcatgtc     16860
     ctttgcgatc gtacagcgcc aggcgatcgt cggtaagctc tcaggccccg ccatcatcac     16920
     cgaaggaacc tgtacgacct atctggacgc cgattggacg gcgcggatcg ggactgtcgg     16980
     cgaaatcatt ctggaacgga agaattaatc atgaagcgga aagatccagt ccttcacttg     17040
     gcaggggttc ccagcaaggg gcttgccgtc aactccgatc caatcacgac ggaagtcgtg     17100
     cggcatgcgc tcaattcggc cgccaaccag atgaagcggg cgctgatccg tacggctttc     17160
     tcgccgatca tttacgaggt gctggacttt gctgtcgcca tctatgatcg cgagctgcgc     17220
     atgctctctc aagcgccaag ccttcccatc ttcatgggaa cgctgaactt tgccgtgcgc     17280
     gaggctgtca agaatatcgg cggcgaagac aagatcttcg atggcgacat cctgatgtac     17340
     aattggcctt atggcactgg ttcgcatccc caggacatgg tcatcatcat gccggtcttc     17400
     tatcggcagg acctgattgg gtacacggcg atcaagggcc actggctcga tatcgccgcc     17460
     aaggatccct attgcaccga caccacggat gtcttccagg aaggcacgat cttcccgggc     17520
     gtgaagatct acaaaaaggg cgagcttaat gacgacatct atcgcatgat cctcggcaac     17580
     agccgcgttc ccaaggccgt atcgggtgac ctcgatgccc aggttaccgg atgccgcgtc     17640
     ggagccaaga gcttcctcga agtagtggag cgtttcggcc tcgacacgta tcgcaatgct     17700
     gtcgagcata tgttcgacca tggagaggcc atcattcgca gcttcttcga gaagattccc     17760
     gatggccgct atgtgggcaa tggggaaatg gacgacaacg gcgtcaccaa gaaccgaatt     17820
     ccctttgaaa tcactgtcga cgtgaagggc tcggacgtca ccatcgactt ttccgaaacc     17880
     cctgatgcgc agggcggtcc cgtcaacagc cccctgccat cgacgatctc cgcgagccgt     17940
     gttgcgatta ccatgcttgc cggctatggc gaagcgcccc atgaaggcca cttccggcct     18000
     atcaaggtca tcacccgccc cggcagtatg ttcgatcccg aaccgccgtc tccctgcttt     18060
     ctctatggct ggtcggcttt gcaggcaatc gaagtcatct acaacgctat ctccaaggcg     18120
     ctgccttcat ctgttccggc ctgctctggc gggtgtattt gctcggtcgt ctggtgggga     18180
     acccgcgagg aaaccggcga ggcctgggcg gatggtgccc cgcatccgac cgggcagggt     18240
     gcctgggatg gcggcgatgg cggcaccatg ctgcatatct cggaatcggc cacgcgcttc     18300
     accccggtcg aagtatggga ggcccgcaat cctttcctcg tcgagcgcct tgctctggcg     18360
     caggattccg tcggtcccgg caaatatcgt ggcggaccag gcatcgatct cttctttgag     18420
     atgacggaag acacattcat cacaacggtg ttcgaacgct cgaagagcca gccctgggga     18480
     cttgagggcg gccttggtgg ccgtgcgaac aatgcaatgg tggtcatgcc ggacggcaca     18540
     gaacatatcg ttccgaaaac cacgcatttt ctcgtcccta agggcggctt gctcaagctg     18600
     caaaccggcg gcggcggcgg atatggcgag cccgctgagc gacctctgga gaagatccag     18660
     gccgatctcg atgacggtta tatctctgag gcctttgcgc gacagcatta tccgcacgca     18720
     ttctgaatct catgagccgg aagggatacg atttctcccg gttcttttcg caaaggaata     18780
     ttatgcggtc cttcttcggt caaatattca gggacagtga aatggcagcg ggaacgatca     18840
     ttctggtcgt cctattcgcc atcgcggttt tcgggccgat ggtctggcat ttcgatccgc     18900
     tcgaagtgga cattttgacc gccctttcac cgccggactg gtcgcatcca atgggaacgg     18960
     atgatgtcgg tcgcgatgtg ctggcccgct tcatgagcgg cgcacgggtt tcattggccg     19020
     tgtcgtgcgc ggtaacagtt ctcgccacgc tgcttggcgg ggggcttggc ctggtggccg     19080
     gtttttcagg cggctggttt gaccttgccg tttcgcggat catggatgca atcttatcct     19140
     ttccgccgtt gatcctggcc atggcagtcg cgatcgggct cggtcccggt gttatttcag     19200
     ccgtgttcgg catcgttctg gcggcgatcc cctggtttta tcgcctgctt cgcagcgagg     19260
     tgctgcgcat tcgcaatctc tcctatatcg atgcggcgcg cgccctcggc gtatcccggc     19320
     tcagcatcct gcgtcgtcac gtcctgcctc aggcggtttc gacggttttg atccaggcgt     19380
     cgtcggtctt cagcttcgcg atcttgacgc tggcagcgct cggctttgtc ggcctcggca     19440
     tccagccgcc gctgcccgaa tggggaacga tgatcacgga aggcctcgcc tatgcgctga     19500
     cagggcaatg gtggctcggc cttttccccg gccttggcat cttccttctg gctgcatccg     19560
     cgaacctgat cgccgaccgc ctccgcgaat attacgatcc aaaatccgcg aagggagggc     19620
     attaaacatg cttcgcttca tcgtggaacg ggtcttttcg gcgctgttga cgcttttggg     19680
     cgcctccctt attgccttca tcgtgctgcg cgccgtgccg acaaaccccg cacgtctcat     19740
     tgctggcccc ttcgcgacag acgaggtcat cgggcaggtg gaggcagcgc ttggcctcaa     19800
     taagccgctt tacatacaat atgctgatta tattgtcgga tttgtcagag gcgactgggg     19860
     gttctcctat agcgccggcc agccggtgct tcagcagatc gggcaacgcc tgccagctag     19920
     cgcggaactc gcgctttacg cctttctctt tgccttcatt ggcgcgatat tcctgacggt     19980
     gttttccgtc tttgcgcgtt cgcgctggct cgatcggttg ctgcgtggct ctgctttcgt     20040
     ttttgttggc gttccccctt tctggatcgc gctgcttttc ctgatcgtct tttcggagaa     20100
     tctcggctgg ttcccaggtc ctgttgggcg tggcgatgcg cctccggtgg tcgtgacagg     20160
     gctctatagt atagacttcc tgctcggcgg cgacgtgtcc gggttcttcg gcgcgcttca     20220
     ctatctggcg cttccgagtg tgacgctcgc gctcggatcg ctcggttatc ttatccggct     20280
     actgcgcgcc aatctgctcg atacggcaaa cgaaccgttt gtcacggtgc tccacgccaa     20340
     aggcgttcgg ggccttgtga ttgcatttgg ccatgtgttg ccgaatgcct tcttgccaac     20400
     gctcacggct ggtgggttga tccttgctca gttgctgggc gggtccgtgc tagtcgagcg     20460
     catctatacc tggcccggtg tcggcgggtt ggtgattgat ggtatcctca ggcaggatta     20520
     tgctgtggtg caggccttca tcctcttaag cgcgttgatc tatatcgtcg tcaacttcct     20580
     tattgacatc ctttacggtg ttgtcgatcc aagggtgagg cgctcatgac catgaacact     20640
     caaccttcct ccaccgccgc gcttctgacc gtctccgatc tgaacacgac cttcgacacg     20700
     gcgcgcggcc tcgtcaacag tgtggatgga gtatcgtttt ccattgctcc gggtaagacg     20760
     ctcggtctcg tgggcgaatc cggttcgggt aaatcagtga ccagcctctc gttgatgcgc     20820
     ctcatcgaac gcagtaacgg ccggatcgaa ggcggctcca tgctgtttaa aagccgaaac     20880
     ggcgaggtcg atcttgtggg gctgccggaa aaggagatgc ggagcattcg cggcaacgaa     20940
     atcgcgatgg tattccaaga gccgatgacc agtctcgatc ctgtctggcg ggtcggcaag     21000
     caaatcgccg aggccgtccg gctacaccag ggggccagca aggccgaggc acgccaccgt     21060
     gccatcgaaa tgctgcgtct ggttggcatt ccagcccccg agaagcgtgt cgatgactat     21120
     ccccaccaga tgtcgggcgg aatgcgccag cgcgtgatga tcgcaattgc gctgtcctgt     21180
     cgcccatcac tgctgattgc agatgagccg acaacggcgc tagacgtgac gatccaggcg     21240
     cagattatcg accttatcaa gcgcctgcag gtcgagatcg gcatgtctgt tcttttcatc     21300
     acccacaata tgggcgtgat cgcgcaggtc gctgatcacg tggctgtcat gtatgccggg     21360
     cagatcgtgg agcatggccc ggtgcgacgg attttttcca atccccgcca tccctacacg     21420
     atcggcctgt tgaattcgat cccgcgcaaa ggggctgtgg gcagcgacgg tcgcctgcaa     21480
     gcgatcggag gcattccccc cagtcccttc gaccttccga cgggctgtcg cttcgcgcct     21540
     cgttgcacat tcgcgacgga cgactgttcc cgcgccaacc caccgtttga aagcgtggag     21600
     gctgatcaca tcgtccgctg cttgcactgg aaggaggtcg cgccatgagt gacaaacccg     21660
     atcttctggt tattgaaaac ctcgtcaagc gctttccggt gaagcgcgat acgtttttcg     21720
     gccccgcccg ctatgtccat gctgtcgcgg atgtgaactt ttccgtgcgc agaggcgaga     21780
     cggttggcct tgtcggcgaa tctggatcgg gaaagaccac cataggccga ctggtcatgc     21840
     gtctggatga gccaagcagt ggcaatatcg tcttcgacac gcagaatatt ggaaatcttg     21900
     tcgagcgcga taccctgcct tttcgcaagc gcattcagat gattttccag gacccatttt     21960
     cgagcctcaa cccgcggatg cgggtgggcg cgcagattgc ggaagggctt gaagtgcatg     22020
     gcattggcaa caaggcggac cgcgtgcgcc gcgtgacgga gatgctggat ctggtcggcc     22080
     tgccggtgga tgccgcaagc cgttacccgc acgagttttc cggcggccag cgtcagcgca     22140
     tcgtgattgc ccgcgcgctg atcgttgagc ccgaattcgt tgtggccgat gagcctgtct     22200
     cagcgcttga tgtgtccgtc caggcacagg ttctgaacct cctgcaggat cttaaagaga     22260
     ggctacatct gacgatgctg ttcatctcgc acgatctcgc tgtcgtggag catttatgcg     22320
     accgcgtcgt ggtgctttat cttgggcggg tgatggagat tgcgcctcgc gacgcgctat     22380
     atgagcgccc gcgccatccc tatacggagg cgcttctttc ggcctcgcct gttccagacc     22440
     ctgaccacca gccgatccgc gccatgacag agggtgatct tcccaatccg atcgatcagc     22500
     cgagcggctg cgtattccga acacggtgcc gttacgccat gccggcttgc gcgcaaaccg     22560
     tgccgccctt gctggcggtg ggtctcgatc atgtgacggc ctgcctgcgc gatgatatcc     22620
     tttagcagag ttatgccgaa accgggtcca ccacagatag caattaaggg aacgttcgaa     22680
     tgcgtaccaa caaggttatt catgttatcg gggtccacgc ggaaggggag gttggcgatg     22740
     tgattgtcgg tggcgtctca cccccaccgg gtgacacgct ttgggagcag tcgcgtttta     22800
     ttgccagcga cgagaccttg cgaaactttg tgctgaatga gccacgcggc ggggtgttcc     22860
     ggcatgtcaa tctgctggtc ccgccgaaag acccgcgcgc ccagatgggc ttcattatca     22920
     tggagccagc cgacacgccg ccgatgtcag gctcgaactc tatctgtgtt tcgaccgcca     22980
     ttctcgacag cggcatcatt tcgatgcagg aaccgctaac gcatatggtc ctggaagcac     23040
     caggcggtgt catcgaggtg acggcagaat gtgccaatgg caaggccgag cggatcaatg     23100
     tgctgaatgt ggcttctttc gtaacacggc tcgccgccgc gctggaagtc gaggggctcg     23160
     gcaccctgac ggtcgatacc gcctatggcg gcgacagttt cgtgattgtc gatgcgatcg     23220
     gcctcggctt ctcgctcaag cccgacgagg cgagggaact ggcggaactc ggtatgaaga     23280
     tcaccgctgc cgccaatgaa cagctcgggt tcgtgcatcc gtgtaatgcg gattggaacc     23340
     atatctcctt ctgccagatg actacgccaa tcacgcgcga aaacggcatc ctgactggca     23400
     agagcgccgt tgcgatccgt cccggcaaga tcgatcgctc tccaacggga accggctgtt     23460
     ctgcccgact tgccgtcatg catgcgcggg gagaaatcgg aattggtgag acctatatcg     23520
     ggcgctcgat cattgactcc gaattcaagt gccacatcga ctctcttaca gagattgggg     23580
     ggcttagcgc cattcgcccc gtcatttccg gccgcgcctg gataaccgga gtgtcccagt     23640
     tgatgctcga cccgacagac ccgtggccgt caggctacca gctttcggat acctggccag     23700
     cgatttgaac caagacaggg ctatcacggc gttgttgcag cgttcagcga caggtgatca     23760
     ttcagtcttt gatgggacgc ttatttggtt gctcggcact gtaaacttat cgccttgaac     23820
     gcaacatctg ggcgtgagga attagttcat gcggcgtgaa ggcgtgcgat ttggtgccat     23880
     gcttgcatgg cttcggttcg cagttcgcga tggtggacgg atggaatatc gtggcgggga     23940
     atgtgaaaaa ggttggtgat cgggtcatgg atggaaacga aacgctgaag atgtcgtgtt     24000
     gacttgaagc gcttcatgat cctctcccgt cgtcggacgg gctgatgaga gttttccgcc     24060
     cgattgttca atcccttgtg agaacgatgc tcaatgccgg gcatgacctc ccgctttgct     24120
     gcaccatagg atcgtagttt gtcgttaatc atcacacgcg gcgcacggcc ttgggctttc     24180
     aggagcttgc gcatcaaacg ttttaccgtc ttggcattgc ggcggttttg caccagcacg     24240
     tcgagaacaa agccatactg atcaacggcg cgccaaagcc agtgtttctt tccaccgatg     24300
     gtgatgacaa cctcatcgag atgccactta tcaccgagcc tgccggcaga tcgcttgcgg     24360
     atatcattgg caaagtgtct gccgaatttc tcagcccaga actgcaacgg tttgatgaga     24420
     gacgatgatg ccacgcagtg ccagcagatc ctcgaccata cgcaggctca gcggaaaccg     24480
     gaaatacagc caaactgcat gggcaatcac ttccgctgga aatcggtggc gacgataaag     24540
     aggatcacgg ctagatctgg tcatgtagcc agattcctca ttttgatcga tgtccggtta     24600
     acgttacgat gccgtgccgc gtcccctgcc gcccgttttg ccctcttcac acccgccgga     24660
     cccatccaaa ttcgatggcg gcggcgtgct ccgttctatc cggcccccac aactcctcac     24720
     gctccccgaa aatggcaggc aaccgcgtgc acgtcgcctt gcaaaaccgg aacctccgcc     24780
     gcgcagcggt cttcggcgcg tggacagcgg gtgcggaaca cacagccgga agggggagac     24840
     atcgggcttg gcaattcccc ttccagcggg atcacgatct tttcgcgctc cagcttggga     24900
     tcgggaatgg gaatcgcaga gagcagcgcc tgcgtgtagg gatgctgcgg attggcatag     24960
     agcgtatcgc gatcggcaat ctcgaccgtg cggccaagat acatcaccat tacccgtgtt     25020
     gagatgtgtt tgacgacact cagatcatgg gcaatgaaaa tcagcgccag ccccagattc     25080
     ttttgcagat ccatcaacag gttgatcacc tgcgcctgaa tggatacatc cagcgccgag     25140
     accggctcat cgcagatgat cagctttggc tcgacaatca aggcgcgggc aatgccgatg     25200
     cgctgacact gaccgccgga aaactcgtgc ggatagcggt tgatcaggct gggcagcagg     25260
     cctacctgat ccatggccgc ctgcacccgc gccttgatct ccttggagga caggccgtgg     25320
     tgatgggtga tcagcgtctc tgaaatgatc tggcccactg tcatgcgcgg attgaggctg     25380
     gccagagggt cttgaaagat catctggata tcagcgcgat gtttcaacat ttctcgtggt     25440
     gacaggcgca aaagatccgt attgccctgc cagatcacgc tgcccgaggc atccagcata     25500
     cggatgatgg cgcgggcgag ggtggatttt ccgctgccgg attcgccgac aatgcccagc     25560
     gtttcgccag cccgcagctc aaaattcacg ccattgacgg catgcaggat acgcggcttc     25620
     tgccatggaa aaccgccagt tttgcgctca aaggtcacat gcaggttctc agccttgaga     25680
     agtggtgctg tgctcatacc aattcctcca cggggcgtgt gcatgcgcgg gcgcgatctg     25740
     gcgcgaaatt ttcaagcgga ggcggtgcaa cgttgcactc ggcaatcaca taatcgcacc     25800
     ggggcgaaaa gggacagcca cgcggcatgt tcatcatatt tggcggcacg ccgggaatgg     25860
     tgcgcagcct ctcatcctcg cgatccacac ggggaatggc gcgcagcaag ccttgggtat     25920
     agggatgcga tggcgatgca aacagcgctt ccgctggtcc cgtttccatt acccggccac     25980
     cgtaaagcac cagaacccgc tcgcaggagc ctgccaccac accgagatcg tgcgtgacca     26040
     aaatcattgc catgccgaat tcggattgca aatcgcgcag cagccccatg atctgcgcct     26100
     gcacggtcac atcgagggca gtggtcggct catcggcaat caatagatcg gggcgacaga     26160
     gcagggccat ggcaatcatc acccgctgac gcatgccgcc ggaaaattca tgcggataaa     26220
     gccggatgcg ggatttggca tcggggattt tcaccgcatc cagcatgcgg atgcattcca     26280
     ccatggcatc gcgcttggac ataccctttt gatagatcag cacctcagcc atctgatcgg     26340
     agatgcgcat ataggggttg agcgaggtca tcgggtcttg aaacaccatg gcaatgcgcg     26400
     cgccgcgaat ggggttgagc actgcggcag gcgcattgag gatttcctga ccgtcaaaca     26460
     gcaccgagcc ggaggccctg ccattgcgcg ccaaaagccc catgatggca aaggaggcct     26520
     gacttttgcc agagccgctt tcgccaacaa tcccaagcgt ttcaccgcga ttgagtgtca     26580
     gattcaggcc ttgtacggcc ttcacttggc cgtctggcgt atcaaaaccc acagagagat     26640
     cggtaatctt gagcagggtc atatcagcga tccttcgggt ccagcgcgtc gcgcaaaccg     26700
     tctccaacga aatagaagga aaacagcgtg ataatgaaga aaaacagcgg tgccgccagt     26760
     tgccacaagg tgccatgggt catgctgcca gccccttcag aaatcatcgc cccccaactg     26820
     gtcaacggct cttgaatgcc aaggccaagg aagctgataa agctctctgt catgatcatg     26880
     atcggcacca gcaaggtggc atagaccgtg accacgccca tcaggttggg caggacatgc     26940
     cgcaagatga tcttgatgga tgacacgccc gtggcctgtg ctgcctcgat atattccttg     27000
     gatttgatgc tcagggtttg accgcgcaca atgcggctca tatccagcca cgacatcaag     27060
     ccaatgccca cgaacaaaat ggtggtggaa cggccaaaca tcaccagcag cagaatcagc     27120
     acaaacatgt agggaatggc catcaaaata tcgacggtgc gcatcatgat gctatcgaca     27180
     ataccgcccg cgtagccgga gatcgcacca tacaatgtgc caaccaccac ggcaatcagg     27240
     ctgccaatca gcgccaccga catggacact tgagttgcct gtacggtgcg ggcaaacaga     27300
     tcgcggccca gatcgtcggt gccaaaatag tgaccatttt caaatgatgg acggccaaga     27360
     tcaaccacct gccccatcac cgaaaaatcc agctcatcat tcgaccaatg ggcgagataa     27420
     gagcccaaaa gggcaaaaac ggcgacaaga cagagaccaa tcaggcccgc aatcgcggcc     27480
     ttgttgcgca tgaagcgccg tcttgcatcg gcccatgggg agcggcctct gacggtctcg     27540
     tctctcattc gtgtcgcaag cttttccatc tgcgctctat caaccatcat cgcatcagta     27600
     ccggattttc ggatcaatcc acgcatagag aagatcgacc acaaggttga acagaattgt     27660
     caggccgccg atgagaatgg ttatgcccat catcacggca tagtcacggt tcagcgccgc     27720
     atcgacgaaa aacttgccaa tgccgccggt tgaaaaatac atgtccacca ccacagatcc     27780
     ggtgatcatg ctgacaaagg caggcccgag ataggaaatc actggcagca gcgccggaat     27840
     gagcgcgtgg cgaaaaatca ccacccgtgc tggtaggccc ttggcgcggg cagtgcggat     27900
     gtggttggca ttcagcactt ccagcataga cgagcgggtg agccgcgaga tggaggcaat     27960
     gaacaagact gagagtgaaa tcaccggcat gatcagatag ggccattgcc caccctccca     28020
     gccgccgccc ggcaaccagc caagccaaag ggtgaagatc agaaccagaa tgggtgccag     28080
     cacaaagctt ggcagcacat gggtgccgat ggcgacccca accgccagat aatccagcca     28140
     gctattgtgc caaacggcag cacagatgcc gagggcaccg ccaatcaaaa cagccaccac     28200
     aaaggagatg cagccatagg tcagggtaac gggaaagccc tgcgcgatga tctcattgac     28260
     cgtgcggtcc ttgtaaataa aggaaggccc gaaatcgaaa tggacaacaa cgccccagac     28320
     gtaagtgaca agctgccgcc acagcggcgc atcaagcccg tacttggcat tgagattggc     28380
     cagaatttcc ggcgctagcg ccttctctgt tgtgaatggc ccaccgggcg ccgctttcat     28440
     cagcaggaag gacgtaataa tcaggatcag cagcgtcggt atggcaaccg ccagacgcct     28500
     taacacgtaa actaacattc tggatcgccc cggtaagagg ggcagcacat ggtgtgctgc     28560
     cctttacagc attatttggc cacgcggtac atgtctttgg cgtaccagtt gcccatcacg     28620
     cttttttcag ggtaaccccg aacatccggc ttcagcatca tcacgttgga atattgatag     28680
     atcggcgcat ggggcgcatc taccgccaga atttcctcgg ccttggtgta aagcggctgc     28740
     ggatcggctg cggtctttgc ttctttcaac agcttgtcat aggccggatt ggaatatttg     28800
     acatagttgt tgccggaggc ggatgtgaag acatccagat aggtcgaagc ctcattgtaa     28860
     tcaccgcacc atgcatagcg cgacacttca aaatcctgat ggttcagctt atcggtcaga     28920
     accttccatt ccatattggt caaggtgagg ttgacgccaa ctttcttcca gaactgtgat     28980
     acggcaatgg caatcttctt gtggccttca tccgtgttgt agctcagtgt caggttgagc     29040
     ggatggtcag ggctatagcc agcttctttc agaagcgcga ccgctttgtc gtcccgctct     29100
     ttctgggtca tatgcgcggc agcaatatcc ggcatcttga aaccagcggt ggcccaatgc     29160
     acccagttat aagccggttt ctggccgccc tggagaatgt tgttgacgat cacatcgcgg     29220
     ttgatggcgt aggacagagc ctgccgcacg cggacatctt tcagggctgc cggtcccttt     29280
     tcagagacat tgaagaggta ggtataggtg caggaccttg gtgtggattt cgcctgatcc     29340
     ggataatcct tcttcatgcg cggatactga ccggtaggaa taccgacttc atcaagttcc     29400
     ccggcaagat aacgggtcat ggcctgattg ccatcgttga taatcagagc tgtgaccgtg     29460
     tcgagcacgg tattggcgtt gttccaatag ttcgggttgc gcttcatcac cagcttttcg     29520
     ccgggaacat gctcggtcaa aacataggcg ccgttgccaa ccagattgcc cggcttggtc     29580
     cagtcgtcgc cgaacttatc gatcaccgat ttcttgaccg gggacatcga ggcattcacc     29640
     gtcatcttca cgaagtaagg aatgggtgcg atcagcttga cctgaaatgt atggtcatcc     29700
     acggccttca cgcccagctc ctgcggcggc ttcttgccgc caatgatgtc tgtggtgttt     29760
     tccacctgca tcatttcaag ataggaggca tattcagagg ctgtcttggg atcggccagc     29820
     cgttgccaag cgtaaacaaa atcgcctgcg gtgacgggcg tgccatcgga ccattttgcc     29880
     tcgggccgca gatggaatgt gtagagcatc ttatcgctcg atacatcgta gcttgatgct     29940
     gcgccgggaa ccagattgcc ctgcgtatcc tcattcatca gagtttcaaa cagattgcga     30000
     agagcgtcag acccatccgt gtctgcattt aattgcgggt ccagcgtctt gaaagaatcc     30060
     agtaccctat aggtataagt ctggtttgct gctagcttct cgccattctt cgtgccggcg     30120
     tcagcatagg aaagactgga aaatgaaaag gccagacagg ttgtcagcaa aagaagtttt     30180
     ctcaattttg ttcccctttt ttgtttgtcg atgaaggcaa ggcagagcag aaatatatgg     30240
     acttgccttt cacacgattg ttttcattcg atttatagta cgtttaacgc tgcgcccaat     30300
     ttactttaga aacatctttt aagatgatat tcctacggat tacaggggat tgttgcgacg     30360
     tgtacgaagg tgtatgcatc gcaaaagttg cgctatcgcc gcatgtattt ctccggaaag     30420
     tctttccacc tgcgacagaa agaaggcgtt catataatcc gaatgattat ccggtttttt     30480
     cctttgcgca agacggatat ttatccgatg tatgattgca ggtgagtgat gacgggggta     30540
     acggtatggc agaggtaggg aatacgggca ccaaacggag gccggttcag gcaagatcac     30600
     aaaaaatgaa gatggcgatt atggaatcga cccatgccgt gatgcgtgaa cagggtgtgc     30660
     gcgccgtgac caccaatgcc gtttctgccc attctggtat taaggtcggc tcgatttatg     30720
     actacttccc caacaaggaa gccattattg ccgaaatcta tgaggaaaag ttggcgcagg     30780
     tgcgggcttt tctggaagcc ggatcagaaa aaatcgaggc agatgactgg cagatccaat     30840
     tggctgcact tattcgtgag acatgggttt accagctgtc gatcgggctg gaccgcacca     30900
     ttgttgatgc tgcttattat tatgagaccc tgtttcccat tgcccagcag catgcaaggt     30960
     tggttgcctc aaactacgtg gagctgttgt cccatcttgg ctcaacctgg tcgcatgagc     31020
     aactttttga tctgggtatc agcctttaca cgctcgtcaa cgccaattgg agttattggc     31080
     gtttgacagg cacggatgat caaatcgcga tcgagcgaca gatcgtgttg acgatcacgc     31140
     tgatcacgcc caccctgaca gcctcggcaa gctctcatag cccagcgtgt tgattttcgc     31200
     ttagaaatga gccgtatttc cacttgggcc tgatccggtc tgccactagt agtgatttga     31260
     aaggattgat cagttcaacg taagttctgg ctcagtgcat aacgacaaac gtgattaatt     31320
     tagcgcggaa atcaacagcg agcgtttcgg caaggacggt tatcgctacg acacgctgct     31380
     gcaacgtaca ggtggcgatt acgagatcga cttgtccgtg accacgacgc cgattggcgc     31440
     gatctcccgg ctcgaacatg ctctcggcgg gtttgaacat gagcgcgaga actatcgcaa     31500
     tcggctcgcc gatgcgaaac gtcgcctcgc ctcctacaca ccgcgtctgg gggaaagctt     31560
     ctcattccaa gccgagctcg aactcaagct gggccaactg gacgagatcg agagggatct     31620
     ggcggcaacc gccgacgaac cagaggagga tcgccaggaa gccgcgtaaa cagcggcatt     31680
     tccaccgtca cttgaaacgc gatcgggtca tacacatcta ccggtcatca cgcgtttcga     31740
     cggtttcatg cagtggcgat tgccgcgcgt tcgaagctgt ccgggttgga agggcgctcc     31800
     ccaagagggt cgagcgccct ttcgctttta aactgcccag tagggcacgt atcgcgcatt     31860
     tctctttcct tggtcgggat cggccggtgc aatccgcccg agcttgatcg actcggcaat     31920
     tatggcggag acggcctgat agtcctctgg ggccagcgag aagcgttctc gcagggtcgc     31980
     gttgctcatg tagtcgtggg tcaaccatcg aagaacgcaa tggaaaaagc aggcccgcat     32040
     cttctctgct tttgacatct gggcaaatgc acgcggagcg aacaaaacca cccgcatcga     32100
     gttttcagag gaaatgaaat ctggcgcggg caggtgatca gcttctattt cgatcagcgt     32160
     cttgtccaga ccgccgccac gctcctcaca aagaccgaat gcgcgcattg tcgatgcgag     32220
     tttttcattg cgcgagcgtc tctcgtcaag aattcggtct gtggctatca gtgagtttcc     32280
     aggattggtt acctcgatac ggttttcgta gatctcgaca accgggccga cgccgccgac     32340
     tatgaagtcc tggtggatca tggcattggc aatcacctcg cggattgctg tttccgggaa     32400
     gtgcggcacc atgcgccgga cgccattgat gtatcgttct tccttgggca gacgttccat     32460
     taggaacctc atcatcccag tgaagccaac tgcatagcct tttttacctt cctgctcgaa     32520
     atccgatttg gatttgtcgc gtccgatata tttgataatg cgtactgcct taccggcaat     32580
     ggacggaaac agcgtgacat cgcgcgcaag catgatcgcg ccaagattgg tgatgtcgta     32640
     gcgcccttcc aggttatcca gcaggaatcc atactcaatc atttttcgaa taatttcgtc     32700
     cggatttttc gggcggggat cgcctgtcaa ctcgaagagg ggttcgggat cgagttgggc     32760
     gaatatgtca tcggcggtgg cgttcgaaac agcgactgca ctctcgaagc gccgacggcc     32820
     agttgcaatc caaagagatc tctcgtgttc gggaaaatcg gagagtttct ttttgttttc     32880
     tccaattcgg atgaattccg catcgctgaa tttgaccggc cgctcatagg atggctcgat     32940
     ggctatgagg gaataagtca gcccgtcaca ttcgacatcc acgacatcga gcatgatcct     33000
     cggttcaatc atgcggctaa gccaattggt aaagtcttcg ttgccatgct tgagttgctg     33060
     caggcgcagg tcggtaccga cccgttccct cgttttgtcc cgaatgccga agaccataaa     33120
     tgcgcggtca cgccctgcta gcattgcggc atttgcaagc gctgagacgt attccccgat     33180
     ctcacgtgga tccttgttgt tgaccttgaa ttcgagccat gtgctttcgt tcggttcctg     33240
     cagcaggcgg tcgagcaggg cgcagggatt gtggatcggc attcatgatc tccttttatc     33300
     ccccttatat cagattcgat gcgtttcgtc ctcgtgccga cgatttcgct tagggaaatg     33360
     ttgaacaaaa acagcggcat ctgaccggcg caaattgcca agtttttatc taggttttgt     33420
     ctgaagggca gtctggactg aatacccaac tcgggtctca cagtggattt ttatatcccc     33480
     tttttgtcgg aatcgacaca cacaacaagc ttccagctta aaaaagtgaa attaaaacaa     33540
     agatttggag gggagaatga tgagggcctt atatcagaac cccttcgcag gtcgacccaa     33600
     cggctgccgg ttccctcaat cgcgccggtc gccgagaccg ggccagcttg cctcgcaagc     33660
     caggtctgct ccggcgcaat tgcagccgcc ggcccgtcct gcggttcggg agatgtcttc     33720
     gaaaagaaga tgaggaggca aggacagtcc gtccgcccga agctcaagag gtcattccca     33780
     tgcagttgat tacagccgat ccgcgcagtc tgaaggacaa tcccgaccgg tcgcgccagt     33840
     cgaaatcctc accacagtcc gacgcgctat tgtgcgcatc gatcagggct atcggtgtcg     33900
     tgcagccacc gatcgtcaaa ctcgatccgg agggcggcaa cagttacatc atcgtcttcg     33960
     gccatcgacg tgcagcacaa gccatcgccg cggatctcgt ggaaatcccg ctgctgctgg     34020
     cagatccctc cgacgatctc ggcgccatgc agtcttttgc cgaaaacatc gcccgcgaac     34080
     cgctgaatcc ggtcgatcaa tggtgcgcca tcgagcggct ggtagctctc ggatggaccg     34140
     aggagtcgat cgccatggcg ctggcacttc cgagccggca gatccgcaag ctgcggtttc     34200
     tggccaatat cctgcccgcg atgctcgacc agatggcgcg cggtgacatg ccgaacgagc     34260
     agcaactgcg cacaatcgcc gccgccggac aggatgagca ggccgaggtg tggaagaagt     34320
     acaagccgaa gaagcaggac ccgcaggttt cgtggtggga ggttgcccgc gcactgacca     34380
     cgacccggat gctcgccaaa catgcaagct tcggcgacga tctggcacag gcttacggca     34440
     tcacctgggt cgaggacctg tttgctcccg ccgatgagga cagccgctat accaccgacg     34500
     tcgaggcgtt tctcggggcg cagcaggagt ggctggccaa caatctgccc aagcgcggtt     34560
     cggtcatcga ggccaatgaa tacggccagg ccaagctgcc tgccaaagcg caacaggtct     34620
     acggcaagcc gggcaagggt gacctgaccg gatggtacat caacgcgcga gacggctcgg     34680
     ttcagtcggt tgcctaccgc atgcccgagg ctaagaagcc caagctggtc aaggatctcg     34740
     atggtgtcga aaccatcgtc gaggaggttg agacgccgaa agtgcggccc gatgtgaccc     34800
     agaagggtct cgacatgatc ggcgacttgc ggacggacgc tctgcacgag gcgctcgcgc     34860
     gtgcaccgat cgaggacgac acgttgatgg ctttgctcat tctcgccttc accggcatga     34920
     atgtcacggt tgccagcggt gcatcggaca atccctatgg tcatgcgaaa tgcggcccgc     34980
     atgctgctag gctgattggc gaggacggca agctgtcctt cgatcgtgag acactgctgc     35040
     aggctgcgcg ctcggtcctg gtcgaagtcc tgtctcttcg gcgtaatcgc tccgatagcg     35100
     gcctgatcgc gcgtattgcc ggcgacgcca tcggggctga tcaattcctg ccaaatatgg     35160
     caaccgaaga cttcctttca tgcctttcac gcactgcgct ggagacgacc gcagaaacgg     35220
     cgggcgtgcc cggtcggatc aaggtgaagg atacccgcgc ggctctggtc gagcattttg     35280
     ccgaggacaa gctggtgcat ccggcagcgc tgctcgcgcc ttccacggac gacgtgcggt     35340
     cctgggctgg acgttttgcc agcgtcgata gcggatcgga ggatgtccgc gacgatctcg     35400
     atgcgctcga agatcagctt tcgggtggtg acctggttga ccattccgcc gtcgaggaag     35460
     aggccggcga gggtttccgc gaggccgccg aatagcacaa ggcacaagga tctgaaccaa     35520
     cgccgctggc tgatgccggc ggcgtttttg tttccagcaa tcagaaggag tttgtcatgg     35580
     cagagatcca tgatgacatg gctgaagata cggccgcaga aaaagcggcg catgaggccg     35640
     agctacggac attgaagcgg ccgacgatac cagcgggagc ctcgacacca tggggcaggg     35700
     cgcaggtttc gcggcaattc gccgacggga tcattctgca ttctaccgcc agtcacggcg     35760
     gtttccatct ggccgagaaa gccaattcgg ccgtccatgc tctcttccgg aatgacggcg     35820
     aattttatga ggaggattgt gaatgggcga aggtcgccca tgctttcccg catctattca     35880
     ccgcctatga acgtcgggtg gccgatcgga cgcttcgaga ctatttccct gatgcctacg     35940
     agcgcgtcat gggtgtcata ctgaacggca gtcagtctca cgtgcgggac gcccaagatt     36000
     tcgaaaagcg acatcgccac gactgggtgg tcatcgcagc cctgaattcc gatcaccagc     36060
     caggtctcgt cgagtgtctc gcgactttgg gtgggatccg aggcgaggtc ggcgaacgac     36120
     ggtttatggt tccacgctcc gactacgtga tcggccgaca tggcttcgtc atcgatccag     36180
     ccaagcacga gccatatgat ggcccgtcca gctttgtgac ctgggcggcg cggcgatgac     36240
     ggtcgcgcct agcgacagtg accttccgga aaatcaggtg atcgatttca tcgagcttta     36300
     tcgcaggatc tgggcacggc agcaggattg ccgctcccgg cgggcagagc ggacgacgcg     36360
     aacgaaggcg cggtggaaat gcaagcaccg catggccgcg ttccgatcac ggcacgtaga     36420
     tcaaccgagc cgggtgagag cgaaaagtct gtccaagtcg agggcgcggt gacgcttcga     36480
     tcgaaggcgg aagccaaggc aaggggcaac tcgcttgcac tggagtgtgg tgtggtcgag     36540
     atttgtcggg ccccttgtga atgacgcggc ggtgccaagg tcggatcgcc atggcgattg     36600
     catcatgctg tcgtggacca gattgtcggc cggcacagca cctcggtttt gctgcggtct     36660
     gacatgggcg cgtcccggtc aaaggccgct ggcgcgccgc gttgcggcag gatcctcgcc     36720
     tcgtcgcaag gcaggtccgc gtctgtcgca gcccgcaagt gcgggcagca ccatccgcaa     36780
     accatcctcg ctcctcctgg cgatgccctg accttgggcc gggccgctgg tgcccatgtc     36840
     cttttgcccg cacccaaggg gctgagccgg acgacgaccg gcaccccggg cttcgctgaa     36900
     acatcgctcg taaaggatcc gatcatggca ccgctcaacc gctccaccca gaagaaccgt     36960
     ccggtaaaat cccagcgcgc caccaccctc gaaatggtca ggcacgcctg ccccgacgcg     37020
     acccaggcgc tgcgcatctc cgaaagcttc ggccttgccc tcatcgacag cgacgggatc     37080
     cgcgacctgc accgcggcca gttgatcgaa agcgccgatg cgctgaagga cggcctcgcc     37140
     gaaaaggcca tgcagatcca catgcagcgc atcgttggct ccttcgtcgg ctccgcctac     37200
     ggcgcggggc aattctacag ccgcgcggta accgaagccc gcgatctcac cacgaagctc     37260
     tccaacgata ccagagacga ggacctcgac ggcccggtcg gcttcgacag ccgcgcccag     37320
     cgaaagcgcg agttcgcagc cgacatggga ctgcaggccc atgtgcttcg catggcagcc     37380
     gaaggcgccg tctcggctta cgaggacatc accggcgaaa cctggaagcc ctacgagcgt     37440
     acggtcgagc agcccgccaa ctcagtcgac caaaaggccg caacggccca gatggcagca     37500
     ttcgaatagg acgatcgcgg ggcttcggcc ccgcctgagg cctcatttag gaaaatcata     37560
     aatgggtaaa tgcgccgtag ggtccgagcg ccctctttct ccggtcagcc gtccgtcgat     37620
     accgtcacgg acgtccacgc atcgatttct tcttgaagac gcttgagtct cgccgataca     37680
     tgcttgagag cgtcgctgcc aagaagaagc tgcggtggcg ggttatcggt ctcgactagg     37740
     atcaagacgg ctgcagcgag tttctctgga tcaccaagct gcttgccact gactgcctgc     37800
     cgggcctcgc gtatcggatc aaaaagggaa tcgtaatccg cgatcgaccg ttccgtgcgg     37860
     atcatcgaac gtccggccca gtctgtgcgg aaagagccgg ggcataacgt cgtcatatgc     37920
     acgccgaacg gcgccatttc tgaacgcatc acttctgata tgccttgcag cgcaaacttg     37980
     ctgccacagt aatacccgat accgggcatg gtgatcatgc cgcccatcga cgtgacattg     38040
     acgatgaaac cctggcggcg ttcgcggaac ctgggaataa acgccttggc gacagctaca     38100
     gcgccaaaga cgttcacgtc gaactgtctg cgcatctgtt cgagaggcga ttcttcgatg     38160
     acgccctcgt ggccgtaacc ggcattgttg atgagcacat cgaccggccc gtgcttgtct     38220
     tccgtatcac ggacgacatc cggaatctgg tcgaaggcgg tgacgtcgca aaggacgggg     38280
     tgaatggcgg gtacggctgc ggcaagcgcc gagcgtgcta tctcggatcg gacggtgccg     38340
     atcacctgat ggcccatctg ggcagcagct gtagcgatgg ccaggccgaa accggaattt     38400
     gcgccggtga tgaaaaaggt ctttctcgac atgatgtgcg aacttccttg attgcagaga     38460
     cgtttgaccg atagtattaa tcgtccggct gaacgattgc agatccgatg aagttgttgc     38520
     caaatcctat gattgacgga catcgccaat cgatgcgaga ccagctggta gaattggccg     38580
     gcggtctagc cacgcgtcac ggatacaatc cgaccggact cgatcccgtt cgcattctgc     38640
     gcactgaggc cgtgctccac gatgtcccgg tcctctataa cccaggcgcg gtgttcgtcc     38700
     ttcagggcag caagcagggc atgctggacg gagaaatctt ccgctacgat gaagaccact     38760
     atctggctgt ttctgtcccc gtgcctttcc ggatggaatc gaccgccagt ccgaagcggc     38820
     cattgcttgc ggtctatctc gaattcgata tgcagttggc ggctgagatc gccctgcagg     38880
     tcgaaaagcg cagcgagctt gctggtcatc cgccacgcgg tctgatgtcg aacaagatgg     38940
     atgctgacat cgaggacgtc ctgttacgcc tgttgagggc gcttcgcagt ccggtcgaaa     39000
     gtgccgttct gggtgcgggc attctgcgcg aactgcacta tcgggtgctg gtcggtccgc     39060
     aaggcggcgc aatgattgcc gcgcttcagc acagtgggcc atacgggaaa atcttccgga     39120
     gcctggcctg gctgcgggag cactacagca ctgaaatctc catcgccgac ctggcaggca     39180
     gggtgggcat gagcgtgccg tcctaccatg tgcatttcaa ggacctgact tgcaccagtc     39240
     cgatgcaata cgtgaaggcc atgcggctgc acgaagcaag attgatcatc gcccgccagg     39300
     aaaagacgat tgcgatggtc gcgacgtcag tcggttatgc aagcccggcc cagttcagcc     39360
     gagactttaa gcgacatttc ggtcgcacag cgtcggagga ggccaaatgg gtcagacacc     39420
     accttggcga actcgtctga gcctaagcga ggaggcatag tgctcgttcc ggcaatctgt     39480
     cacatgtggg cgttcgctac gaccattcga ttgggagttg tggccactat gcaacctgtt     39540
     cccattcggc acctcccgat aatgccatag tcgtaccact tgatctgtca gccggcacgt     39600
     ccactgcggt ctcgatgggg catgtctgac caaagaccgc ctcgcgaggc tcggctcgat     39660
     cggcatccgc aacggccggc tcgttttctt cccctgtgcg ctgaagcgcc cattcctcgc     39720
     gaggcaagaa agcctctccc tggccgtcct ccactccgtt tcggtccgtt ggatgcaggc     39780
     cgatcgtccc cggtcctatc gactgccatc gaggccgcga tggacgcggc ccgaacaacc     39840
     gtaaagggat tacgacaatg gcaaccatcg gctctttcac cgcttccggc aacggcttct     39900
     ccggcaccat caagaccctc aacctcaacg tcaaggcaac catccgcgcc gtcgagcgca     39960
     cttccgaaaa gggaccggac taccgcatcc tcgccggggc tacggtcgaa ttcggcgccg     40020
     cctggaagaa gacctcgaac gaaggtcgcg attacctctc cgtcaagctc gacgacccga     40080
     gcttcccggc tccgatctac gcaacgctga tcgaggtcga aggcgaggaa ggcctctccc     40140
     tcatctggtc ccggtcgaac cgggactgag actggatgcc ccgcctcgcg gcggggctct     40200
     ccacgtcagg gatcacttgt tcagtgcatc cttgagggcc ttggcaggcg cgaaagtcag     40260
     cttcttcgaa gctgcaacag tcattttttc tccggtcgcg ggattgcgac cctcgcgctc     40320
     aggtgatgtt ttcaccttaa atttgccgaa accggggatt gacgtttccg cgtcggagcc     40380
     tgcggcgtcg gcgatggcct tgaacacgga ttcgacgatg cccttggcct gaacctttgt     40440
     caggccgttg ttggcggcga tcttgtcggc gatttcattg gtggtggtca tgggattcct     40500
     cgtacgtatc cgaggaaggc cgtcttgtgg ttatgagtga aggtgaagat tctgtttgtc     40560
     gcgattaaca gcgagagaca aggagcgtca cgtgagttct cacaggatcg atttaccgcg     40620
     taaggcggca ggcacccgac actggcctgc ggcgttaaaa gaagagattg ttctggcaac     40680
     gcttgaggct ggcgcgacgg tggcatcggt ggcgcgggga tacgatctgg acccatctca     40740
     gatttatcag tggcgcaagg ctctgaaggt ttcgcggctc tcatctcagg aggttgcaac     40800
     gtcaccggaa tttctgcccg tgcagatttg ggcagcagct gatggtgagc aagcgtcggt     40860
     ccaggaacat gcaggccaag aacaggcgga agctctgtct tgccctgagc gtgggtcagt     40920
     gacatcttcg atttcgggag cgatcgaaat tcaggttgga ccgctgcacc gggttcgggt     40980
     ttgcaatgat tttgcctccg acacgctgga gcgcgtgctt gatgttttgc ggcggcaaca     41040
     atgatcgcgc ttccgtctgg ccaggatgtg cgtgtctgga tagcgacagg ttatacggac     41100
     atgcggtgtg gatttccatc gttagcgctt cgggtgcagg aggtgctgaa gcatgaaccg     41160
     ctcagtggac atttgttttg cttcaggggt cggcgcggcg acctgatcaa gttgatctgg     41220
     catgatggcc agggcagttg cctgttcaca aaaaggcttg agcggggcaa gttcatctgg     41280
     ccttctgcgg acggtggcgc ggtggcgatc tcgcctgcgc aactgtctta tctgctgtct     41340
     gggattgact ggcgaaatcc gcaacaaaca tggcgtccaa caaaggttgg atagcaatat     41400
     tcaattgaaa atgcagggaa aatctgatcg aatagtgtca tggctttgaa acctgacgct     41460
     cttcccgaag accttgccag cgcctatttg gcgctactgg ccaatcacga tgtcgtcgtc     41520
     aacgagcgga acattgcagt cgcggaggct gccaatgcgc aagccatgct atctgatcgc     41580
     gatgcgcgga tcgccagtct tgaattgcgg atcgacaagc tcaagcgcga actacacggc     41640
     cagagcagtg aacgctcagc gcggctgatt gatcagttgg aattgcagct cgaagagctg     41700
     gtgacggcag cgagcgaaga tgaagttgca gcgcaggcag cggcggccaa aacggcaaac     41760
     gtgcgtccgt ttgtgcgcaa gcgtccagtt cgcaagcctt ggccggacga tgtcgagcgc     41820
     gagcgcgtgg tcattgcccc tccgagcacc tgcgcgtgtt gcggcgggtc gcgcctgtcg     41880
     aaactgggtg aggacgttac cgagacgctg gaagaaattc cgcgccgctt caaggtcatc     41940
     gagacggtgc gcgagaagtt cacctgccgt gactgtgagg ccatcagcca gtcgccagcc     42000
     cctttccatg ccaccccgcg tggcttcata ggaccccaac tgctggcgac gatcctgttc     42060
     gacaagttcg gcatgcatag cccgctcaat cggcagagta cccggttcaa atgcgagggg     42120
     atcgatctgt cgacctcaac gcttggcgat caggtcgggc ttggaacatc ggctctcatg     42180
     ccactgttcg atctcatcga ggcccaggtc tttgcggctg agcgcctcca cggtgacgac     42240
     accaccattc ccatctgggg caaaagcaaa tgcacaactg ggcgcatttg gacctatgtg     42300
     cgtgatgatc tgcccttcaa gggggatgca cccccggctg cggtttatta cgcctcgagc     42360
     aaccgccgag gcgagcatcc gcaaagacat ctggccagat atggcggcat tctgcagacg     42420
     gattgttaca acgggttcga gccgatatcg attgccgcac agaaagacgt gccgatcacg     42480
     tttgcttttt gccatgcgca tgcacgacga aaattctttg agttggccga tctcgaaaaa     42540
     agtgcgcgcg acagcaagcg caatggcagg ccgatctccc cgatcgcgct tgaggccgtc     42600
     aaacgcttcg acgcgctgtt tgacatcgag cggcagatca atgggctgag cgctgaagag     42660
     cgattggcgg tgcgacagca caaaagcagg ccgctgttcg acgacatgca tgcgtggctg     42720
     caacgcgagc gcgccacgct cagcagatca tccgacctcg tcaaagccat ggactatatg     42780
     ctcaagcgct gggacggctt tgcgctattc ctggaagacg gccgaatttg cctcacaaat     42840
     aatgccgccg agcgcgcttt aagaggtatt gcattgggac gccgcaactg gaccttcgcc     42900
     gggtcccagc gtggggccga gcgcactgcc gtcatgctca cactcatcac aacctgccgt     42960
     cttaatgatg tcgacccaaa ggcatggctt gccgatgtgt tcacccgcat cgccgatctc     43020
     cccgtcaccc gcctgcacga actgctgcct tggcaatgga agttgcgcaa agggatagct     43080
     atagcgccgg tcgggtgaac aactctcgga acaacgcctc cgaacgctcc aagccttcat     43140
     cggtcaggat caacgacttt gacgtgttaa ccgggtcgcc gatcatgccc ttcttatgaa     43200
     gtcgatccgt cgttgcccag tcgaagcctt tccacgcaca accctcgtta tgcagcgtca     43260
     gccatagcag tgccaaaacc gcgtcatcga tcttgtcctc atcaatctcc atggacccac     43320
     attatcacgc gcggcgagca aaatcccgcg gttctgctcg gatggatacg attcctcgta     43380
     tcttcctgtc aaagataaaa tccgtgtcag cttatgaccg ggttgtcatc ggcgacgatg     43440
     gggacgaggg tcagatccgc tggatgtcca caggtcgttt tggccgataa cctcgtttgc     43500
     gcttctcgcg aagcacgtcg aggaacaggt tggtggcctg gttctcattg tcgaacagaa     43560
     gcaacatctg ctgtccgcgc gttccgatcc ggccccaggc gcgcgcaagc gacacctctc     43620
     cgaacaatgt cggctgaaca gcaagcgcat agaaccgcgc catgttctat tccggcggat     43680
     acgctcgaca tagacgtggt agcgcgttgg tacggggatc aaattccaat gttctgcgtc     43740
     tatacggccc ggatcaaaaa cagatcgctt gatcccgggt gccgcacaaa cataacgccg     43800
     cccgccgcca tcacatcggt aagatgaagt tcaaacgggt tttcttgtga ttttctcaca     43860
     ccaatatcgg tctattcacg accaccagaa aagcggccgt ttttctggtg gtgctgaaga     43920
     caacgccttc tctaatcgtc gttgtcgtct cgggtaagct tctcatgaag tttcaaagct     43980
     tgcgggctgc gtaaagccgg atcttcgcca ttttcgacag ccatgaccat gcgaatgcgt     44040
     tcttcttccg ccatacggcg ggcttcctca tagccgaatt tgctgacgtt gaaggtgcgc     44100
     gtaaactgtc ggcggcggcg ctttcccgca gggaccggcg tgttatcatc aagggcgatc     44160
     tcaatacgag ccatccagat accggtttta tgcgccccgg tgggtccgat ataatagacg     44220
     cccggcacgc tgctgccttc tgagcgattt ttgcgcacca acatgcgcat atcattgttg     44280
     ctcaatgggg gtacgacccg gagaacggca tcgcggtagg cttgcgccac ttccagcgcc     44340
     tgatccttcc caccataggt gctgtcgctg aaggtcatgt ggatcgattt cccgccgcga     44400
     gaaagattga ccatccaggc atcttgtctg tgcttgtcga tgtccagtcg gtgaatcgca     44460
     tacatagctt cgtcatggaa gcgctcctct ggagcaagtt taggtcgtgg tctgatcatt     44520
     gttattgccg tccgatttcg cgcattcgac caatcagcct caggctggct gccattcttg     44580
     cggctcccca aggcgggcca taatgatccg atcaaaacca atcatgccct cattaaaccg     44640
     caactcgata aggcgtcccc cttccatgaa gaatgaaatc cggcgctcat cggcatcgcc     44700
     ccttgcatcg cctggtccgg ctatattatc ggacagtttc atggtggcgc tggctggcgt     44760
     ctcgtttatc ggatccaggc caaagggcat tggcgaggtg ctatcgcctt cggcgctgac     44820
     caagatgatt tcgtcttgcc agttatccag cgatgtccca actcggccga aggtcaggat     44880
     gagaccccag gatcgatccg acctggaaaa tgctccgggc tgcaaagcag ggttcggcat     44940
     aggccgtcca agcttcagca tcgtctcttg gagccaatcg gccatgtgat agcaattaat     45000
     gcgttcgaaa aatgcgtccg ccaaacccgc catcgtctca cctcaacaga tcattgccgg     45060
     gaaaatcgat gcgctcccag tgcgtgccgt catagcgcag caagtccttg cggcccatga     45120
     cccacagcac accatcaact gcctcgacgg cggagacatc gtcgatgtcg ggtgtaagac     45180
     cggagcgcac ttgttcgaca tggtggccgt cgaacacgaa cagccctcga ggatcgacat     45240
     agctggagag atagagacgt tcattgaaca tagtcatacc gttgaagctt ggccaaccat     45300
     cgatgccacg aagcgcgtcg agatcccgaa agcccgtctt gtggttgcct atcaggaaat     45360
     ttccatcacg gccggcaacc cagactcgat cctcgctttc cacgaggata gaaaggaggc     45420
     cacgatccgc ctcggttggg atttcagcga ttttctctcc gtcaaaccaa taaacggttt     45480
     ctttttctcc ggtgaagtag atgctgtctt cggagaggcc ggaaaggtcc cataacgttt     45540
     ttgacgaatt ttcttttctt agctttttaa ttttctcgaa gttttcgagg gttctatttg     45600
     ctttctgatc caacagagcg tccagtttgc tcaattccga cgtgggatcc atgatcgcat     45660
     ccggtccatc atagaactcc acatccaagg cttcccattg tccattcgat gagcgtcgat     45720
     aggtttggcc gccgtcacca caaacataaa ggtgatcgcc gatctgcctg atcttgacca     45780
     gataaccaag cctatgtttt gtgcgaggag ccttggaaag atccaggatt gtctcgcggt     45840
     ccttcgtgtg gaaattgacg actgtgccag tctcacccaa cacatagagg acgcggtgag     45900
     gactgcctgg ctcgcgatac agcgtcaagc tcgccagtgc aaaagcgaat gtctcataag     45960
     accattcccc cgcattgtac tggcagatgg ccgtgaacgg cgtagccatt tcctggtcat     46020
     cgggcgtggt gccgagatag acgatgtccc tgttgaccgc gcaaagacgc gtgaagctgg     46080
     cctttttcat cggctcacct cagcggatca ttgccaggga aatcgatgcg ctcccagtgc     46140
     gtgccgtcat agcgcagcaa gtccttgcgg cccatgaccc atagcacgcc gtcgatcgcc     46200
     tcgacggcgg agacatcgtc gatgtcgggc gtaagaccgg agcgcacttg ttcgacatgg     46260
     tggccgtcga acacgaacag cccgcgagga tcggcatagc tggagagata gaggcgcccg     46320
     ttgaacatgg tcatgccgtt gaagctcggc cagccatcga taccccgcag cgcgtcgaga     46380
     tcacggaacc ctgtcttgtg attgccgacg aggaagttcc catcacggcc agcgacccag     46440
     acgcggtcct cattttccac caggatggag aggaggccac gatccgcctc ggtcgggatt     46500
     tcggtgattt tctctccgtc aaaccagtag acggttttct tttccccggc aaagtagatg     46560
     ctgtcttcag aaaggccgga aaggttccaa agggttttgg attggttctc ttctcttagt     46620
     atctttagct tggcgtaatt ttcttctgtt cgattttctt ttatgcgggt caaactactc     46680
     attaatctca gctctgactt cggatccatg atggcgtcgg gtccgtcgaa gaaccccaaa     46740
     tccagggctt gccattgccc gtccgacgag cgtcggtagg tctggccacc gtcgccgcaa     46800
     acgtacagat gatcgccgac ctgcctgatc gattgcaaat agccaagtct gtgctttctc     46860
     cgaggagcat ttagcagatc cacaattatt tcacgtgtct tcgtgtggaa attgaccgct     46920
     gttccagcct cgcccagcac atataggacc cgctgcgaac tgccgggctc gcggtacaac     46980
     gtcaggcttg ccaatgggaa gtcgaacgtt tcgtaagacc actctcccgc gtcatattgg     47040
     caaatggcgg taaatggtgt cgccatttcc tgatcatcgg gagtagttcc gatgtagacg     47100
     atatccttgt tgacagcgca aagacgcgta aagctaacct gtttttttgg catattgcct     47160
     ctcagtgaac tgtcgcgtga gcaccggtcg acagcagatt ataagggtcc gttccttcag     47220
     caggtggcat aatggtcgtt cttcctagaa tattggaatc tagagaaggc tgggcatcta     47280
     gtgccgtatt gatttcgtct tcacattccc ctccagtcgc ggcgacggca gcatttcgtg     47340
     aaatttcagt aatgctcgaa atatctgctg ttccctgcgg cgtactccaa ccggagccca     47400
     aagcattaac ttgtacatcc gctagatgtg ccaacccatg ctcactgcct gcatcggcag     47460
     aataaccttt taagcagatc gctggtccct gtccgaacgt tggcaatcca ggaattcgtt     47520
     tctgcccttt ctcggcctct gcacgattac cgtaacgcag tgtgtaatcc ggcacgatat     47580
     ggtgcgcctg ataatcagaa ccacattcga caccgcagac attcttgata tcatcatagg     47640
     cgcccgtgac gcaccggcac tcccttttgc gcttctgttg ccccgtgatc ttggtgtttc     47700
     cgtccgtccg cccattggcc ggcgccgtcg tttgcttttc ctcaagttcc tgcttctttt     47760
     caggttcggt tggggccgtg ttggttggga caccattatc gataggagta ttcgtgtgag     47820
     ttggttgcgt ctttagaaag ccatgactca accagtccgt cggctcatta acgttctgct     47880
     tcagataata gtcagccgcc cccatcagct ccatagcgcc tgcaccgctc ggattgatcg     47940
     atcggatgtt tttgagcccg ttgatgatgg tccaccatcg cgatccatcc gacgctgtct     48000
     gcttcgtatc ggtcggctgg gtttgggcgg gttttgtaaa ttgtccggtc gtatcgttga     48060
     aagcgtattc cttgccaggt tcgaaggtca tgggcgtcgc atcgctcatg accagacctt     48120
     cctggctccg gctagcggac ggttgttcta aaggaggcgt tggcttaaaa tccttcgacc     48180
     ccgtgtacca aaccagttta ccgacggtat tcttgttgtt catataccat tcgtcggtgt     48240
     cgcgggtggc ccattggcct tcgatacgga cattgcgcga atgagttttg cgatggcaca     48300
     cagagccaac agtattcgat ttgacgccaa gacccacgcc cggctcgtcg ccgaagcatt     48360
     tcgtgacaac cgaattttgc ttgtgggcgc gctgcccagt catatgcact gtcgcggccg     48420
     tgccggctgc gtcggattgg taggctataa tattgtatgg cacgcaggca tgcggcgagc     48480
     ggcaaacatc aggatatttc gagatgatca gacccaatcg cgtctcgcgg cttgcctctt     48540
     gcgatggata gctcatgcca gcacctccgt cagtccatgc aggctggcgc gtggcaggct     48600
     ggccgcttcc tgatccgcaa acggcctgtc tgacaggttg atacatagaa aattcgggca     48660
     gatcggcagc caggcgcgcc aggtcaaatc gacgttccgg gcgccattgc gaaagtcgat     48720
     atgcacgccg tcgaggttga gctgcaccac aacctcgcgg ccatcgcgcc accgatagct     48780
     tgcaacaggg cgcagcgcag ggagcgcgaa cttgaacgtc ccgccgccag gcgtcagtct     48840
     cgccatctcc accatctcgt cgcccgccag aaaacctgga tagatcatcg acggatgggc     48900
     cgagtgataa aaccgatagt caaaatccgt aggaagctgc ggatgtcgat gcgcctgcca     48960
     cgtgtcgtca taggttccgg catatctctg gcgaaaatac cagaatggtg ccaccggtcc     49020
     gaagcctagg ggcttgcgtg caaaaaacgg atctgaatag tcttcttcgg cgtcatcgat     49080
     gcgtggtgct ggcactgatg cggatgacaa cgcctgttcg ggcgtcggcc tcgatacgcc     49140
     tatcggattg ccgggaacgc tgggcgagcc cagtccttcg atgtggccat cgccggctgc     49200
     caatcgataa tcaatcggaa cctcggtcgc ctcctgtgga tctgacaagc gccatttgcc     49260
     tgcggtgcag acccaggacc gtgctcctgt cacccgaatg gcatgagaaa gctgtccaac     49320
     cttgatggca acgagccagt cctgtttggc gcgcccgtcc ggcgcatagg ctgcaccgag     49380
     aaacgtgatg tcacttgccg gtttgaatgg aatgagatca gcagctttga tcagaggcga     49440
     ggtatgggga ttgccgtcat actcatccac cagcacgata tcctgccggt cactgagctg     49500
     aagagagccg tccgcgttga cctgataccg tcctcgcacc gcgatcacgc ccatatcctc     49560
     gccatcgcga tgggcttgct cgaaaccgat ggcagcaaga cgcgtgagat tttttcccag     49620
     catgcacgcg ccctcagttc agatcgatga cttcgccatt gatctggaca tgtcccgatg     49680
     cggcgaaatt gaacttcgtg ccgacgatcg tcacattgcc agccttgtcc atcatcagct     49740
     tggattcgcc acatttgatg atgaattcct cgccagcgtt gatggtcatg gtgtgaccga     49800
     cggtggtgtt cttgtagaga ccgatctgtt cggttcgggc aattccaatg gtgtcggagc     49860
     gaaatttttc gatcaccgtg ttgacgatgc cgctgatcgg cagaattttg cccaacagtc     49920
     cgccaagggt cgatcccgtc gatgcctgct ccgtgccggc cgccgttctg aaattgccgg     49980
     cattggtgac atccgcattc gccgataaag acgcaacctc cgccgttact cccgccgaag     50040
     ccatggcccc ggcgaattcc tgcaacagac cgtgaccgat agcagacgaa ccgttcttgc     50100
     tgtctatgcc accggccgcc gcgatactgg caagagaggc gaacagagaa gagcttgcac     50160
     ctccaccaac ggtgacattt ttagacccgc cgatcttttc ctgatgattc tgaccgacat     50220
     cgatcgattt attctgcccg atactctcga cctgatgagc atcaacccgt ttgacgcgat     50280
     tattcaacac cttaatggtc tgatccttct gggcatggaa gaacatattc tcctggccgt     50340
     tctcgtcctc gaaggtcatc tcgttgaagc cgctgccctt gtgggtgttg gagcgcagca     50400
     ccatccgggt cttgttggcg ggcagctcat aaggcaccgg gtttttcggg ttcggcacca     50460
     cgccaatcac caatggccgg tccggatcgc catccacgaa tgacaccatc acttccatgc     50520
     caatccgcgg aataacctgc gcaccccagg tgccaccacc ccaggcctgg gcgacgcgca     50580
     cccagcaggt atcactgccg tccttctgtg cttttctatc ccaggggaac cataatttta     50640
     atcgcccgta ttgatccgtg tggatctcct cgcccgatgg tccggcgaca atcgccacct     50700
     gtgtcccctc gatacgcgga cgtttggtct ctcggtgcgg cgttagtgga acgcgtgagg     50760
     gaatggcctc gaatgcgttg gcatattcca tctcattgct ggccgtctca taggatcggt     50820
     ccaccacccg atgcacaatt cgggtaatca catgctcttc gtatttgtgt tccggatgcg     50880
     gttcctcata gggcgtgaac cggcgaccgg cttccagaaa gcgcacattg gactggcccg     50940
     tcaccctctc atgatcagcc tccacggcct gcatccgaaa ggtttcggcc acttcggctt     51000
     ctttgacatc ggagatgcgg gccggatatt cgtaaagctc gcgctgcttg gcgcccggca     51060
     tctggattag tgacggcgtg acattcagcg gtacagtgct gggcgtctca aaattccagt     51120
     ccgcaccggc acgctggcca gggacatagg agaattgccg catccattcg ttgatgtggt     51180
     tgcggtccga cgagccctgg gcaagacgta cattctgttc gccttctgcc gcagccgatg     51240
     gcgagcccca ggctacctta ctgtcgctga ccttcaggcg gtgaacgcct gtctcgtgtt     51300
     caaaccagta gaataaccct tcttgttcga atcggcgcag cagatagtca agatcggtct     51360
     cgttccactg cgttgaatat tcccgcgacg gcggcgttct atgcagagga gcatatgcgg     51420
     gggccggaat gccatgctcg gaaaacaggg tttccatcac ctggatggcc gtcatattct     51480
     gccagatccg gcaatcggag cggcgcgaca acagccacaa ttgcgggcgg atggtcagtg     51540
     tgtaggagcg aagcccgcgg gtcaccggcg gtccctcgga cagattggtc accagtccat     51600
     tgaacggccg gcgcacgcca tcaccgtcca gttcaccctg ccggatttcc agggagacat     51660
     ctaccagctt gccgatcagt tcttcaggct tgactgcctc gcgtttggcc cgaactgaca     51720
     cagtgatttc gaacaggcga ttgacgcctt catccaccgt catccgctca ggcagcaact     51780
     ggtcttcacc caggggcgag gataatttta gcacacggct ggcctggatg aaatcggcgg     51840
     gtgacagaac gtcgtccatg gaagccccca aatgtcgttt tcaaaatcaa cagatcgtat     51900
     tgctggccac gcaatggcta ttctaatatt cactcatgaa gtgtcgcaat cacgacatcg     51960
     aatttggaac gtagatcacc ctaccaaaag gtcaaggtct cggttgtaga tttttgtctg     52020
     gttgtgcttg cgcagcaatt cgctttaaac agtcgctttt tgttgagcaa caggccaaaa     52080
     cccaagcatc ctgacccatc agtgccatca aaaactgctc acccctgccg gagtaggttc     52140
     gaggatcaat gagcatgata ctcgaaatca atcatgtgcg ttcgtcgcaa cgaatgtgat     52200
     ttcattctca tttatggcgc gccactacaa taaggggcag ctattcagtg cgattgacct     52260
     cggaataacc ccgtcgtttc tttgcgcgct cgaggtggga aacggcccaa tccgcgtctt     52320
     cctggcgatc gaaggtttca atcatcgtct ggccgcctga gccgatccgg ccccagttgc     52380
     gaatgactga tacgccacca aacagtgttg gctggattgc aagcaagtag aagcgtcgca     52440
     tgttctgcgt cgtgtcaatg cggtgaagat gaaccaggtc tttcgcgtct ttttccatga     52500
     ctgcattgtt gtttcctatt ggagttgcgt ccaacgactt ttcagaatcg atatggcttg     52560
     attgattcaa agccgtgatg aaccgccgct gttggacaat accgaaatgg gcgaggtggt     52620
     gttgtcccat tcgggttgca gcgcgatccc gcgggcaaat tcgcaatgac ggccaatgtg     52680
     ctcttttgcg gtcgtaagat catccgttga agatggcacc aaacgcgcgg tgtcctggaa     52740
     tctcttgata agatgcacgt cgaacatgca atggggatct tcgatatgtc gtgttgaggc     52800
     ttgacgttct ctatcgatga tgagaacata aagtgaacat tgatcggagg ccatcatgaa     52860
     cacagccgac attgcaattc aaaacgccag gcaggaaata tccaagatac gagccgcccg     52920
     tgaggtccac atggctcaac gcttggaaat gcaacgcaag gcagaggcca tgatacgtcg     52980
     tcctccgaca tatatggtaa ggaaatacgg tggccagcaa ctcactctca acatcggggc     53040
     gggctatgca aacaaaatca attgaaccac aggttcatga tgaggcggct cacctcatcg     53100
     cttggcacga tggggacgcg acggctgcca tccggacttt gctcaaagat tgtcgccatc     53160
     ttcatgaaca gttgcggctg gcggcggttg caataggctg cggatataca cgaggctgga     53220
     tgccaacagc cgagccgaaa cacctcgacg tcgaagcggc ctcgactggt tgcaaagaaa     53280
     cgtagccgcg cccaatttga acaaaacgta taggtatgga tcgccctgtt gacaggagcg     53340
     taccacgtca gtcttcatcc gacttcgtca ctttgggtgc ggcaatggag gttgttgtcg     53400
     tatgggggtg atggaaccta ttctctccga cgcaggcttt catgtcttcg cgtcgaaacc     53460
     agatggcgcg tccgcagcgt agcggtgcat tgccagcagt aaagacgatt tgctcgtcgc     53520
     tgcgcatgcg cagaacctca tgcggcatga tcagtggccg gcggctgagc tgttttgatc     53580
     gcgaccgtga cgatcccttc atgccggagg agcgattggt ttggtcgacc tcaaccgtgg     53640
     tgtcaccaca acgtttcgag atataatctg cggtatcagg atcgttgatc gccgcaaatg     53700
     atatccagga tgcggactcg aaccatttgg acgtcgcgtc ccgaccccca taagcctcgc     53760
     gcatctggcc cagcgactgg aagatcagcg tcagcgtgat gccgtatttg cgcccggcat     53820
     cgcgtgcggt ttctaggata cgcaggtatc cgagccgggc gacctcatcg agcaggaaga     53880
     gcgtgcgtcc cttcacatca ccgttgcgat tgtaaatggc gttgagcagc gagccgatga     53940
     cgacgcgtgc caggcctgga tgggcttcca gcaccttcag atcgagtgca atgaagatat     54000
     ccgttccacc gttggctaga tcgtcggtcg aaaaactgtc accagatacg aggccagcat     54060
     agttcgggta ggatagccaa tgtgtttcct tcacggcgtt tgcatagaca ccggaaaacg     54120
     tctccggcgt catgttgacg aagacagcga cgttctcttt cacgaagtcg gattccgact     54180
     gttcataaat ctcggtcaaa cgtccccgca gcttgggctc cggttcggag agattggccc     54240
     ggacacggcg tagtgtctgg ttcttcgcgt cggtgtggcc ggaaagacaa acgtcggcga     54300
     tgagggccgt cagaagctgc atggccgagg cccgaaagaa gtcgtcgcgg gcggacgcgg     54360
     tgcgcgcatt gtctgtcatg atccaggtgg ccacggcgac aatatcttct tccttcgtat     54420
     tgccgtgacg gccgatccag tcgagcgcgt tgaagcccac tccctgtcgg gtgggatcca     54480
     gcacaatcac cttctgccca gccttgcgtc tgtgatcgac gaccatcggt gcgacctcgc     54540
     ttgatggatc aagcacaacc agcccgccac cccatttgag cgctgttggg atcgtcaccg     54600
     acgtcgtctt gaaaccgccg gagcccgcaa aaacgatgcc gtgcgaggag ccaaacgacc     54660
     catcgaagca gagcagctgc gacttgccgc ccgcacccca gctctgtggc tcatcggccc     54720
     gaaaaggcat ggtggccacg ctgtccttgt cgactctata tcgctcgcca ataacgatgc     54780
     cgccgggttc gggaaagagc tttgccgcct cctgcaactt catccagtcg gcttcgccat     54840
     gcaccgctcg ctttccgccg atccgcttag gtccggtttg agcaaaagcg gcattgccct     54900
     tgatcgcgac gcgcagcgca aacattgcac tgacgaatgc gacgcccgca ccgaccattg     54960
     tcgctggatc ggcataggtg agaaccgatt gtcctgccgg tacgttgccc gcgatgccgg     55020
     tcagacggat cgtctcgcct atggtcgcga taatgatcgc cgtactgttt gcggctagga     55080
     cgctcacacc tgccgtcttg atgttggctg atccatttgc tgcaaacaat gctatggcac     55140
     caattgcggc gacggcgatg tagggcaggg caaggccagt tcgtcctagc atcagcttcg     55200
     cctgggtcga ggagccgaac tccgccagcc gatgttccat tccggatgtc attaccaacg     55260
     cggcaagcat gattgccgcc agcagaacga acagcaaaag cctattcacc gtcatggcca     55320
     aaagcctcca cgccgatgga cgtcaggcgc gatcgctccg cctcattgcc tttgatcctt     55380
     ttgttcgcat cgatcagaag accgagcagc agcgcccgct tctcatagcg caagcccgct     55440
     ttgacgatca gggcaccgag ctcgatcttt tcgcgcgtgt cctttttgcg cgcttctgtc     55500
     gtcatcgcct tcgccatccg atcaagcctc accaggcccg cccgcatccg cgccaggcgt     55560
     gaacgacggg cgggtgtcgc gatctggctt gtcaccatgc ccattctctt ttccggtcgc     55620
     aggtcctttg cctccgcgaa accgtcgtgc aatctcctcg aaagccgcct gaagctctgc     55680
     ctcgtcaatc tcgatctccc caatcccggc cttcagtgcg atccggccga tgcgttcggc     55740
     ctcgcgtgtt tcagccgctc tcagttggtc ctgtaatttg gcgatttctt ccctgatctt     55800
     cgatgacggc ttcttcattc cggttgctct ccttggcgtc gtggcgttgc atttgcgacg     55860
     ccaagtctcc cccggatgct cgaaaaatgg aatctgcaga tctgcagatc gccaagggcg     55920
     atgctttcgt gaatgatccc gccgttccga aggagcggtt ccaagggcgc aattatacgt     55980
     cgctgatgcg acgtggttgc tttccgccct ggcggggccg tcgtggggtc gtcgcccccg     56040
     acgaacgaga ttcgaaccgg gagtgtttac gcggtggcca tcgcccattt ctcagccagc     56100
     atcatcagcc gcggcgacgg ccgcagtgcc gtgctgtctg cggcctaccg gcattgcgcg     56160
     aaaatggaat atgagcgaga ggcgcgcacg atcgattaca cacgcaaaca gggcctgctg     56220
     catcaggaat ttgttctgcc agccgatgcc ccgaattggg tccgctccct tatcgccgat     56280
     cgctctgtat cgggagcggt cgaagccttc tggaacaagg tcgaggcctt cgagaagcgc     56340
     tccgatgccc agctcgcgcg agacctgaca atcgcacttc cgctggagct gacggccgag     56400
     cagaacatcg cactggtacg ggacttcgtg gaaaagcaca ttctcgccaa gggcatggtt     56460
     gccgactggg tctatcatga caatcctgga aatccgcaca tccacctgat gacgacattg     56520
     cggccgctct ccgaagatgg gtttggggca aagaaggttg cagtcattgg tgaggatggc     56580
     cagcctgtcc gcacgaaatc tggtaagatc gtctacgaac tctgggccgg ttcgaccgaa     56640
     gatttcaaca agctgcgcga tggatggttc gaacgccaga accatcacct ggcgctcagt     56700
     ggtatcgatc tccgtgtcga tggccgctcc tacgagaagc agggcataga cctggagccg     56760
     accatccatc tcggcgtcgg cgccaaggcg atcgagcgca aggcggaaag ccaaggcgtg     56820
     cgtccggggc tcgagcggat tgagctgaat gagaagcggc gaagcgagaa cacccgtcga     56880
     attctgcgac gcccggagat cgtgctcgac ctgatcaccc acgagaaaag cgtctttgac     56940
     gagggtgata tctccaaggt gctgcatcgt tacatcgatg atcccggcat gtttcagcag     57000
     ttgatggcgc gcatcatcca gagccctgat gttctgcgct tgcagcgcga cacgatcgat     57060
     tttgcaaccg gcgacaaggt gccggcccgt tactcaacac gggcgatgat ccggctggaa     57120
     gcgagaatgg cgacgcaggc gatatggctg tcaaaccggg agggacgtgc ggtttcccca     57180
     accatactgg atgagacatt ccggcggcat gtgcgactgt cggatgagca acggattgca     57240
     atcgaacgta tcgctggccc ggctcgcatc gcggctgtcg taggccgtgc gggcgcgggc     57300
     aagaccacga tgatgaaggc ggcgcgtgag gcatgggaac tggccggcta tcgcgttgtc     57360
     ggcggcgcgc ttgcgggcaa agcggccgaa ggcttggaga aggaagctgg cattcagagc     57420
     cgcacgctcg cgtcctggga attgcgctgg ggccgtggcc gcgacatgct cgatgacagg     57480
     accatcttcg tcatggacga ggccggaatg gtcgcctcca aacagatggc gggctttgtc     57540
     gatgccgtgg tcaaggcagg ggcaaagatc gcgctggtcg gtgatcccga gcagcttcag     57600
     ccgatcgagg cgggggctgc cttccgtgcc attgttgatc gcatcggata tgccgaactg     57660
     gattcgatct atcgccagcg cgaggactgg atgcgcaaag cctcgcttga tctggcgcgg     57720
     ggccgcgtcg gagatgcgct cgccgcctat cgctctgagg gcagggtgct tggttccgag     57780
     ctgaaggctc aggctgtcga acacctcatc gcggactggt accgtgatta tgaccctgcg     57840
     aagtccacat taatcctcgc tcacctgcgc cgtgacgtgg gcatgttaaa cggcatggcg     57900
     cgtgacaagc tggtcgaaag cggcatcatc ggcgaaggcc atgcctttag aactgccgac     57960
     ggcatccgcc aatttgacgt aggtgatcag atcgtctttc tgaagaacga aggatcgctc     58020
     ggcgtcaaga atggcatgat cggtcatgtc atcgaagcgg cgccgaaccg gatcgtcgct     58080
     gtcgtggggg aaggcgatca gcgccgccag gtgacggtcg aacagcgctt ctacagcaat     58140
     ctcgatcatg gctacgcgac aacgatccac aaaagccagg gagcgaccgt cgaccgggtg     58200
     aaggtgctgg cttcgctgtc gctcgatcgg catctgacct atgtggcgat gacccgccac     58260
     cgcgaggatc tgcagcttta ttacgggaag cggtcctttg ccttcaatgg cggtctatcg     58320
     aaagtccttt cccgcagaaa cgccaaggaa accacgctcg attacgagcg cggaaacctc     58380
     taccgcgagg cactgcggta tgcagaaaac cgtggtctca acatcgtcca ggtggcgcgt     58440
     acgctgctgc gcgaccaact cgactggaca ctgcgccaaa aaaacagact tgccgatctt     58500
     gctcagaggc ttcgtgcaat cggtgagcgc tttggcctcc aacaatccct gaaaacccaa     58560
     gcgatgaagg agacagcacc tatgatcgca ggcatcaaga cattttccgg ttccgtcgcc     58620
     gatacggtgg agcaaaagct cgacactgat ccagccctca aaaaacaatg ggaagaggtc     58680
     tcgacccgct ttgtttacgt ctatgccgat cccgagactg ccttccgggc gatgaacttc     58740
     gatgcagtgc tggcagataa agatagcgcc cgccaagtgc ttcaaacgct tgaagcggag     58800
     ccggcattca tcggaccatt gaagggtaag accggtattc tcgccagtaa ggccgaccgc     58860
     gaggaccgtc gcgtcgcaga actgaacgtc cccgtgctga agcgcgatct tgagcattat     58920
     ctgaggatgc gcgagactgc cgtgcagcgg ctgcgggctg acgagcaggt attgcgccag     58980
     cgcatatcga tcgacattcc agcgttgtcg ccgacggcac atgtggtgct ggagcgcgtg     59040
     cgcgatgcga ttgaccgtaa cgacctgcca gcggccatgg cgtatgcgct cagcaatcgt     59100
     gaaaccaaga ctgagatcga cgggttcaac caggccctcg cccagcggtt tggggaacgc     59160
     acgctgctca ccaatgccgc gcgggaaccc tccggaaagc tgttcgacac actctctgaa     59220
     ggaatgcagc cggagcagaa agaacgcctg aaggaagctt ggccggtcat gcgcacagcc     59280
     caacggcttg ctgcccacga acgcaccgtg cagtcattga agcagtcggg ggaattgcgt     59340
     ctcacccaga gccagacctc ggtgctcaag caataacgcg gcggcagcta ctcttgtctc     59400
     tggcgggtgt cggcgtggtc atctccagtc ttgtcgcgac cgggtggatt ggcggctatc     59460
     gactgaacct gacgccaagc gagccactcg ggctgtggcg tatcgatgcg cttttccgcg     59520
     acgtcgatgt cggagatctc gtgttcgtct gcccgccggc tacagccaca ttcgaagagg     59580
     catggcagcg cggctatctc cggcgcggac tgtgtgccag cggctttgca ccgctcatca     59640
     aaactgttgc agcactccct ggccagcacg tcgccattgg cgaaacgatc gaagtcgatg     59700
     gcgtgccgct gggcgcatcc cgcctccgaa aaagtgatgg gcaacggcgg gtgatcgtcc     59760
     cgtattccgg tggtgttgtg ccgcgaggat acctgtttct ccactcatcc tttgagagct     59820
     cctatgactc acgatatttt ggaccgatcc ccgatagcgg gctcctcggg cttgccaagc     59880
     cgatcctcac gtttgatccc tgaaagctgg cgcggaccgg tcctggtcgg gctgtcgatc     59940
     gtggctggga cggtcggctg gagtggaaac atcatgacct tgccggtcgt gatgctgttc     60000
     ccgctactct gggcgcaatc gccgtcacgt ttggtcgctg ctgccgtctc agctggttac     60060
     ttcctcgccg cttcccgcgg cttgccccag ggcgtcgcca atttctacgc cgctgatctt     60120
     tggcccggcc tgctactttg ggcggttgcc tcgcttgctt tcgttgtcgt gcatgccgtc     60180
     ctctgggcaa ggcaaacgga aaggttacgg gcggtacgtt atgtggtggc catggtgcag     60240
     atggctctgc cgccatttgg gatcattggc tgggcgcatc cattgaccgc ggccggcatc     60300
     ctgtttccag gatggggatg gtttggtctc ggtgctgccg cgatcctgtt ggtcgtcatg     60360
     accggtcgaa ggtggaaaat cgcggttgcg gccctggtgg gactacacgc ctggtccgcc     60420
     acgaactgga cgcagcccaa ggcacccgac agatggaaag gggttgatct cgcgctcggg     60480
     cagaggctcg gtcgtgacag ctcgctcacc tatcaacgcg gtctgatcgc aaccgcgcgt     60540
     gcgatggagg acgggaaggc tcgtttcgtc gttttgccgg agagtgcgct cggcttttgg     60600
     acgccgaccg tggcgcgtct ctggcaggat ggcttgcagg gatccagcgt caccgtgatc     60660
     gccggtgcag cggtcatcga tgcggccggt tatgacaacg tcatggtggc tatctctgcc     60720
     agcgacgccc gtgttctcta tcgagagcgg atgccggtcc cggtctccat gtggcagccg     60780
     tggctcgatt ggacagggca gggtggaggt gcacgcgctg accttttacg aaatccgacc     60840
     gtcgatatcg acggccagaa gatcgcgcct ttgatctgct atgagcagct tatcctttgg     60900
     ccggtcctgc aatcgatgat cctctccccc gccgtcattg tcgccacggg caatggatgg     60960
     tggactgtcg gcacctcgat cgttgccatc cagaaggcaa gcgtgactgc ctggggcagg     61020
     ctgttcggcg tgcccgtcat cgtggcgttc aacacatagg atatttcccg atggtcgatg     61080
     ctgcccttat ccagcaatgc gccgatcctg ctctaaaacc cgcaatcgtc gagcagttca     61140
     tcgaacgggc agggtcccag gatccactct ttattaaggt tcgctctggg agccgagtca     61200
     ttctggtacc taagccagcg acaccggatg atgccctgac gctgatccgt aacaacctcg     61260
     gtcgaaacac cgtgcgcgtt gggataactc aatatcccgc tggcctcggc atcctggagg     61320
     ccgggcaact gaagcccgac ctcgtcgatg catgtacgaa catccgcatg ggcacggcgc     61380
     tgtttgccaa ggtctaccgg atcgtcacca aatggtatgg caatccaacc aacaaagatg     61440
     tgctgccaca ggtactcgat gatgccatca ttgcttggca gacggggtat ttcgaggggg     61500
     tggcggtgtt tcgggcagag gatcccgtgg acgggaagat tgatgagttc gagcaagacg     61560
     gaaaaggttc cacccgtaga gaggatgaga atgaaatcaa ccatacgaca gcaccggctg     61620
     gcaatgatac agacgaccca aacagcgcag gcattcggat tgacctttca ggtattggtg     61680
     ctcgttcgca atacaacggc ttagcaggcg atcccaatta ggcttgacgg cgccgatctt     61740
     ccaaaatgtt ctcggtaacg tctccccagc gagcgaaaat gccaaggata gatacctctt     61800
     catccttgac aataagggct atgctgatgc gacttcatac tgaagggtga ccggaagagc     61860
     gctgctgaac atcgcaagtt gcaaaacgcc accatcaaag cggcgcgcga aattacgttg     61920
     gggtttgtga gaaagaccag gctggaacac gaccaatcct gtgtccggct caagttaagg     61980
     cgacgcgact atgccgttgg cctagtggct ttcccgtaac gaagcgtatt cagttgcact     62040
     cgtcttgttg cgcctttcat acttctggcc atgcggccat ttcaggtctt gcgggatgcc     62100
     ccaatattgc gtttatcaat cagatattac aaggcttcgg aacggtagaa tgccatgaaa     62160
     tttcgcgatt tagagataaa atcctttcga aaaaagtcga aatctggtcc acctacgtgc     62220
     tcatatatac gatgctcatt ggaacgtttc tttcgatttt tatgcatcca tataaactat     62280
     gctaatgata ggaataatct tgtctattat ataaataaat tcaaatattt atattttata     62340
     tcgcaataat tattggccat tggactgcac tttcgttcaa tctttcgttt tagtgttttt     62400
     cttctatcgt gaataaaggg gtgtcagaaa cagatcgccc gaggctggcg tgtggctatt     62460
     ggccgaaacg attggggagc gaagattgaa cgcacaggaa gaaagatcac gtgactgggt     62520
     atcgatccgt cgcccgttcg caaaggctgg tctggaaacg atgacggcgc gatatatcca     62580
     gcaatccttt aaaccgcatg cacatgatga atatgtcata gggatcattg agggaggtgt     62640
     tcattctgtt tggtgtcgtg gcattcatca taacatgccg tcaggcactg tggtcaccat     62700
     gcatccaggt gatgtccact atggcaatgc ggcaattgcc gagggctgga agcagcggat     62760
     gatttacatc agtgaaaatg aaattggaaa attcattagc gacattgcag gtggagacaa     62820
     gtttttgcta cctgatttca aacaaacgtt tcatgatcgg ccggatctcg cccattcctt     62880
     cgcgcagttt catgaagtct tgcatagctc acccttggca ttggcacgtg atgttgcgct     62940
     tgattcgatt atgcgcgtca caattggtgc cttgtcgcca gatttcgtga aggcaaaaga     63000
     cgcaaagcag ccgtccggtc gcattgcaga tgccgttgag ttcttgcaca atcgcatcga     63060
     agatgatgtc acgctggacg aactttgtga tgtcgctggt ttgaggcggc ggcaaaccat     63120
     tgaagcattc aagcggtgta ccggattacc cccgcacgct tatcacgtta ttcaaaaagt     63180
     gaaggccgtc aaaactatgc tacgtgatgg tttttcggca accgaggcgg ccgcacgagc     63240
     tggatttgct gaccaaagcc acatgacgcg ccacttcgtt ggggtggtcg gaatgacacc     63300
     tggtgcctac gctctggatt gccaaaaaaa atattaaccc gcgttttcat tctatccgat     63360
     tcatgaccgg ctctcttagc ttggttgcgt aaaacccgct catcttgcgg gaaatgcagt     63420
     caaaaaggaa atccctatcg tggttgggtt tagaaatgcc tcattatcga gaagacctgt     63480
     tgctgtctcc atgtgggcag acttggcagt cctcggggtc gctgtcgtgt gggggactag     63540
     ctatcccgtt gcaaagggag cgctactata cgctccagtc ttgatcctta ttctttatcg     63600
     cttcctgatc acgacgatta tcatgatgat cgtagcgcgt cgcgagattg tggctatgtc     63660
     gcggggagat attctacggg gatttttact tgggtcgatc ctgttttcaa ttttccttgc     63720
     agaaacctat ggggtcgctt tgacgagtgc gacgaatacg gcgctaatca tctccctttg     63780
     tgtgatcttt acaccaattc tggactacgg gttgtcacgg aaacttccgc cgcctgccgt     63840
     tattgcgagt gccatcgttt gctgcgttgg cgtcggtatc ttgaccggtg gtataaacgc     63900
     cttcggtgca ggtgacttgc tcgttttggg tgcagcagta ttacgagcca ttatggttgt     63960
     ctcgacaaag cggcttatgt tcggtcgcca gatttcctct gcggcactca ctgcaatcca     64020
     gggtttttcg gtcacaacgc tgaccttggt tgtcgtgatc gctcaatttg gtgtcggcag     64080
     cattgcggtt gatgccgatc cccaattttg gtttgcagtc gcattccttt cgctcttttg     64140
     caccatcgcg gcattctaca tacagaatgc tgcggtcagg agaacaacgc caacgcgtgt     64200
     tggatttctg atggggactg agcccttttt tggcttcctc ctcgcacatc ttttgctcgc     64260
     cgaaccgatc agcgcgacaa gcgtatcggg tgctgccctc atcctcgcag ggtcctttgc     64320
     cggaattctc tccgaaaaca ggaaaagatc atgaatttcg ttattttcat aattagcgca     64380
     atgtcgttct tgtttacggt acgagaacag agaaaagcta tagggcagcc gcgactaacc     64440
     ctacgctcat cggcaatagg gcgcgttacc gcctatcttt gacgtcacgg agacggatag     64500
     gcgcaacagg gccggacagc gaattatttc agccgagtca atttcgtcat ggtcaatgag     64560
     ttctgctgct tcctccgcct tatacgaaga gtcattgaaa gtgactcttc gtattccctt     64620
     tgaaaatatc tcaagcctct gatgcatttg agatattttc aatttctcaa gtcgaggatg     64680
     cgtcagcatg tcagagactt ggtattatgc gacgcttaaa tgacaaccgc acaagtttta     64740
     tcggttcacc catcacagcg agaatatgaa gacaagcaat gaaatattgt ttttaaaaac     64800
     tgttcttttc ttaaagccaa agtcaaagag ttactatttt gcgcgctgat tgacagccta     64860
     agactacaca aaatgattga tttttcgcgt tgcataaccg cggacaaatt aacaacggag     64920
     gaaggcacta acgtcacttt cctaagccgt ggcaacgttt tacctgcgca atcctattgg     64980
     agattatatg tcctataaag tacatattaa ggcatcggat gtaatagatg ttcatgtcgg     65040
     ctgccgtatc cgtttacagc gtgtgctcaa gggaatgagt cagaaggcgc tcgccgaagg     65100
     ggtcggtgta acctttcaac aggtccagaa atacgaaact ggcacaaatc ggattggctc     65160
     aagccggctt caggccgtcg ccagaattct cagtgtccct gtcgcgttct ttttcgagga     65220
     tggccctcag agttcttccc cttcgcaatt gcccgaggcc ggcatcggca aggaaatcac     65280
     gcggtttatt cgttcagagg aggggttggc cctcaatctt gctttcacaa aaatccagga     65340
     tgccaatgtc aggcgaaagg tcatcggact ggtgaagacg ctggcaaaag agcatgcaga     65400
     gtgagaccgg aatgcgtgcc cagatgattg ccgcgaatac gctgatggct tgctcggctg     65460
     catccgaaag ggcaccgtaa agttaaagaa ctacggccaa agctggcact cgccgcttcc     65520
     tctcacgcag cctgcaggcg cgcgaattca ctccacattt gcatggctgc ggttctcagt     65580
     tcacggtgat ggtgggacag gatatcgtgg cgtggaatgt ggaagagatt tgcgaccggg     65640
     tcatggatgg agacgaaacg ctggagatgt cgagctgatt tgaagccctt catgatgcgc     65700
     tctcgccgtc gtgtcggttg atgtgaattc tccgcccggt tattcaatcc cttgtgtgaa     65760
     cggtgttcga cgccgggcat gatgtcgcgt ttggccgcgc cgtaggatcc gagtttgtcg     65820
     atcatcatca ctctcggtgc ttgaccctgt cctttcagaa gctttcgtat cagacgtttg     65880
     gcggccttgg tattagggcg gctctgcacc agcacatcga gaacgaagcc atcctgatcg     65940
     acggctcgcc acagccagtg cttcttgccg cctatggaga tgacgacttc atcgagatac     66000
     catttgtcgc caagctttcc ggctgaacgc cgccggattt cattggcaaa gcggcgaccg     66060
     aatttctcgg cccaaaggcg gactgtctgg tgcgagacaa taatcccgcg cgccgccagt     66120
     aagtcttcga ccatccgcaa gctgagcggg aaacgaagat aaagccagac gacatgagca     66180
     atcacttcag ctgggaaccg gtggcggcga taaaggggat cacgaacggt ttgggtcatg     66240
     tcgcaaaaat cgcacacgcc aatcgccgcg gggttaacgt tacgatgcct gcgttcggcc     66300
     ttagcgtgtt tgtgaggaca gaccttgttc cagccccgag atgctatgtg gccaaatgat     66360
     gggtgagaat aaagcgcgct tcaggagtgc catcgcagac atcataagcg gctcctgccg     66420
     atcaactgca tcatcgcgac ggcagttaat ctgagaattt tcccgggcag gttctcacgt     66480
     taaataccaa accggctaga agcacccgca tcctcagggt tcactgccaa ccgacaactc     66540
     ttggtgattt tggtaaacaa ttccaactac gccttggcca cgctgcgcct gtaggcctcg     66600
     aaagtgatcg ccataattaa gatgataggt acggtcgcag aaaaggcggt cgttaccccg     66660
     aaccgatcgg acaaagcgcc cagagcaaaa gacgcgacct gccccccgag agtcagagag     66720
     acaaccatca gcatagacag agcagcactg gatgaaggat tatgatccat agcgcgcccc     66780
     aggaagattg gaaaaagacc cccgatgccg gcgccgagga taacatttcc aagcaacatc     66840
     aagggcgcag tggctgctat aatgacaatc gtttctccga caagggcaag caaaagcatc     66900
     gttctttgaa tggctacgga tcgcacagcg ccatcgaacc agatgacgaa gactctggag     66960
     gcgatcatgc cagcggtaaa ggccgacaag ccgaaccgtg ccaggtcctg cggcaatcct     67020
     tcttccagcg cgtagcttac gaaccaaaca ttttgtgtcc actcggtcgc gccgagggca     67080
     aaactagcga tggcgagcga aacgagactg gcgagaggta agatgttgag accggtgcga     67140
     gcatccatgg tactatcagc acgttcatgg aacacttctg catttcgacc aaggagttga     67200
     agagcgaata acccggttat caacgtgaag ccaaaggtga ggagcaaata gaagctctgc     67260
     caacttattt tccaagaaag aaccgccacg attaagagcg gtgcagccat gttgccaaca     67320
     ctgaaaacaa cgtcgaggac cgccagcgcc gatgaccgac gatcgacaaa gagttcacca     67380
     aacagtgtat gagacgccgt aaagatcgcg ccgccacaca gacccagtgc aagataaatt     67440
     gcataaaaaa gacttggcac tgtggctgta aactgtagca acgagaagac ggcggtcaga     67500
     gctgaaagga gcgtcagaac aatgatcgta ccgtaggctc tgaggaggcg ttcagcggcg     67560
     aaggacccga cgctgaatcc gatcgaccag attacgaaga ccatgcccgc catgaagggc     67620
     gatagcgaaa aggtctccat ggcattaggg agaagtgcgc caatagagac gcccagcata     67680
     ccccagaaga aaaatgatat gctggccgat actccaagca gtaaacgatt attggtcaaa     67740
     gtgaattacc gtcttgagat gaggagttgt gtaatattcg gcgaagaact gaatgacctc     67800
     ctgcggacgc caaaaggaca tatggttcgt catcatccag cccggatcga taatccgtcg     67860
     gagcaacagt tcctttgcgg tcttcatgac gaatgccgtc ttgtacatcg gaaaatggtc     67920
     aacgtcgaaa gcggccgagg caagcgtaat gcccttcgct agcagcaacc atgtatcgaa     67980
     ttgctggagc gtctgggacg caccatagag tacatatttg gaacccggct tggcagcccg     68040
     catcgccgcg cgacgagggc atgagtctgc ttctatgttg accaaaggcg gtagagcgtc     68100
     aaacacataa tcaaatgcat cgtcatccga ctctcgtaac tcttctgcag aaccgaatac     68160
     gaaatttgca tactggcttc gcgcaatttc ctggcgtgcc tgattgcgtt caagaacagc     68220
     aaccgacttc gttgcataga gggtctgcaa tatagcgccg gcgatcgcac cgcacggtcc     68280
     accgccaaga actaacactc ggtttccaac ggcgggtgga tgggtaagga tcgatctcaa     68340
     gaccgctgta atcggctcga tcaggggcgc atcactgtcc gagatctcgt ctggaagcgt     68400
     aatcgccgcc gcccgttcat catctttgaa aaagcggcct gtcttgaaag gtgatgatcg     68460
     cagatctccg gcgaaaaggg gacgcaaagc ccggtattct gccatcccgc cgaaatctgt     68520
     ttggccgaaa taagcaaggc gttgtccttg gagggaggac gggcattcgg gaccgacatc     68580
     aacgacgata ccgctatatt cgtggccaag gatcaccggg tagtcctcgg caaggagatt     68640
     gccatgataa tgcgagatgt cagtagaaca aatcgagacg gccgatgtct taagcagaac     68700
     gccatctaca ggggtctctg gcacttggcg ctgtgagatc gagagccgat tagggccgtt     68760
     gagttcgatg acttgcatag tagttgacat tgaggaactc ctttttggga aaaaatttcc     68820
     ttggatgtcc atcatgtgtg cgatctctct tggatcgctt ctagtgcagt gcaatatctg     68880
     gggagatggg tgcagcctag gagatttcaa gccccaggta atcaactttt gatagactgt     68940
     cgaataaccc gctgtagttg aatatcattt tcagatgaac ggctatgctt caaggcgatt     69000
     tcggctgggg gacgacctcc accagaggag cacaattgac gtctagctct tcaaggatcc     69060
     accatgcact aggtgtttgg tcccaacata tggaggggca atgccttagc gtaaccaaca     69120
     gactgcaggc ttttgtttta gaatatattt ttctatcggg gtcattggtt cggttcccat     69180
     caaggcgaga caactcgggc tgaacgaggc gtggacgaat ccacgcctca tgttgcttag     69240
     gcttcgataa cacagccgag ccgcgtgaga gacgcgtcga cccaggcgcg gtcgttcttc     69300
     ccgagcttaa tgttttccat ctgctttatt tctgccgcgt gcttcttcga tgcggcttcg     69360
     aatacagtct cgaccgagga cagcgggacc gacagaaggc catcagcgtc gccgcagatg     69420
     aggtcgcccg gctcgatgac catgccgttg atggcgatag gcacgttcac ttcgcccggg     69480
     ccatccttgt aggggccgcg gtgggtgaca cctgctgcaa agacggggaa tgatccggcc     69540
     agcagttctt cgctgtcgcg gatggcgccg aaaataacga tgccgccgag accgcgctgc     69600
     gctgcatgcg caaccatcaa ttcgccgatg atcgcattgc tgaggtcacc accagcatca     69660
     acgacgacga tgtcaccggg ctcggcaatg tcgagtgcct tgtggaccat caggttgtcg     69720
     ccggggcgcg ctttgaccgt cacggcggcg cccaccattc tcgggcccgt atagaacggg     69780
     cgcagcggcg cgccgcccgc tgtcatacgg gacatgacat cgctcacatt ggcgacaggc     69840
     agagttctga atttctccac ccattccgcg cagacatttt gcttacgctt gcatactctg     69900
     aaacccaaca tttcgattcc tccgttttca aatttggtgg tttagttctg ggcgaggttc     69960
     tggttggcga gtgcccgacg atcaaagggc gcgccggtga ggacatcgac gatgtgctgc     70020
     gcgctctgta gcgccatgtt cctcagcgct gatcggcttg ccccgcccac gtgaggggtg     70080
     gcgatcaggt ttggcagcgc ccagaacggg tgatcggcag ccggtggttc ctgctcgaaa     70140
     ctgtcgagtg ccgcacctgc gatgctgccg tccttcagtg catccagaag agccgcctca     70200
     tcgatgacgg cgccgcgcga cgtgttgacg atgaaggccg tggatttcat caccttcagc     70260
     cgctcggcat tgatgaggtg atgggtctgc ggtgtcagcg ggcaatgcag gctgacgata     70320
     tcgctttgcg cgaggatgtc cgacaggtcg cggctcacgc gcgtgccatc tgcgtcctcc     70380
     gcaaacgggt cgtatgcgat ggtttccata ccgaggcctt gcgcaagttt cgccgtcctg     70440
     cgcccgatct cgccaaaacc gatgatgccg aagcaggcgc ccgcgaggtc gcgtccgaca     70500
     tatttcgtct tcggccaagc gccgcccttc acggtgtcgc tcaggctgcc gatgtctttc     70560
     atcagcgtca cggacagggt gatcgcaagt tctgcgaccg actgtgcgtt agcggcgagg     70620
     gcgcgcagaa ccgggatgtt gtgggaagtg gcggcgtcga gatcgatatt gtccacgccg     70680
     ctgccgtgtt ttgcgatcac tcgaagacgg gaggaagacg cgatgacctg atcgtttatc     70740
     tggccttgtc tgacgaggat cgcatcaacc gcgtgtgttt tggcgatctc agcgagattt     70800
     tccgagccgc tgtagccatc cgcataaacg atctcgattg catgtcgttt aagaagttct     70860
     gttgcttcag gtgccaattc cgccccagtc acaagaactt tgagacctct cgcaatcgcc     70920
     gttgataggt ttgcagcagc ttccgctgca ttgattttgt tcactaaacc ctcccgaact     70980
     ccggtgcgtc gcctgacagg taagcgacgg ttgacgaatc cttattatcg gttattgtac     71040
     tagatgaaaa gatgttgtac ctagtacaac atctttttga gggaggtttg atccaatgcc     71100
     aggcaattct tcaggtgtcg cagctgttga acgcgctgtt tcgatgctgg aagcttttac     71160
     cgatgtcgac tattcgttga cgctcggaga gcttgcgcgt cgcacggaac tcgacaaatc     71220
     cacggtgttg cgcatcgcgc gctcgcttgc gaaatcctcc atgctcgttc gcaatgatga     71280
     tgccagctgg cggctagggc cgaagctcgt gcgtctcggc gggctgtatc aatccacgtt     71340
     caagtcatct gcgatcgttg agcctttgct tgcccagatc agcgatgaga gcggcgagag     71400
     cgctgcggtt tacgtgaaag aaggcgttgt ccgcgtctgc cttcataggc acgattccac     71460
     acaatcgatc cgccactcgg cgcgtgttgg cgatgcgatg ccgctcgatc gcggggcgcc     71520
     cgggcgtgtc attctggctt tcaccggttc cagcggaaag ctctatgacg atattcgcgc     71580
     gaaggggttt catgtcacca tcggcgagcg cgacccacag gtcgcgagcg tcgccgtccc     71640
     ggtctaccgc gacggacaag ccctctttgg ctctttggct ttgaccggcc cgccatcgcg     71700
     tttcaacgaa gaggccgtgt cgaaaaatct cgaaattctc cgcgttgccg cgcgcaagct     71760
     cagcgctgcg cttggaggag accccggcta gttccagagc gggtgccggg cccgcatagc     71820
     gttccttggg aggagcatat cgatgaatat gatgagaaca gcgatcttgg cggccagcag     71880
     tttgcttgca acgattggct cggcccatgc cgagtggccg aaggatcgac ccattcagat     71940
     gatcgttgct ttcgcgccgg gcggcagcac agacgtcatg gcgcgtgcca tgcagcccta     72000
     tcttgaaaag gaactgggcg cagacatcgt catcgaaaat cgccccggcg catcgggcga     72060
     aatcgcctat acggcgttgg caaaggccaa gccggatggc tacaccttct cctacatcaa     72120
     cacgcccggt ttcttgtcca tgcaggtgca gagaaagctc ggctatgatc caaagaccat     72180
     caagccgatt gcccgtatcg tagacgaccc ggcggctatc gtcgttcctg cggcgtcaga     72240
     aatcaaaacc atcgcgcaat tcatcgaagc agcgaaggca aagcccggtg cggtttcgtt     72300
     cggctcatcc ggcatcggca cggatgatca ccttgccatc atcattctcg gcgctgaagc     72360
     cggcaccaag atcacgcata ttccgttcaa cggtgctggc gaaacccgca ccgcgatcct     72420
     tggcgcacag gtgaccggcg gcggtctcaa cgttagcgag ttcggcggaa acgatacgtc     72480
     cggcctgcgg atgatcaata ccttcggcaa ggagcgctcg cctgagcttc cagacgtgcc     72540
     gacagccatc gaatccggtt tcaatgtcga gatgacatcc gagcgcggca tcgctgctcc     72600
     ccgcgaagtg ccggctgaaa tcgccgaccg tttcgctgcc gccgtcaagg caacgctgga     72660
     taaccctgag ttccagaagc aggccaagca gatggcgctg ccactggctt atctcagcgg     72720
     tcctgactgg gaaaaggaaa tgccaacgcg tctcgctcgc ttccagaaga tctgggacac     72780
     tactccttgg gtgcagcaat gagcgttaag cctgtagcaa acggtcggga ctttcccgat     72840
     attcttgcgg gtggcgtact gatatttctg ggagcgcttg gcctttgggc cgggcgcgac     72900
     ctgacatacg gcactccggc aatgatgggc cccggtttcc ttccgaagtc cctctgcgcc     72960
     atcatcgcgc tcatcggcgt gatcgtcctt atcaaggcac tttccaagcc gcatgagtca     73020
     ctggatgcgg ttaaccccaa gccgttgctt attctggtcg ccgccatcgc aggatttgcg     73080
     tttgcagccg aacgcttcgg ctttgtcgct gcaaccatct ggcttctggt tgtgggaagc     73140
     cttgccgatc cggaatcgcg ctggaaggag attttcatct cgaccgcagt gctgacgacg     73200
     ctcggcgcgc ttctcttcgt ttacggactt ggcgtccaga tgccgatttg gcccttctga     73260
     cgacctttcc tgatttgatc ggattatttc gatggctttt ctcgacgtcc ttatgctcgg     73320
     attctccgag gccctgacac caaccaactt aatgttttgt ttcatcggcg cgcttctggg     73380
     aaccctgatc ggcgtcttgc cgggtatcgg cccgaccgca accgtggcga ttcttctgcc     73440
     ggtgacgttc ttcctgccgc cgcttggggc tttgatcatg ctggccggca ttttctacgg     73500
     cgcgcaatat ggtggctcga caacggccat tctggtcaat cttcccggtg aagcctcggc     73560
     ggtggtaacc gcgatcgacg ggtaccaaat ggcacgaaag ggcagggcgg gtgccgcctt     73620
     ggccattgca gcgcttggct ccttcttcgc gggcacggtc gcaacgatcg cgctggcagt     73680
     tgccggaccg acgctgtctg ccttcgcact gtccttcgga ccggccgagt atgtagcgct     73740
     atgtatcttc ggtctgctcg cggccaccat tctcgcccat ggttctgtcg tgaaagccat     73800
     cggcatggtc tgcctcggtc tcgtgctcgg catggttggc attgacgtca acagcggctc     73860
     ggcccgcatg acgttcggct cgaccgacct ttatgatggc atcgatttcg tcgtgatagc     73920
     ggtcggtctg ttcgggatcg cggaaattgc caccaatctc gaatccaagg aaatccgcgg     73980
     cgttctgcaa agcaagatcg gtcggctgtg gccgacgcgg gaggaattca aggacagctg     74040
     ggccgcagtt ctgcgcggca ccggcgttgg aacgatcctc ggcgttctcc cgggtggcgg     74100
     cgcgacgttg agcgccttca gcgcctattc cgtcgaaaag cgcatttcga agacgccgga     74160
     gaaattcggt cacggtgcga ttgcaggtgt tgccggaccg gaggctgcga acaatgccgg     74220
     tgcgcaggca tcgttcattc cgcttctgac gctgggtatc ccctccaatt cgatcatggc     74280
     catgatgctg ggcgcgatga cgatccacgg catcaccccc ggcccatcgg tcatccagaa     74340
     ccagccggaa ctgttctggg gtctggtcgc atcgatgtgg ctcggcaacg ccatgctgct     74400
     cgtcatcaat ctgccgctga tcggactgtg ggtgaagctg ctgcagattc cgtaccgcct     74460
     gatgtatccg gctattttgc tgttctgctg cgtgggtgtt tacagcgtca gcaatcgtgg     74520
     cttcgacgtg gcactggtca tcctcttcgg tatccttgga tacgtcctgc ggaaggcaaa     74580
     atgcgagccg ggtcctctgc ttcttggctt cgttctgggc ccgcttctgg aaacaaacct     74640
     gcgccgtgca atgctcttgt cgcagggtga ctggctggtt ttcttcgagc gaccgatcag     74700
     cgccgtcctc ctggtcatca cggtcgcgat gctgctgacg ctgatccttc ccaccattcg     74760
     caagaacaga aaagccgcgt tcgaagcgag cgaagactga cataaaaggg cgccgagagg     74820
     tgcccttttt cactgtcttc gaggcaaatc aaaaggcccc ctcggtggtc atcggtgaag     74880
     gctgaaaatc atggtttccg ctctttttgc ttcggcgggg catcgcttgc gcgatgtcct     74940
     atctcttgat gatttcgagg ttctggcgaa acgtcatttg ccggggccgc tctttggata     75000
     cattgccggg gcaagcgaga ccaatgcctc gttgcgcatg aatgccgagg cgttcaggga     75060
     cataagcctc acgccacggg ttctcagaaa cgtttcgacc agaaccacaa agacaatctt     75120
     gttcggcgag gaatggagcg caccgtttgg gatcgcgccg atgggtataa gcgccctgat     75180
     ggcctatcgc ggcgatctcg ttcttgccaa ggctgcgcag gatgccggga ttgccatgat     75240
     catgagcggc tcatccctga tacggttgga ggagattatc gaagctgcac ctcgatcatg     75300
     gtttcaagcc tatctaccgg gcgagccgga ccggatcgat ggattgatag atcgcgtggc     75360
     ttcggcaggc tacaaaactc ttgttctgac ggtggatacc gccgtactgg ccaatcgcga     75420
     aaacaatatc cgcgctggct tctcgacacc tcttcggcca agccttcgtc ttacctggca     75480
     gggaatgacc catccggcat ggacgattgg gactttcgca cgaacgatac tcactcacgg     75540
     catcccccat ttcgagaatt cgtatgcgac acgcggcgcg ccgatcattg cgtcgaacgt     75600
     catgcgagac ttcggcaaga aggatcatct gagctggggc catttcagcc gtatcaggca     75660
     aagatggacg gggaacctgg tcgtgaaggg gatacttcat cccgaagatg cagccatggc     75720
     cgcagagcgt ggggcagatg gtatcatcgt gtccaaccat ggcggcagac aacttgatgg     75780
     cgctatagcc ccgatgaaag ctctgcctgc gatagtggat agagtaggat cagacacggt     75840
     cgtcatgatc gatggtggta ttcgtcgggg gacagatatg gtaaaagccc tcgcgcttgg     75900
     tgcaaaattt gtgttcgtag gcaggccgtt cgtctacgcc gtggcggtag gttcaaaagc     75960
     gggtgtcgcg aaagccacca gcattctttc agatgaattg catagggata tggggctgtt     76020
     gggtgtgaca gaaattattg agcttccatc aattcttact cgcatctgaa atttcgttcc     76080
     gtcgccaaaa ctggaaaatg ggctctgttg caaagatttc aaatcgaaac gaaattccct     76140
     aacctacttc gtcaagcggc ctgactttct cggttctggg cgagcagtgc cgaggcttcc     76200
     gtgagagcgt ttggcccgat accgaaagta cgctcatcga tccttgcttc tccacaaatg     76260
     tcgcccgtca ggttgaaaat ggctgcctga cctttgcgca cagcgcgcat gacctcaaaa     76320
     cccttgatcg tggcgtaggc ggttttcagc gttttgaacc ctctcaccga tctgatcaac     76380
     tgcttcagct tgccgtgatc agcctcaatg acggtgttca gatatttgac ctgccggtgc     76440
     atgaactctg cggggtattt gcctttagtc ttcagttgcg aaagcgcgat acggtaggtc     76500
     ggtgccttgt cggcgttgat gacggtcggt gtctcccaat ccttcaggtc atttaaggct     76560
     ttgtcgagaa agcgcttcgc cgctttggca ttgcgggtcg gggaaagata aaaatcaatc     76620
     gtgttgccga gtttgtcgac agcccggtag agataagtcc atcgtccgcg aaccttaatg     76680
     acagtaccag cgtaccgccc aaaggataac ctcaccctga aaatggcgca cttgaaccga     76740
     aggtccacgt cgtttcgcaa acgcaggcac cggacatcga cgcttgcggc cagtgttgcg     76800
     gcgctggctg tgcccagcaa taggggtcgg ttccgctatc agtgcagttg ttcaaaagat     76860
     gctattgacc agcgcacgta catcttgctc cgaatagggc ttggtgagga atggcgcgag     76920
     ggtgagccga aagacttgtg ttgcgagttg atcaagcgtc atgcttgttt gcaacagatg     76980
     tgtcagatgg ccaatattgt tgaaatgggc aagtccatgc ggtgacagaa caagataggt     77040
     cgcaatggcg cgtgggtcag catcaatgat gtctccctca gactggcatt ggcgcaccag     77100
     tcctacgagg tttccaaagg ctgtccgttc acccttgcgg gcttcttccc attcacccgc     77160
     cagatttaca tcaaacatca cgcggaagaa gccaacgttt tccatggcaa aacgcacata     77220
     ggttgccccc atttgttcca gcctcgccaa tggaggcagg tcaggggcct caatcgtgcg     77280
     attttgataa agggccaact ggcgaaaacc ctcactcgac agttcggcga agagagacgc     77340
     cttatcggaa aagtggcgat agacagcggt gtggcttacc ttttcgcgca tggcaagctc     77400
     cctgaggctg aaggctgggc cgtcccgttc cacagtcagt tcaagtgctg atctaagcaa     77460
     atcctcacgc agatttttgc gatgataagg cttgtccgcc gcgacggcgg gaacagactt     77520
     tgcagctcct gccaaaggtt ttcgctcgct gcccgcgtta tcctcgatat gcttcatggt     77580
     ccctcttggg gcgatcgttt tttgatgtcg ctcgccgttt tctctactac gcgcgttcac     77640
     acaacacacc aacccttttt acgcagccaa cgcatgcaag gcaaaggcct gcttgactcg     77700
     ggctttgttt gctgctcatt atgtttacag tggaaacata ataatccata aaaaataaac     77760
     tcaaccgagt gggaacgaca atgaaaagct taacaagcgc ggaccggctg tcgcgcacca     77820
     tcagccgtcg cacgattgtc aaaggcgcgg gcgctctcgc ccttggtacg ctcatgagcc     77880
     cccatgtcgt gcgggcctca tcgggtaaaa tcaagattgg ctatatcggt tgtctgtctg     77940
     gcctgcgggc agaattcagc gttgccgatc tgtggaccat caaccagatg aaggcgctgg     78000
     tggccaaagg ccttgatgtc ggcggcaaga cctatgaggt cgaatttgtc attcgtgaca     78060
     atcagtcaga cgtcaatcgt tccgcaagcg ttgccagcga actggttttg cgcgagcgtt     78120
     gcaatcttgt gcttgtggcg gatggtgatg gtgccttggc aatcggtgaa ttggccgata     78180
     cgcggcgcgt gccggtgatt tccaccatga tgccgtggga ggggctgtat gcggcacggg     78240
     gaagcacacc cgaaaaaggt tttccctaca cctttcactt ctttccgtcc tctgcatcca     78300
     tcttgcaaaa ctatgtgggc atgtggaacg cggccggaac caatggccgt gtcggcacga     78360
     tctatctcga tcatgccgtg ggccgtgccc tgatggaccc tgcccacggc ctgcccgccc     78420
     agatgaaaca ggcgggcatg accgaagttg ccgccggggc ctttcagctt ggaacaaccg     78480
     atttttccaa ccagattgcc cgcttcaagg atggaaactg cgacgtgctg gcagggtata     78540
     tgttccagca acatttcgtc accttctgga atcaggtccg gcaggcggga ttgacgccca     78600
     aagtctgtac gtttgctgcg gcttttgcct tttcaagcac gatggaagcg ctgggcaaat     78660
     ccggcgacgg catgacaacg gatgtcttct ggacgccgag ctatccctat aaatcctcgc     78720
     tgaccggcat tggtgcccgt gatcttgcca atcaatggca aaatgaatcg ggcaaacagt     78780
     ggttgcagcc acttggctat atccatgcgc tgtgggaggt gggttttgcg gccttgaaac     78840
     aatcgaccga tccgcgtgat gccaatgctg tgcgcacctc cattgccaat ctggacattg     78900
     aaaccatggc gggccgggtg aacttcaaaa ccacgaccaa gaaaagtatt gccgatatgc     78960
     cgatggcggc cgggcaatgg cgctttgatg cggcagcgaa atttccgttt gatctggata     79020
     ttgtttacaa tgctctggcc ccggaaattc cagtcacagc acacctccgg cgccttcaaa     79080
     atgcataggt cgtctgaggc tcaggacaat gtcattctgc gcatcgacaa tctgaacaag     79140
     agctttcaag ccctccatgt cactcgtcag gtgacatttg atttgttgag cggagaatgt     79200
     gtcggcctca ttgggccgaa tggtgcggga aaaagcactc tgctgggcct gctttcgggc     79260
     agtctcaggc cggattccgg aacactcacg ctggatggtg ccaacgtaac cccgtttgcg     79320
     caattcaaaa gggttcgcag cgggattgcc aaggcaagcc agattcccca gacgtttgat     79380
     cgcctgctgg tgttcgacaa tgttcgggtt gcggcgctgt atggggctgg aatccgtgaa     79440
     aaggaagcgg cagactggac agcggatgtt ctgagccagt gtgggcttgg cgataaagcg     79500
     cggcgcgaaa cccgcaccct tggccttctg gatcgaaaac ggctggaact ggcaaaggcc     79560
     gtggccgcac gtccgcgcgt gttgttactc gatgaagtgg cagccggact gacggagcca     79620
     gaaattctcg aaatcgtgaa gctggtcgag cggttaaagc cgggtcgtgc gacggtttgg     79680
     gttgagcata ttccctatgc ccttcgagat gtctgcgagc gcctcatcct gatggatgcc     79740
     ggggccaagc tgctcgatgg tccattccac accgtctggc aggatccgaa attgcatcag     79800
     atctacatgg gggttcccga tggcaccact tttgacgttt gacgatctgg ttgtgcgcta     79860
     tggcgacatt cctgcgctgg cgggggtcag ttttgccatg gatgagggag aaacccttgc     79920
     acttgtcggg gccaatggtg ccggaaaatc aacccttctc aaggcgctgt gcggccttgt     79980
     tgatcgttgg gagggcggaa tttcgctgga tggcacagtg atcaagccgg ggcaggtgga     80040
     aagcaccacg gcacggggca ttgcccttgt tcctgaaggc cgcctgttgt tcaactctct     80100
     gaccatagag gaaaatctca agatcggaca aaccggccgc caaggccgct ggagtctgga     80160
     tgagatctac gcactcttcc cgatcctgca tgagcgacgg cggcaaaatc cgggtcatct     80220
     ttcgggaggg caacagcaga tggtggccat cggccgtgcc ctcgcatcca atccgcgcct     80280
     tttgctctgc gatgaaatct ccctcggcct gtctcccaaa gtgactgagg atgtgtatgc     80340
     ggctctcgca tccattcgcg cctccggcgt gtccttgttg attgtcgatc aggacattgc     80400
     gcgcgtgtgt tcacgcgcag accgggtggt ctgcatgctg aaaggccgcg tgagccatat     80460
     tagcccggca gcgggtgtga ccgcccatac gctgagagat gcctatttcg gagcggccca     80520
     atgaccctgt cggatatgct ggaattgtta atacagggtt tgacgctggg tggtctctat     80580
     ggcctcgtgg gtgctggcct tgccttgaac tttggcgtgc tgaaggtggt taatctcgtt     80640
     catggcgagt tgattacctg tggtggtttt atcgcagcct tttgcttgtc catggtgccc     80700
     aatatgcctt ttccgctcat tctggtgctg gcgatggctg gcacagcact ggtgggggcg     80760
     ggccttcagg cgcttgttgt cgagcgggcc atgacaacgc gcgatcccat ggtgactatg     80820
     cttgtcacct tcggactggg cattgttgca cgcaatgtga tggtcgagct tttcggcgcg     80880
     gacctgcggg gacttgatgt gggcggtctc agccatgccc gcctccagat cggtacggtt     80940
     tccgtgggcg ttttgccctt gatgaccttt gccttcgctc tggcggcctt tgcggtactg     81000
     catgttctgg tcaacatgac ggcctttgga cgcgcggtgc gcgccacatc ggatcggccc     81060
     gacattgcaa ggttgatggg ggttcgggtg cgaacactcc acatcaaagt cgcggccctt     81120
     gccgccgcgc tggccgcgtt ggcggggatg ttgctggcga tgcgggcgtc aatctcgccc     81180
     tattccgggg ttgaacgttt gatcgtggcc ttcgaggtgg tggtgctcgg cggggtcggg     81240
     tctattcgtg gagcgctgat cgccggtctt gtgcttggaa ctgcacaggt tgttaccgcc     81300
     cgtttcgatg gcaacgcggg cctgctttat gtccacctga cgtttcttgc aggtcttggt     81360
     ctgcgtgctt tccgggggaa actctcatga aactgcttgt tcagagcatg gctctggttg     81420
     ccgttatcgg ttcggtcgct tttttcgcca gcggatatat cgatcccgga ttgctctatc     81480
     tgctctctga ggccctgctt ttgctgttca tggcgcagat gtggaacctc cttgccggat     81540
     atggcggcat ggtctcgatg ggtcatcagg cgtttgtcgg gcttggagcc tatctgtttt     81600
     tcgccttggc caattttggc gttttgccag tgggcgctgc cttgccggtg gccgcccttg     81660
     ctgtagggct gatggccctg cctttaggcc tgctgctctt tcggctgcgc aacgcctatt     81720
     tctcggtggc gatctgggtt gtggccgaaa ttcttgtcat cctgttcagc aaatttagtg     81780
     cgctgggcgg aacggggggc atgacactgc gccccgacgg gggcaatctt gacctgccgc     81840
     ttgagcaata tgtctttgcc attgcgctgt ttagctgcgt gggcttcacg ctggccatgc     81900
     gctgggtgct ggccagaccg acaggccttg ccattctggc ggtgcgcgat aacgaggatg     81960
     cggcacaggc cgctggcgtg aatgtgcaaa aactccatct ggccctgttt gccatctcgg     82020
     cggcgggctg tgcctgggcg ggcagccttt actacgccaa tgttctttat ctgacaccca     82080
     cggatgcctt tcagatcaac tgggtgatcg gaatgatgtt cattgccgtg gtcggcggaa     82140
     ttggaactct cacagggcct gtgattggca cggtgatttt catcggcttg cgcgagtttc     82200
     tcaccagttt cggcttctcc ggcagcatct attggattgt catggggctg attgtgattg     82260
     tcacccttgt ttatgcaccg cgtggccttt ggcctgcgct gcactctctc ttcagacgaa     82320
     tgagcattga aaggaaatcc gcatgaatgc gtcgaacgat cccacaaaat ggacggcatc     82380
     ggaggccagt cttgcccttg ccgctaaaca gatcggcgct gtggagcttc tggatgccta     82440
     tcttgcccga caggccgctc tggatggtga gataaacgcc gtttgtgcgc tcaatccaga     82500
     cctcgcccgc acggttgcgc agcaggtcga tgcggatcgc attgcaggaa aaagcctgcc     82560
     aattttggca ggcctgccga tgaccatcaa ggattgcttc gacgtggtgg gtttgccgac     82620
     cacggcgggc attccggaca tggcatccta ccgaccgcag accgatgcgg atgctgttgc     82680
     aaatcttagg cgtgctggtg ccgtgtttta tggcaagacc aatacgccgc tcgcggctgc     82740
     cgaccatcaa acctataatc cgctgtttgg attgacccgc aatccccatg atctctccaa     82800
     aaccgttgga ggctcctcag gcggcgcggc agccgcattg gcggcaggct ttaccgcgct     82860
     tgaacttggg tccgacattg gcggctccat tcgcattcca agccattatt gcggcgtata     82920
     tggccacaaa tcctcatggg atactgtatc catgcgcggg catatgccac caccgcccgg     82980
     tcatctggcg aaaaacccct tgctggtcgc aggcccgatg gcgcgctcgg cacaggatct     83040
     ttctgtggcg ttcgagattt tgtcatccga ttgcaatcgc attttaaaac ctgcgcgaca     83100
     cagcgcattg gcggattttc gctttggcgt ctgggtcgat gacaatcctg tcgatcccgt     83160
     ctatgcatcg gcaattctgg attttgccga aagtttgcgc aaacagggcg cgaaagtcgt     83220
     cgaaataccc ggcggtccca gtggcgctga taggctgttc gatacctata tcaagatgct     83280
     gtttgccacg attggcagtg aactggatga cgatgaaatc gcgcgctaca cacaggctgg     83340
     caacgacccg gcaacaggcg aatttggccc acttctcgca ggcgctgttg ttgaaagcca     83400
     tcgcaaattt gtggaacagg cgcaaatgca ggcccgcttt caatcggtct gggccaagca     83460
     gtttgagacg ctcgacgttc ttctttgccc ggtttcaatg ggcacggcct tcccccacga     83520
     ttgcgacgat ggccatggcc ctgtgccgca gatgaaaaga acaattcaga ttggcaacat     83580
     aagccagcct tatctcgaca atttgcgttg gcccggcatt gccacacttt tgcatctgcc     83640
     agccacggtc cgcccgttgc cccatccggt caacggcatg cctgctggcg tgcagatcat     83700
     tggcccttat ctggaggacc gcaccacgct gacattcgca aagctgtgcg atgaggcctt     83760
     tggcagatca gaaatgccgc tcctgccgcg caaatcataa cagttcattc ttctaggccg     83820
     cacactcata aaccgggttt gcaaatcggc ctgattttga ttcactgagg ccttgatttg     83880
     gaggcctctc atgacccgtc gccggtttga tctcaccgat ttcgaatgga ctgtcatcca     83940
     gcccttgttg cccaacaagc cgcgtggggt gccacgggtt gacgatcggc gggtgatcaa     84000
     cggcatcttg tggcggtttc ggacaggttc accctgggca gacgttcctg atcgatatgg     84060
     tccatataca acctgctaca accggttcgt gcgatggcga aaggcgggtg tctgggatca     84120
     tgttctgggc gagatttcca aggctttcga cggcgatatc gttatgatcg acagctcctg     84180
     tgtccgtgtt catcaacatg cggccacggg aaaaaggggg atcaacacga tggctgcatg     84240
     ggacgttccc gtggcggctt gaccaccaaa atccacgccg ttgtcgacgc cgatggccga     84300
     ccgatccgtc tcgcactcac agccggtcaa gcccatgatg gtcgcatggc agaaccattg     84360
     ttacagacaa tctccaaggg tgcgatcctg ctggcggaca aggcctacga taccaacgcg     84420
     atcagagcat ttgcaaagca aaggcaggca tgggccaata ttcctgccaa gagcaatcgg     84480
     aagggaagct tccctttcag ccaatgggtt taccgacagc gcaatctcgt tgagcgtttc     84540
     ttcagcaaac tcaaacagtt cagaggcatc gcaacccgtt acgacaaaga cccattgaac     84600
     tttctcgccg ctgtcaaatt ggcagcagca agaatttgga tcagatcgtt atgagtctac     84660
     ggcctaaaag atgctggcga tgatccacaa cgaatgatca cccgggctcc aatctctgca     84720
     accaaaaggc cgatccctat ggacacttct tttgctttcg atcagctgcg tcttttgccg     84780
     gtctgggagg ccagcgtgct tcttgaaccc acgcaggtgc gcggccccgg acctctggga     84840
     gtccgcaata tcgtgcccat tgtcggcgga gattttgagg gcgtgatcgc gccagagaca     84900
     gacagccccc gccgcttctg cggcaccatt cagcccggtg gttttgattt acagcgagag     84960
     cgggccgacg gcatgctgga gctggaagcg atttaccaca tgctgacgga cgaccatgtt     85020
     tccatcgaaa ttcgcaatta tgcgctgctg gaaccgaagc tggacgggtc tatcggctat     85080
     tcacgctgcc gcatcttcgt cgatgccccc gatggggatt atgcatggct caatcggcga     85140
     atctttaccg gctctgtcga agtcatccgc ccccaaaagc aggtcttgat ccgatccttc     85200
     acggtcgtct agcgattcca gcggcgtacg ctctccttca ggctgcgaaa atggccaacg     85260
     cggagaacgc cccctgaatg cggcttgggt aagcgggtaa cgcaagtacc aggcaactgc     85320
     ctgtacaata agccaagcct cgaaatgcct gcctttgaaa tcatctttcg actggcgctt     85380
     cagcttctcg gcaatggtat tcagaatcat ggctcgctcc gcaactttcg gagcggcaaa     85440
     ttccatacct atggtcaaca tgcggttaag cccgaaaatt tgcgacaagc ccggctatgt     85500
     attttcggct tcaattagcg aatagcaaaa cttgccacga atactaggca aattgccgag     85560
     gcatacttaa acagcacgtt gtttgcgcca gattgcctta agaagtattg tcgtgtatat     85620
     cctgaagtca gaaccaacga aatatcaaac aaaaacgcga ttataacgaa agtaaccgca     85680
     agaaagctgg tttgcacgaa ataaccttgg cttggatcaa taaacgtcgg gaggaacgcc     85740
     gcaaagaaaa gtgtgacctt gggattcagc aatgacacga tgacgccttg gcgaaagaat     85800
     tttgtctggt cggagtcaat ttgtgttgcc gatgatgcac caggggagac ggccttatat     85860
     gcaagaaata acaaataggc tgcgcccaaa tatttcacga cggtcaacga cgcaggaatt     85920
     gtcttgaata tcaatgaaag ccccacagcg gacgcaagcg cattcgccaa tgcgccgaca     85980
     gcgatacctg atgctgataa gaagcctgcg cggaagccac cttcgacggt tcgggacaga     86040
     atgtagataa gcgctggtcc tggaatggcg atgatggcga ggcacgcacc tacgtatatc     86100
     caaaggtttg tcatagagtt agcttttccg aggttctaaa gtggattcaa aagagagaac     86160
     gtttgatgca atgatgaatt gcaggtgact cgcaaaatcg tgcatcaaag tggccctgga     86220
     aggaacgtat tgcttgatgg ctatgatgac ggcgaagtaa aggtgctcgt cgcgagctgc     86280
     ttgcgacatc ttcacgagga ttgtgaccgg tggttcgcct tttttgcccg tggcatgaag     86340
     gaaaagcagc ccatcagcac cttctttagc aaacagccgc cctttgccaa attgaaggat     86400
     tgtcgtatca acgcggttac ttccaccaat caaaatggga tttgccgtcc acaactcctt     86460
     gatcgcttcc atcgcactag catttgaatt ggaaagagca ttccaaagcc gcgcatgctg     86520
     gtgcatcggc gcaacccaac aaggcatgcc gcaactatca tttacccaat atccatcatc     86580
     gccagcgagt tcagaaagcc acgcgcgtag agctctatgc ttgatagatg aaaccagagt     86640
     atcaatttga tgatattctt ttgaatcaag tgtgtagcga tcaaacatat atgtttcgag     86700
     cctgtttact tgacgccgga gattttacgg tttggtccat gatcgtgcgg ctgtacaaag     86760
     cctaggacag tgcgggaccc cgaaatgaag cgaagcaacc gctcaaagcc gataccaaat     86820
     ccagccgttt gaattttgcg ggtacgtttc cactcagcgt gaccgtgagt gagagtgcct     86880
     tctggttcac caagattgcc gactgactgc gccagtattg catcaccagt tttaggacga     86940
     acgccgcccg tagagatctc gccgtaaccg aacggcaaca tcagatcgta ggtatcatag     87000
     ttgccctcag cattctcgtg gtagacagca tcgcgtacac ccttcgggta gttgtgaatc     87060
     cagaatggac ggtcaaatag cctgctaagc gcttgatctt cctcaaaggt gaggtctgtc     87120
     tggcgggttg ggtcagcatc gaccatcttg agcgcttcag caaaggttat ccggggataa     87180
     ttgccgagca tcattgcttg tatgtgtttt tcagcgtctg ctgtattcag atcgataagg     87240
     gactttgctt tattaagaag acggcttgca acacctacca gaagcttttc ggcaattccg     87300
     aacacaactt ccatcgactc agtttttaat tcgacttcga tctgaaaaaa gtatttaagt     87360
     gctttcgcga ttgcgcttca ccgtcttgca gaagacgcat acacggtgcg aggcaatata     87420
     ccatatccag atattcagtc gcttgttgct tttcaaagtt atgactaact ggcaggtaat     87480
     aagcctcttt gcccgttacc gatacttgat gctcgacatt cgcttgaaat gagatttttt     87540
     acctctgggc ggaaacgatc accaataact gcataggaat gaaaagcacc tggctcaagc     87600
     tcactagaca aaatggcagg aacgatttca ttgaaattga gctcgtccat tgtcgagcga     87660
     accgccgata gaacaatggt cgtccattgg tatgtctgat tatccgtaaa ccgtctcttt     87720
     tgctcaatca ttggcaggat agctcccgat aataggttgt taaaataaat cgacgccctg     87780
     ataagatgca atctttaaag ttgtcaagca acataaagct cgaaaaggtg tgcttgcgta     87840
     gattgaatag attttgctca aaatcagaat acaagcaaga gttgccacgg gcgctggtgc     87900
     atcggtcgta gtgtgactgg atttcggtct tcgatgatgc ggctatgcgg tagcttttct     87960
     acaccgacgg atttcgagtg cgcgcaggcc agcatgcgat tgcggacggt ctcgttgact     88020
     ggggggatcg tcgtgctggc gttccaccgc attggcgggc agcgggataa ccacagcagc     88080
     atcggcgctg tggcttggga cggtgtcgta gttcgtctca ccgtcatagg ctccatcagc     88140
     cgtgaactgc cagatcggca tatcgatctg ctcgagtagc ggccccacct gcgaaccgtc     88200
     gccgacctct tgattgttca tgacgtgtgc gatgatgtcg ccagtgttgg catccagcgc     88260
     caggtgcagt ttgcgccaac ccctgcggaa tttggcaccg tgcttttcct ccagccactg     88320
     ccccgcgccg tagacctaca aacctgtgct atcgatcacg aggcggacag gctcttttga     88380
     gggatgcgat catcgtactt cttatccggc gcgcgcggct tgctgccacg acggctcagg     88440
     atcgtgtgat cgggaacggc gagatcaagg ctgatcaact tcagcacaga ggtaaccaag     88500
     tcctccgtat gacgcagacg caggccgaac accaacccca gcgtcagagc ggtctcgatc     88560
     gccagatctg aatagtgcgg ctggccacca cgcgtcctgc gcttcggtgc ctcccagcac     88620
     gataaggcat ccggcgtcat tcagagcgtc agacttccgc accgacgaag gcctgcctcg     88680
     tactcaggcc agttcgtcaa cttgaacttc acctagttga tatgatagcg gcgagaggca     88740
     ttgtgtttga agggcatcgt gctggagacc agctatcggg cgggcccagc atctatgata     88800
     ccgcgtttaa cattcatcca tgcaccaact ccaccttttg gctatttttt tatgtttaca     88860
     acttgcagga tgattcgatc catattatgt gacattttta tgacaaagca tttatttaga     88920
     gttgcataga tgaatttcga agccagaagt tcaaagcatt tcgaccgcgt gtctcctaaa     88980
     ggttgctttg ggcagcaaaa gcaagacgca ggccccttcg cgtttgggac gaaaagtgaa     89040
     acactattta aaatcaataa aatatcaaag aattttacga ttctaccgat agcggtcgtg     89100
     caatattcgg actggcagga agatagggat cgcacggcac gcaaggtttg gtcagacctg     89160
     gagatggcac agacattaat tgtgcgctca agctgcgccg tcgaagattc cgaagtcgcc     89220
     tcgcacgccg gggaattcct ttctcttctc aacatcaaaa gcctggcgga tttggatcgc     89280
     gccattgatg acgtattcat gtcctatggc aaaccaacac cgggtgagca ggtgcttgtt     89340
     caacccatgg cgcgtgaggt tgtcttgagc ggcgtcgcca tgactgcgga cgcccaaagt     89400
     ggtgcgccct acacgatcgt cgactatgcc cacggagccg acaccgaagc cgttacggcc     89460
     ggaacatcaa actcgggcat ggcgatctgc gtgacgggct acgaaagcca tctgccgcct     89520
     tgcttgcaac ctttggcacc cgctcttcgc gaactggctg agatcacggg cggcaagcct     89580
     gtcgatatcg aattcgcgat taccgcgaca gggaccgtca tcatcttcca ggtgcgccca     89640
     atcgtgatga aatcaccaag gcataaggtt gtcggctttg gtttcccata tctgatcgag     89700
     aacgtgcgac gttgctataa agatatcgtc aaattcaatg cgcgcaacgg gctagcgaat     89760
     gccctgtttg gtgttatgcc ggattggaat ccagcagagt taatcggcat caagccgcgt     89820
     cccctgacgt actctctgta tcgatatctg attacagatg tggcctggac caaggggcgt     89880
     gcgccgcttg ggtacaccga catgagcggc gacgggctga tgcgcctcat cggcggaaca     89940
     cccttcatta atgtgagtgc tagccttagt tcatttgtgc ccaaatcggt acctgcgctc     90000
     atacgtagca acatcgttgc agatgcgtct cgcgcgctgg cagcagcacc gcaatttcac     90060
     gacaagattg aattcgagat catgccaacg gtgttcacgc cggacttgac gcagccccac     90120
     tggagggctc gctttccgac gcggagtggg ctgggtattt ggaagatctc ctgaaactca     90180
     ctaacggcgt cgtggccgaa ggcggtgcct atgacagcat catggccgac gtggtgcgtc     90240
     tggaagcgat gtatgagcaa aagagcgatc ttaagtctgc aaacctgatg gacgccacac     90300
     ggcttctgtc atgggtgcgg cacaacgcag caccgttgtt ttccggcgct gcgcggtcgg     90360
     catttattgc gacttctatt ctgagggtcc ttgcacgtac cggttatatc cacgaagccg     90420
     tgattgagga tatctcccgt agcgcgcagg cgattggttc ggaactggtt cgcgatttcc     90480
     agagactgga gcgcgacgtc ttcatggcgc gatacgggca tattcgcccg ggaaccttcg     90540
     acatcaccgt gccgcgatac gatcaagaac cggagaagta tttttcattt cttgatgcca     90600
     cccaagcgca acccgacgtg cgagacacag gaagctttgt agagctttcg gcgagtgaca     90660
     tcgcgcggat tgatgcgcat ttcgccgcgc ttggatacaa ctttaactgg gcgcgcttcc     90720
     gcacttttgc agcgagtgcc attcatgcgc gggaatatgt aaagtttctc tacacaaaac     90780
     aggtttcaga tgcgcttgaa atcatttcga atgtcggggt gcagtacggt tgcaacaggg     90840
     aagagatgtc gtttctaacg ctctcggata tcgagaacat gctcgacttc acatccgaca     90900
     tagaccggcg gatccgcgaa atctcggcgt cgaaccgggt ctcgtggcag cagagcctgc     90960
     cggtgcgatt gcctgatttg ctgacctcac ctgacgatat tttcggtttt gaggtggaag     91020
     cttcggcacc aaatttcgtg acctatgaaa cggttcaggc cccggtcgcg ctgtctctcg     91080
     acaatgacct gaggggcaag atcgtgttca tcgaaaccgc tgatccggga tacgattggg     91140
     tgtttactcg aggtattgcg ggtttcatca cgcgatatgg aggcgagaat tctcatatgg     91200
     cgatccgtgc tcgtgaattc gggattccgg cggtggttgg ggccgggcgg cattatgaca     91260
     aatggaagac cttttcggtg ttgcggtgtg attgccgcgc ccgtcgggtt gagccaatca     91320
     tatgagccgc tttgtggcaa tcaccatgcg tgacgccgtg ttgcctgagc ggaacgagca     91380
     ccgggactgc cttgaaaccg ggtggtggac tttcctggag gcctgcgagt ttgtgccagt     91440
     ttgtctgccc aaccatctcg ggcaagcaga actcattctc gacagcggta tcctgagcgg     91500
     tgtgatcctg agcggtggcg gtaatgtcgc gcgctcactg gagcatgttc gggcccggga     91560
     cagagttgaa gatatcgttc tggcccgcgc gaaagagaag gggctcccgg ttctcggggt     91620
     gtgccggggt ttgcaaaaac tctgccacgc gtttggcggg actcttgtgg agcgtgcagg     91680
     ccataccgtg accaggcata ggattgcggg caactggggg gagcgctgcg tgaattccta     91740
     tcatgactac gggattgatg aggtgccgag ccaatgccac gttttggcag aggcggagga     91800
     tggttcgccg gaatggttgg cgcatgacag cctgcctgta tcagggatca tgtggcaccc     91860
     cgagcgcaat gtggtgccgg atcaagccga tattgccttg ttcagggcta gattttcaac     91920
     cataggatgc tattaatgcg cgccatcatg cttgtagccg gtcgaggttc acgacttcgt     91980
     aatcttacgg acatgcgacc gaaatgcctc gttcctttcc ggggcaggcc gcttctggag     92040
     ctttcagttg agcgcctgaa ggcaggcggt gtggaaaaat tcacgtttgt ggcgggatac     92100
     cgttccgagg caatcgaggc gttcatcgag acgcatgaga ttgatgccga agtcgtcttg     92160
     aaccgtgatt gggacagtac gaacatggtg caatcgctgt tttgcgcggc ggatcgtctg     92220
     gcggcggaac cgtgcatcgt cagctatggc gacatcttct ttgaaagtgg cattgtgcgg     92280
     aatctcattt ccgcccaggg cgaccttgta ctggcctatg atcataatgg ccgtaccctt     92340
     tgggagcgac gcttcaagga cccactttcg gatatagaga acttccgcat tggtacggag     92400
     ggacgcctga tcgcgattgg cgggagggtg caagatatca cgacggtgca gggccaatac     92460
     atgggcctat tcaagcttac gccgaccggt ctcgccgaga tgcaggattt ttgcgcaagc     92520
     cttagtgcag atcgtcgccg ttcgatcgat gtgacgagca cgttctcggc tcttctgggg     92580
     cgcggaacgc tgattcgatg cgtacccaac ctcgatccgt ggggcgaact cgactctccc     92640
     gaagatattc acttctttga agcctccacc cccctcaaca ctcctgcttt agaaagatct     92700
     tactgatgga tcccgcactc tggctacttt tcgcgcttgc ctatctcgga atcacctttt     92760
     cgcccggtcc taacgtcctg atggttctga accatacggc aaaatatggc tatcgccacg     92820
     ttttcgtgac aatggccggc aacctttcat gccagctttt gattatcgtc gcgattggtg     92880
     tcggcatcgg ctcgttgcta actgtagaga gcgcagccta ccactggatg aagattgcgg     92940
     gcgcacttta tctgatctat ctcggcgcgc gtatcgttta tgatgttttt atccggggtc     93000
     ggctgaaagc ggtaaaagca ccgacgcagc tgaatcaggt gcatgcgctg ccctcggcgc     93060
     gcaaacgctt tcttgaggct ttcgcggttt cggccagtaa tcccaagacg gtgatttttc     93120
     tatcggcgtt cctgccccaa tttatctcgc cggaatggcc aatcgtgccg caattcgcaa     93180
     tcatgtatct gacaatcgcg attatcgtca tctccgtgca ttatatgtac gcgttcttgc     93240
     tcatcagagc tcagcgtcgc ttctcaggca tgttttccag ccgtttgttc cccgggctca     93300
     gcgccgcgat ttatctcttt ttgggagtca cgttgggggt ttctgcgtga atttggggga     93360
     cgataaacga ggggaaagcc tccgggtttc ggatgagccg ggccatatca ccgctctgat     93420
     gcgagacccg gccaatgccg taacgttggc gggactgggg tttgccgttg ccgggcttca     93480
     tgcgtcagtg gtgggcgagg tgcatctcgg agctgcatgt ttggctctgg ccctgttcgc     93540
     cgacatgaca gatggctggg tcgcgcgtcg ttccgggctg cgccgcgcgg ctcatatgtc     93600
     gcgtgcgggt atgcaactcg actcgattgc ggatctgatg catggagcga tcctgcctgc     93660
     ggcgctcatg ggggcgttga gcgactggag cgcgatcagc ctattacttt ccgtgcttct     93720
     ggcgctatgt gccgcgacac ggctaacata tttctctgtg tttggcggca atcctgacgg     93780
     cagctatcgc ggcgttccgg taatctacac atcgttcttg acgagtcttc ttattgggct     93840
     tttgccgatg ccttttgccg cgcaagtatt gccgtggtgc atcgccacca ttgcagtatt     93900
     caacgtgagc tccctaaggg taccaaaaat gacgggagga gggctggcag cgttcaatct     93960
     actgtccgtg ggcgtcgtta ttctcaatct gttgaagagc attacctgat gtaggccata     94020
     cgcaattcac cgtgtactgt aaacttaaag ccttgatgcg gcatcgtaac gttaaccaga     94080
     catcgatcaa atgtgggatc tggcaggatg acgagatctc gccgtgatcc tctctatcgt     94140
     cggcatcgat ttcccgcgga attgattgcc catgccgttt ggctgtattc cggtttccgc     94200
     ttagcctgcg tatggttgag gatctgcggg cagtgcgtgg catgacggcc gcgttcctgc     94260
     aggacaccac cgaaacgaaa tcctttgcca tttggtaaca aacgcccgta gggcattttc     94320
     cgatgcattg gtgtgcagcg ggatgtcggg atgttcccac gcccacccac gagctgacaa     94380
     tcgcccttga agtcctgcgg gttttgtcgc aaattttctg gccgattacg gaagtggcta     94440
     tagctggaca cagttatgtg gcgagtgccg agaactgttg aaatggcgat tggacgctgg     94500
     tggaaaactg tttcttgcgg atcatatgtg cgacttcgat gccgtccagt gtcgctgatg     94560
     cggactgaaa gcgtttgaag cccttcattg gcctggtcag tttcttaata aagcggtgat     94620
     cctgctcaat catgttgttg agatatttga cttgcagaac ttcgatcagc cagaaccagc     94680
     catgcaatag cagcagaata ttcatgtttt gcagccctgc caagttcgcc ccgcttttgt     94740
     cgatgacaac cttttcgggc caaccattgt tctcgatggt gcgggcgaag aaatcggtag     94800
     cggcggcctc atcgcgatgc tcggatagca tgaaatcaag ggttttgcca tgcttgtcaa     94860
     cggcgcgata aaagtacatc cactggcctt tgacctcgat gtacgtctca cccattcgcc     94920
     aggagccgct gggtttggat ttccggcgct tcgcttgcag ggcaatcagc ggcgcgtatt     94980
     tcacgaccca tctattcagt gtcgcgtggt cgagattgac cccgcgttcg gccataatct     95040
     cttccaggtc gcggtaggaa actgcatatc ggacatagaa aaataaggcg tataaaatca     95100
     cttctttcgg gtagtgactg cctttgaaat cgaccatgat cgctcaatcc tacctgcctg     95160
     ctttcgtcag gccacatcta tcggcgttgt tgcatcgatc gatgactgag cggatttcag     95220
     tctttgatgc tgtgtttatg cggtatctgt ctcgcaccgg acggatttcg ggcgcgcgca     95280
     tgccagcatt cgattgaggc tggagcagtt gatagcgact tccgtctgtt gcgtggcgaa     95340
     tgagcgtgcc ctcaatcgat gtccgatgat cgacttatag cgaccgatcg cggtctcgac     95400
     caaagatctc ttgccgtagt cggtagcggc ctgccatttc atccgcccat cggcgttgat     95460
     cgccgcgata tgatggtctc gttgagagaa gagatcggcg tctggctgtt ccaccgcatt     95520
     ggcgcgtggc ggaatgacca ccgcagcgcc cgcgctacgt ttggtaacgg cctcataggt     95580
     tgggttgccg tcataggcgc catcggccgt aaattggccg atggggtcgt cgatttggtc     95640
     gagcagcgcc tccacctgcg tggcatcgcc agcatcctgg tctgtcatga cgtgagcgat     95700
     gatttcgccg ctgtcggcat ccagcgccag atgcaatttc cgccatcgcc gacgggactc     95760
     ggcaccatgc ttctcttcca gccgttggcc agcgccatag atctccaaac cggtgctatc     95820
     gacgaggaca tggacgggcc cttttcctgg gtgtcaatga cattgccgtt tgtccggcga     95880
     ttgccaattt tttgcccgac ggcttagcgt cgtatggtcc ggaacggcga gatccagtcc     95940
     catcagccgc agcactgaca tcagaaagcg ctccgcctgg cgcaggcgta agccgaatac     96000
     gaggcccagg gtcagggcag tctcaatcgc cagatcggaa tagcgctgct ggccacctct     96060
     tgtcttgcgt cgttgcgccg cccaaccgtc aacaacctcc gacgtcaccc aaagggttag     96120
     actgccacgt tgtcgcagac acgcatcata ctcggcccag ttcgttacct tgaacttcat     96180
     cttgccgatg cgatgacggc gagcggcgtt atgtttctgt ggcattgatg atcaatcaag     96240
     ctgttttcga tcgcagccac ataggcgaga actgttggaa tttggtccgt gcaccaacgc     96300
     caaaataatg cacaactaga tgccgggatc aaacaccagg atcgttggga ttaaacggtc     96360
     aaacggaaat ctgatcctct ccggttttta tggggcaact caacataggt gctagttctg     96420
     gtcttggcct gagcaaaaat ccagtccttg aacatcttga cggcgtttga ggccggctgc     96480
     aggggtgaaa tgagataata aggattgcga attggataag ggtcgcccaa ccggatcagt     96540
     tctccagttt ccaaggcacg ctcaatcaga atcgagcgcc caagcagcgc ccccattccc     96600
     gctttggcag cctcaatcgc cgggccagcc tgattgaagc gcggcccctt ggcgatatcg     96660
     ttgcggctga tgccatattc acgcaagtaa cggtcccaat cgggatattg accattaatg     96720
     ctcgccttgg cgcggtccac atgcacaagt ggtaactctc gcaaggagtc aaagctcaac     96780
     tcaccaaact cctcagccat ctgaggcgag caaacgggga taatatcctc ttccaatagg     96840
     agttccacgc gccgatccag attggtgtgc cagttgcaga tccagacatc ggaggtgtcc     96900
     gtttcaatcg ctgaacgctc aatgaaggtg gtcagcgaaa tatcaatttc tggcgctgta     96960
     cggtaaaaat tccgcaatct tggcatgagc cacaaagagc caacggaggc tgatgcgcca     97020
     accaccagac gctccggcat gtccatcggt ttgtgaagtg cggcaattgc atcgtctata     97080
     atgtccagtg cttcggtaag tttggcaagg caagcacgcg attccggcgt tagctccaga     97140
     cggctgctgc ggcgcagaaa cagtttggtt tgtaggaaat cttcaagttg ccggatctga     97200
     tgactgaccg ccgtcggcgt cacacacaat tcgtcactgg cctgcacaag gctcatgcgt     97260
     cttgctgctg cttcaaaggc ccgcacggag ttgagaggta cacgtcttct catgccaacg     97320
     tcccctattg attgtcctcc caatcaaaga agaccatgag cgcagaagaa cggcaagtct     97380
     aaaaattgat caaaatcaat attgttcaaa atataggcat aatgcaactt actcggcagg     97440
     ttgtgccgtc gcgataggct gtgcagcgct atctggtgcg ggacgggtga gatcgaaagg     97500
     aaaattccgc cgcatcctgt ggaaatagaa aaacgcaaaa gccgtaccga tgcagcacag     97560
     cacaccattg gtggatatgg cagcgggtac gccaaaatgt tcggcgagca cccctgtcat     97620
     catcgcccca atcggcgatg agccggtaat cagcagatgg accatcgatg caaagcgccc     97680
     gcgcatctcg ggcggcgatt ggatctgcaa tgaaccggcg actgatgtgg aaaaggtgac     97740
     tgctgcggca cccaccagca aaaacaacag gcagctgaca atgagggagc cacaaaaggc     97800
     aatggcaatc agcaccagac caaagctgag accggcaacc aggatcagcc caacggttgg     97860
     ctttctacgc cccgtcagca taaacgcgga gaaaaatgac cccataccaa ggctggagtt     97920
     taacaggccg aattcggcag cacccgcatg tactagataa ttggctgcca aggggacaat     97980
     ggtcgtgaag ttctgtccga acatgccaat aaaggctgtt gcgatcagca gaaacagaat     98040
     gctcggggtt ttacgggcat agctcaaccc ttccgcgatc tgagatatca tagtgtaacg     98100
     gccgctgaac cggatgggtt gcagatctgc ggcgcggata gatgccagcg caaagaggat     98160
     cgtgctgcaa gtcaccgcat tgatcaggaa cgctggccct accccgaaag ccgcaatcac     98220
     cacaccgcca atggccgggc caatgatgcg gccaagattt tgcatcattg acacaagcgc     98280
     aatggcattg ccaagccttg gcacatcaac cagttcgctg acaaatgcct gccttaacgg     98340
     attatcgagt gcattgatca cgcccaggct gagagccaaa agatagatat gccagagcgc     98400
     gatcgtatct gtcatcacca gcacacccag caccagggcc tgcactgccg caaggctctg     98460
     ggtaatggcc atcagccggc gtcttggaaa ccggtcggca accacgccgc ccaccaatgc     98520
     caatagcatg atcggtagga attgcaggga tgtgaccgtg gccagcgcga gcgaggaatc     98580
     gctgagtttc aacaccagcc aggcctgcgc ggtagtctgc atccatggac cggcaagaga     98640
     caagagcaga ccgagataga agatgcggaa attgcggatc tgcaaggctg gaaaacggtt     98700
     tgccagcatc aaacggagtg tcgtgaaagc cattggcgcc gtcagaccgc tgcgctcatc     98760
     aggtagctat ccggtcggcg gttggcatgg aagtcccatc tatcccgaat gagctgctgt     98820
     ctttgcagat cgatgtcagc caccaccaat tcgtctccca tggttttggc cttgctgaga     98880
     agacgtccgt ccgggcctat caccacgctg ccgccgatgt agcgtaaacc gccttccatg     98940
     cccgctttac ccgccgcgac cacataggtg ccgtttgaat aggccccgcc acacatggca     99000
     agttccgagg catggcggct tgcggacagc gtgctggcgg gcatgacggg cgtgttgtaa     99060
     ccaatacaga tcacatctac gccctgcaaa aacagcgagc gataggcttc gggaaatcgc     99120
     cgatcatagc aaatcaatcc acccagcttc cagggttcac agtcatgcac agcaaagccc     99180
     ttgtctccag gtacgaagta gcgcttttcc agaatggtga cttcgccact ttccttctgc     99240
     tccacgaagc ctggaatatg cattttgcga aaggtgccaa catgctcgcc tcggctattg     99300
     atgaaggcca tggaattgta gatgcgattg ccgttctgct cggcaaacgg caggatcacc     99360
     gtcattgcgc aatcgcgggc cttggttgtt attgccgaaa ttgctgcatc attctcctcc     99420
     ttgtcggcat attgagcagc gcggtcatga atcgtggcag caaaataagg cgtgagcgcc     99480
     agttccggca acaccgccag cgtgattttt tgctctgccg ccttatccag caaggttaga     99540
     atgcgggcaa gcgtggcttt gatcgtggca cttgcggggc caagctgcac ggcggcggcg     99600
     cggaaggtca tgatggcatt ctttccagca aaagcatttc cagaagaagc gggaaccagt     99660
     tttcctctgg agagacataa acgaaagaaa gagcatttcc gcgtttccgt gaaaagttga     99720
     aatgctcact gttgaacatg gagatcaggc agcctggatt ttgcgtgcac catgactgct     99780
     aaactggctc aacgcctcgt cttcgctgat cacatcacag attttaaact gcatatcgaa     99840
     caaggcggcc gcatgggaca tttcgatgcg atcaaacacc gcctcttcga tgacctgaat     99900
     tttataacca agagccgtac catccacagc ggtggcccgc acgcagccgc tggtgctatt     99960
     gcctgccagg aacagaccgt cgacattcag attgctcaac atcaaatgta ggttggtgaa    100020
     ggcaaaacag cttggggtct gtttttccac cagaagatcg ccagactgca tggcaacctc    100080
     tggcggaata tcggattttg cattgcgggc gctgaagtta ttgtcggacc gcgcttcggg    100140
     aaggccactg atgtcgtaga atacatgctt ggagtaaatc acgggcatct gcgcggcgcg    100200
     tgccgccgcc agcaagcgtt gttgcaccgg tatggctttc caggcgtgag gaccgcaggc    100260
     acccgagtaa agatcaagct gctcataaat cggcttgtcg agaccgcagg ccgtgacctg    100320
     catatcaatg atcagcaggg cattgcgacg gcccggtcca ttcaatgggc gccgcgcacg    100380
     ccgcgccacc acaagcttgt catcgtcagt cagaaatcga tcccacacag ccatgcgcct    100440
     gtcctctttt ccttacaact ctgcgcgacg gtagaggcaa gcgacgctat tggcgattgc    100500
     gatttcctga tggtggtgat gagaaatgtt cagcctatca ttttcacgcc tacctgtttt    100560
     tagggtcatc tcttgcgggc atgagttttt ctcaaggtgc agcttcgaat tcgtcgcttg    100620
     gcattgcacg caagccgttc aactcttgct tcataacaac agaagagagg aacgcgctta    100680
     tgacgaagat cggagtcttc attcccatcg gcagccgcgg ctggcttatt tccaccactt    100740
     cgcccgcaac catgccgagt tttgagctca acaaggcggt ggtgcagcag gcagaacatt    100800
     acggcctcga ttttgccctg tcgatgatca agcttcgtgg ctataatggc ccgagtgaat    100860
     attgggtcca taatctggaa tccttcaccc tgatggccgg cttggccgcc gttaccaaga    100920
     aaattcagct gtttgcatct gtggccatgt tgaccatgcc gcccgcagtg gtggcacgca    100980
     tggcggcgac gatcgattcg attgcgccgg gccgctttgg catcaatatg gtcaccggct    101040
     ggcagcctaa agaataccag cagatgggcc ttgagctgac acccgagcat tttgcccgcc    101100
     gctatgacta tgcctcggaa tatgtgcagg tgatgcgcga tttgtggacc aagggcgtct    101160
     ccaacttcaa gggcgagttc ttccagatgg acgactgcaa gctgtcgcca cgtccatccg    101220
     cccatattcc agtggttggt gcgggccagt cggaacgcgg catgcggttt gtggcggaat    101280
     atggcgacta caacttcatt ggcgctggcg gggatatgaa ccagaccgat ggtgcccgca    101340
     ccatggtggc caaggtggaa gccgcggcaa agcaaagcgg acgcgacacc ggcgcctttc    101400
     tgcttttgat ggtgattgcc gaccgtactg acgagttagc ctttgcaaag tgggagcttt    101460
     acaagcaggg taccgacatc gaagcgctgg aatggcaggc cagtcaggcc gggcaggata    101520
     cggtggccaa ggaaggctca acggccgccg ccctggtgcg ccagatcaaa aatccgcagc    101580
     caaccggcat gctgaagctg atcggctcct atgaaaaagt cgcggcaatg ctggatgaaa    101640
     ttgctttgag cactccaggc ctgaaaggca tcatgctgac ctttgatgac ttcgtcatcg    101700
     gcatggagca gtttggccaa tatatccagc ccttgatgcg ttcccgcaat cccaacctca    101760
     aacgcaatct ggatgcagcg tgaggtgaac agatgcttag gttctgtcag gttcaggttg    101820
     aaccagacag aacctagttt tgtgttttcg tgtgtctttt agggaaaacc ggtttccact    101880
     tttccctgac aaactctaca gcgccgtgcg ccttatatag cgcacaaagg ttcgctgtag    101940
     cgctttatat ctgctgcata attttctctt taaaccgatt ccggtttaaa gaattatgca    102000
     gtaagcgccg tgccttgctt atgcggcacg gcgctttttt gtggaagaca gctattctgc    102060
     cgccatgctc tgtcggtttt gcagggctgc acccaacaaa tcagcgtagg cgatcacctt    102120
     gcgatcctga tagcgctgcg ctgtcaggga cactccgacg ggcctgccat ttggcccgta    102180
     taggccggga acattgacga caggcacctg catcaacgtc catatcgaat tgaatatcgc    102240
     atctccggtt gtctcaatcc cccttggcgc ttcgcccgtg gaactcggcg tgaggatcac    102300
     atcataggac gcagcaatgt cgtcgaaggc ggcacggcat tgatcggcca gccggtaggc    102360
     atcgcgggcc tgagatgggg tgatggcctg gcgattttca acaatggctt tcagttcgtc    102420
     gtgaaggtcg ggtgtcgcat tcgcctcgtt gaggaaggcc gagcgcccct cacggcgcaa    102480
     aatgatatgg tgggcggcca gaatgccatc gaacatcgcg ggcaaggcaa tatccgaaac    102540
     cacggcccct gcctgtttca gggcatcgat tgccgtgttc atcgcctgtt gcgtggcaag    102600
     ctctgctttt ggccaggccg gtgagaggca cacgccaatc cgctttccgg caaggtcatc    102660
     ggcaagcgcc gtttccgttg catcaagcgc aaaaacatca gccagaaggg caagatcatc    102720
     agccgagcgg ccgtaaaggc caagggtatc gcaggtggcg gaatacattt tcaacccttc    102780
     ccggctgatt gcattccagg ttggtttgaa cccgtaaatc ccgcaaaaag aggcgggtcg    102840
     tatggtggag cctcccgtct gggtgccaag cgccaatgtg gcctgaaaat cggcaaccgc    102900
     tgcagccgat ccactggagg acccgcccgg cgtgcacgca agatcgtgcg gattgcgtgt    102960
     cacgcttccc cggtttgttg tggcaaattc ggtcgtgact gtcttcccga tcaacaacgc    103020
     tccggcttgg cgcagggtat cgacgcaggc ggcatccatt cccggctggt gtccatgata    103080
     gcgggctgaa ttgtgctgcg tcggcatatc cttggtgttg ataacgtcct tgatggcaat    103140
     gggtacgcca tgcagcggcc ctttatgggg tgccgcatcc agcatctgcg cggcagccag    103200
     aacctgggtg ggatcgaaat gagcataggc acgaacggca ctgtcgcgct cttcaatgcg    103260
     gcggatgatc gacgttgcga tgtcggtgac cgaaagttgc ccaccgtggg taagggtcgt    103320
     gagcgtgcag gcatccaatt gataaggcaa tgtcattccc atgtccttct tggtgggtgc    103380
     gatcgtggcg cgcaggttac cgttactctt gttctatgac acggcagatt ttctcacgac    103440
     gcggctgaga aatggtcatt tggcgtctgc actctcgggc aacatagttt ccaccgaagg    103500
     ctgatgcgca tttttaacgt gtgttttggc aagaaccatc aaaacagcat gaaacggaga    103560
     tggaaaacca tggatattgc ccggttcaag cttggcatgc gccgtctggc ttctggcgtg    103620
     tcactgatca ccacgctctc tgacggtgtg cgccacggat tggtggcaac ggcggtcagt    103680
     tccgtcagcg gtgatccacc gtcgctgctg atctgcgtca acaaaaatgc ctcagcgcat    103740
     gggcatatcg agcgctccgg aatctactgt gtcaacatcc tgtcggaaag cgcccagccg    103800
     attgccgcca gcttttccag cgccattgac cgggacaagc ggtttttgcg tggtgaatgg    103860
     cagatactaa agaccggcgc acccgccctt gtcgattcac tggccagctt tgattgcgag    103920
     gtgcgccacg cactctccta cgccacacat acgatcttca tcgctgacat cgtcgcaaca    103980
     gagctttggg acagtaccga tgcaccattg gtctatctgg atggccgcta tcggcaggtg    104040
     cttgtcgagc cggatatgac acccgctgag tgagattttc atgaggcgcg aggcaccaag    104100
     tatagttcgt actgatcata aaaacgggaa cagaagcacg gcaaaagccg gcatatggag    104160
     catcagatga gcaaccaaaa gcgcaagggg ataacacggc gcggattgat caaaggcgcg    104220
     gcagcggtgg gcggcatggc cgccgggtcc ggggccatat ctggatttcc aacaatctgg    104280
     gcgcagaata tcaaggacat caagctggtc catgttggcc agtcctattc caccatcaag    104340
     aatattcagg aacaggccag caaggatctc ggctttacca ttgaaatgca gacggcagac    104400
     gtcgccaccc agatgaaccg gatgctgacc cagccggaat cgatggatgt cgccgacctt    104460
     gccaatacgt ctgtacgcta tctgctcggc cgcaatattg ttcagcctgt caccaccaag    104520
     gaatataaat ggtgggataa gaccatttcc ctgtttcaga caggtaaata ccccaatggt    104580
     aaaatggcct cgctggaagg atttgcaccg atcaaggcgc aatattatgc caataagacc    104640
     gccagcgcct attcaatgac gccgacagaa tggctggtgg gcattccgct ctattataat    104700
     gccgatacgc tgggtgtgcg gcccgatctg atcggctcca ccaaaatcga cagttgggca    104760
     cgcctgctgg accctgcctt caagggccat gtggcgcttc aggagggggt caatgtcggc    104820
     ttgccggatg ccgccatggc gctgtccgcc ctgggcgagg tctcctatgt tgacaagggc    104880
     aatatgaccc gcagcgaaat cgacaaaacc atcaagaaac tgattgaata caaaaaagcc    104940
     gggcaattcc gctccttctg gctgaatttc gatcaatccg tgcagctgat ggcctccggc    105000
     gaagtggtgc tgcaatccat gtggtcgcct gctgtgacgg aggtgcgtac gcgcggtatt    105060
     gcctgcacgt tccaaccgct gaaagagggc catcgcggct ggtacatcat gatgttccag    105120
     atgcagcatc tgaccgggct gaagcgcgaa tgcgccatcg agtatatgaa ctggtacaat    105180
     tccggctggg ccggcgcctt catttcccgc caaggctttt acaataccgt acctgaaaat    105240
     gtgaagccgc tgatgagcgc caatgaatat ggctattggt atgagggcaa gcccgcgtct    105300
     gaacctattc tcaacccctt tggcaaggtg atggaaaagc cgggtgcggt gcgcgacggc    105360
     ggctcactct gggatcgcat gggcaatatc ggcatctgga acacgctaat ggatgaggat    105420
     cgctatctgg tgcgccgctg gcaggatttc atcgccgcgt aaaatttcat tccaaccaag    105480
     gacatttacg atgtcactct cctcggcaaa gcgggtatcg cttttgcaaa tcgcgcctat    105540
     ggcgctggtt ctggtgtgtt tcgtgatcct gccattggcg atgattattg ctgtcagctt    105600
     catggattac ggttttgccg aggtgatccc ggagttcatc tgggaaaatt atcttgatat    105660
     tttcacctct gaactgacgc tcaggctgta tctccagacg ttcaaattcc tggcgattgt    105720
     ctgggcgatc acgctgtttc tcggctttac catcgcctat tatctgatgt ttcatgtccg    105780
     cagcccaatc gtgcgggcgc tgtgcattgc ggcctgcgcc ataccgttct ggacatcagg    105840
     gccaatccgc atggtgtcct gggtgccgct gctggggcgc gaagggctgg tcaatcaggt    105900
     cttgctgcat ctgcatatca tagagcagcc gctctcttgg ctgctctatt cggaattttc    105960
     cgtcatcgtc gtctacgtca atgtgctgac gctggccatg ttgggaccga tcgccaattc    106020
     catggcaaag attgataaaa accttctgca tgccgcccgc gatcaggggg caagtgaggg    106080
     acagatcatc cgtctggtga ttatcccact gatcaaaccc ggcatcgcca taggctcgat    106140
     ttttattgtg acggcggtga tgggcgattt cttcatcgtc aaacagatgg gcggcggcca    106200
     gatcaacacg gcggtggggg ccatcgccac cgagctgaac gccttccaat acccgcccgc    106260
     tgcggcaaaa tcggttgtga tgctggtcat tgtgctgggc ttcgtcgcct ctctgctgcg    106320
     cctcgttgat atccgaaaag aactggccaa tcaggagtga atgatgcgcg agcgtggaca    106380
     accaagacct gcttccttct atctgctgtt gggcattttc gctgtctatc tggcctttct    106440
     ctatgggccg atgctgtgtg tgttcatcct gtcctttcag ggaccaagcg gcggcatgag    106500
     ctttcccatg gtcggggttt caacccattg gtttcaggtg ctgctgggcg gcacgggcgg    106560
     cgaaggggtt ggcgatctgc atgatgcctt ctttcgttcc atgcgcctcg ccgctattgt    106620
     agcggtgctg accatgacga tatcggtggc ggcaggcatg gcctatcggc gaaagttccc    106680
     tggggccaat ctggtatttt actctgcaat agcggccatg gtgctgccgg ggatttttgt    106740
     tggttttggc atcgcgctgg ccttccatct gctgggctac aagatccagt ggtattcgtc    106800
     gggtattggc gcgcagctca cctggtcact gccttttggc ctgttaatca tgtttatcgt    106860
     gatggggcgt ttcaaccggt cctatgaaga ggccgccacg gatcttggtg ccaccagctg    106920
     gcagcgcttc agccaggtaa tcttgccaat cattctgcca ggcgtcgttg ggatcttcat    106980
     ggccggtttt acctcctcct atgaagaatt ggcccgcacg tcactcaatg tcggctcggg    107040
     caataccatg ccgatggaaa tcaccggatt gctgacggcg gccacatcac cggtgctgtt    107100
     tgccattggc acgctgacga ccgcggtgtc cttcattctc gtcatcggca tgctgcttct    107160
     ggcgacgacg ctggccaagc ggcaacagtc gagattgcaa ccgcattgat gcgacccatt    107220
     ccatgaggat gtaataatga gacatgaaac acagctgaca acagttccga cggatagcgt    107280
     tgcgaagaat gtgatccaga aaaccgcccc ttcatcctct gcccaccata atgatgttga    107340
     gctggtggcc gtgaccaaac gctatggctc cagcactgcc gttgacacca tttcgctgcg    107400
     tattccgtcc gccagttatt gctgtttgct gggaccaagt ggctgcggaa agaccacaac    107460
     cttgcggatg atcgccggac atgaaattgt cagcgatggt gatattctgg tgcaggaccg    107520
     caacgtgaca ctggcacccg ccgttcagcg cggcacctcg atgatgtttc agaattacgc    107580
     gctgtttccc catctaagcg tggtagataa cgtcgcattt tcgctcaagc tcaaaggtgt    107640
     ggccaggtct gagcgacgcc gccaggcgat ggactatctg gcgctggtgc agatggaagt    107700
     actggcagaa cggctcccgg cgcaattgtc cggtggccag cagcagcgcg tagcacttgc    107760
     ccgttcgctg atcacccggc caaaggtttt gctgctggat gagccgctat ccgcgcttga    107820
     tccattttta cgtattacca tgcgctcgga attgaaacgt attcaacgcg agctgggcat    107880
     taccttcgtg catgtcaccc acagtcagga ggaggccatg gctctgtcgg acatgatcgt    107940
     ggtgatgaat ggcggtgcaa tcatgcaggc aggccctgcc cgcgaggtct ttgcccggcc    108000
     cctcaacgct tttgtcgccc gcttcattgg cggacataat gttttaaacc ttggcggtcg    108060
     gcaattttgt gtgcgggctg acaaatgccg gatcgcaggg gccgaggatg acagacatac    108120
     catcgcggag gtggtcggag gcgaatatca gggcgcaata ggccgccttt ctttgatgac    108180
     ggccgacaga caaccgatct ccgtaatggt cagcgataac gactattttg cctttagcca    108240
     ttccatcggt gatcgggtca gcgtttcatg gtctgtgaaa gatgaatggg gcctggaagt    108300
     ggtgggctaa acgctgggac gtgttgcatg ttcagtcccg gcatgtgatt ggattggatt    108360
     tatgatgaat cttccggctc caaagtccac cgtttgcaga tgaactcata gggcgtgagg    108420
     ctctttaggg tcttgcgcct tcgcccgaaa ttgtaggcgt cgttgtagtg gacacgcttg    108480
     acggtcgctt ccttgatcgt gctttccagt cgctcgacct gcccattggt ccaagggggg    108540
     cttcaccttg gtcagacgat gctcaatgcc gttctcgtca cagacccggt cgaagatgtg    108600
     atggaaggcg tagagatcgc aggcccgatt ggtgaactga atgccgttgt ccgtcagaac    108660
     cgtatggatg gcatagggta cagccttgac cagattgcgc aggaattggg ctgcattcat    108720
     ctttccggct ttggcgtaaa gctcgacgaa ggcaaacttg gacgttctat caatggccac    108780
     aaacagatag agcttgccct cagcggtctg gacttcagcg atatcgatgt gaaagtagcc    108840
     aatggggtaa ctcttgaact tcttttttgg ctccttgtcg ccctcgactt ccggcagtcg    108900
     tgaaatgtca tggcgctgta ggcatcgatg taaggacgag cgcgtcagat gcgggattgt    108960
     tggctgaagg gcataaaggc aatcatccaa aggtagaagc gtgtgcctgc ggaaggcgac    109020
     aatcacggcc tcctcctcga ggatcaagac tgtcgaatgc ggttccttcg gcccggtcgc    109080
     caaatcggca accgatgtgc gcttcttcca cttggcaacg gtcttcgggt tgatcccata    109140
     ccgctttgag agcgctctca ggctctcttg actattttgt attgctcgac ggaccgtctg    109200
     cgcgggaaaa cagtccactg gactgttttc taatccgctt gacctatcgt tgtggcgcga    109260
     ccgtatagag cctggcccat agtgcttcct tccattcgag ggaaaataat gcaccattaa    109320
     agcctgggat caaacaacta gccactttcg cctgaacctg cggcacacca aaccccacag    109380
     ctccatccgt ggcgctacat tgaaatactt acccaatctt catgcccgtg gcgaattcgc    109440
     actacgaaaa ttttctcatc gtcttcaacc cgatagacga taagatgtgc tttgaaggga    109500
     tgaattctga cggccggttc gatctcattc cgttcgcgtg cgatgcgtgg attagcagcg    109560
     atcagatcaa atagtgcgaa aagttcatca tggtagcgtt ttgcctggtc tactccgaac    109620
     atacgggcac cctgctcggc gatcgtaatg atgtcttctt ctgcctcgac agaaagttta    109680
     aaactcatga cttgctggca cgatccatcg cctcagcaaa gagttcatcc tttgatcgaa    109740
     tgccaacgcc actttggagc ccggcctcga cgaaaccttg catggcggca atcttgtcgt    109800
     ttcgtgtctg gtcgcgtcgg atcaggtcgc gcacgtagtc gctagcgttc gaatatcgcc    109860
     cagtcctggc ctgcgcctcc acccaatcct tcatcgggtc tggaagagat acgttcattg    109920
     ttgccatggg aaacctccat ttgaaggaat catattcgat tttggcaaag tttgtcaaat    109980
     tttcctacat ctgcatggga tcagaaccgt cccccattct ctctgccggt gggataacgc    110040
     ctgtttatag aactatcagg tggacagagc atcggtttct cgttctgcag cgagcgctaa    110100
     cctggctaga gcgggcaatg atcttcagcc tgtcttggtc acgaaggacg ccctatggtt    110160
     ttccagggcc tgtcgcaaac attttcggag cgcgcgatta tccccttagc atcttcattt    110220
     tcatgcttta ttaacttttg gcagtccgaa gaggcgcgca agcaaatcgt tctgatcatt    110280
     gatggttcag cctccggaaa agccaaagcc tttcctcaac cacagcatcg cctcgaaacc    110340
     caagatggtt ctccacgccg tgttgaagga tttgaagcca ccgatctttg gcatgtttct    110400
     cacgagttgg gggctccggt aagtccggga cggttcaacc gcgagattgg tcttcaaaaa    110460
     gccaaagctg cgcgtcttgg ttcccatttc cgatagtcac atgaaatcgc acggcacaac    110520
     ggcaaccgat accttcggat gtccactaaa acagttgtcg atcaatcaaa cgctggcagg    110580
     ttccgatatt gtggtctttc gcaagggaac aagtgtcgtg aggctcgatc aggtcaagac    110640
     atcgtcaagc aatcgaggtc ttgttgttgg tgtctcatcg atcggtggtc atacgcgacg    110700
     catccatcat caacatcgtg taaatattaa cgactttgcg ggaaaatcaa tttacattcg    110760
     tgagctcgcc gaggcctaca aggcagattt cggcggctcc tttgagttcc tcttatttga    110820
     aatctcgcct gcggatctca tccgtattgc cgagggtgcg gaactttcag gcatcacctc    110880
     gctcgcggcc gaaactgcgt cgaaagacat cgtgcttgcc aatcttgcgc gcgcccgatt    110940
     ccggcgcttg aaaaaccgga ggacgcaagc gcgctgttcg tcgaccagat gacaaccgcc    111000
     atcgggacct acttggttca acgttatggc ggccgatccg ttgcaacctc caacagacca    111060
     cgaagggctc tgttgcaaaa actctttgtc gtagaatgaa atttcaaacg acgtctgcgt    111120
     atggacggaa aacctctcgc tcgaacgaca atcatccagt catgcaccat cttatttggc    111180
     ttttcaaaac cgcttcagat tgaattatgg aatatttttc ttcgatccag agacaccaca    111240
     aatttttgca acagagccgg ttccagacac ccgcagtgct atttggctac gggttcgcgg    111300
     aaacgatcgc agacaccgcg atcatcgata tgtaaagacc acatcatgca ggaacttgct    111360
     gcgaatttta tcaagactgc aaacgctttc gacattgagg gtgtgatgtc cctggtcgcc    111420
     ccagatgcca ttatcgatga cgtttcggtc ggcgacgcct tcattggtcc ggagggcatc    111480
     aaacagtatc tcaatcagtt tttcgtcggc taccacacac agagccggct tctgtcggtt    111540
     ggaaaacagg acgatcatac tgctttcgtc agactcgatt ttgccggcga ttttggccac    111600
     gagatcggcg tcctcaagat cacgatcaat tccgatggct ggatccacgc cgatctcgaa    111660
     tgagaagtct gagtaaccgg acgacagccg cgctcgcagg gcggatttgt gaagcagagc    111720
     ggaaggttga ccccgttcga ggacgcggta agcgcctgac tttatctgca aaatttccgc    111780
     gcgtgcgaga tcttcatcgc cgccgagctt gaccccagcc gatctccatt ttgttaaagc    111840
     agggtattac gagaccggtc ataggggtca acctccgacg cggcttcata gtttgtcgtt    111900
     cagcaaggac tcacagccct tcgcctcgtt cgctatcaga atgcttggct tctgggtcat    111960
     gattgctcac gtggtaagta aggtccggcg cttcataatt gaaatgattt tcgcgagtaa    112020
     agcgaccact taggatcagg atctggatcg aagacaacgg tcgtcacgct atgacaaccg    112080
     acgataagaa acaaacgggt acagaatctc aacgagatca tcgatcgaga gtgagaaggc    112140
     tcccacgacc cctttaaaat cctcaacatc attcatctat ctctcgacca tttcaacccg    112200
     gcggttcttg gcccgacccg cgtcgtttgc attgctggcc gccggcgcat agggaccgat    112260
     gcccttgggc tgaagccgat cagagtcgat accgaatttg gctgtcaaag ctttcacgac    112320
     agccgccgca cgcgcctgcg aaaggttcat attgcgctcc aaagcccctg aactgtcggt    112380
     atggccaacg atatagacct ttcggctcac gtcctgcgtc agaaactcgg ccatctgtgc    112440
     cagcgttttg tccgattccg ccttcaaggc tgcgctatca gtttcgaact ggatgccata    112500
     gagcgcgatg tggccggttt tggccagact atcactcatt gcctgggcgt ccgcagtgac    112560
     ctcacccgtc tccatagcgc ggccttccag gatttgtagc agcaaaccgg gctgtctacc    112620
     gctatcctgg cttaccagca aggaaacgtc gacgggccct tgggggcgct ccagatgagc    112680
     cgtcatcgcc cgcacgtttc catcggtggc gttgatcaga tcaatcctga gattgaaaag    112740
     gttgtcaccc atggcgtgat tgatcgggtc ggcaagtgct gcggcaaagt catagccacc    112800
     gcaggcgctg ccttcacact ggtaggccgg ctgaaaacca gctgccctca atgtctgttc    112860
     gtaattgcga tagacttcta gcgccgtttt tccttcgggg atggcgtatg cgatgctggt    112920
     caggcggcct tcaacggtct tgctcttggc aaagtggctt ttctggctgg cgtcatacgg    112980
     tcccagtggc aaggtcagcg ctgcgtagtc ctgctgttgg taaccaataa tcaccgcacc    113040
     agaaaaacgc gacacaatcg gattgtcctt gccgccttca atatcctgcg acggcgcttc    113100
     ggccgcggcg aatttcggta agcccaggac cgtgatgaga gcgagggtcg cgaggcctgt    113160
     tcggaatcca gacatgttaa ggtcctttcg ttggtgcgaa actgacaatg ctcacagggg    113220
     ataaaccgca agcaaggaaa ggcaattagt actcttgtgc taattgcccg gcccctatcg    113280
     tcaccgcaac caggacgagg cccgacctca atctgcccgt tgctgcggtg gcaagaccgc    113340
     agccattgtt cgccagatat cgaaaaaggc cggaggaacg gtcgtccggc cttctctttc    113400
     agtttcggag cgaggcgacg ccaccaacga acgtcctcat gagcttcttc acggcatttg    113460
     atgttgtagg tgtcagcagc gagcggcacc ttagagtcaa tcgcatagga aaatctgccg    113520
     taataagctt gcctgcgtga caatctcgcc atcaaaaaga tttcgcaacg gcctcaaaga    113580
     cgccaacgcc cggggatacg ggaggctgtt gcccgcctgg gatttatatg ggaaacagca    113640
     gaaatatttt ttggcttgcc tgaccgctga atgcggcatt agaagaagat tatattcatg    113700
     gacaaattac cgaagaccca cagtgaaagc ctgctggttg aactgacgtc cgatatcgta    113760
     tcagcctacg tcagcaacca tgtcatcccc gtgagtgaac tacgtttgct gatagccgat    113820
     gtccacgcaa cattgacgtc gacgtcgata cctgccgcag ctgaagtcat tgtcgagaag    113880
     cagaagccgg ctgtttcggt ccgcaagtct ctccaggaag atcagatgac gtgtctggaa    113940
     tgcgggaatg tcttcaagtc cttgaagcgt catcttatga cccatcattc gctttcccct    114000
     gaccagtatc gagaaaaatg ggatctgtcg agcgactacc ccatggtcgc tcctgcatac    114060
     gcggaagcgc gttcgcgttt ggcaaaggac agtggcctag ggcagaaccg acggcggaag    114120
     gtggcctaac aagtttcagg ggtaccccca cgcagtagcc cgcattcgag atgaagcggc    114180
     ctactcgctc tcgtgcgagc gacgtcagga caaccactcc acggatgtcc tgacctgaca    114240
     aatggacgaa gataaggaag gtcgggtgcg atttcgctgc ggcctttttt tgttgtcgac    114300
     aggtagagga tgatctaccg aagccgaacg gacgaggtcc gaccgccgac ggagagacag    114360
     atggcacgca aaatcagaga caatttcgct tcggacgata tgcaggcgga gccggtcatc    114420
     tgcccgctgt gcgagcgcgt gataccggac gaccaaatgg aggaccacca tctggttccc    114480
     aagagcaaag gcggcaagct caagttgccc ctgcatcgca tatgccatag ccacatccac    114540
     agggttttca ccgacgcgca gctggcgaag aagttttcca cgatcgccgc tattctcgag    114600
     gaccccgcga tccagaaatt cgtggcgtgg gtgaaaacca agccacccag cttcgaggac    114660
     gaggcagagg aacgtacccg acgtcgctga aaatctgcga cgggacagcg agcaggcagc    114720
     gtcgccttaa cttgaacagg acgtcagatg gcagcggcgg tcgactttat gtggcgtgtg    114780
     gcagcgtgat ttcacgccag acggccatag cctcggtgcg aagcgttcgg tgatcggcgg    114840
     caatttgatg ttgcggtgaa ccagaaagag attggaatcg gtccgtgggt tgaaacgaaa    114900
     cgttggcatt gcgcggcaga cttgaaccgc atcatgatcc gttctctccg ccttatgggt    114960
     agatgggaat tttcggcccg attgttcagc cccttatgcg aacgatgttc aacgccgggc    115020
     atgatatcgc gtttagcggc atcgtaggac cggagtttgt cggtcaccat cacacggggt    115080
     gtgaggccct ggcctttgag caatttgcgc atcaatttca gagctgcctt tttgttgcga    115140
     cggctttgca aaagggcttc aagcatatag ccttcagcat cgacggcgcg ccagagccag    115200
     tatttccggc ctttgaaggt taccaccatc tcatcgaggt gccatttatc ggcaaagccg    115260
     ccctttgagc gccggcgaag caacgcagca aactcggagc caaatttggc ggcccattcc    115320
     gatactgtct ggaacgaaac gtcaataccg cgttcggcca gcaaatcctc gacatgccgc    115380
     aggctcaatg gaaaccggaa gtacagccaa accgcgtgag cgataatctc ggctggaaag    115440
     cggtgacgtt tgtaacgata ggaggcgaag gtagacgaag aaatgttcat gcccactgct    115500
     ctatcgtaca aaacttaagg cgacactgtc atctctgatg atggtcaaca ccgcgttaag    115560
     ccgaaaaatt tgcgaaaagc ccattcccag cggcccattc aaaggatagt tggaaatgga    115620
     atttcaatta tttattatta tgtaaattat atttatctta aaaaaaattg caaaatatca    115680
     agttgtgaat catataaatg caattaaatt gacttctcct ataatataat atattgctat    115740
     ttaccggcgc tgtattagcg tcgacaaata ataaaggagt aagatatgaa gaaatttctt    115800
     gccgtcttta ttggcgcatc taagcttaat cgtcgtaagc cccgttatat ctatacatac    115860
     tgattaccta ttggtcctcg ggagtttaat tttaaattcc cgaggacgcc gattccttgt    115920
     ttaaattgat gttagtgaaa taggctttcc agttttggcg gttgctattt tagatgatct    115980
     cagttgagaa ttatcaacaa aaaattccaa atattcggca gcgatgcctt ttcaacaata    116040
     gcttcagatt ccgcaaggat cctctgtcat tgctgtcttc gtgctgtcaa attaacagcc    116100
     ctttgatcgg catcgataag ggcttctatg ttgtcactgc ccctgaactg attgaattgg    116160
     ttcttcatga caagcatcaa gtctttcgaa agtcccttcc tgatgacgat aggggcatgg    116220
     tcaattttgc ttcttcgatc atgaatagct cgggtgacga ttggcgccac aagcgaaagg    116280
     tgttgcaacc cggctttaat ctcgacgccg ttgcaaaggg cgtggatgca acaatcgaaa    116340
     ttacccaggg ccatctcgat cagtggcagg tcgagcctcc atcttccgac atcagaaaat    116400
     ccctgcaacg gctgtgtttt gacatcggct gtcaattttt tctcaagacc acgcttggcg    116460
     agaaggaaca atccgcgttc gtgatcctat cagatttgat catagcgaag acgcgcgacg    116520
     gtatacgctt tccactcggt ccattcgaca ggacggaggc acgacttgcc agcgcccgcg    116580
     atgccgcgaa ggaactggct ggcgctgccc ttgcccgtgc gcgacagcag cgcgagggca    116640
     gagacaagag cgttgcatcg cacgacgggt tcgaacgatc cttcgatgag gggtctgatg    116700
     aggatgacaa ctggctgcgc gacgagtttt gcaccatgat cctctcgggg ctggagccga    116760
     tgtctgccgg acttgcctgg accttgcact tgttgacagc gcacccggac gttctgcaac    116820
     gtgtgaccgc agaaatagat gcattggcta tgagcggcga cggcccgatc agtcttgacg    116880
     gattgcccga aacaagggct gcgctcaagg aggccctgcg actgttccca ccggcctggc    116940
     tgacggggcg gactgtcttt gaggatacgg tgctcggcga cttccttctt ccaaagggga    117000
     gcgccttgat gatcagtccc tgggtcaatc accgcagtgg ccgctatttc gacttgcccg    117060
     agcactatcg gcccgaccgt tggctggacg gcacgctgga aaagcgcttg ccgcgctacg    117120
     cttttttccc ctttggcggg ggcagccgac gctgcattgg cgagcatttc agcatgatcc    117180
     acatgacagc catattggtc tgtattttga ggcgcttcac cttgaaacgg atgccacata    117240
     ccaaagtgcg accctatcca gcactcgttt tacgcccttt gggggtcact ctgactttaa    117300
     caccccgcgc tccggaagcc ggactagata ggaacttcat atgacggcaa gctcggttaa    117360
     caactatgac agctatgcag aattttacga tagctggcag gaatcctggc ccgaaagcgt    117420
     catggctccc tgcgtgaatg ttctggcgga catcgccgat ggccgccctg cgcttgaact    117480
     tggcgttggg acaggacgca tagccttgcc actgtctcaa cgcggccttg atgtctccgg    117540
     cgttgacctt tccgaagcga tgctcgaacg gctaaagcga aagccgggag cggaaaaact    117600
     ttccctggtt ctcggcgaca tggcggatgt gcccatcgag ggagaattcg gtctcattta    117660
     ttgtgtggcg tcgttcgact atctcctcac ccaagaggaa cagctgcgct tcttcgccaa    117720
     tgcagaaaag catcttgcag agggcggttc gctggttgtc caaacgatca ttccaaacga    117780
     ggcgattttt agcagcgact tccggcttaa ccgcatgggg gacctgccat cggacgagga    117840
     cgggatggcg tccgtcatgc tcatgggggt gaagggcgat ccgatctctc aagtgcttga    117900
     gcagcgcatc atggtcatcg gtcaacatcc caaggtcttc cgacacaaga tccggtgcgt    117960
     ctggccgaat gaactggatt tgctcgcgcg gtctgctggc ctctttcttc atgctcgctg    118020
     gagcaattgg cagcgtgaat cgttcgtttc cgccagccga acagcgattt cagaataccg    118080
     cagatcctga ctggcataga tggcgccatt gatagaatga gggaaatgtt atgagccttt    118140
     gtgttattgg tgccggatta ggtcgaacag ggactttatc ccttaagctc gctctcgagc    118200
     atttggggat agcgccctgc tatcacgcca tggaaatcgc cgcgacggtt cggacctcac    118260
     tgccactttg gaacgatgct attggtggaa cggccgattg ggaccgtatc ttcgaaggat    118320
     atcgcgccac tgtcgattac ccaagttgcc tgttctggcg cgaattgatg gagcattacc    118380
     cgcaagcgaa agtcatttta accagacgag acccggatgg ctggttcgaa tccgtcagtg    118440
     aaacaatctt tccagccaag cgaaaaggga tgttgttggg cgatgatggc cttgccctca    118500
     gcgacttttt gcgcagggat ttcggcgaca atatcagcga tcggacgttc atgaccaact    118560
     atttccgtcg gtggaatcag tccgttatcg atgacgttcc cgccgatcgc ttgcttgtgt    118620
     tggaggccgg tgacggatgg gagccgcttt gcgcgtttct gggcgttgca cgccccgatg    118680
     tggcttatcc ctggctccat gcgcggccta agaaatcccg ctggaacctg ttcaggaggc    118740
     ggtcgatgcc tgaacaaaag ccagaagagc ttgaagacaa tacgcgcgat tacctggacg    118800
     gcttacatca aacgacattt cgttaagacg tggtttcgga ggacgtcatg gatgcgaacg    118860
     atcacctttt gaagaagcgg gagtttgcca accgctattt tgatgccagc atctggaacg    118920
     acataaaata tcgtgatgga gatatcgttg tcgcaagcta tgccaaagca ggaacgacac    118980
     tggttcaaca gattattgcg caactcattt ttgatcagga tgacgaggtg gacgtggcgg    119040
     ctatttcgcc ttggatcgat tcagtctatc ccgacaaaaa ggttaaactg gacctgatcg    119100
     aggcgcaaac ccatcgccgg tttctcaaaa cacatttgcc catggatgcg ctgatctttt    119160
     cggagaaggc gaaatatatc tacgtcgggc gggacggccg agatatcgtc tggagccttt    119220
     tcgatcatca aaatgcggcc cgccaagatg cgcaactgct gctagacaag gaagcggggc    119280
     cttctggacg gctgcgcgtg gcgacaccgc cgcagtcgtc catcaccgag tttttcgatg    119340
     cctggcttga taaagatggt tttccgttct ggccgttctg ggaaaatcta cggtcgtggt    119400
     ggttggcgcg gattgtcccg aatgtcctgt ttgtgcatta tgccgacctg atcacggata    119460
     tggccgaaca aatccttcgg atcgctgcct ttttagaggt cccattgtcg cttgatcggc    119520
     taccgcgcat tttgcacaac tgtagcctcg gacatatgag ggaccatgcc cgtcgctatg    119580
     ttccgcatgg agcaggcctg tggaaagacg atggcaagtt gttttttaac aaggggcaaa    119640
     acgggcgatg gatcgatata ctgacgccgg aggctaatgc aaagtttgaa cagcatgcca    119700
     tggcagaact tggcgtcgat tgcgccaaat ggatgatgtc tggacgtgcg ggtctaaagc    119760
     atgtcgcgtt tcattgccct caatgaaacg ataacgtaca tgcgacaaaa taagagctaa    119820
     agcgagctaa gatcttgttt tttgaactta cgcattcaaa accaccagaa gcagttggcg    119880
     gacgcgcttt agcctgctgg tgcgctctca ccgatccggg aagcctttgg ctcgacatag    119940
     cccagcgatc ccttgtatcc cgcatacccc aggagatgtc gctcgtcgct ggacaaggcc    120000
     tcgaatattt cgggcaggat attcgccgga aaattctcgt attgcctgat aaaaggcagt    120060
     acataggatg acgccacagc atatcgggta actccgggtg cggcatgcgc tcccgcgccg    120120
     tgccatacgc gaccgtcgag aataagggcg ctgcctgccg gaccttctac cgcaattgta    120180
     gtcatcggcg gggctggaat gcccatggtg cggaaggggt aatccggggc ggtattgggg    120240
     ctgcgcgacc agggcgggcg cggccaaagg tgcgagcccg gaatcacccg cgtggcaccg    120300
     tttgcttctg taaaatcgct gaccatcacc aagatgttgg cgacgtaagc cttcgatgga    120360
     tcgagcggca actggtcctg atcggtgtgc aatttctgtg cgggtctgcc atggttggta    120420
     atctgggccg caagcccgga caggttgaat tcccgccccc caaatatgtg ccgcacgcaa    120480
     gtgagaaggc tggggttatg agcgatttcg cgaaacacct tccccttgtt gtacagcatc    120540
     atcaggatct gtctgggcac cagatgttga tctattgttc gtgccacttc ctgcgatagt    120600
     ggcttgtcat ccacatcatg caaaagtgct actccggcgg cgcattccgc atccgcctgt    120660
     tcgaccagtc gctggcgaag agcttccagc ccagaacccg tcaccaaatc ggccaggatc    120720
     gcatagccga actgatcaag gtctgctttc gcttgagaaa cgtcgcgcgt tgcgacgggc    120780
     agactgccag atgtgaaatt cattgcactt ctcccgggaa tgcaggacac ggcttcagcc    120840
     tgactgagca agcttaatat gaaacagaat ggatttacga ctaaactacc gaggaaaatc    120900
     ggcgggtaag atgactaatt gatgccaacc attgtgattg atgtggttgc ataaaattca    120960
     atattgtatt tcattgtgag caatcatgat tttcgacgaa acccaaagag cttagtcgcc    121020
     tggtcagcga tgttcaagtg atttgcgcgc cgtggaaagc cgccgaatgg gcttgtcgca    121080
     aagattttcg tgggcctgga ttatccccta aacggtgtgc atttatactt tgttaacctt    121140
     ttgtagtccg aagaggcgcg caagcagatc gttctggtcg ttgacggtcc agccgccgga    121200
     atagccgaag cctttcctca accacagcat cgcctcgaaa cccgcgatgg ttcgccgcgc    121260
     agtgttgaat gactgaaacc cgccgatctt cggcatgttc ttcttcagcc ggaagtggtc    121320
     gctttcgatg ccttgttgga gatgcttggt ggcatagtgc acaggatctg gatgcaacag    121380
     cccgctatcg accgatgttt tgatcgccga cggaaacgta ttggcggcat caagatcgcg    121440
     ctttgccgtc agcaggaagt cgacgggatt tccgtgcttg ccgattgcgc gatacacgta    121500
     tcgccacttg ccgcggatct tgacgtaggt ctcatcgacg cgaaccgagc cgcaatgtgg    121560
     ccgacgaaac tgacgtaacc gcttctcgat catcggtgcg taggccagaa cccagcggtt    121620
     gatcgtgcta tggtcaacct cgaaactgcg ttcccggaac atttcctcca aatcgcgata    121680
     gctgagcgga taacgcaaat accatgcaac cgcctgcacg atcagccacg cctcaaaatg    121740
     tcgtcccttg aaatcgtctt tcgattggcg tttcagcttc tcggtaatgg cattcagacc    121800
     atcggtacgc tccgcaacaa ttggagcgga atttctcttc cgatggtcaa cataccgtta    121860
     accgaaaaaa tttgcgacaa gccccacgat cagataaacg ccatctttcc tccccgccgg    121920
     tacaacctct caactctcat atcgccacgc aagcgcagat ttcttctgac tttgggccga    121980
     ttatactgca gaaatggggg cttgaaaaag ccaaggcatc acagccttcc aaccaatgac    122040
     aattaagttg gcaatgcccc ctagttttat cactcgacat taaacaacca tagcgaaagc    122100
     tgtcaaactc gaaatttact gacgaagagt gatcatgatc aggcaaaatt atacctctat    122160
     aaaatctata aagataatag attttctgtc ttgtccgtca gcctgatctt acgctgcacc    122220
     agcattagac acggctggaa actctcatga caaagacgat acgcttcaat gcctttgaga    122280
     tgaattgcgt tggccaccaa tcgccgggtc tatggcggca tccgcgcgat cggtcctggc    122340
     aatataagga tctggaatat tggacggatc ttgccaaaat tctggagact ggcttttttg    122400
     aatccatctt catcgctgac gttatcggtt actatgatgt ctataagggt aatctggata    122460
     atgcgctgct tcagggcgtg cagatacccg tcaacgaccc gctgcaattg gccaatccca    122520
     ttgcgcaggc aacaaagcat cttggcattg gcatcaccgc ttccaccagt ttcgagcatc    122580
     cctatacctt tgcacgcagg ctctctacgg cggaccacca taccaaaggg cgtgtgggct    122640
     ggaatatcgt cacgtcctat ctggaaagcg gtgccaaaaa tgttggtcag ggtggcttgc    122700
     gctcccatga caatcgctat gatgtggcga cagagtatgt cgaggttctc tacaaactgt    122760
     tcgagggcag ctgggaagaa ggggcggtga tccgcgataa ggagcgcggc atctttgctg    122820
     accctgccaa aattcacgag atcggccata agggcaaata tttcgaggtt ccgggctatc    122880
     atttgagtga accctcgccg cagcgcacac cggtgctgtt tcaggcgggg gcctcgggtg    122940
     cgggcaagca atttgccgca ggccacgccg aatgcgtgtt tatctcaacg ccgttgaagg    123000
     atgccactcg cgcttatgtc gcggatattc gcaagcgtgc agcggaacag ggccgtgatc    123060
     cgaagaaggt gctgatctat gccatggcca ccatcatcgt tgatgagaca gatgaaaagg    123120
     cgcgggcgaa atacgaagac tatgcaaaat atgcctccta tgatggtgcg ctggtgttga    123180
     tgtcgggctg gaccgggatt gattttggtc actaccagcc gtctgacacc gtgaaaaagg    123240
     tcaagaccaa cgcgattatc tccgctgtcg agcatctgtc cgaaggcaat aaagtctgga    123300
     ccatagaaga attggcgaag tggggcggga ttggcggcct tgggccgttg tttgtgggat    123360
     cacccaccac gattgccgat ctgttgcagg aatgggtcga agaaaccgat atcgatggtt    123420
     tcaacctcgc ctatgcgctg gcgcacgaca gttttgccga tgtgattggc tatgtggtgc    123480
     cggagctgca aaagcgcggc gtttatgcca cccagtaccg cgaggggact ttgcgcgaaa    123540
     aactgtttgg cgaggggcca tacttgccac gaacccaccc cgcccatcag ttccgcgaca    123600
     ttgagcgcgt caagcgtgag gaggcaaaca aggcttccgg cgaggctgcc tgatgacagg    123660
     ttaagccgcc cgctctaccg aaatatctct tggccaatat gcaaaacgcc acgccgatcg    123720
     agctgtggcg aaggactttg tttgtccgct tcacaaaaga aagacggagc atgacccgat    123780
     gagcacgccc acaggtccag cgctggaagt taaacacgta tcgctctcct tcaagggggt    123840
     gaaggcgatt tctgatttga gctttcaggt cgagcgtcag gaaatctgcg ccttgattgg    123900
     tcccaatggt gcgggcaaaa gctcgctttt gaatatcctc aatggcgtct atgtgccgga    123960
     ttccggtgaa atcgtgtttg agggcgagca tttccggcgc atgcagccgc tggaggcggc    124020
     acgtcgcggc attggtcgcg ggtttcaaaa caatgcgctg ttttccggca tgagcgtgct    124080
     cgacaatgtg attgcggggt tatcgcggca ttccaaagtc acgctgcttg aggaggcttt    124140
     ccggcttccc cgtgcgttaa agcaggagag agattttcgc gagcgggcgc aggccgtgct    124200
     gcatcttttc gatctggaaa aacatgcggc agccattgtt ggcactctgc cctatggcgt    124260
     tcaaaagaaa gtggagatcg ccagagccgt tgttggcaag ccccgcctgc tgttgctgga    124320
     cgagccactg gccggaatga atgccgagga aaagcaggaa atcgccgccg tcattgcccg    124380
     gctgaacaca gagatgaaac tcaccatcgt gttgattgag catgacattg gcatcgtgct    124440
     caagctcgcc caccacgttg tggtgctcga ttacggtcgc aaactggccg atggcttgcc    124500
     cgaaaccatc cgcgacaacc cggatgtgat tgccgcctat ctcggctccg accacaagga    124560
     gattgcggca tgaacatgtt tattgaaacc ctgattggcg ggctgctggc aggcacgatg    124620
     tattccttgg tcgccattgg ttttgtgctg atttacaagg cctctggcgt gttcaattac    124680
     gcgcaaggct cgcttttgct gtttgccgcg ctgacctatg tgacgctgac cgatcagggt    124740
     gtgcctgcct ttggtgccat tgccgtcacc attgcccttt tgatcctaac tgccattgcc    124800
     atcgaaaaac tcttgctgcg ccctttaacc aaccgcagcc cgatgacgct gtttatggca    124860
     acgctcggcc tgtcctatgt ggtggaaggc gtggcgcaag gcattatggg ctctcaagtg    124920
     cgggcgctgg accttggtat tgaagatctg ccgatctttc tgggtgatat catgatcagc    124980
     cagttcgacc tgatcgcagc tggtgttgcc cttgccattg ttgttatcct gtccctgctg    125040
     ttcagcaaaa cacgcatcgg cattcaattg cgcagcgtcg ccgatgatac gcgcgcggcc    125100
     ctttccatcg gcatcaatat caaccgaatc tggcagattg cctgggccgt tgccgggttg    125160
     gtggggctgg ttgcgggcct gttgtggggt gcgcggcagg gtgtgcaatt ttccctgtca    125220
     ctggtggttc tcaaggcgct cccggtgctg atcattggcg gctttacctc cattcccggt    125280
     gccattgttg gcgggctgat tgtgggtgcg ggcgagagcc tggccgagac ctatcttggc    125340
     cccttcctcg gcggcggtat cacgccgtgg tttgcctatg cgctggccct tgtcttcctg    125400
     ttcatccgcc ccgccggtct tttcggcgaa cgccagattg aaagggtttg atcgatgacg    125460
     aaccttgaat tgccgttggt gacccatccc gtgcagaaca ttggcctgaa ggctgtgggc    125520
     cttgtggcac ttgttatcct gctgttggct gctccctttc tgacctctga atattggatc    125580
     aatgccatca ttgtgccctt cctgatcctg tcgcttgcag ggttggggct gaaccttctc    125640
     accggttatg cggggcaatt gtctctgggc gcaggcgctt tcatgatggt gggggcctat    125700
     gcaaccttcg ccttccagct tcgggttcca gaattgccct tgccgctggc gctgatcatc    125760
     tccggcctga tttctggcgt ggttggcttg gcctttggcc tgccctccac gcgcatcaag    125820
     ggcttttacc tgattgtcag cacactcacg gcgcagttct tctttgagtg gttgtttttg    125880
     aaatttccgt ggttttacaa tggcaattca tccgcaacca ttgccctgcc gcatggactt    125940
     tccgtgtttg ggctggatct caacaatccc cacggtcggt attttctcac ccttggcagt    126000
     gtggcattgc tgacctggct gtcgttcaat ctggtgcgca gccagacagg ccgcaactgg    126060
     atggccatcc gcgatatgga tacggcggca gccgtgattg gtgttcccac cttccgcgcc    126120
     aagctgcaag ctttcgcggt gtccagtttc atccttggta ttgccggtgc gctgtgggcc    126180
     tttacctatc tcggatcggc cagtgttcag agttttggcc tcacccgttc ttaccagatc    126240
     ctcttcatca tcattatcgg tggccttggc accatcaggg gtgcctatct gggggcggct    126300
     ttcgtcagtc tgctgccttt ggcgctcgat tggctgtttc aatatctgtt cagcggccat    126360
     gtggatgcag ggctgctgca aaatatccag aaggcaatct tcggcattct catcatctgg    126420
     tttctgatca aggaacctga gggtctgtcg cgcctgctcg gtttgcggcg tgcgcatggc    126480
     gcacgtcggc gtctctttcc ctcctaacca caagagtgaa ccctatgaaa cgttttgtta    126540
     ttgctgcact ttttgccagc accatcttct cggcaagcgc gccagccttt gccgcagatg    126600
     tcagtcagta cattcccctg ccaacctatc gcgtcggggc ctatgcctcc tccggcgaac    126660
     tgtggtgggc gggagagcgc gactatttcc gctatatcaa cgaggtggaa ggcggcgttg    126720
     agggcgtgaa gctcaactat gaagagtttg aaaccgaatg gagcccggac cgcaccgttg    126780
     aagtctatga gcgggtcaag gcgggcaagg acggctcgcc gctggccttc ttcttcaccc    126840
     acggcacccc tgccacctat gccctgctgg aaaaagccgc agccgacaag attccgctga    126900
     ttgatcccgc aggcggcaag acggaaaccg tggatggaac ggtgtttccc tacgccttcc    126960
     cgctgctgtt cagctattac agtcaggcct ctaccggcat caattatatt gcctccaagg    127020
     tcggcggtct tgataagctg aaaggcctga agatcgcaac cctctatcac gatagtgcct    127080
     atggccgcgc cagccagcca gcaattgagc ttctggccaa gaaatatggc tttgagaata    127140
     ttcagattcc ggtggccgat cccggcaacg aacagtcacc acaatggcgc cagatccgcg    127200
     agcaaaagcc ggattgggtt ttcctgcgca cctggggggt ctccaccgtt gttgccctca    127260
     agacggcaca gcgctttggc tttccagccg atcatatcat tggtgatgtc tgggccggat    127320
     cagagtcaga cgcgatcccc gcaggcgctg ccgccatcgg ttattcagca ctcgcacctt    127380
     atcccggcgg cacggatttt gagatccaca aacgcctgaa ggccgagatc ctcgacaagg    127440
     gcaaatccga tttgcgcgat ccgaaactgt ttggtgcggt caattacaat atcggtctcg    127500
     tcaacgcggc attggcggtt gaggcgctac gcaccggcta caagcatttc ggcccaaagc    127560
     cgctgaatgg tgagcaaggc cgctgggcct ttgagcatct gaccattgat gacaagcggt    127620
     tggagcaaat cggtttcaag ggcctgctgc aaccgatcaa aatcacaccc accgaccacg    127680
     aaggtggtgg tgctgcccgc atccagagct gggatggcaa gaaatgggtg ctgaagaccg    127740
     attggatcaa ggcagatcac gatcttctca atccgctgat caagcaaggg gcggaagctt    127800
     acgccaagga acacggcatc acgcctcgca caccggaaac agaaaccaat tgatccattg    127860
     agatcgggcg cgcgcggtat cgccgcgccc attttgggaa cacaggggat atcggatgtt    127920
     caagatattt ttgcgaaatg cccttgctgt cgcagcatcg gcttttgtct tcgcaagcgc    127980
     tgcacaggcc attgagacga cgccgggacc agatagcaac aagcagtttt tcccaatcgc    128040
     cagttttcgc gtcggtcctt atgcggcctc cggtgcatcc atctgggcgg gacgtatcga    128100
     ttactatcgc tatatcaacg aggtggaagg cggcatcaat ggtgttccca tcgtctggca    128160
     ggaatgcgaa acggagtgga ccgccgaaaa gggtattgag tgctatgaac gtttcaagcg    128220
     cggcctgaat ggcgcgccga tttccgccta tttccccaat ggtgctccgg cagcctatgc    128280
     tctgtctgat cgcgccacca aagacaagat tccgctggta actctggcct atggccgcac    128340
     agaagccacc gatggccgcg tctttcctta caatttcccc gtgatggtga ccttctacag    128400
     cgaagcctca gcggtggtga attatattgc ccagcgtgag ggcgggtttg acaagctcaa    128460
     gggcaagaag atcgccactg tctatcatga cagcgcctat ggccgcgaaa cccttgatcc    128520
     gctggcgctg ctggccaaga aatatggttt tgaaaacatc cagattccgg ttgccgatcc    128580
     cggcagcgag caatcatcac aatggcggca ggtgcgcgag cagaagccgg attgggtttt    128640
     tctgcgcaca tggggcgtgt ccacgcccgt tgccatcaag accgcccagc gcttcggttt    128700
     ccccgctgat catgtgattg gcgatgtttg ggcttcgtcc gaagaggatg tgattccggc    128760
     aggggatgcc gccaaggggt atctcgctct gacaccatac ccagcaggtg cggatttcga    128820
     catccataag cgtctgaagc aatctatcat cgacacgggc aaatcggacc tgcgcgacac    128880
     caaggctttt ggcagcgtct attacaattc cggtctggtg gatgcgctga tttcggtcga    128940
     aatcgtgcga caggcgcagg ccaaattcgg caaccgcccg atcaccagcg aagaggcaca    129000
     gtgggctctg gaacatttca agctcgatga tgccgcgctg aaaaaggcag gcttccttgg    129060
     ccttgtgcaa aacctgcaac tgacacccgc cgatcacgag ggtggcggtg ccgtgcgcgt    129120
     gcagcaatgg aatggtaaaa actggacgct gatcagtgac tgggtgcagg cggatcgcca    129180
     aacccttcgc ccgctgattg acgcgaaatc cgcagcctat gccaaggaaa acggcattac    129240
     cccgcgggat gttggcacca actgatgggt catgcaccgg agcggccccc gctgctccgg    129300
     tttttggcgt ttgtcaggga aaagtggaac ccggttttcc cgaaaagaca aacgaaaaca    129360
     aaagaatcga gagtctgttg ggttcaatct gaaccagaca gacacgaagg agatggatga    129420
     tgtcatttgc gcttgagcca actgagaaac agccggaagt gactgatatt gttgcagata    129480
     atcttctgga cgtgtccggc attgaagttg tctatggcgg tgccattctg gcggttgcag    129540
     atgtttcgct caccgttggc gcaggcgaga ttgtggcatt gcttggtgcc aatggtgccg    129600
     gcaaaagcac ggttttaaag gcgatttccg gtctggtgag cgctgacagg gcaaccgtgc    129660
     gtaaaggcca catccgcttt gatgacagtg atattctcgg ctctgctgcc aatcatctcg    129720
     cagcacgggg cattgtccat gtgctggaag gccgccatgt gttttctcat ctgacggttg    129780
     aggaaaatct acaggcaggc gcattcctgc acaggcctcg ccgccgcgat ctgttgcggc    129840
     agattgagga ggtctacgat tggtttccga ggctcaagga aaagcggaag acactggctg    129900
     gtctgacatc cggcggtgag cagcagatgc tggccattgg ccgcgctctt ctcacccagc    129960
     cccggctggt gttgctggac gagccatcca tgggtctggc cccgcgcatt gtgcaggaaa    130020
     ttttcgagat catcggcagg ctcaaccgtg aaaaaggggt ggcctttctg cttgccgagc    130080
     aaaacgccgc cttgtcgctg gcccattcca gccgcgctta cattcttgaa agcggcaagg    130140
     tggctttggt gggaacctct gctgagctga ctgcgcgcga tgatcttcac cacatctatc    130200
     tcggagcgtc cgcttaaatc cggacaccaa caacgaccaa caggaaaagc atcttcatgt    130260
     cacaaattga tctaggctgg ggcgagggcc cttcagagcg ctatgaaagc cttgccgaaa    130320
     aattccgccc gatcttcgct gaaatttcca ccggtgccat tgaacgcgag ctcaaccgga    130380
     cactgcccac cgagcaaatc gccaagctca aggcggctgg tttcgcagcc cttcgggtgc    130440
     cggaatctga agggggtaca ggcgtaacac tgcctgaact gttcaatctg ctgatcgagc    130500
     tgtctgctgc ggattccaat atcacccagg cgctgcgcgg tcatgttggc tttgccgagg    130560
     atgtggtgaa caagcttgat ggcccagacc gccgacgctg gacggaacgt ctggtgcggg    130620
     gcgaccttgt tggaaacgca tggacggaaa ttggcaacgc ccaacaggcc agcttttcaa    130680
     ccaccgtatc caagcgggat ggtcaattcg tcatcaacgg ccagaaatat tacacaacag    130740
     gttcgctgtt tgccgactgg atcaatgtgg gtgtcaccgg gcttgatggt gccagcagcg    130800
     ccgcgcaggt ccgacgtgat gatccgggtg tcgaggttat tgatgattgg aatggctttg    130860
     gccagacatt gacggcaagt ggcacaacga cattcactga cgccgccgtt gatccgttag    130920
     acatcgttgc cgatgacaat cagtttcgct atggcgcggc tttctaccaa acagttcatc    130980
     tcgccacgct tgcgggcatt ggccgcgcca ttgccgacga gacggctgcg gccgttgcca    131040
     aacgggtgcg aaactactcc aacgccgcag gcccgcgttc cagccaagac ccgcaggtgt    131100
     tgcaggttgt cggtcgcatc cgcagcaatg cctacacggc aaccgcaatt gtgttgcagg    131160
     tggcacgcgc catcgagagg gcctatcagg cccatttcag cggtgatcgt gacgccgaag    131220
     atcgtgccaa tatcattgca gagctggaaa catctcaagc cctgacggtg gtgaccaacc    131280
     tcattcttga ggcctcaacc attattttcg atgctcttgg cgcatcgtcg acaagcaaac    131340
     ccattggtct tgatcgccat tggcgcaacg cccgcacttt gtcctctcac aatccccgga    131400
     tctacaagga tcgcattgtc ggtgatttcg ccgtcaatgg cacgcctccg ccatttcaat    131460
     ggcgcattgg gcttgctggg tgacgttgat acgaaatact tcaaaattga gtacaatatt    131520
     cccgccaata aactacaaaa atatatattt tctattcttt aagtatccaa tccttaagat    131580
     cgtctgcata caagtgaacg gcatttcgcc agttctcgac ttggaggaaa tcacaaaatg    131640
     tcgcttaaaa aactcgtcac atttgcattg gcatccgttg gcattgccct tgtcgcgctt    131700
     ccaacatttg ctgctgacaa aaaggtggtt gttgcctatc agaccgatgc gcttccgtct    131760
     tcggtggcga ttgccaatgg cgaattggcc aaggcaacgg gctatgacat cgatttccgc    131820
     aagtttaatt ccggcgcaga aatttttgca gctattgcct ccggcgatgt ccaggtcggt    131880
     tatgttggct ccagcccgtt tgcggctgcg acatcgcgtg gccttgatgt caaggccttc    131940
     tatctggcat cgatttccgg aacggatgaa gcgcttgtgg tgcgcaatgg gtccggaatc    132000
     aattctgtca acgacctgaa aggcaagaag ctggcggcag cgcccgtgtc caccgaccat    132060
     taccagctgt tggcgctgat caaatccttg ggtttgagcg aaaaggatgt gcaggtgttt    132120
     gccatcccgc agccggaaat tgttgccagc tataatcgcg gcgacattga tggcgggttt    132180
     gtctgggacc cggcgctgac cgaactcagc aagaatggca aggtgctggt gacatccaag    132240
     gatgttgcag aaaagggcgc tcccacattt tccgcctggg tggccgctgg aaaatttgcc    132300
     aaggccaatc ctgattttct gaaagcctat gcgggcgtga tcaacaaata ttacgcctcc    132360
     ttcgccaagg acaagagcgc atggggtgcc gatagcgaca atgccaagca gttggccaaa    132420
     ctgctgggtg gcacagccga acaacaggct gccgccttga agaacctcaa cctgctgaca    132480
     cctgaggtgc aggcttctgc tgcatggttg ggtggcggtg agaattccgg tgccgccaag    132540
     atcctcaaag acacagcaca atttctgaag gcacagggca agattggcga tgtgctgccg    132600
     agctatgccg catttgtcac gccagaggcg ctgcaagtca ccaattgatt gattgttaga    132660
     ggctttcatc ccgctggcac gattgccggc gggattgttt ttgaaagaga accccatgct    132720
     gcggattcaa aatgccacgg tttactttga cgcccgcgac ggtggagatg tccacgcgct    132780
     ggagaaggtc aatctcgata ttcccgaagg tgcttttgtc gtcgccctcg gtgcatcggg    132840
     ctgtggcaaa tccacgcttc ttaacgccat tgccgggttt ttgcccctgt cgacgggctc    132900
     cataaccctc aatggccgcg ccatcagtgg gccgggggca gatcgtgggg tggtgtttca    132960
     gaaagacact ttgttgcctt gggccaatgt gctcgacaat gtcgcactcg gtttgaaatt    133020
     cgcaggtgtg tctgccaggg agcggcgtga tcgcgccgaa gaactcctca atctcgttgg    133080
     ccttggcgat tttgcccgca gctttcccta tgaactctcc ggcggtatgc gccaaagagt    133140
     gggcatcgca cgggccttga ccaccgagcc ggaggtactg ttgatggatg aaccttttgg    133200
     tgcgctcgat agcctgaccc gggagcagat gcaggaactg ttgatttccg tatggcaccg    133260
     gacgggcaaa cgcatctttt tcatcaccca ttccatcgaa gaggctttgt ttctgggaac    133320
     gcatctggtg gtcatgtccc ccaggcccgg ccggattatt gcccgctatg agctggattt    133380
     tgtgcgtgaa ttcgtcaaga ccaatgatgt ccgcgccatt catctctcgc cccaatttgc    133440
     cttgctgcgc gaggaaattc gtgaactgct gcacgcaacc cattctccga aagaggcttt    133500
     cgcatgacct tgatcagcaa tgatgtgcgc cccgtcgtgg tgccaacacc gggtatcaaa    133560
     acggtgcgca tgcgcgagtt cggcattggc cgaaagccga cggtgttgat cagcgtggtc    133620
     acggcgcttg tgcttttatt tgcgtggtgg ctggtctcag cgctgggcgt ggtgccgcat    133680
     ctgtttttgc cgcgcccaga tgaggttgtg catcaatttg tggtcatttt cagcgatggc    133740
     tatgcggggg catcgattgg cgatcatgtg ggagccagcc tgtttcgcat cggcgtggcc    133800
     gccattctcg ccattgctgc ggggattccg attggcttgc tgatgggcct taatcgttgg    133860
     gccaagggca ttctggatac gcccatcgag ttttactggc ctttgccgcc gctctcttat    133920
     cttcccctga tgatcatctg gctgggtatt ggcgaaacct cgaaaatcat ggtgttgttt    133980
     ctggcgatgt ttgcgccgat ctgcctctct gcacaggcgg gcgtgaagtc ggtgccgatt    134040
     gagcgggtga atgcggcgcg atccttgggc gcaaaccgct ggcaattgtt ctccagcatt    134100
     gtctttccct cggcgctgcc ggaaattctc acgggcatca ggatcggact tggcattggt    134160
     tggggcacgc tggtggccgc tgaactgatc gcgtccacgc gcggcattgg ctatatgatc    134220
     atgtctgcgt cgcagtttct ggccaccgat gtcgtctttg tcggtatcgc gattatctct    134280
     gtctgcgctt ttgcctttgg tgccgccatt cgcctgttgg agcgcgtgct tgttccctgg    134340
     aagggcaagg catagttgcg gcctcaagaa cgctctataa aaacatcacg aagtcctgtt    134400
     gagatggcct tcgtgatggt cttgctgtga gcagtcttta tccgcgaagc agaggcaata    134460
     attgctgtcc ctgccgcgca atttcgccga gatacggcgt atcggataaa acaaagtggg    134520
     tgatgccaag ctcctgatat ttttttaagg aacgggcaac atcctgtgca gaacccacca    134580
     gccaggtggt gccagcgccg ccgccgccaa atttgccggg tgcagtgtag agattgtcgt    134640
     ccagaacatc gccgcgcttg gccagatcat agagccgctg ttggccaacg gcaaccgtgc    134700
     cagcatgatc gtgccaaacg accccactgc ttttcgccat cgcttcaact ttcgcctcgg    134760
     cgtccgtcca tgcctgttct gttgtgtcac gcaccagcgt ggtcacgcgc agaccaaact    134820
     ggagcggggg cagatcacga tccagtttac gactcaggtc tttcagacgg ttgatccgct    134880
     ccccgatatc cgcaagcggc tcaccccaga acagctgaac atcggcctcg gttgccgata    134940
     cttcttctgc cgctgcggag gcaccaccaa aatagagcag ggggtgtttg cgctccccgc    135000
     gtggctgaag cctcggctga acggtggact ctgtgacgtg ataatattgg cccttgaagg    135060
     tgacgttttc ctcggtccac aggcggcggg tcagccgcat gaactcgcgc gtgcggccat    135120
     agcgctcggc ctgatcgccc tcggtatcgc cataggcgga gaccgaatct ttgccggaaa    135180
     cgatattgat acgcacacgc ccgccagtca gatgatcaag cgtcgccgcg gatgacgcaa    135240
     aatgggcggg ctgccaatag cccggccgga tggcaatcaa ggcttcaaaa ctgcgcgtgc    135300
     gtgtcgccag cgctgttgcg acggtgaatg tatccgggcg cccccacccg gcaccaatca    135360
     gcgccccctg ccagccgttt tgttccagcg cttccgcctg ttttaccagc gtttcaagag    135420
     cattatggcc aacgacagta tcgtcaccgc gatgccccgg caccgtctgg tttggaatat    135480
     accagagaaa ttgtaaatca ctgctcatga tgttctccaa catgcctcac ccgtggtgag    135540
     catgccaatt gccggatttt cggcgtgtcg atcattgttt tgcaaagccg ctgttaatag    135600
     gcctgcgcta ccgcctgtcc ggccaattgc tcaggcgtga gcaaatcagc gtggtgggcg    135660
     cgggcaacat cggggtgcga ccgcaggcgg cttttgagat ggttctggcc aacttcccga    135720
     aagatcgggt tcagcagatc aaccgtgatg ccgcgctctt ttcgatgcag ctcgtctgga    135780
     agcgtaatca ccggaatcgt tgcgtcgtag cgcgagccta agaagaaggc gacggagaag    135840
     cgctcgatac cggcaggcgg tgcaaccaca tcatgcacgt cggcccgcac gaagccattg    135900
     gtggccagtt ccagcaattc cccggtgtta accacgaagg tgcccggtac gggcggagca    135960
     tccagccaca cgccgtcttc agtctgcacc cgtagacctt cgaccttgtc ttgcaaaaga    136020
     accgtgacga agccgccgtt cttgtgggca ccaacgccct gatctgtctc agccacatcc    136080
     cgcccgggat agcgaatgat tttcaacagt tgcgatggtt gcggctcgta gatctgcgca    136140
     aacacatctt ccggctggtc aagcgccacg gcaatggcct tcaaaacatc aatgccaacg    136200
     caggtgactt ctgcctgata ggtcagcagc aggggcttta gttctggaat agcctctggc    136260
     cattgatttg gcccgagcaa acgtttccac gcaggtgttt ccgggccaat ctcgacaggc    136320
     gtgccttccg tatttatatc cagttgttcg cgccaatcct gctgaccacg ggtgtgctca    136380
     tagcccgcac gattgtagcc gcgaaagtgc cgggatttca ccatttcaat cttcagcttt    136440
     tcctcaagcg gcagcgcaaa aaagcgtttg gcggtctcga gcacatccgc aatcagcttt    136500
     ggatcaacgc catggccggt gagatagaaa aagccgtgat caaacagaat gcgacgcagg    136560
     tctgcgatga aggctgcgcg ctcctctggt cccgcatgga agcggccaat atccacaaag    136620
     ggcagggttg cgattttttg ttgaagtgtc atgggattat ctccattcaa gccgctggcg    136680
     ttggctcgcc cagcgagagc atcaagcggt ttgcccagtt gaagaaggcc gcgccatgca    136740
     cgacatcata gatctcgtca tcggaaagac cggcggcgcg aagccgctcc acatgggtag    136800
     tcgcaaacac gggcggggtg gcggttaatg caacagaggc gctgacaatt gcgttccaac    136860
     gttcatccag atcagccccc acgccttcat ccagcagttt ttgcacatca tccttgcgcg    136920
     gtgagtggtg cgatgcgaag cgggaatgga cggaggcgca aaagatgcag ccgttatagc    136980
     gcgatgtggc ggtggcgctc agttcgcgct cggcgcgggg caggccatcg gcggtgttgt    137040
     agaaaatatc cttatctgtc ttggtgcggg cttccagaat atcgggatcg cgcaccagaa    137100
     gagagaaata gggcgatttc gcccgtgcct tgtccaccag cgcttcgtag tggcgctcgg    137160
     tcagctcagt ctcggtcaat ggttcaagcc atggtgtcca gccgatctgg tcttgcgtga    137220
     agacattggg ggcgttttcc accttggggt cgataatggt gtcggtcatg atggatcgtc    137280
     cttatgtggc gttcaggact ttcagaccgg caacaacgcg gatctgaaag gcgaggaaag    137340
     aaatcagctg cgacagcgtg acaatgccgg tggtgctcca gcctgctttg agaagggcat    137400
     caagcgcctg tgacttggaa tcgcgcaggt gaaaaatcag aagatgggcg tgttccagcg    137460
     cagcactcaa gcgcgcaccg aggatggctt tttcgctgtc agccacggta aaggcaggcc    137520
     cttcggtgtt ttcggaggac agcggcccgg cgggataatg gccataaggc ccaatggccg    137580
     ttcccttgga tgcagcggtc tgaatggcgc tcagaagcgc agggttcgtc gcaagctttt    137640
     ccgcgtagaa ggccgcaatc tccggctgcc cgtgcagggc cgccacaaaa acagcaacgg    137700
     caaagcgctc ttcgattgaa aactggctat catcgccggg tgcaaatagc gcttgccagc    137760
     tggcttgcgc cccgtctttc gtcaccgggc ggcgggcgcg taaagcctcg cccttggagc    137820
     cgggagcaat gccgctgaga gtgtcaataa tatcggtcat cagactttac tttcctgatt    137880
     aaattcaatg gattattctg cggcggccag cgctttggaa gtcttgcggc tccagcccag    137940
     tttgggggca acttcagtgg caatcagctc aatggagcgc agaatatcgg catggggcgg    138000
     atcgatggag tgaacctgaa agaccagttc tgtggagcgg gccaaggccg tgtcggcctt    138060
     cagcgaggca atcacatcat ccggtgtacc cacatggcta tccagcgcct tgatcagatc    138120
     ctccacgctg gtgccatcga tgcgatggcc tgcggcggca aagcgggcgg cgactttggt    138180
     gaggccctct tcggccagct tcagagcgcg cttgcggtct tcagccacaa acaggctgcg    138240
     agagccaaga atgcgcggtg cgcggccttg gggcagggcg ctcagatagg catcgatgat    138300
     cgggttttgc aattcatcaa gccgcgcatg gggcctgtct gccgggcgtg gttgggtgcg    138360
     tgatagcatc aacccatcgc cgctttcccc agcaagcttt gcgccaacgg gcgaaaacgt    138420
     cgcaagccag acgcgatcca gcagatgcgg ggcattggga taaagccgat tgcccgcgcc    138480
     cacatccttg cctgcccaag ctttgcgaac gatgtcgaga tattggccat aaacctcacc    138540
     gcgcttgtcg gcagcaatgc caaacgcctc aaaggactca cgggtgccgc ccgtgccaaa    138600
     gcccacttcc agacggccac cggacaaaag atcggtcacg gcagtgtctt ctgccacccg    138660
     cagcggattt tccattggca aggtgatcac cccggtgcca agccgaatgg tggatgtgcg    138720
     ggccgcaaca tgggcgagga acacggcggg cgatggcaac ccgccttctt cggcatgaaa    138780
     gtgatgctgg gcaatccatg cgctgtcaaa accattggct tctgcgtgct ggatttgctc    138840
     ttccgccaga cgatagcgtc ccgctgcatc ggtatcatcc agcaagcgtg tgaaaaagcc    138900
     gagccgtttt gcctgctttg ccagtgttat ttgggtcatg atggtgatcc tgctgtcagt    138960
     gaatgttgat gtctcttcgg aaaagcccgg cccggaatgg cctcgatcaa ctcgcgggtg    139020
     taggcgcttt gcgggtgggt gaagaccgtc tcaaccgggc cgtaatcaac ctgtttgcca    139080
     ttgtgcaaaa ccgagaccgt gtcggcgatc tggcgcacga cggccagatc gtgcgagacg    139140
     aaaatatagg tcaggccaaa atcgcgctgc aaactgccaa gcagggcaag gatttgcgcc    139200
     tgtaccgtca catccagcgc cgagacggcc tcatccagca caaccacctc aggctccagc    139260
     accagagcgc gggcaacggc cactcgctgg cgctgtccgc ctgacagcgc atggggttta    139320
     cggttgagaa ccgagagcgg caggccaaca cgctcaatca tggcttccac gcgggcggcg    139380
     cgctcttgct tgggaagcgg ttcaaaattc agcagcggtt cttcgacaat cgagaaaatc    139440
     gtctgcttgg ggtccagaga actccacggg ttttgataga caagctgcac cttgcgccgg    139500
     aacgcgcgca ggcttttgtg gttcaggctg ccaaggtcaa aatcacccac gcggatgctg    139560
     ccagatgtgg ctttctgaaa tccggcaatg ctgcggattg tggtggtttt gccagagccg    139620
     gattcgccaa caatggcgtg ggtggtgcct tggggaacgg tgaaggaaag accatccacg    139680
     gcgcggaaac gctcacccgt tggcagttta aactcctgca cgagattatc gacggtaaca    139740
     ctgatgggcc gatccgccgc aatggcaggc cgcacaaccg gggccgccaa cgagggcgca    139800
     tcggataaaa gccttgccgt ataggcgctt ttgggcgcga ccagcacctc tgcggttttg    139860
     ccttgctcct gaatacggcc ggactgaagg accaccaacc gatccgagcg gtcggcggca    139920
     acacccagat catgggtcac cagcagcacg gcggtgccgt aagctttgcg cagatcgtca    139980
     atcaaatcca ggatgcgacg ctgcacggtc acatccaacg ccgaggttgg ctcatcggca    140040
     atgatcagtg ctggtttcag cgcaatggcg atggcaatca gcacccgctg tttcatgccg    140100
     ccagagagtt cgtgtggata ttgtctggcg cgaagcgctg gctgcgagag gcccacctgt    140160
     gtcaacagct ccaccacccg ccgatctgca tcccggcggg aaagcttgcc gtggatttcc    140220
     agaatttcgc gcacctgcgc gccaaccgtg agtaccggat tgagcgaatt cgacgggtct    140280
     tgcgggatca ggctgagaac ggggccgcga atgccgcgca agctcttttc actccagcgg    140340
     gaaatctcct cgccattcag gcgaatagag ccgctatcaa tctgcccatt gccagagagg    140400
     aggccaatga tggcctgtgc cgtggaggtt ttgccagaac cgctttcgcc caccagtgcc    140460
     acaacctcgc cagcaccgac ttcgagcgac acatcatgca ccacgcgggt gcggctctct    140520
     ccatctccat aggaaatatt cagttctctg atatcgagaa cagaaggggt cttactcatc    140580
     ggctggtgct ccccaaggat tggctgatgc ggttggcaga cagcaccacg gcgaccacaa    140640
     tcaggccggg ggctgtggtc agccaccagg cggtggcgag gtaattgcgc ccttcggaaa    140700
     tcagcaggcc ccattccggt gttggcggcg gtgcgccata gccgaggaat cctagggtgg    140760
     acatttgcag aatggcccag ccaaattgca cggcggcata ggcaatcacc gaggtcagcg    140820
     aattgggcaa gatatgccgc cacagcacgc tcaaaaacgt accgccactg ccataggccg    140880
     cttcaacaaa atccgcccgc cgcacccgca ccacttcgga tcgggtcaac cgggcaaaac    140940
     cggcaatggc cgtaacaccc accgcaatcg cggcattgat cgtgccaaag ccaagcagaa    141000
     taatgatgct gagagacaga agcagggtgg gaatagacag cagcacatcg acaaagcgca    141060
     tgatgatcat atcccagcgc ccgccaatgg ctccggcaaa aaggccaagc agggtgcctg    141120
     ccaccagtcc cacgcccacg gcggcaaggg cacccgacag cgaatgaacg gagccataga    141180
     ccatccgcgc ataaagatcg cgcccaaggg agtccgtgcc gagaagatgc gccgctgacg    141240
     gcgctttcaa ctgcccgccg ggaatgccct ccagcgggtt atagctggta aaaagccacg    141300
     gcatagctgc ccagagcagt acggtgacca tgaccaccca cgccagcaca agaccggggc    141360
     gcaagccttt aaaacgggtg agggacgccc ggcgcttgac gctatccgat ttcacgccat    141420
     tggcttgcag ggagagaatt tcaacactgc tcatgatgcg gctccgttcc ggcttctcag    141480
     gcggggatcg agaaggggat aggcaagatc gaccagaaga ttgatgatga caaaggcggt    141540
     ggcggaaatc accacaatgg cctgaagcac ggcaatatcc tgcgtgctga cggctttttc    141600
     cgtcaattcg cctaggccgt tcaggccaaa tacggtttcg gtcaccacgg ctccggccag    141660
     aagctcgcca aacagcaccc cggcaatggt cagcactggc aaagccgcat tgatggcgac    141720
     atgccgccac agcacacggg cgggcgtggc ccccttggca atgacgacag agatgaaggg    141780
     ccgggtgcgg atttcatcaa tattgcggat caggatttgc gccagcggtg cggcaatggg    141840
     aacagacagg gtgatcaccg gcaggacgag actttcccat ggtccgggat tgatcaccga    141900
     gaccagcttg agccgaaacg agaaaatctg gatcagcata atgcccagcc agaacactgg    141960
     aaccgagatc aacagcgaag gcactgcctg taccagattg cgcaaaaatg aaaatggtgc    142020
     gagcgaagac agcaccgcca caaagaccgc aaggacgatg gcagcaagaa aggcgagagc    142080
     tgccagcgtg agcgttgcag gcagacctat ggccaactgc gccgtcaccg gcacgcccgc    142140
     gtgcagcgaa tagccaaaat caccctgtaa gaaattcgcc aatgtgtgga aatattggac    142200
     gaacacagag gaatccacgg cataggcggc gcgaatttcc ttgatttgat cagggcttaa    142260
     cccataatca gggctgagaa acttgatcag caccgcgtcc ccaggcatgg cctgcaacag    142320
     aataaaggac agggtaaagg ctgcccagag caccagaacc gcctgtccta tccggcttgc    142380
     aacatatcgc gtcatcatcg atctccgcag atttcaaaac cgggtggcgg ctgttgctgt    142440
     cacccgggtg ctgaccatta cttatccagc cagacgctgt agaagctggg gcgggccacg    142500
     gcatcaaaag ccacaccctt cacgtaaggc gctccggcaa agacttgcgg ctcttcaaaa    142560
     atcgggatgg cataggcctg atcgagcaca taggcctgta cctctgccac aaccttcaat    142620
     cgcttctgtg gatcaggttg agagctgatc tcctccagta agctattgag cttatcatca    142680
     acaaaggtct tggctttatc gctgagacca cccttctgac gcagcgcgtc gcggtttttc    142740
     gggtaatatt ggctcttgat cacatccggg tcggcgcgac caacgatggc aggagtcacc    142800
     ggggttttca gcggatcaag atcatccaaa gcggcgcttc ccgcgtcgcc ggccagcacg    142860
     ttgagcttca cgcccacttt ttgccattgc tgggcaatca gctgcaaagc cgcgcggttt    142920
     tgcggttgcg gcagggattc ataggctgtc agcaccagtt ttgccccgtc cttggcacga    142980
     atgccatcgg catctggctt atatccggct tcatccagca gagccttggc cttctcaaca    143040
     tcaaagccca atttgtcgga ttgatcgaca tagccaatgg ccgtggaggc gatgatggag    143100
     gtggcgcgtg gatagttctt ggagaatagg gtcttgatga tttcatcgcg gttggtggcc    143160
     aaagacagcg ccttgcgcac ccgcacatca gcaaccaacg gattgtctgg tctgaacacc    143220
     accgaattgt tcacgccgcg ggtgccgggc gcataaatct tgaaattctg cgtttcaacc    143280
     tgtgcctcat cataggcctg aatctggcgg atcagatcgg cctgaccggc cagaagcgcg    143340
     ccaatgcgca cgccatcttc acgggtgatg atatatttga tgccatcgag ataggcgcgg    143400
     ccctgatgct ccagcttttt cggaccccaa gtgtaatcgg cccgcacttt caaatcgagc    143460
     gatttgccaa gcgtctcggc gctgaccaca aaggggccgg agccgatgat tttggtggca    143520
     tcgcccaatt gctcaaaggg cagggagagt gttttcaacg acaacagacc ggagccgata    143580
     acggatgttc cctgaagaaa gcccggcgac ggctttttga acacgaattt caccgtcagc    143640
     gggtcaatca cttcactgtg gtcgtaattg ttgaccactt ccgaaaccgg ctgcttcaaa    143700
     cccttatcgc caagcccgaa gcgatcaaag tttttggcca ccgcattggc gtccaccggg    143760
     gagccatcgg agaacgtcac gccggggcgg attttgaagg tatattccgt gttatcggca    143820
     ttgaccgtcc agctctcggc aatccacggc tcgatttcca gtgtcttggg gttttgatag    143880
     gtcagcttat cggtgatctg gttgagaatg ccgctgttgg ggtaaaagcc gcctgctggt    143940
     gggtaaagat tggtatgcgc ctgctgctca agatagacca aggttccgcc cttgaccggc    144000
     gcatcagatg catggccgat ggtcgatagg cttacagaag cggccagcgc gaggctgagg    144060
     ccaagaaaag tgcggcgaag cgtcatcatc aatgtccctg ggtagtgagt gaatgaaccc    144120
     gtggaccaag ggtaaacttt tgcgtgttgc aatcaatatt gtctattgat ttactattct    144180
     aattttcaac acccctctgg aagattcatg cttcccgttg atgagttgga aaaattttat    144240
     ggaaagaccg gttttgaaga tcgaaaaatc gcgttgaaaa gcggatatcg gattgatttt    144300
     tggcatttat tggctggcgt tcaaattgcg cgcaggcaaa attttgctca accctagagt    144360
     ttgccaggga aaagtggtta ccagttttcc cgaaaagaca aacgacaaca agaaaagcga    144420
     gagtctgtct ggttcaatct gaacctggca tactcgcgca aggaaccgat atttgaagca    144480
     tccttgctac gctgaccttc tcacgctgtt ttttgccaat atcatcggcc gctgatatag    144540
     taagacaatc cgtgactgtc tccccggttc tcttgttgtt gttcaagcct gtgttggcgt    144600
     agatcatagt ccacgtcagc cagcctctcc cgcaggtcca tcagtctatc gtcaacgcta    144660
     tcatcgcagg aataaccgct gaacgtttcc tgcatgtcga tcatggtgct cagctcggcc    144720
     cggcgctgct gaagtcttgc gctataggtg caaatactca tggctatatc cttccaaagg    144780
     ttgggtttca gggcgtagtg gcagctcgct ccagtgcggc cttgccgaaa atggatcgga    144840
     tcatgtggct ttggggggca tgggcacggg cggtaatggc atcacgatga tgccgctcca    144900
     gatgataatc tcgcctcagg ccacggttgc cgccgtattc aagggccaga tcggtgacgg    144960
     agacagcatt gtcgatcacc acgtggcgca cggccagcgc gtcggtgggg cctgcttttt    145020
     tttggtcaac gtcgcgtgcc aaagagcgca gcagccgggc attggtggcc agcagcactt    145080
     caatttggcc cacgccttcc tgaagacgct gaatagaggc caagggcgcg cctaggctgg    145140
     tgggggcatg gctggtgagg tgcttcaaaa tatcattccg ggccgataga gccacgccgt    145200
     gatagaccga agacagcagc gtgaagaaaa tattgccgaa atccggatcg cggcgcagtg    145260
     gctcgctggc cggttgttca aagatcaggt cagacagcgg cacctgcacg ttttccagca    145320
     gaagatcatc gctggcggtg gaatacatgc cagtcgcctc ccatgtgcgc accttgcgaa    145380
     tacccggcgt atccagtggc accagcacct gaatgaggcg cggcacctcc tccgtggtca    145440
     atgccagcac aaccgcccat gtcagcccgg caagcccggt gacaaagccc ttgtgaccat    145500
     tgattaccca atgatctccc tcaatgtggg cgatggtttc gggcaatccg ccatgggcgg    145560
     gggagcccat gcccggctcg gcctgcgcat tgttgaccag caccggcttg gctcggctgg    145620
     ctgccagcac acgcgctgcc aaggcctctg gccagcgccc cagattgatc acaccatgaa    145680
     tggtgtaatg catggtgaga ataagtgcgg ttgaaggatc accaaccgcg atttcagaaa    145740
     ccaccttttg cgcggtttca aggttcgctc caagaccgcc gtggtctttg gcaatcaaca    145800
     gagccagcaa accggcttcg tgaagcgctg cgatgttgtc atgggggaaa tcaccgctgc    145860
     ggtcatattc ggcggcacgc gttgcgaaat cgcgcgccag ttcccgtgcg atctcgaccg    145920
     gatcagggct tggtgccgca ttgggcttga tggcagaaac ggtggcactc atgcaacagc    145980
     cctccgatcc agcgtttcat aagggcgctg atccacccag gcctcgaggt caaaatcagc    146040
     ctgcaagaag ccccattgat acagaaaatc cttataatgc ttcacagcag ccacatgggc    146100
     aggctccagc ccgatgccga gatggcgatg cacatcccgc ccattggcgg ccagcacctg    146160
     ctcttcgctg gctcccgcct cgcgggcaat gaagcggcgc gtctcgtccg ggtgtgcctc    146220
     cgcccagccg gaggccttgc ggatcaccgc aatcagccgc tccaccagat cggggcgttc    146280
     atcggccagt cttgcatcca ccgtgagaat gcgcggtgag ccggaattga tgcggatggt    146340
     tgggtcggga tgaaaaccga agtcagagac cgtcaccgcg ccaatcagat tggcaacggc    146400
     aatgcccgcc gtgcctttca caaaaatcgc gtccacctcg ccacgcaaca gggctgcggc    146460
     ctcctcgcca aaggattggc gccgtttcag gccaaacagc gatgcgccag tttgtccatc    146520
     cagcacggac tcagtgatgg tgatgtcagt cagatcaacc gcgttgatcg aaaccccgtc    146580
     cagcgacaga gccgagacaa ggcctttcag ggcggttgcg cgcataaaat caacaatccc    146640
     atccggtcgc tttggcacgc caaaccgacg gccaacaagg tccttcaggc tttttatgcc    146700
     agtctgcggc agggtgatga tggcctgaaa ctcatcggtc caggtaatgc ccaccagccg    146760
     ggtgttgcgg ccttcagagc gggcgcggat gggtggcacg ttgccgccat ggcggaaaga    146820
     ccattccagc gtatggttga aatggctctg ccggacggct ttatcggggg aatcaatgat    146880
     ggactccagt gtgatgccaa tctcggcaaa gctttgttca agatagccaa gctgggcagc    146940
     aagccccacg ggcgttggca ccgggcagcg cgtataccag agtttggaga tgggagtgac    147000
     cataatatcc tcaacaaaca ggagatgaaa ccggctcaac gcccggcgaa aaccttgaga    147060
     aatccagcct tacgttgacg cgatataggc gaaggcgagg ctgctgatga tgccttccgc    147120
     gcccagcgtg tgatcggcga tacgcttgtt ataaatggtg atttcgggag ccgcagcgat    147180
     atcgatggca ggcacatcct ccaccagaat ctgctggatt tccttccact gcgccacgcg    147240
     ctttttcgga tcaatctcca ccgctgctgc ttccagcagg gcatcgactt tcgggttgct    147300
     ataggccgca ccattggaga aaggcacgcc ttttaggaag ttcttgctcc aataaagccg    147360
     ctgtacaccc acggtgggat caaacagatt gctcatgcct tcataggcaa aatcgaaatc    147420
     acggtcagtg tagatgcgtt tggtataggt ggcgaaatcc tgtgtgcgca ctgtgacctc    147480
     aatgcccacc ttggccagtg cttgacgaat ataatccgcg ccacgcggat agccttcacc    147540
     cggtacataa tcgagtttga ggcgggcgcg aatgccatct ggcccacgct tatagccagc    147600
     gtcatccagc agggcttccg ctgctttgag atcaatggga taggtcttca ggtccgaaac    147660
     ataccatttt gacagtttgg gattgatggg gccggtaatc ggcgcgccat agccgtaatt    147720
     gaccgtgttg aaaatcacat tgcgatcaat cacatgagcg aaggcgcggc gcacccgcac    147780
     atccttgaaa aactcttttt ccagattgaa ttcaacccgc gtgacaccgt tggagtattg    147840
     gtagccctgc gtttcaaagc cgatatgcgg caaggctttc aaccgatcca ggtcgccgta    147900
     ggacaccggt gtgcttggcg ccagatcaat ctcacccgcc tcaatcgcaa tcgaccgcgc    147960
     tgccgaatcc gagatgaagc gcacgatcag gctgtcgaga taggggcggg gcttgtccca    148020
     atagtcctca ttgcggacat aaacgatatg gctgccgcgc acccattgct tgaacttgta    148080
     ggggccggtg ccaacagggg caagattgac cgggttttcc tgcactttgg tgccttcata    148140
     gagatgcttt ggtacaatcg gcgtctcgga agaggcaagg gcggtgatga gatagggggc    148200
     tggcttggac agcacgagca ccaccgtgcg tgcatccggg gtttccactt ccgtcaaatt    148260
     gaggaatgtg ttgcgcccac gcggatggac ttgggcaatg gttttgatgg aaaacgccac    148320
     atctgccgag gtgaagggct tgccatcatg ccatttcacc ccatcgcgca gtttgaacgt    148380
     atatttcagc ccgtccgggc tgatctgcca ttcagttgcc agcaagggct taggcgtgag    148440
     gtcaaaatca taggtcagca acccctcggt gacctttggc gagacataga ccgagttgaa    148500
     cgcggtatgg gcaatggtgg tcaaaaccgg aggctcagac gacaaaagca gcgttgccgt    148560
     gccacccttt gccggcgttg cggcgcgcaa atttgtgccg ctcacagcaa atgcgctgac    148620
     tgctgccgat gccagcagaa agccgcgacg ggttgtggaa tgggcggcgt gttcggtaga    148680
     cgggcggttg acgatcattg ttttccctcg ctgcgtgggc aggctgcaac cagagcgaca    148740
     ttttccaata gctggatggc taagtgaaaa ttcttctgtc gcgcaacgct ttcgtagttg    148800
     gagttggtta aaatgtccga tttatcggca tataattcct attatgcgcg acacatctca    148860
     ttttttcaga aaaatattct tttctcatgt ttgacaaaat atataaaatt agtcaactac    148920
     tgacatagaa ctcaatttca aaactgcact tcaggcgata gtgatgaccg catcaaaccg    148980
     aatattgaaa cgcgcaagcc gtgtgacgtt gcaggccata cccaccgttg tgggcatcgt    149040
     gatcctgaac ttttttctgc tgcaactggc accgggcgat gccgccgatg tgctggccgc    149100
     agaggctggc tccgccaccg tcgagacaat ggcggatatt cgcgcgcgct ttggtcttga    149160
     tctgcccgtg ctgcaccaac tgggcaatta tcttggtaat cttgctcatt tcagtctggg    149220
     gtattcgccg cgctatggca tgccggtggc cgagctgatt gggcaacgac tgcccggcac    149280
     attggtgctg atgggggcgg cctttatcat tgcgcttgtg cttggggtgg tgcttggctc    149340
     cgtcatggcg gtgttttcgg gtcgcctgcc ggaccgggtc atctcccttg gttcgctgct    149400
     gttttattcc gtacccggtt tctggatcgg tttgatgctg atcctgctgt tttccgtcaa    149460
     gctgggttgg ttgccttccg gcggtgatag caccattggc agcccgctga ccggctatgc    149520
     ggcgcttttg gatcgcgctc ggtatattgt tctgccagca acttcgctgt cgctttatta    149580
     tttggcgatc tatgcccgac tcacccgcgc cgccatgctg gaagtgaaat cacaggacta    149640
     tgtgcgcacc gcccgcgcca agggtgtcac accgcttcgg ctgacgttgc gccatatcct    149700
     gcgcaacgct ttgatcccta tcaccaccat ggccggaatg catcttggcg gcatgctggg    149760
     tggcgctgtt gtggtggaaa ccgtgttcag ctggccgggt ctggggcggc tggcatttga    149820
     agcggtcatg gcccgtgatt tcagcgtgct tttgggaatt ctgctgctgt catccttttt    149880
     ggtgatcatc atcaatgctg ccgtggatct gtttcaggcc tggctcgacc cgcggattgg    149940
     agaaagccaa tgacaattat caatgcaacg acaccgctcg ccgaggctac gcgccagcgt    150000
     gaaggggaaa aggcaagcgt tgaaacggcc aaagaggcca aagcccccaa aggctggccc    150060
     tatgtccatg cacccgacgc gctgacagcc cgcaccagtc tgataccaaa acggggtctg    150120
     cgccgtgagg tcaaaatctt tctcaccaac cccaatgcgt tgattggcgt ggcgtttctg    150180
     gccattgtca tcatcacagc gcttctggct cccttgcttt atcccggcga tccgctggaa    150240
     atggtgtcgc ggcccttcct ctggccgggg cagaaccccg cctatccact gggaaccgat    150300
     tccatggggc gtgacgtgct ggcgggtatt gtgcacgggg cacgggtttc gctcacagtc    150360
     ggcattgccg caaccgtgat ggggctgacc atcggcgtca ccattggtgc atttgcaggc    150420
     tatttcggtg gcgtgatcga tgatgttctc gtcaagatca tcgagatttt ccagacgctt    150480
     cccagctttg tgctgctggt ggtgttggtg gccattgcac agccgtcgat caccaccgtg    150540
     acctttgcca tcggtatcat tacatggccg atggtggccc ggctgacccg cgccgaattc    150600
     cgcgcaatcc gcgaaaaaga ttatgtgctg gccgcgcgaa gtctcggcta tggccatgcc    150660
     cgcatcgtgt ttgcagaaat tctgcccaat gccctgccgc cgattattgt cacatcgtcg    150720
     gtgatggtcg cgggtgcgat tttgatggaa gcggccctgt ctttcatggg tctgggcgat    150780
     ccaaaccggg tctcctgggg ttcgatgatt ggctctggcc gtgaggtgat ccgtacggcc    150840
     tggtatctca cggccctgcc ggggctggcc attgtgttta cggtcatctc cctcaacctg    150900
     atcagtgacg ggttgaatga tgcgctcaat ccccgctttt cggaggaacg tcgatgagtg    150960
     ctttgattga tgttcgggat ttttccgttg gtttcggcag cgcccagccg gtcaagggcg    151020
     tcagcttttc ggtggaacgc ggcgaaatgc tggcgattgt tggcgaatcc ggctctggca    151080
     aatccttgac ggcgctgggt ctgatcgggc ttttgccatc gcatgcgcaa aagggcggct    151140
     ccatccgctt caagggccgc gagcttttga cctatagtga acggcaatgg cgcgccattc    151200
     gcggcggcga gatcggcatg atctttcaag agccgatgac ctcgctcaat ccagtgctga    151260
     cggtgggcga gcaaatcacc gaagtgctgc gcattcacga aaagctggac cgcaaacagg    151320
     cgcgtaaacg tgctatcgaa ttgctggatc tcgtcaacat ccctgaatcg ggaaaaaggg    151380
     tggatgatta cccgcatcaa ctctccggcg gcatgcgtca gcgggtgatg attgccattg    151440
     gcgtggcctg caatcccgaa ctgttgattg ccgatgaggc gaccacagcg ctggatgtga    151500
     ccattcaggc acaaatcctg caattgctgg ataatttgcg ccgggatttg aacatggcgg    151560
     tcattctcat cacccatgat ctgggcattg tcgcccaatg ggcggatcgg gttatggtga    151620
     tgtatgccgg gagaaaggtg gaagaaggtc tgccgcagcc ggtgtttgat cagccttatc    151680
     atccctatac ccgtggtctt ctggctgcgt ctccgcgcgg cggggcaggg cagcattacc    151740
     gcgatggacc cttggtggaa attcccggct ccatcacctc ttcggtcaat gagaagggat    151800
     gtgcctttcg ccctcgctgt tccagcgcgc gcacgtcttg cggtcaggcc gtgccgtctt    151860
     tgacgcaagt gtcgccgggg cggtttgcag cctgtcctgt ggtgtccgca aacttttcgg    151920
     aggtgtccca tgacgctctt gtcggtgcgt aatctttcca cccaatatgc cggcgcacgg    151980
     ggaaccgtgc gggctgtgga tgatgtgtcg ctggagattg aagccggtga aaccgtggcg    152040
     ctggtgggcg aatccggctg cggcaaatct tcgcttggca aatcgctgat gcggctggtg    152100
     gagccatcct ctggccagat cacctttcag ggcggcgatg tcacggccat gccagccaat    152160
     gagttacgcg gcattcgccg ccgcattcag atgatctttc aagacccgtt tgcctcgctc    152220
     aacccacgcc agaccatccg caccattttg accacgccgc tgaaagtgca tggcattggt    152280
     gatggtaaac gccgccgcga gattgttgag gcgattattg aacaggtggg attgccagcc    152340
     gattcactgg atcgctaccc gcatgaattt tccggcggcc agcgccaacg catcggaatt    152400
     gcccgcgcca tcattctgga gccagagctg gtggtgtgtg atgagccggt ctccgcactg    152460
     gacctgtcca ttcaggcaca gattctcaat ctgctggtgg agctgaagag ccgcctgtcg    152520
     ctgtcctatc tgtttgtttc ccatgatcta tcggtggtgc gctatttttc agatcgggtg    152580
     ctggtgatgt atctgggcaa gatcgttgaa agtgcgccca cggcagagct atgggccaac    152640
     ccgagacatc cctatacccg cgcacttctg gcagctgtgc cagacccggc gaggcgcaag    152700
     caggcagccc cgatttccgg cgatttgcca agcccgcaca atccgccctc tggctgtcgc    152760
     tttcacaccc gctgcccgct ggcgacagat ctctgtcgtg aacaggcacc ggattatcaa    152820
     ctgtttggtc aagcccatgc cgtggcctgc catcacgcca acgaacactg aaatggagta    152880
     aggactatgg ttgactatcg ttatctggga cgcagtgcgc tgaaagtttc acccctcagc    152940
     cttggcacga tgatgtttgg cggcccaacg ccggatgaag tggcctttcg cattatcgac    153000
     aaggcgcgcg agcagggcat taatttcatt gatacggcag atgtctatca cgatggcaaa    153060
     tccgaggaag tggtcgggcg tggcatcaag gcaagccgtg atcactgggt tttggcgaca    153120
     aaatttgtca attcccgcga aaaaggtccc aatctcggcg gccagtcgcg caaatgggtg    153180
     atcgagacgg tggaaaattc gctgcgccgc ctcaacaccg attacatcga cattctctat    153240
     ttccaccgtg cggtgtttga tgccccattg gaagagccgg tgcgcgccat tgccgatctg    153300
     atccgtgcag gcaagctgcg ctattttggc gtctcgaatt tccgtggctg gcgcattgca    153360
     gaaattgcgc atctggccga tcagctcggc attgatcgcc ccattgccag ccagccgcta    153420
     tacaatatcg tcaaccgcac cgcagaggct gaacagcttc ccgccgccca tcattacggg    153480
     cttggtgttg tgtcctactc gccgctggcg cgtggggttt tgacgggcaa atatgagccg    153540
     ggcaaggcac ccgccgccga tacccgcgca ggccgtggcg acaagcgcat tctggaaacc    153600
     gaatggcggc ctgaatcggt ggagatcgcc cgcaaggtgg ccgcccacgc ccacgccaag    153660
     ggcatttccg ctgccgattt cgccctcgct tgggtgctga acaaccgcta catcaccgcc    153720
     gccattactg gtcctcgcac agaggagcat tgggatggct atatccgtgc tctggatgtg    153780
     cggctggatg cagaggatga ggcgctggtc aacagtctgg tcgctgaggg gcatccgtct    153840
     acgccgggct ttaatgaccc aagccacccg gttgaaggcc gagtgccacg ctataacgat    153900
     cagccctcgg ttaagccggt tcgcgccgtt gcctgatcat ggatgtggca gccggggtga    153960
     agatgaacac tccggctgcc tgctcagttt tgaaggatga tgaccatgcc ccacagcgcg    154020
     cgtgttccag atagcaccga ggccttaacc cgcgatggct tgcttgcgca ggcccgcacc    154080
     ctgtccgaca cctttgccaa ggatgcagcc cgcagcgagc tggaacggga attgccgttt    154140
     gaggctttcc ggctgatcaa ggaggcacgg ctcggcacgc tgcgtattcc caaagccaag    154200
     ggtggaccgg gtggatcaat tgccgattat atcgagctgt tgatgatttt gggtgaagcc    154260
     gatagcaata taccccacgc cttgcgcagt catttcaact tcaccgaagg gctggcgctt    154320
     ggcccaaccg tgctggaaga ccgccgacat ctggaccatg tgctggaggg aaaactgttt    154380
     gccggagcca gcaccgagca gggcacgaaa cggcccggcg aaatcaccac ggttctcagc    154440
     cgtgagggcg atcactatcg gctgaatggg cgcaaatggt atgccaccgg cacggccttt    154500
     gccgattttg gctccttcag cgcggtggat gaacagggag atcccatcgg cgtgctgatc    154560
     ccgctggatc gcaagggcat taccattctg gatgactggg atggcatggg ccagcgcatg    154620
     acggccagcg gtggcgtgtt gctggaaaat gtcgaggtgc tggcgcatga agtaactggc    154680
     cgcaagctct ccagccagat tggtcgccat tgcggcgcgc tgcggcaact gcatctggcg    154740
     gcatcggctg cgggtgccgt gcaaggggcg gtgaaagatg gcattgatta tgtgctcaac    154800
     cacgcccgca ccaccctgca cagcacagca gaaaccgcca atgacgatcc ttttgtgcaa    154860
     aaaatgctgg gtgaaatcac ctcgggtgcc tttgcggttc aaaccttgat ccgcgaagcc    154920
     gcacgcgcac tggaccgcac ggcagagacc tttgcaatgg gcgatgaaga ggcgattgaa    154980
     acagcactga tttctgcctc gctcatcacc gcccagacgc agatcattac ctcgcaactg    155040
     gcactttcgg tggccaccaa tatcttcgag ctgggcggcg gctcggccac ctcgcgccga    155100
     tttaatcttg atcgccactg gcgcaatatt cgcaccgtct acaatcacaa tccgttgctg    155160
     cacaaggcgc gggtggtcgg cgattattac ctgaacggca ccaccacgca tttgaaagaa    155220
     ggccgggtgt tctaaagttt gatgcctgtc tggtggagag ccaccagaca ggctttatca    155280
     gggctttact tcaaggcaaa accaaagcgc cgcaaaatgg cggtcaattc aacccggcct    155340
     ttgagagcgc tcgcactgcc aatgcgcttg gcaatcacgc tggtccatcc cgcttgcggc    155400
     agattttggc cttgctggaa ggtttttagc cgctcatcat agctggccag atcctgttca    155460
     ctcaccgtgc catattgctc ccgaaacagc actgccgatt gcggcaggcg cggctttaca    155520
     tcggttttta ccgctggatc gggatagccc actgtgaggc caaacacagc gatggtttca    155580
     ggcggcagat tcaattcccg cgccacatcc tctggccgat tgcggatgcc gccgatataa    155640
     cacgagccaa gaccaagcga gtcaatggcc gccaccgcat tctgggcggc aagggcggca    155700
     tcaatcgcgc caatcacaaa gctttccaga taatccagtc ctgcaccctc gctgtcattg    155760
     ctgcgggcaa tggctcttag ccgggcgaga tcgaccagcc agaccagaaa cagcggcgca    155820
     gcattgattt gcggattggg agcggcaaat tcttccagac gcgccttgcg ctccgggtct    155880
     tcaacagcca ccacgctcca cgcttgcaga ttggaggagg tgggagccga ttgtgctgct    155940
     gctaccagca gttccaccgt gccttgcggc agggctttgg gcagataggc gcgtgcggaa    156000
     cgatggttca gcaacacatc cagcgtctca ttccagctgg gtggcaaaac acttggcggg    156060
     acgccatagc gggctttgat gcgttctgcg gcagaagcct gcggtacatc agaggccgca    156120
     gtgagtgatc cagaatgcac cgtcatggtt tttcctttca atgatcggat aagacttttg    156180
     gacgttgttt gacatctgtt gatggcacga cactatcatc gatgtcgggg acggctgcga    156240
     ttaacattcg ggtgtagtca tgctgaggac gttcgaacac ctcctcgaca ggcccttcct    156300
     ccaccagaac accgtttttc aacacgccaa cccggtctgc catttgccgc acaacagcca    156360
     gattatggct gatcaacaga taggtcaggc cgaattctgc ttgcaggcta gccatcaact    156420
     ccagcacttg tgcctgcacc gacacatcca gcgccgaggt tggttcatca cacacaatga    156480
     agcgcgggcg gctggcaagg gcgcgagcaa tggctatgcg ctggcgttgc ccgccggaaa    156540
     actcatgggg aaagcggctg cgcgcatcgg gatcaagccg gactttttcc agaagatctg    156600
     taacacgctg ctcaatcacg cgattgtctg tttccaggcc aagggttcgg atgggttcgg    156660
     caataatgtc accaatccgc caacggctgt tgaggctggc atagggatct tgaaagatca    156720
     tctgcacagc gcctttcagg gcgggggcct tatcctgccc caacaccgta ccgccgatgg    156780
     tgaccttgcc cgcttgtgcg ccgagaaggc ccacgacaat gcgggcaatg gtggacttgc    156840
     cagaaccgga ttcgcccacc agcgcaaagg tctggccctc gccaatcgaa aaactgacat    156900
     cattgacggc gcgaagactg cgctgctttc gatttttgct gaaaaacggc aggccaccgc    156960
     cacccggcag ggcaaaatcg cggatcaagc cttccacctt gaccaaatcc cctttggatg    157020
     ccaccgaggc ccgcgtgttt ttacgcctaa tcgaagggat ggcggcaatc agcgcccggg    157080
     tgtaatcatg cttgggactg ccaatcacct cagccacgga cccgctttcc acaatccggc    157140
     ccttgtgcat caccacaacg cggttggcga tttccgcgac cacgcccatg tcgtgggtga    157200
     tcagcagaac agccagcccg cgccgctggc aaagagactt aagcagcgca ataatctgcg    157260
     cctgcacgga cacatccaat gccgaggtcg gctcatcggc aatcagcagg tcgggatcgg    157320
     cggccacggc cagcgcaatc accacccgtt ggcgcattcc accggaaaat tcatgcggat    157380
     aggcatccag ccgccgtgct ggctcatcaa tacccacctc acgcaacagg tctatcgccc    157440
     tttgccgcgc ctgcccctga tccagcggca ggtggcggcg aatggtttca atcagctgtt    157500
     gaccaatggt gtaaagcgga ttgaggctga ccagcgggtc ttgaaacacg gtgccgatcc    157560
     gccgtccgcg caaagtttcc agcgctttgt caccgaggtt atcaatccgc tcgccttgca    157620
     ggtggatttc gccagaggtg atgcggccgg ggggatcaat caggccaatg atcgcagctc    157680
     cggtcatgga tttgccagcg ccggattcgc caatcacgcc cagcacttcg ccacgggcaa    157740
     tggtgagcga taggtcatcg actgcacgaa aattgccatc aaaaccggga aaatccacgc    157800
     tcagactatt gatacgcaga acgggttttg ttttggataa agacaggctc atcggcgatt    157860
     gttcctcagg cgcgggttga gcgcatcgcg caagcggtct cccaacagat tgacggacag    157920
     ggccagcaga accagcgtgg cagcgggaaa accgataatc caccattccc ccgaaaacag    157980
     gaattgctgg ccaatgcgga tcagcgtacc aagcgacggc cgcgtgggcg gcacgccaac    158040
     accaagatag gacagggttg cctcttcaat gacagcaagc gccagaccga tggtggcaat    158100
     caccagagcc ggcccggcaa tattgggcag gatatgcgtg agcagaatgc ggctgcggct    158160
     gacgccgatg agctttgcag ccgccacata atccttgcgt ttttccacca gcacggcccc    158220
     gcgcacggtg cgggcaaatt ggggccagtt ggaaaagccg atggcgaaaa tcagaatcca    158280
     caccgcagcc tgttcctgct gtgatgccgg aatgatgccg tgggcaatgc caaagatcag    158340
     cagggcgacc agaatggtcg ggaaggtcag ctgcgcatcg gcaacgcgca tgatcacggc    158400
     atccacggca ttgcctgcgt aaccgctgat tagccccgca ccaacaccca aagccagcga    158460
     taaaagcgtg gcggaaaagg caaccagcaa ggacacccgg ctgccataga gaatggacga    158520
     gagaatatca cggccctgat tgtctgtgcc cagccaaaac actttgcaac taaaggcatt    158580
     ggcggccatg ggcggtgtca tgccatccat caaatccagc gttgccggat tgaacggatc    158640
     atggggcgca agaagcgggg caaacaaggc agccagcacc aacacgacgg ccaaggcacc    158700
     cgccaagatc gtgacggggg aaatcctgcg ccacctgtgg cgtttcgaaa aaggacgtag    158760
     ggtttgggtg gtcatggcat cactccgtgc ccgtgcgcac aatccgcaaa cgcggatcaa    158820
     cagcgtaata gaggccatca acaatcagat tgatgagcac aaacagagcc gagataaaca    158880
     ccagataagc cgccatcact ggcacatcca cggactgcac cgaattgatg aacagggagc    158940
     caacacccgg ccattgaaac accgtctccg tcaccacggc aaaggcgatg accgagccaa    159000
     attgcaggcc agccacagtg atgaccggca ccagcgtatt tttcaaagca tgaccaaagt    159060
     ggatgctgcg gcgggacagg cctctggcgc gggcaaagcg gatataatcc tgccgcagca    159120
     cctccagcat ttctgcccgg atcagccgca tcagcatggt catctgaaag agcgacaggg    159180
     tgatggcggg caagatcagc gagcgccagc ccgaaagggt caaaaggccc gtggtccacc    159240
     agccaagctt gaccgtttca ccccgtccga aagacggcag ccagccaagc tgcaccgaaa    159300
     agactgcgat caggccaatg ccgattaaaa acgtgggcag cgaaacacca accagcgaca    159360
     gggtcatgat tgcatgggtc aaaacaccct tgggccgcaa agcacaataa acgccgaaaa    159420
     gaccgccaaa cagcagcgca atcaggctgg atgccgtggc aagctccagc gtggcgggca    159480
     atcgttcaaa aatcatccgg gtgacaggtt cttgctgttt gtaggacgtg ccgaaatcgc    159540
     cgctgatgcc gcgcttgaga aaggtgagaa actggatggg cacgggctga tccaaaccaa    159600
     gccgcgcctt aagctcaacc ctttcatcca gccgcgtttc ctgactggtc agcgattcca    159660
     agggatcgcc aacaaagcgg atcacagcaa aggcaatcag cgccaccgcc agcatgacgc    159720
     ctatggattg aaaaaaccgt ctgagaataa aacctgccat gcatcctatc caatcatcca    159780
     gcgccgggcg tttgagaaac cgctcggcgc tgtcaatgta ttgccttaca agattatccc    159840
     acccccattg ggcggggtga caaaggttaa ctgcctgttg tgccgcggtt aaaccgaggt    159900
     gtgttattgg ttggaatttc aagaccaaaa ccgtcgcgca cagcccaggc aatgatctga    159960
     ttgtgcagcg gcagatatag atgctggtcc ttcacgtagg tccaaagctc agagatggtt    160020
     ttatcgcgct tggccacatc cacctctgtt cccagagatt cgattttcgc atcaatggcg    160080
     gcatccgaga aataggtggc attccacgcg ccgtagtgat cgttgcgcga atggatcagg    160140
     tcgttgaaat tataggcact atcataggtc ggaacacccc agccgtagag gaagaagtca    160200
     gatttccgat ctgccagcag cggagaatgc tgggtgaagg gccgtgatgc cagcgtgacc    160260
     ttcacgccaa tgcgacccag aaagccgacg acggcttgag aaatcgcctc gtcattcaca    160320
     tagcggttgt tgggcgtatc cagcgtgatg gtgaagccgt ccgggtagcc agcttctgtc    160380
     agcagtgcct ttgctttggc aatgtctggc ttggaatagg tgtccagcgc cggtgtccag    160440
     ccatgcacaa acggcggaac aataatgccg gttggcacgg cattgccacg cagcaccacg    160500
     gttttcaggg cttcgcggtc aatggccaga tcaaaggctt cgcgcacgcg caggtcgctc    160560
     aacgggttct tgtccttggc attcgacgat gccagagggg ccttgtccaa tcgatagccg    160620
     aggaagatcg agcgattttc cggggtggtc agcagtttga caccggatgt tttcttcagg    160680
     cgctcaatat cctgcacagg cacatcctgc acaaaatcca cttcgccgga gagcaaggcg    160740
     gcaatgcgcg tggcgttgtc ggcaatcggc gtgtagacga tttccgtaat gccctgattt    160800
     ttctcacccc aataggcagg gttggcttct agtacggtgc gaacacccac ttcacgggat    160860
     ttcagaatat agggtccgct gccattggcg ttgcgcacag caaaattgtc tttggaggct    160920
     gcggcatctt gcacctccag cgcattgttc ttttctgccc agctcttgct gagaatatcg    160980
     gtgcctgtga ggttgttggg atagatcagg ttgggggcac gcaacgtcac ctcaacctta    161040
     tcctcgccaa ctgcctttac atccacaaca tcggcatgca attgccgcag cttggatttg    161100
     tccgagcggg cgcgattgat ggaaaacacc acatcttctg ccgtcagagc ggagccgtca    161160
     tgaaacttga cgcccttgcg gatggtgaac acccaggttg ccggagcgcc atccttaacc    161220
     ttccattctg tcgcaagcct tggctccaac gcgcccttgg catcgcgggt gacaagcgtg    161280
     tcata