(data stored in ACNUC8465 zone)

EMBL: CP000644

ID   CP000644; SV 1; circular; genomic DNA; STD; PRO; 4702402 BP.
XX
AC   CP000644;
XX
PR   Project:PRJNA16723;
XX
DT   08-APR-2007 (Rel. 91, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Aeromonas salmonicida subsp. salmonicida A449, complete genome.
XX
KW   .
XX
OS   Aeromonas salmonicida subsp. salmonicida A449
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Aeromonadales;
OC   Aeromonadaceae; Aeromonas.
XX
RN   [1]
RP   1-4702402
RA   Reith M.E., Singh R.K., Curtis B., Boyd J., Bouevitch A., Kimball J.,
RA   Munholland J., Murphy C., Sarty D., Williams J., Nash J., Johnson S.,
RA   Brown L.;
RT   "The genome sequence of Aeromonas salmonicida subsp. salmonicida A449";
RL   Unpublished.
XX
RN   [2]
RP   1-4702402
RA   Reith M.E., Singh R.K., Curtis B., Boyd J., Bouevitch A., Kimball J.,
RA   Munholland J., Murphy C., Sarty D., Williams J., Nash J., Johnson S.,
RA   Brown L.;
RT   ;
RL   Submitted (23-MAR-2007) to the INSDC.
RL   NRC Institute for Marine Biosciences, 1411 Oxford St., Halifax, Nova Scotia
RL   B3H 3Z1, Canada
XX
DR   MD5; a33cee64a74f7f3ab9aae519ad847c22.
DR   BioSample; SAMN02603664.
DR   EnsemblGenomes-Gn; ASA_0026.
DR   EnsemblGenomes-Gn; ASA_0027.
DR   EnsemblGenomes-Gn; ASA_0028.
DR   EnsemblGenomes-Gn; ASA_0029.
DR   EnsemblGenomes-Gn; ASA_0079.
DR   EnsemblGenomes-Gn; ASA_0080.
DR   EnsemblGenomes-Gn; ASA_0081.
DR   EnsemblGenomes-Gn; ASA_0082.
DR   EnsemblGenomes-Gn; ASA_0083.
DR   EnsemblGenomes-Gn; ASA_0180.
DR   EnsemblGenomes-Gn; ASA_0230.
DR   EnsemblGenomes-Gn; ASA_0273.
DR   EnsemblGenomes-Gn; ASA_0274.
DR   EnsemblGenomes-Gn; ASA_0276.
DR   EnsemblGenomes-Gn; ASA_0295.
DR   EnsemblGenomes-Gn; ASA_0296.
DR   EnsemblGenomes-Gn; ASA_0297.
DR   EnsemblGenomes-Gn; ASA_0298.
DR   EnsemblGenomes-Gn; ASA_0440.
DR   EnsemblGenomes-Gn; ASA_0441.
DR   EnsemblGenomes-Gn; ASA_0442.
DR   EnsemblGenomes-Gn; ASA_0443.
DR   EnsemblGenomes-Gn; ASA_0457.
DR   EnsemblGenomes-Gn; ASA_0491.
DR   EnsemblGenomes-Gn; ASA_0492.
DR   EnsemblGenomes-Gn; ASA_0493.
DR   EnsemblGenomes-Gn; ASA_0494.
DR   EnsemblGenomes-Gn; ASA_0495.
DR   EnsemblGenomes-Gn; ASA_0748.
DR   EnsemblGenomes-Gn; ASA_0749.
DR   EnsemblGenomes-Gn; ASA_0750.
DR   EnsemblGenomes-Gn; ASA_0751.
DR   EnsemblGenomes-Gn; ASA_0752.
DR   EnsemblGenomes-Gn; ASA_0753.
DR   EnsemblGenomes-Gn; ASA_0754.
DR   EnsemblGenomes-Gn; ASA_0755.
DR   EnsemblGenomes-Gn; ASA_0801.
DR   EnsemblGenomes-Gn; ASA_0802.
DR   EnsemblGenomes-Gn; ASA_0803.
DR   EnsemblGenomes-Gn; ASA_0804.
DR   EnsemblGenomes-Gn; ASA_0805.
DR   EnsemblGenomes-Gn; ASA_0847.
DR   EnsemblGenomes-Gn; ASA_0848.
DR   EnsemblGenomes-Gn; ASA_0859.
DR   EnsemblGenomes-Gn; ASA_0860.
DR   EnsemblGenomes-Gn; ASA_0861.
DR   EnsemblGenomes-Gn; ASA_0862.
DR   EnsemblGenomes-Gn; ASA_0863.
DR   EnsemblGenomes-Gn; ASA_0868.
DR   EnsemblGenomes-Gn; ASA_0869.
DR   EnsemblGenomes-Gn; ASA_0870.
DR   EnsemblGenomes-Gn; ASA_0871.
DR   EnsemblGenomes-Gn; ASA_1006.
DR   EnsemblGenomes-Gn; ASA_1007.
DR   EnsemblGenomes-Gn; ASA_1155.
DR   EnsemblGenomes-Gn; ASA_1156.
DR   EnsemblGenomes-Gn; ASA_1157.
DR   EnsemblGenomes-Gn; ASA_1158.
DR   EnsemblGenomes-Gn; ASA_1159.
DR   EnsemblGenomes-Gn; ASA_1160.
DR   EnsemblGenomes-Gn; ASA_1161.
DR   EnsemblGenomes-Gn; ASA_1162.
DR   EnsemblGenomes-Gn; ASA_1171.
DR   EnsemblGenomes-Gn; ASA_1302.
DR   EnsemblGenomes-Gn; ASA_1315.
DR   EnsemblGenomes-Gn; ASA_1517.
DR   EnsemblGenomes-Gn; ASA_1558.
DR   EnsemblGenomes-Gn; ASA_1559.
DR   EnsemblGenomes-Gn; ASA_1560.
DR   EnsemblGenomes-Gn; ASA_1708.
DR   EnsemblGenomes-Gn; ASA_1739.
DR   EnsemblGenomes-Gn; ASA_1785.
DR   EnsemblGenomes-Gn; ASA_1807.
DR   EnsemblGenomes-Gn; ASA_2187.
DR   EnsemblGenomes-Gn; ASA_2188.
DR   EnsemblGenomes-Gn; ASA_2189.
DR   EnsemblGenomes-Gn; ASA_2244.
DR   EnsemblGenomes-Gn; ASA_2245.
DR   EnsemblGenomes-Gn; ASA_2246.
DR   EnsemblGenomes-Gn; ASA_2247.
DR   EnsemblGenomes-Gn; ASA_2248.
DR   EnsemblGenomes-Gn; ASA_2249.
DR   EnsemblGenomes-Gn; ASA_2250.
DR   EnsemblGenomes-Gn; ASA_2307.
DR   EnsemblGenomes-Gn; ASA_2450.
DR   EnsemblGenomes-Gn; ASA_2451.
DR   EnsemblGenomes-Gn; ASA_2452.
DR   EnsemblGenomes-Gn; ASA_2473.
DR   EnsemblGenomes-Gn; ASA_2475.
DR   EnsemblGenomes-Gn; ASA_2476.
DR   EnsemblGenomes-Gn; ASA_2524.
DR   EnsemblGenomes-Gn; ASA_2801.
DR   EnsemblGenomes-Gn; ASA_2923.
DR   EnsemblGenomes-Gn; ASA_3048.
DR   EnsemblGenomes-Gn; ASA_3049.
DR   EnsemblGenomes-Gn; ASA_3097.
DR   EnsemblGenomes-Gn; ASA_3098.
DR   EnsemblGenomes-Gn; ASA_3214.
DR   EnsemblGenomes-Gn; ASA_3242.
DR   EnsemblGenomes-Gn; ASA_3274.
DR   EnsemblGenomes-Gn; ASA_3275.
DR   EnsemblGenomes-Gn; ASA_3276.
DR   EnsemblGenomes-Gn; ASA_3422.
DR   EnsemblGenomes-Gn; ASA_3423.
DR   EnsemblGenomes-Gn; ASA_3424.
DR   EnsemblGenomes-Gn; ASA_3425.
DR   EnsemblGenomes-Gn; ASA_3460.
DR   EnsemblGenomes-Gn; ASA_3595.
DR   EnsemblGenomes-Gn; ASA_3596.
DR   EnsemblGenomes-Gn; ASA_3597.
DR   EnsemblGenomes-Gn; ASA_3598.
DR   EnsemblGenomes-Gn; ASA_3599.
DR   EnsemblGenomes-Gn; ASA_3814.
DR   EnsemblGenomes-Gn; ASA_3815.
DR   EnsemblGenomes-Gn; ASA_3816.
DR   EnsemblGenomes-Gn; ASA_3817.
DR   EnsemblGenomes-Gn; ASA_3827.
DR   EnsemblGenomes-Gn; ASA_4056.
DR   EnsemblGenomes-Gn; ASA_4057.
DR   EnsemblGenomes-Gn; ASA_4058.
DR   EnsemblGenomes-Gn; ASA_4059.
DR   EnsemblGenomes-Gn; ASA_4060.
DR   EnsemblGenomes-Gn; ASA_4186.
DR   EnsemblGenomes-Gn; ASA_4187.
DR   EnsemblGenomes-Gn; ASA_4188.
DR   EnsemblGenomes-Gn; ASA_4189.
DR   EnsemblGenomes-Gn; ASA_4190.
DR   EnsemblGenomes-Gn; ASA_4191.
DR   EnsemblGenomes-Gn; ASA_4192.
DR   EnsemblGenomes-Gn; ASA_4241.
DR   EnsemblGenomes-Gn; ASA_4242.
DR   EnsemblGenomes-Gn; ASA_4243.
DR   EnsemblGenomes-Gn; ASA_4244.
DR   EnsemblGenomes-Gn; ASA_4312.
DR   EnsemblGenomes-Gn; ASA_4313.
DR   EnsemblGenomes-Gn; ASA_4314.
DR   EnsemblGenomes-Gn; ASA_4315.
DR   EnsemblGenomes-Gn; ASA_4316.
DR   EnsemblGenomes-Gn; ASA_4317.
DR   EnsemblGenomes-Gn; EBG00001055667.
DR   EnsemblGenomes-Gn; EBG00001055668.
DR   EnsemblGenomes-Gn; EBG00001055669.
DR   EnsemblGenomes-Gn; EBG00001055670.
DR   EnsemblGenomes-Gn; EBG00001055671.
DR   EnsemblGenomes-Gn; EBG00001055672.
DR   EnsemblGenomes-Gn; EBG00001055673.
DR   EnsemblGenomes-Gn; EBG00001055674.
DR   EnsemblGenomes-Gn; EBG00001055675.
DR   EnsemblGenomes-Gn; EBG00001055676.
DR   EnsemblGenomes-Gn; EBG00001055677.
DR   EnsemblGenomes-Gn; EBG00001055678.
DR   EnsemblGenomes-Gn; EBG00001055679.
DR   EnsemblGenomes-Gn; EBG00001055680.
DR   EnsemblGenomes-Gn; EBG00001055681.
DR   EnsemblGenomes-Gn; EBG00001055682.
DR   EnsemblGenomes-Gn; EBG00001055683.
DR   EnsemblGenomes-Gn; EBG00001055684.
DR   EnsemblGenomes-Gn; EBG00001055685.
DR   EnsemblGenomes-Gn; EBG00001055686.
DR   EnsemblGenomes-Gn; EBG00001055687.
DR   EnsemblGenomes-Gn; EBG00001055688.
DR   EnsemblGenomes-Gn; EBG00001055689.
DR   EnsemblGenomes-Gn; EBG00001055690.
DR   EnsemblGenomes-Gn; EBG00001055691.
DR   EnsemblGenomes-Gn; EBG00001055692.
DR   EnsemblGenomes-Gn; EBG00001055693.
DR   EnsemblGenomes-Gn; EBG00001055694.
DR   EnsemblGenomes-Gn; EBG00001055695.
DR   EnsemblGenomes-Gn; EBG00001055696.
DR   EnsemblGenomes-Gn; EBG00001055697.
DR   EnsemblGenomes-Gn; EBG00001055698.
DR   EnsemblGenomes-Gn; EBG00001055699.
DR   EnsemblGenomes-Gn; EBG00001055700.
DR   EnsemblGenomes-Gn; EBG00001055701.
DR   EnsemblGenomes-Gn; EBG00001055702.
DR   EnsemblGenomes-Gn; EBG00001055703.
DR   EnsemblGenomes-Gn; EBG00001055704.
DR   EnsemblGenomes-Gn; EBG00001055705.
DR   EnsemblGenomes-Gn; EBG00001055706.
DR   EnsemblGenomes-Gn; EBG00001055707.
DR   EnsemblGenomes-Gn; EBG00001055708.
DR   EnsemblGenomes-Gn; EBG00001055709.
DR   EnsemblGenomes-Gn; EBG00001055710.
DR   EnsemblGenomes-Gn; EBG00001055711.
DR   EnsemblGenomes-Gn; EBG00001055712.
DR   EnsemblGenomes-Gn; EBG00001055713.
DR   EnsemblGenomes-Gn; EBG00001055714.
DR   EnsemblGenomes-Gn; EBG00001055715.
DR   EnsemblGenomes-Gn; EBG00001055716.
DR   EnsemblGenomes-Gn; EBG00001055717.
DR   EnsemblGenomes-Gn; EBG00001055718.
DR   EnsemblGenomes-Gn; EBG00001055719.
DR   EnsemblGenomes-Gn; EBG00001055720.
DR   EnsemblGenomes-Gn; EBG00001055721.
DR   EnsemblGenomes-Gn; EBG00001055722.
DR   EnsemblGenomes-Gn; EBG00001055723.
DR   EnsemblGenomes-Gn; EBG00001055724.
DR   EnsemblGenomes-Gn; EBG00001055725.
DR   EnsemblGenomes-Gn; EBG00001055726.
DR   EnsemblGenomes-Gn; EBG00001055727.
DR   EnsemblGenomes-Gn; EBG00001055728.
DR   EnsemblGenomes-Gn; EBG00001055729.
DR   EnsemblGenomes-Gn; EBG00001055730.
DR   EnsemblGenomes-Gn; EBG00001055731.
DR   EnsemblGenomes-Gn; EBG00001055732.
DR   EnsemblGenomes-Gn; EBG00001055733.
DR   EnsemblGenomes-Gn; EBG00001055734.
DR   EnsemblGenomes-Gn; EBG00001055735.
DR   EnsemblGenomes-Gn; EBG00001055736.
DR   EnsemblGenomes-Gn; EBG00001055737.
DR   EnsemblGenomes-Gn; EBG00001055738.
DR   EnsemblGenomes-Gn; EBG00001055739.
DR   EnsemblGenomes-Gn; EBG00001055740.
DR   EnsemblGenomes-Gn; EBG00001055741.
DR   EnsemblGenomes-Gn; EBG00001055742.
DR   EnsemblGenomes-Gn; EBG00001055743.
DR   EnsemblGenomes-Gn; EBG00001055744.
DR   EnsemblGenomes-Gn; EBG00001055745.
DR   EnsemblGenomes-Gn; EBG00001055746.
DR   EnsemblGenomes-Gn; EBG00001055747.
DR   EnsemblGenomes-Gn; EBG00001055748.
DR   EnsemblGenomes-Gn; EBG00001055749.
DR   EnsemblGenomes-Gn; EBG00001055750.
DR   EnsemblGenomes-Gn; EBG00001055751.
DR   EnsemblGenomes-Gn; EBG00001055752.
DR   EnsemblGenomes-Gn; EBG00001055753.
DR   EnsemblGenomes-Gn; EBG00001055754.
DR   EnsemblGenomes-Gn; EBG00001055755.
DR   EnsemblGenomes-Gn; EBG00001055756.
DR   EnsemblGenomes-Gn; EBG00001055757.
DR   EnsemblGenomes-Gn; EBG00001055758.
DR   EnsemblGenomes-Gn; EBG00001055759.
DR   EnsemblGenomes-Gn; EBG00001055760.
DR   EnsemblGenomes-Gn; EBG00001055761.
DR   EnsemblGenomes-Gn; EBG00001055762.
DR   EnsemblGenomes-Gn; EBG00001055763.
DR   EnsemblGenomes-Gn; EBG00001055764.
DR   EnsemblGenomes-Gn; EBG00001055765.
DR   EnsemblGenomes-Gn; EBG00001055766.
DR   EnsemblGenomes-Gn; EBG00001055767.
DR   EnsemblGenomes-Gn; EBG00001055768.
DR   EnsemblGenomes-Gn; EBG00001055769.
DR   EnsemblGenomes-Gn; EBG00001055770.
DR   EnsemblGenomes-Gn; EBG00001055771.
DR   EnsemblGenomes-Gn; EBG00001055772.
DR   EnsemblGenomes-Gn; EBG00001055773.
DR   EnsemblGenomes-Gn; EBG00001055774.
DR   EnsemblGenomes-Gn; EBG00001055775.
DR   EnsemblGenomes-Gn; EBG00001055776.
DR   EnsemblGenomes-Gn; EBG00001055777.
DR   EnsemblGenomes-Gn; EBG00001055778.
DR   EnsemblGenomes-Gn; EBG00001055779.
DR   EnsemblGenomes-Gn; EBG00001055780.
DR   EnsemblGenomes-Gn; EBG00001055781.
DR   EnsemblGenomes-Gn; EBG00001055782.
DR   EnsemblGenomes-Gn; EBG00001055783.
DR   EnsemblGenomes-Gn; EBG00001055784.
DR   EnsemblGenomes-Gn; EBG00001055785.
DR   EnsemblGenomes-Gn; EBG00001055786.
DR   EnsemblGenomes-Gn; EBG00001055787.
DR   EnsemblGenomes-Gn; EBG00001055788.
DR   EnsemblGenomes-Gn; EBG00001055789.
DR   EnsemblGenomes-Gn; EBG00001055790.
DR   EnsemblGenomes-Gn; EBG00001055791.
DR   EnsemblGenomes-Gn; EBG00001055792.
DR   EnsemblGenomes-Gn; EBG00001055793.
DR   EnsemblGenomes-Gn; EBG00001055794.
DR   EnsemblGenomes-Gn; EBG00001055795.
DR   EnsemblGenomes-Gn; EBG00001055796.
DR   EnsemblGenomes-Gn; EBG00001055797.
DR   EnsemblGenomes-Gn; EBG00001055798.
DR   EnsemblGenomes-Gn; EBG00001055799.
DR   EnsemblGenomes-Gn; EBG00001055800.
DR   EnsemblGenomes-Gn; EBG00001055801.
DR   EnsemblGenomes-Gn; EBG00001055802.
DR   EnsemblGenomes-Gn; EBG00001055803.
DR   EnsemblGenomes-Gn; EBG00001055804.
DR   EnsemblGenomes-Gn; EBG00001055805.
DR   EnsemblGenomes-Gn; EBG00001055806.
DR   EnsemblGenomes-Gn; EBG00001055807.
DR   EnsemblGenomes-Gn; EBG00001055808.
DR   EnsemblGenomes-Gn; EBG00001055809.
DR   EnsemblGenomes-Gn; EBG00001055810.
DR   EnsemblGenomes-Gn; EBG00001055811.
DR   EnsemblGenomes-Gn; EBG00001055812.
DR   EnsemblGenomes-Gn; EBG00001055813.
DR   EnsemblGenomes-Gn; EBG00001055814.
DR   EnsemblGenomes-Gn; EBG00001055815.
DR   EnsemblGenomes-Gn; EBG00001055816.
DR   EnsemblGenomes-Gn; EBG00001055817.
DR   EnsemblGenomes-Gn; EBG00001055818.
DR   EnsemblGenomes-Gn; EBG00001055819.
DR   EnsemblGenomes-Gn; EBG00001055820.
DR   EnsemblGenomes-Gn; EBG00001055821.
DR   EnsemblGenomes-Gn; EBG00001055822.
DR   EnsemblGenomes-Gn; EBG00001055823.
DR   EnsemblGenomes-Gn; EBG00001055824.
DR   EnsemblGenomes-Gn; EBG00001055825.
DR   EnsemblGenomes-Gn; EBG00001055826.
DR   EnsemblGenomes-Gn; EBG00001055827.
DR   EnsemblGenomes-Gn; EBG00001055828.
DR   EnsemblGenomes-Gn; EBG00001055829.
DR   EnsemblGenomes-Gn; EBG00001055830.
DR   EnsemblGenomes-Gn; EBG00001055831.
DR   EnsemblGenomes-Gn; EBG00001055832.
DR   EnsemblGenomes-Gn; EBG00001055833.
DR   EnsemblGenomes-Gn; EBG00001055834.
DR   EnsemblGenomes-Gn; EBG00001055835.
DR   EnsemblGenomes-Gn; EBG00001055836.
DR   EnsemblGenomes-Gn; EBG00001055837.
DR   EnsemblGenomes-Gn; EBG00001055838.
DR   EnsemblGenomes-Tr; ASA_0026-1.
DR   EnsemblGenomes-Tr; ASA_0027-1.
DR   EnsemblGenomes-Tr; ASA_0028-1.
DR   EnsemblGenomes-Tr; ASA_0029-1.
DR   EnsemblGenomes-Tr; ASA_0079-1.
DR   EnsemblGenomes-Tr; ASA_0080-1.
DR   EnsemblGenomes-Tr; ASA_0081-1.
DR   EnsemblGenomes-Tr; ASA_0082-1.
DR   EnsemblGenomes-Tr; ASA_0083-1.
DR   EnsemblGenomes-Tr; ASA_0180-1.
DR   EnsemblGenomes-Tr; ASA_0230-1.
DR   EnsemblGenomes-Tr; ASA_0273-1.
DR   EnsemblGenomes-Tr; ASA_0274-1.
DR   EnsemblGenomes-Tr; ASA_0276-1.
DR   EnsemblGenomes-Tr; ASA_0295-1.
DR   EnsemblGenomes-Tr; ASA_0296-1.
DR   EnsemblGenomes-Tr; ASA_0297-1.
DR   EnsemblGenomes-Tr; ASA_0298-1.
DR   EnsemblGenomes-Tr; ASA_0440-1.
DR   EnsemblGenomes-Tr; ASA_0441-1.
DR   EnsemblGenomes-Tr; ASA_0442-1.
DR   EnsemblGenomes-Tr; ASA_0443-1.
DR   EnsemblGenomes-Tr; ASA_0457-1.
DR   EnsemblGenomes-Tr; ASA_0491-1.
DR   EnsemblGenomes-Tr; ASA_0492-1.
DR   EnsemblGenomes-Tr; ASA_0493-1.
DR   EnsemblGenomes-Tr; ASA_0494-1.
DR   EnsemblGenomes-Tr; ASA_0495-1.
DR   EnsemblGenomes-Tr; ASA_0748-1.
DR   EnsemblGenomes-Tr; ASA_0749-1.
DR   EnsemblGenomes-Tr; ASA_0750-1.
DR   EnsemblGenomes-Tr; ASA_0751-1.
DR   EnsemblGenomes-Tr; ASA_0752-1.
DR   EnsemblGenomes-Tr; ASA_0753-1.
DR   EnsemblGenomes-Tr; ASA_0754-1.
DR   EnsemblGenomes-Tr; ASA_0755-1.
DR   EnsemblGenomes-Tr; ASA_0801-1.
DR   EnsemblGenomes-Tr; ASA_0802-1.
DR   EnsemblGenomes-Tr; ASA_0803-1.
DR   EnsemblGenomes-Tr; ASA_0804-1.
DR   EnsemblGenomes-Tr; ASA_0805-1.
DR   EnsemblGenomes-Tr; ASA_0847-1.
DR   EnsemblGenomes-Tr; ASA_0848-1.
DR   EnsemblGenomes-Tr; ASA_0859-1.
DR   EnsemblGenomes-Tr; ASA_0860-1.
DR   EnsemblGenomes-Tr; ASA_0861-1.
DR   EnsemblGenomes-Tr; ASA_0862-1.
DR   EnsemblGenomes-Tr; ASA_0863-1.
DR   EnsemblGenomes-Tr; ASA_0868-1.
DR   EnsemblGenomes-Tr; ASA_0869-1.
DR   EnsemblGenomes-Tr; ASA_0870-1.
DR   EnsemblGenomes-Tr; ASA_0871-1.
DR   EnsemblGenomes-Tr; ASA_1006-1.
DR   EnsemblGenomes-Tr; ASA_1007-1.
DR   EnsemblGenomes-Tr; ASA_1155-1.
DR   EnsemblGenomes-Tr; ASA_1156-1.
DR   EnsemblGenomes-Tr; ASA_1157-1.
DR   EnsemblGenomes-Tr; ASA_1158-1.
DR   EnsemblGenomes-Tr; ASA_1159-1.
DR   EnsemblGenomes-Tr; ASA_1160-1.
DR   EnsemblGenomes-Tr; ASA_1161-1.
DR   EnsemblGenomes-Tr; ASA_1162-1.
DR   EnsemblGenomes-Tr; ASA_1171-1.
DR   EnsemblGenomes-Tr; ASA_1302-1.
DR   EnsemblGenomes-Tr; ASA_1315-1.
DR   EnsemblGenomes-Tr; ASA_1517-1.
DR   EnsemblGenomes-Tr; ASA_1558-1.
DR   EnsemblGenomes-Tr; ASA_1559-1.
DR   EnsemblGenomes-Tr; ASA_1560-1.
DR   EnsemblGenomes-Tr; ASA_1708-1.
DR   EnsemblGenomes-Tr; ASA_1739-1.
DR   EnsemblGenomes-Tr; ASA_1785-1.
DR   EnsemblGenomes-Tr; ASA_1807-1.
DR   EnsemblGenomes-Tr; ASA_2187-1.
DR   EnsemblGenomes-Tr; ASA_2188-1.
DR   EnsemblGenomes-Tr; ASA_2189-1.
DR   EnsemblGenomes-Tr; ASA_2244-1.
DR   EnsemblGenomes-Tr; ASA_2245-1.
DR   EnsemblGenomes-Tr; ASA_2246-1.
DR   EnsemblGenomes-Tr; ASA_2247-1.
DR   EnsemblGenomes-Tr; ASA_2248-1.
DR   EnsemblGenomes-Tr; ASA_2249-1.
DR   EnsemblGenomes-Tr; ASA_2250-1.
DR   EnsemblGenomes-Tr; ASA_2307-1.
DR   EnsemblGenomes-Tr; ASA_2450-1.
DR   EnsemblGenomes-Tr; ASA_2451-1.
DR   EnsemblGenomes-Tr; ASA_2452-1.
DR   EnsemblGenomes-Tr; ASA_2473-1.
DR   EnsemblGenomes-Tr; ASA_2475-1.
DR   EnsemblGenomes-Tr; ASA_2476-1.
DR   EnsemblGenomes-Tr; ASA_2524-1.
DR   EnsemblGenomes-Tr; ASA_2801-1.
DR   EnsemblGenomes-Tr; ASA_2923-1.
DR   EnsemblGenomes-Tr; ASA_3048-1.
DR   EnsemblGenomes-Tr; ASA_3049-1.
DR   EnsemblGenomes-Tr; ASA_3097-1.
DR   EnsemblGenomes-Tr; ASA_3098-1.
DR   EnsemblGenomes-Tr; ASA_3214-1.
DR   EnsemblGenomes-Tr; ASA_3242-1.
DR   EnsemblGenomes-Tr; ASA_3274-1.
DR   EnsemblGenomes-Tr; ASA_3275-1.
DR   EnsemblGenomes-Tr; ASA_3276-1.
DR   EnsemblGenomes-Tr; ASA_3422-1.
DR   EnsemblGenomes-Tr; ASA_3423-1.
DR   EnsemblGenomes-Tr; ASA_3424-1.
DR   EnsemblGenomes-Tr; ASA_3425-1.
DR   EnsemblGenomes-Tr; ASA_3460-1.
DR   EnsemblGenomes-Tr; ASA_3595-1.
DR   EnsemblGenomes-Tr; ASA_3596-1.
DR   EnsemblGenomes-Tr; ASA_3597-1.
DR   EnsemblGenomes-Tr; ASA_3598-1.
DR   EnsemblGenomes-Tr; ASA_3599-1.
DR   EnsemblGenomes-Tr; ASA_3814-1.
DR   EnsemblGenomes-Tr; ASA_3815-1.
DR   EnsemblGenomes-Tr; ASA_3816-1.
DR   EnsemblGenomes-Tr; ASA_3817-1.
DR   EnsemblGenomes-Tr; ASA_3827-1.
DR   EnsemblGenomes-Tr; ASA_4056-1.
DR   EnsemblGenomes-Tr; ASA_4057-1.
DR   EnsemblGenomes-Tr; ASA_4058-1.
DR   EnsemblGenomes-Tr; ASA_4059-1.
DR   EnsemblGenomes-Tr; ASA_4060-1.
DR   EnsemblGenomes-Tr; ASA_4186-1.
DR   EnsemblGenomes-Tr; ASA_4187-1.
DR   EnsemblGenomes-Tr; ASA_4188-1.
DR   EnsemblGenomes-Tr; ASA_4189-1.
DR   EnsemblGenomes-Tr; ASA_4190-1.
DR   EnsemblGenomes-Tr; ASA_4191-1.
DR   EnsemblGenomes-Tr; ASA_4192-1.
DR   EnsemblGenomes-Tr; ASA_4241-1.
DR   EnsemblGenomes-Tr; ASA_4242-1.
DR   EnsemblGenomes-Tr; ASA_4243-1.
DR   EnsemblGenomes-Tr; ASA_4244-1.
DR   EnsemblGenomes-Tr; ASA_4312-1.
DR   EnsemblGenomes-Tr; ASA_4313-1.
DR   EnsemblGenomes-Tr; ASA_4314-1.
DR   EnsemblGenomes-Tr; ASA_4315-1.
DR   EnsemblGenomes-Tr; ASA_4316-1.
DR   EnsemblGenomes-Tr; ASA_4317-1.
DR   EnsemblGenomes-Tr; EBT00001658192.
DR   EnsemblGenomes-Tr; EBT00001658193.
DR   EnsemblGenomes-Tr; EBT00001658194.
DR   EnsemblGenomes-Tr; EBT00001658195.
DR   EnsemblGenomes-Tr; EBT00001658196.
DR   EnsemblGenomes-Tr; EBT00001658197.
DR   EnsemblGenomes-Tr; EBT00001658198.
DR   EnsemblGenomes-Tr; EBT00001658199.
DR   EnsemblGenomes-Tr; EBT00001658200.
DR   EnsemblGenomes-Tr; EBT00001658201.
DR   EnsemblGenomes-Tr; EBT00001658202.
DR   EnsemblGenomes-Tr; EBT00001658203.
DR   EnsemblGenomes-Tr; EBT00001658204.
DR   EnsemblGenomes-Tr; EBT00001658205.
DR   EnsemblGenomes-Tr; EBT00001658206.
DR   EnsemblGenomes-Tr; EBT00001658207.
DR   EnsemblGenomes-Tr; EBT00001658208.
DR   EnsemblGenomes-Tr; EBT00001658209.
DR   EnsemblGenomes-Tr; EBT00001658210.
DR   EnsemblGenomes-Tr; EBT00001658211.
DR   EnsemblGenomes-Tr; EBT00001658212.
DR   EnsemblGenomes-Tr; EBT00001658213.
DR   EnsemblGenomes-Tr; EBT00001658214.
DR   EnsemblGenomes-Tr; EBT00001658215.
DR   EnsemblGenomes-Tr; EBT00001658216.
DR   EnsemblGenomes-Tr; EBT00001658217.
DR   EnsemblGenomes-Tr; EBT00001658218.
DR   EnsemblGenomes-Tr; EBT00001658219.
DR   EnsemblGenomes-Tr; EBT00001658220.
DR   EnsemblGenomes-Tr; EBT00001658221.
DR   EnsemblGenomes-Tr; EBT00001658222.
DR   EnsemblGenomes-Tr; EBT00001658223.
DR   EnsemblGenomes-Tr; EBT00001658224.
DR   EnsemblGenomes-Tr; EBT00001658225.
DR   EnsemblGenomes-Tr; EBT00001658226.
DR   EnsemblGenomes-Tr; EBT00001658227.
DR   EnsemblGenomes-Tr; EBT00001658228.
DR   EnsemblGenomes-Tr; EBT00001658229.
DR   EnsemblGenomes-Tr; EBT00001658230.
DR   EnsemblGenomes-Tr; EBT00001658231.
DR   EnsemblGenomes-Tr; EBT00001658232.
DR   EnsemblGenomes-Tr; EBT00001658233.
DR   EnsemblGenomes-Tr; EBT00001658234.
DR   EnsemblGenomes-Tr; EBT00001658235.
DR   EnsemblGenomes-Tr; EBT00001658236.
DR   EnsemblGenomes-Tr; EBT00001658237.
DR   EnsemblGenomes-Tr; EBT00001658238.
DR   EnsemblGenomes-Tr; EBT00001658239.
DR   EnsemblGenomes-Tr; EBT00001658240.
DR   EnsemblGenomes-Tr; EBT00001658241.
DR   EnsemblGenomes-Tr; EBT00001658242.
DR   EnsemblGenomes-Tr; EBT00001658243.
DR   EnsemblGenomes-Tr; EBT00001658244.
DR   EnsemblGenomes-Tr; EBT00001658245.
DR   EnsemblGenomes-Tr; EBT00001658246.
DR   EnsemblGenomes-Tr; EBT00001658247.
DR   EnsemblGenomes-Tr; EBT00001658248.
DR   EnsemblGenomes-Tr; EBT00001658249.
DR   EnsemblGenomes-Tr; EBT00001658250.
DR   EnsemblGenomes-Tr; EBT00001658251.
DR   EnsemblGenomes-Tr; EBT00001658252.
DR   EnsemblGenomes-Tr; EBT00001658253.
DR   EnsemblGenomes-Tr; EBT00001658254.
DR   EnsemblGenomes-Tr; EBT00001658255.
DR   EnsemblGenomes-Tr; EBT00001658256.
DR   EnsemblGenomes-Tr; EBT00001658257.
DR   EnsemblGenomes-Tr; EBT00001658258.
DR   EnsemblGenomes-Tr; EBT00001658259.
DR   EnsemblGenomes-Tr; EBT00001658260.
DR   EnsemblGenomes-Tr; EBT00001658261.
DR   EnsemblGenomes-Tr; EBT00001658262.
DR   EnsemblGenomes-Tr; EBT00001658263.
DR   EnsemblGenomes-Tr; EBT00001658264.
DR   EnsemblGenomes-Tr; EBT00001658265.
DR   EnsemblGenomes-Tr; EBT00001658266.
DR   EnsemblGenomes-Tr; EBT00001658267.
DR   EnsemblGenomes-Tr; EBT00001658268.
DR   EnsemblGenomes-Tr; EBT00001658269.
DR   EnsemblGenomes-Tr; EBT00001658270.
DR   EnsemblGenomes-Tr; EBT00001658271.
DR   EnsemblGenomes-Tr; EBT00001658272.
DR   EnsemblGenomes-Tr; EBT00001658273.
DR   EnsemblGenomes-Tr; EBT00001658274.
DR   EnsemblGenomes-Tr; EBT00001658275.
DR   EnsemblGenomes-Tr; EBT00001658276.
DR   EnsemblGenomes-Tr; EBT00001658277.
DR   EnsemblGenomes-Tr; EBT00001658278.
DR   EnsemblGenomes-Tr; EBT00001658279.
DR   EnsemblGenomes-Tr; EBT00001658280.
DR   EnsemblGenomes-Tr; EBT00001658281.
DR   EnsemblGenomes-Tr; EBT00001658282.
DR   EnsemblGenomes-Tr; EBT00001658283.
DR   EnsemblGenomes-Tr; EBT00001658284.
DR   EnsemblGenomes-Tr; EBT00001658285.
DR   EnsemblGenomes-Tr; EBT00001658286.
DR   EnsemblGenomes-Tr; EBT00001658287.
DR   EnsemblGenomes-Tr; EBT00001658288.
DR   EnsemblGenomes-Tr; EBT00001658289.
DR   EnsemblGenomes-Tr; EBT00001658290.
DR   EnsemblGenomes-Tr; EBT00001658291.
DR   EnsemblGenomes-Tr; EBT00001658292.
DR   EnsemblGenomes-Tr; EBT00001658293.
DR   EnsemblGenomes-Tr; EBT00001658294.
DR   EnsemblGenomes-Tr; EBT00001658295.
DR   EnsemblGenomes-Tr; EBT00001658296.
DR   EnsemblGenomes-Tr; EBT00001658297.
DR   EnsemblGenomes-Tr; EBT00001658298.
DR   EnsemblGenomes-Tr; EBT00001658299.
DR   EnsemblGenomes-Tr; EBT00001658300.
DR   EnsemblGenomes-Tr; EBT00001658301.
DR   EnsemblGenomes-Tr; EBT00001658302.
DR   EnsemblGenomes-Tr; EBT00001658303.
DR   EnsemblGenomes-Tr; EBT00001658304.
DR   EnsemblGenomes-Tr; EBT00001658305.
DR   EnsemblGenomes-Tr; EBT00001658306.
DR   EnsemblGenomes-Tr; EBT00001658307.
DR   EnsemblGenomes-Tr; EBT00001658308.
DR   EnsemblGenomes-Tr; EBT00001658309.
DR   EnsemblGenomes-Tr; EBT00001658310.
DR   EnsemblGenomes-Tr; EBT00001658311.
DR   EnsemblGenomes-Tr; EBT00001658312.
DR   EnsemblGenomes-Tr; EBT00001658313.
DR   EnsemblGenomes-Tr; EBT00001658314.
DR   EnsemblGenomes-Tr; EBT00001658315.
DR   EnsemblGenomes-Tr; EBT00001658316.
DR   EnsemblGenomes-Tr; EBT00001658317.
DR   EnsemblGenomes-Tr; EBT00001658318.
DR   EnsemblGenomes-Tr; EBT00001658319.
DR   EnsemblGenomes-Tr; EBT00001658320.
DR   EnsemblGenomes-Tr; EBT00001658321.
DR   EnsemblGenomes-Tr; EBT00001658322.
DR   EnsemblGenomes-Tr; EBT00001658323.
DR   EnsemblGenomes-Tr; EBT00001658324.
DR   EnsemblGenomes-Tr; EBT00001658325.
DR   EnsemblGenomes-Tr; EBT00001658326.
DR   EnsemblGenomes-Tr; EBT00001658327.
DR   EnsemblGenomes-Tr; EBT00001658328.
DR   EnsemblGenomes-Tr; EBT00001658329.
DR   EnsemblGenomes-Tr; EBT00001658330.
DR   EnsemblGenomes-Tr; EBT00001658331.
DR   EnsemblGenomes-Tr; EBT00001658332.
DR   EnsemblGenomes-Tr; EBT00001658333.
DR   EnsemblGenomes-Tr; EBT00001658334.
DR   EnsemblGenomes-Tr; EBT00001658335.
DR   EnsemblGenomes-Tr; EBT00001658336.
DR   EnsemblGenomes-Tr; EBT00001658337.
DR   EnsemblGenomes-Tr; EBT00001658338.
DR   EnsemblGenomes-Tr; EBT00001658339.
DR   EnsemblGenomes-Tr; EBT00001658340.
DR   EnsemblGenomes-Tr; EBT00001658341.
DR   EnsemblGenomes-Tr; EBT00001658342.
DR   EnsemblGenomes-Tr; EBT00001658343.
DR   EnsemblGenomes-Tr; EBT00001658344.
DR   EnsemblGenomes-Tr; EBT00001658345.
DR   EnsemblGenomes-Tr; EBT00001658346.
DR   EnsemblGenomes-Tr; EBT00001658347.
DR   EnsemblGenomes-Tr; EBT00001658348.
DR   EnsemblGenomes-Tr; EBT00001658349.
DR   EnsemblGenomes-Tr; EBT00001658350.
DR   EnsemblGenomes-Tr; EBT00001658351.
DR   EnsemblGenomes-Tr; EBT00001658352.
DR   EnsemblGenomes-Tr; EBT00001658353.
DR   EnsemblGenomes-Tr; EBT00001658354.
DR   EnsemblGenomes-Tr; EBT00001658355.
DR   EnsemblGenomes-Tr; EBT00001658356.
DR   EnsemblGenomes-Tr; EBT00001658357.
DR   EnsemblGenomes-Tr; EBT00001658358.
DR   EnsemblGenomes-Tr; EBT00001658359.
DR   EnsemblGenomes-Tr; EBT00001658360.
DR   EnsemblGenomes-Tr; EBT00001658361.
DR   EnsemblGenomes-Tr; EBT00001658362.
DR   EnsemblGenomes-Tr; EBT00001658363.
DR   EuropePMC; PMC2713604; 19182778.
DR   EuropePMC; PMC2724415; 19622168.
DR   EuropePMC; PMC2805215; 19933350.
DR   EuropePMC; PMC2849387; 20124004.
DR   EuropePMC; PMC3262155; 22176631.
DR   EuropePMC; PMC3264088; 22247525.
DR   EuropePMC; PMC3303853; 22432045.
DR   EuropePMC; PMC3568572; 23204414.
DR   EuropePMC; PMC3608246; 23406017.
DR   EuropePMC; PMC3638308; 23611906.
DR   EuropePMC; PMC3826670; 24127837.
DR   EuropePMC; PMC4495220; 26025898.
DR   EuropePMC; PMC4749718; 26904002.
DR   EuropePMC; PMC4950343; 26661507.
DR   EuropePMC; PMC5723325; 29259599.
DR   EuropePMC; PMC5756416; 29304740.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00534; SgrS.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000644.
DR   SILVA-SSU; CP000644.
XX
CC   Source DNA is available from Michael Reith:
CC   michael.reith@nrc-cnrc.gc.ca.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4702402
FT                   /organism="Aeromonas salmonicida subsp. salmonicida A449"
FT                   /sub_species="salmonicida"
FT                   /strain="A449"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:382245"
FT   gene            201..1571
FT                   /gene="dnaA"
FT                   /locus_tag="ASA_0001"
FT   CDS_pept        201..1571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="ASA_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88218"
FT                   /db_xref="GOA:A4SH46"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SH46"
FT                   /protein_id="ABO88218.1"
FT                   /translation="MTASLWQQCLNRLQDELPSAEFSMWIRPLQAELSDNTLTLYAPNR
FT                   FVLDWVRDKYLIRVNGIINELCGVDGPTLRFDIGNRPHPVAIARAPARGAAPVNNLQKS
FT                   WESKADAKPEPNHKSNTNVNYTFENFVEGKSNQLARAAARQVADNPGGAYNPLFLYGGT
FT                   GLGKTHLLHAVGNAIKERKKDAKVIYMHSERFVQDMVKALQNNAIEEFKRYYRSVDALL
FT                   IDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTV
FT                   AIEPPELETRVAILMRKADENQIHLPDEVAFFIAKRLRSNVRELEGALNRVIANANFTG
FT                   RAINIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKLADLLSKRRSRSVARPRQLA
FT                   MALAKELTNHSLPEIGDAFGGREHTTVLHACRKIEQLKEESHDIKEDYSNLIRTLSS"
FT   gene            1654..2757
FT                   /gene="dnaN"
FT                   /locus_tag="ASA_0002"
FT   CDS_pept        1654..2757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="ASA_0002"
FT                   /product="DNA polymerase III beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88219"
FT                   /db_xref="GOA:A4SH47"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH47"
FT                   /protein_id="ABO88219.1"
FT                   /translation="MQLEISREALLRPLQLVSGALGGRPTLPILGNVLLDVSQGLLSLT
FT                   GTDLEVEMIGQVYLNNESQDGRTTVPARKLLDICRGLPEGADIRLNTEGERLIIRSGRS
FT                   RFNLSTLPASEYPNIEDWESVLEFDIGQLELKKLIDATQFSMASQDVRYYLNGMLFESE
FT                   GHGLRTVATDGHRLATCRREVVEESLPDHQVILPRKGVLELVRLLEAEDKPVRLQIGRS
FT                   NLRAALDGFIFTSKLVDGRFPDWRRVIPRNSDKALIAGREDLRQAFARAAILSNEKFRG
FT                   VRLNLQENLLRITANNPEQEEAEELLDVQYEASEMEIGFNVSYVLDVLNTLKCDQIRIS
FT                   LSDSISSAIIEDFDHQDAQYVVMPMRI"
FT   gene            2760..3863
FT                   /gene="recF"
FT                   /locus_tag="ASA_0003"
FT   CDS_pept        2760..3863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="ASA_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88220"
FT                   /db_xref="GOA:A4SH48"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH48"
FT                   /protein_id="ABO88220.1"
FT                   /translation="MSLVKLQLSDFRNIQQASLKLSPGLNILVGCNGSGKTSVLEAIHY
FT                   LGLGRSFRTHLTGRVIRQGERAFTLFAQCELEGRQVPIGLAKDKSGETQLKIAGAQAQR
FT                   LADLAELLPVQLIHPDGFNLLTGGPQARRAWLDWGVFHQEPTFFSLWGRVRRLLKQRNA
FT                   LLRQSTQYRQLAFWDQELVRLGGELAEFRASYCQAITPLIKEMTADFLPEFDISLGFYR
FT                   GWEKDTPLGDLLEAGFERDRTLGYTGVGPQKADVRLKANGVPAQDILSRGQLKLLVCAM
FT                   RLAQGLYLNQHSSRGCIFLIDDFASELDVDKRRLLATRLKQCGSQVFITAIDTGQLADM
FT                   MDANDCKLFHVEQGKISETLEKAESKL"
FT   gene            3860..6274
FT                   /gene="gyrB"
FT                   /locus_tag="ASA_0004"
FT   CDS_pept        3860..6274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="ASA_0004"
FT                   /product="DNA gyrase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88221"
FT                   /db_xref="GOA:A4SH49"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH49"
FT                   /protein_id="ABO88221.1"
FT                   /translation="MSENTYDSSNIKVLKGLDAVRKRPGMYIGDTDDGSGLHHMVFEVV
FT                   DNSIDEALAGYCSDILVKIHSDGSVSVRDNGRGIPVDMHEEEGRSAAEVIMTVLHAGGK
FT                   FDDNSYKVSGGLHGVGVSVVNALSDKLLLTIRRNGHVYEQTYHLGEPQAPLKQIGDSSS
FT                   GTGTEVRFWPSPTIFTDTLYHYEILAKRLRELSFLNSGVSIRLQDERDGREVHFCYEGG
FT                   IKAFVEYLNQNKTPIHPKVFHFSTEQDGIGVEVAMQWNDAYQEGVYCFTNNIPQRDGGT
FT                   HLVGFRTALTRTLNTYMDKEDYSKKAKSAASGDDVREGLIAVISVKVPDPKFSSQTKDK
FT                   LVSSEVKTAVEQAMGEKLGEFLLENPGDAKIVVNKIIDAARAREAARKARELTRRKGAL
FT                   DIAGLPGKLADCQEKDPALSELYIVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKAR
FT                   FDKMISSQEVGTLITALGCGIGRDEYNPDKLRYHNIIIMTDADVDGAHIRTLLLTFFYR
FT                   QMPEIIERGYIYIAQPPLYKVKKGKQEQYLKDEDALLQYQTAMALDGATLHVNESAPPI
FT                   GGEALERLVNQHRAVSHLITRMSRRAPDAVLTQLIYQPELNETLLASESDLLAWCQGME
FT                   AVLNESNHGIQYQIQVRRDEERSLFVPHAVVRQHGVDREYAISYDFLQSSEYRQLVSLG
FT                   KEIANLIEDGGFIKRGEKVKPIANFVEAVDWLMGEGKRGIYIQRYKGLGEMNPDQLWET
FT                   TMDPEARRMLRVTIDDAVGADQLFSTLMGDAVEPRRDFIETNALRVANLDV"
FT   gene            complement(6342..7106)
FT                   /locus_tag="ASA_0005"
FT   CDS_pept        complement(6342..7106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0005"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88222"
FT                   /db_xref="GOA:A4SH50"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH50"
FT                   /protein_id="ABO88222.1"
FT                   /translation="MTSRHNSLRLYQPTNSTPDELTEQQLALFTLLQLREQEFGFNPNV
FT                   IVHYPEAGFLGSPIGYLNQLIGEQLQQGYFINQVVIITTYQVLSSPLMQAGYQHEAVHM
FT                   PAGPDHTAIFRWQCGTHPAGKTLYVEVVNEQDPKIRPTFVLMLRDEHGKLLGGMSGSIW
FT                   TKEEHRYAYIGTVVVQPGQPAGTGTRLANTVLEYLSLQKVCEINLGTQTAEPFYTRLGF
FT                   RAIHHIVPALRHRTTKDGTELPHNLVIMSKLL"
FT   gene            complement(7310..7690)
FT                   /locus_tag="ASA_0006"
FT   CDS_pept        complement(7310..7690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0006"
FT                   /product="glyoxalase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88223"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR026275"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH51"
FT                   /protein_id="ABO88223.1"
FT                   /translation="MLLVPQFTILYVANPARSALFYRELFGHPPVEESPTFAMFVFESG
FT                   ARLALWSSATVEPAVTQSAGAMELAFPLPNEASVDTGLAEWRARGLTILQQPTKMEFGY
FT                   TGMALDPDGHRLRLYCPGAEPV"
FT   gene            complement(7758..8462)
FT                   /locus_tag="ASA_0007"
FT   CDS_pept        complement(7758..8462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0007"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88224"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH52"
FT                   /protein_id="ABO88224.1"
FT                   /translation="MSRSERLLALLQLLRGHRYAITGTELASQLGISMRTLYRDIATLQ
FT                   AQGAHIEGEPGIGYVLRPGFMLPPLMFSEDELEALVLGSRWVVAHCDEALSASASSALA
FT                   KIEAVLPAEYRQQLQANALLIGTSRSDSPVDEAPLRSAIRQQRKVTLSYRDLKEELSER
FT                   TVWPFALGYFEQVRVLVAWCELRQGFRHFRVDRIAWMQLEDNRYPKSRESLLKEWRATQ
FT                   QIPQPKFIADRN"
FT   gene            8741..9154
FT                   /gene="ibpA"
FT                   /locus_tag="ASA_0008"
FT   CDS_pept        8741..9154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ibpA"
FT                   /locus_tag="ASA_0008"
FT                   /product="16 kDa heat shock protein A"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88225"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH53"
FT                   /protein_id="ABO88225.1"
FT                   /translation="MRSIDFSPLYRSAIGFDRLANLIESAASNGNAGYPPYNIEQLSDN
FT                   DYRISMAVAGFTQEELELSFQENLLTVKGSKQAESDRNYLYQGIAERGFERRFQLADYV
FT                   RVKGADLKNGLLHIELMREVPEAMKPRKIEING"
FT   gene            9248..9685
FT                   /gene="ibpB"
FT                   /locus_tag="ASA_0009"
FT   CDS_pept        9248..9685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ibpB"
FT                   /locus_tag="ASA_0009"
FT                   /product="16 kDa heat shock protein B"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88226"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH54"
FT                   /protein_id="ABO88226.1"
FT                   /translation="MRNLDFSHLYSNAVGFERMARELEGLFEQKAAAYPPYNIEKREHD
FT                   SYRITLAVAGFEREELELETENGTLKVKGRKAAAGERQFLHQGIAERDFELAFKLSQHV
FT                   EVQGAKLEHGLLTIDLARELPEALKPRAIEIGKPDQLALPG"
FT   gene            complement(9398..10894)
FT                   /pseudo
FT                   /locus_tag="ASA_0010"
FT                   /note="putative type III secretion effector protein,
FT                   inactive; in frame TAA, internal stem-loop at 3' end
FT                   location in v. para -> fs to extend ORF?"
FT   gene            complement(10881..11312)
FT                   /locus_tag="ASA_0011"
FT   CDS_pept        complement(10881..11312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0011"
FT                   /product="putative type III secretion chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88227"
FT                   /db_xref="GOA:A4SH55"
FT                   /db_xref="InterPro:IPR010261"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH55"
FT                   /protein_id="ABO88227.1"
FT                   /translation="MDIGEILLAELATQLQLSSLTIDENGNCPLLIDSELPLILHLEPC
FT                   ALLIMAPLVLPTFSFDNAELQRRMLMAALNPAFDKEPGIGWHPEFQLIAYRRHMLDGMT
FT                   GSQLAQHLGDFIEWMRKFVTSLPRSTPATATTRGIHDRV"
FT   gene            complement(11425..12672)
FT                   /gene="avtA"
FT                   /locus_tag="ASA_0012"
FT   CDS_pept        complement(11425..12672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="avtA"
FT                   /locus_tag="ASA_0012"
FT                   /product="valine-pyruvate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88228"
FT                   /db_xref="GOA:A4SH56"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH56"
FT                   /protein_id="ABO88228.1"
FT                   /translation="MEFSLFGEKFTRHAGITQLMDDLNQGLTNPDAIMLGGGNPAPIPA
FT                   MLERFQTEARNLLDNGELVKAMANYDGPQGKDRFTKALATLLSKELGWNITSRNIALTN
FT                   GSQNAFFYLFNLLAGEFADGRKKKVLFPLAPEYIGYADSALADDYFVAYKPTIEKLPDG
FT                   QFKYHVDFESLQVGDDIGVICVSRPTNPTGNVLTDEEIEHLDQIARDKGIPLLIDNAYG
FT                   VPFPGIIFSEAKPFWNANTILCMSLSKLGLPGTRCGIVIADEKIIQAITNLSGIINLAP
FT                   GSLGPAITIPMIESGEIIALSEQVVKPFYKQKADFAVQLLRDAIPDPRFHIHKPEGALF
FT                   LWLWFEGLPIHSQELYERLKAKNLLIVPGHYFFPGIDDPEWRHSQECIRLNYSQSEELV
FT                   RRGIAILADEINALYV"
FT   gene            12965..13198
FT                   /locus_tag="ASA_0013"
FT   CDS_pept        12965..13198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0013"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88229"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH57"
FT                   /protein_id="ABO88229.1"
FT                   /translation="MKTLIATLIMSTLSLNVMATENPRPELDTAKLGQEMLAQQQEASR
FT                   VVVLDALSNLKPLALDTLVVEASSADATHPQS"
FT   gene            complement(13164..13942)
FT                   /pseudo
FT                   /locus_tag="ASA_0014"
FT                   /note="transcriptional regulator, AraC family; frameshift
FT                   due to 10 bp deletion"
FT   gene            14035..15169
FT                   /pseudo
FT                   /locus_tag="ASA_0015"
FT                   /note="multidrug resistance protein; frameshift due to 10
FT                   bp duplication. Also, in frame TGA"
FT   gene            complement(15359..16042)
FT                   /gene="kdpE"
FT                   /locus_tag="ASA_0016"
FT   CDS_pept        complement(15359..16042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpE"
FT                   /locus_tag="ASA_0016"
FT                   /product="two-component system potassium response regulator
FT                   KdpE"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88230"
FT                   /db_xref="GOA:A4SH58"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH58"
FT                   /protein_id="ABO88230.1"
FT                   /translation="MAHILVIDDEAAIRRFLRISLIAEGHQVSEAVGVNEGLELYRHLN
FT                   PDLVILDLGLPDGDGIQILQAIREHHQNPVLVLSARDSEQEKVRLLDASANDYMSKPFG
FT                   IGEMMARIRVLLRQRAGVSSGERRHFPQCGLTLDASSHKVSLHDEEIPLSRKEFALLQA
FT                   LVCHPGKLVMQTQLLNDIWGPSHKEDTHYLRIVIASLRKKLGDNPQQPSLIETESGIGY
FT                   RFIGS"
FT   gene            complement(16129..18717)
FT                   /gene="kdpD"
FT                   /locus_tag="ASA_0017"
FT   CDS_pept        complement(16129..18717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpD"
FT                   /locus_tag="ASA_0017"
FT                   /product="two-component system potassium sensor histidine
FT                   kinase KdpD"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88231"
FT                   /db_xref="GOA:A4SH59"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH59"
FT                   /protein_id="ABO88231.1"
FT                   /translation="MRDEARADALLASLEQEHKGKLKVFLGAAPGVGKTYAMLQAVREQ
FT                   AREGVDILIGVVETHGRQETLALLDKLAIQPRKLHLHRQQRLEEMDLDALLARKPAIVV
FT                   VDELAHSNAPGSRHEKRWQDVEELLGAGIDVYSTLNVQHLESLNDLVWQLTGVRVKETL
FT                   PDQVLLEADSIVLIDLPPKELLGRLKEGKVYVPHQAKAALQSFFSLNNLTALRELAMQT
FT                   AASHVEGDLQLQWQAAGKTTLPLRGKLMVCLGDQHGSALVRYGHRFAQRRQLPWLVVHI
FT                   DSKGQRSAELEQALALASHLGAKVLTLSSPAVASTLLETAEQQQVSQLLLGKPHKAPWR
FT                   RSLVQHLLKQAQGLEITLVDTEKRKPGIGLQPLHPKDIRQSLLAVTIMGLTSAAAWGLS
FT                   HWLPPASLPLLFVLGVLATALTTSLVPAILAAVLGFVGHNLLFTAPYFSLSVASHSDLL
FT                   TLFVLLIVGMTAGRLASRQRQQLVGLRETQQLGNALLSLSQGLATASSPEEVLRQGTQA
FT                   ISLALAQPVFALDQDYQHRAGSAQHNPGQTDKAAIDWCLAQKQSAGAHTATLNAAEAQY
FT                   HHLTDELILGIRLSNPLASSAEHQLQALLTDIRAALARIDLNERLADSQLQAETDRMRA
FT                   ALLSSVSHDLKTPLATIMGAGSTLLEYGDRISPEDRSELLHSVQDEARRLHSYVQNLLD
FT                   MTRIGSPDFQLKRDWVDLADLVESARKRLESSWRQHKLLVHFDQQIPQLYVHGALIEQV
FT                   LVNILDNASRYSPAGTPIEFKVMLADPDLILDIIDIGVGIAESDRDKIFNLFYTQPVGD
FT                   CGSRGTGLGLAISRAMIEAHGGRIWAFSGPNGNGTCMRISLPLALNAPEV"
FT   gene            complement(18844..19359)
FT                   /gene="kdpC"
FT                   /locus_tag="ASA_0018"
FT   CDS_pept        complement(18844..19359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpC"
FT                   /locus_tag="ASA_0018"
FT                   /product="potassium-transporting ATPase, C chain"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88232"
FT                   /db_xref="GOA:A4SH60"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH60"
FT                   /protein_id="ABO88232.1"
FT                   /translation="MIAIRTLLTLTLLLGVGYPLAVTGVAQLLFPWQANGSQLTNKKQE
FT                   FVGSALLAQKFERAEYFHSRPSASDFATIGSGASNLGVSSPLRSEFAKAQGDVQSPAML
FT                   TRSGSGLDPHLPVDAVLAQVDRVAKQRGLDPALLTEQVKSATQAGILGPQVVNILQLNL
FT                   LLDQGKDA"
FT   gene            complement(19420..21477)
FT                   /gene="kdpB"
FT                   /locus_tag="ASA_0019"
FT   CDS_pept        complement(19420..21477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpB"
FT                   /locus_tag="ASA_0019"
FT                   /product="potassium-transporting ATPase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88233"
FT                   /db_xref="GOA:A4SH61"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH61"
FT                   /protein_id="ABO88233.1"
FT                   /translation="MSKSISITTHTDKVKGKKQRSQIVQAMAEALYRFNPKALFGSPIL
FT                   FTLWLAAVMATVESLLGQPLSGVAPSLAWQLTAWLWLTLWFANFAETLAEGRGKARADS
FT                   LKAGMSQLKARRVTDAKDGQGEWVPATSLLKGDLVLVRSGEMIPADGEVVAGIASVNEA
FT                   AITGESAPVIRESGTDRSGVTGNTTVVSDEIWVRVSNNPGESTLDRMIALVEGAKRQKT
FT                   PNEMALDALLVGLTLIFLLVVATLPWFLNYNGTQVPRLYLIALFITLIPTTIGGLLSAI
FT                   GIAGMDRLVKLNVIAKSGRAVEAAGDVRTLLLDKTGTITFGNRMADELIPAPGVDPSLL
FT                   AQAAMLASLGDNTPEGKSILTLAGKSMAKPSQLESDKVIPFSAETRLSGLDRNGHQYRK
FT                   GAVDAVLNYLSLDRKAVPEVILKSVDHIARQGGTPLLVCTHEKLLGVVFLKDIIKPGIK
FT                   ARFQILRHMGIRTVMITGDNPLTAAAIAAEAGVDDFIAEATPEKKLAYIRQEQADGRLV
FT                   AMCGDGANDAPALAQADVGLAMNEGTQAAKEAGNLVDLDSNPTKLLDVVLVGKQLLVTR
FT                   GALTTFSIANDVAKYFAILPALFITAYPQLGALNLMQLGSPESAILSAIIFNALIIVAL
FT                   VPLALRGVSLKGTAASLLRRNLMIYGVGGLLVPFIGIKLIDLVITGLGLV"
FT   gene            complement(21545..23227)
FT                   /gene="kdpA"
FT                   /locus_tag="ASA_0020"
FT   CDS_pept        complement(21545..23227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpA"
FT                   /locus_tag="ASA_0020"
FT                   /product="potassium-transporting ATPase, A chain"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88234"
FT                   /db_xref="GOA:A4SH62"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH62"
FT                   /protein_id="ABO88234.1"
FT                   /translation="MWQEVIYPVAFVLLVLLPAPLLGSYIYRVFEGKSRWLSPIERATL
FT                   ACCGTDGREQDWKSYALSLLAFNGTGFGLLFLILMAQGLLPLNPQQLPGLNWELAFNTA
FT                   VSFMTNTNWQAYSGEASLSYFSQMVGLTTQNFVSAGTGAAVAVALFRGISRQQTIHLGN
FT                   FWQDLVRFCLYVLLPLALIMALLLVWQGVPQSLSAYLPFHSLEGQEQLLPLGPAASQIA
FT                   IKQLGSNGGGFFGVNSAHPFENPTALSNWLEMVTLLTIPAALVCTLGRYVKDTGHGRAI
FT                   LTAMALLFVLGLCLSLSQEMKLDPNLAHITSQAGNWEGKESRFGPVLSSIWEVATTAAS
FT                   NGAVNSMHDSFTPLGGMVGMINMLLGEVIFGGVGSGIYGMMLFVLLTVFLCGLMVGRTP
FT                   TYLGKRLGITEMKWVVASMLVMPVGVLVLGGVTLLMPDASTIIGHEGPHGLSRLIYAYA
FT                   SAAGNNGSAFAGLAAADSWQCIAIGLAMLLGRFGYIIPVLAIAGQLARAPRQETGEGDF
FT                   PIRGPLFITLLIITVLLIGGLSFLPVLALGPVAEHLSLMQGAF"
FT   gene            complement(23541..24890)
FT                   /gene="gor"
FT                   /locus_tag="ASA_0021"
FT   CDS_pept        complement(23541..24890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gor"
FT                   /locus_tag="ASA_0021"
FT                   /product="glutathione oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88235"
FT                   /db_xref="GOA:A4SH63"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006322"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH63"
FT                   /protein_id="ABO88235.1"
FT                   /translation="MAQHFDYIAIGGGSGGIASANRAAMYGKKVALIEAKELGGTCVNV
FT                   GCVPKKAMWYAGQIADALKYGADYGFDTTLNQFSWAKLVESRQAYIGRIHQSYQNVLGK
FT                   NQITVVKGFARFVNSNTIEVNGEQYTADHILIATGGRPEVPTIPGAELGIDSDGFFDLQ
FT                   AQPKRVAVVGAGYIAVEIAGVMQALGSETHLVVRKHAPLRNFDPMIHETLVEIMAQEGP
FT                   KLHTHATPKAVIKNADDSLTLQLEDGRHLTVDCLIWAIGRTPATDNLDLTAAGIELDDK
FT                   GFIPTDKFQNTAVANVYAVGDNTGRIQLTPVAVAAGRRLSERLFNNKPNEHLDYNLVPT
FT                   VVFSHPPIGTIGLTEPEAIAEYGESQVKVYRSQFTAMYSALTQHRQPTRMKLVCVGPEE
FT                   KVVGLHGIGFAMDEILQGFGVAMKMGATKADFDNCVAIHPTSAEEFVTMR"
FT   gene            complement(24967..26964)
FT                   /locus_tag="ASA_0022"
FT   CDS_pept        complement(24967..26964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0022"
FT                   /product="two-component system sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88236"
FT                   /db_xref="GOA:A4SH64"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR033414"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH64"
FT                   /protein_id="ABO88236.1"
FT                   /translation="MAIYPDRKDAMSGLFSKTAQAVGRNGLSYRLLSYILVCSTVLAMI
FT                   ITVLQLGWDYRKDVAVIEDSIGQIEASFLQPIAASLWNLDEEQVKVQIEGIMNLPNMQF
FT                   VMVKEMLGNSEVPLLTQGVERESYDISREFNLTYQGEVVGKLFVAASLEQIYQRLIEKS
FT                   VLIMVSQTIKTLVVSFCILIIIYYLVVRHLNRIANYAQKFNLDRLAVELTLEGRPLPRK
FT                   KPDELDTLVATLNQMRARLNDEFAARHQAAEQLQQERDFSATLINSANMVICCMEPDLN
FT                   IASINPAAILLTGYHQQEILQHNWLDLFVSQEQREDLTLTLADHGAIEDKEVIMHDQQG
FT                   NELVLQWTFAPFYEGPNLKYLIGFGYDITRLKKVEREIIQLNELLEDKVVERTRSLSDA
FT                   NNQLGKAYDDLKQAQQTLVESEKMASLGSLVAGVAHEINTPIGISVTASSYLQERVADF
FT                   KLHIDSKQLSRSYLNEFTVNLDESMQLLQSNLRRASELIASFKQVAVDQSSEARYNFSL
FT                   ADNLHQVVVSLGHKLKKAQCEVDIQCDPKLSIFSFPGSFAQIYSNLILNSINHGFDNWD
FT                   KPKKITIKVEQEGEELLINYSDNGRGIPTEILPRIFDPFVTSKRGQGGSGLGTHIIYNL
FT                   VVQLLKGRISCVSEPGNGAQFHIRLPIQHN"
FT   gene            complement(27057..30137)
FT                   /locus_tag="ASA_0023"
FT   CDS_pept        complement(27057..30137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0023"
FT                   /product="multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88237"
FT                   /db_xref="GOA:A4SH65"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH65"
FT                   /protein_id="ABO88237.1"
FT                   /translation="MRFTDIFIKRPVLAISLSFLIALLGFQAIFKMQVREYPEVTNTVI
FT                   TVSTSYYGASADLIQGFITQPLEQAVAQADNIDFMTSSSQLGSSTVTAFMKLNTDPNAA
FT                   LSDILAKVNSVRSQLPKEAEDPSVTSSTGSTTAVLYLGFTSPELSSSQITDYLERVIKP
FT                   QLFTVGGVSKVDLYGGVEFALRVWLDPAKMAAFNLTASDVMTVLNSNNYQSATGQATGY
FT                   FTLFNGNAETQVSDTDELKRLVVATRDGKVIRLSDIAKVTLEKSHDIYRASANGREAVV
FT                   MAVNAAPTANPINIAHDVLELMPSLKSNMPSTMQTNVLYDSTIAINESIHEVIKTILEA
FT                   AAIVLVVITLFLGSFRAVIIPIITIPLSLIGVVMMMDLFGFSINLMTLLAMVLAIGLVV
FT                   DDAIVVLENVDRHIKQGEEPFRAAIIGTREIAVPVIAMTVTLAAVYAPIALMGGITGSL
FT                   FKEFALTLAGAVFVSGIIALTLSPMMCAKMLKANEKPGKFESTVHHLLERMTDRYDSML
FT                   HAVMQKRIVVLVFAVIVFGSLPLLFKFIPSELAPSEDKGVMAVLGTAPSNANLDYIENT
FT                   MADVNKILDEQPEIAYSQVFSGVFNANQAFGIASMVPWNQREASQKEVLDRVANLVKDI
FT                   PGMAITTFQFPELPGASSGLPIQFVITTPKSFESLFLIAGEMLAATQANGQFVYSDLDL
FT                   NYDSATMKIKIDKDKAGAYGITMQDIGITMGTMMADGYVNRIDLDGRSYEVIPQVERKY
FT                   RMNPESIKGYYVRAADGKSIPLGSLISIEVVGEPRALPHFNQLNSATIGAVPAPGVAMG
FT                   DAINWFKATAEEKLPQGYRYDFMGEARQFVTEGNALYATFALALAIIFLVLAIQFESVR
FT                   DPLVIMVSVPLAISGALIALAWGMATMNIYSQVGLITLVGLITKHGILICEVAKEEQLL
FT                   HGMNRMEAVMQAAKVRLRPILMTTAAMIAGLIPLLYAAGAGAAQRFSIGIVIVAGLAIG
FT                   TIFTLFVLPVIYTYLASEHKPLPVFDESIPPKAKGSH"
FT   gene            complement(30153..31259)
FT                   /locus_tag="ASA_0024"
FT   CDS_pept        complement(30153..31259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0024"
FT                   /product="membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88238"
FT                   /db_xref="GOA:A4SH66"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH66"
FT                   /protein_id="ABO88238.1"
FT                   /translation="MKKWMAIMLLIALALFGSVIGFNMFKQKKIAEFMANRPEPEFPVT
FT                   AMVTKAQDWVPTIEAIGFIEPNQGVTLSTELAGTIDAITFESGKPVKAEQLLLSLDSSV
FT                   EKANLQASLAKLPAARAKFERFQNLYKKSSISKDQLDDAEASYRSLEADIDSLKATIAR
FT                   RQVRAPFGGVVGLRNVFLGQYLQPGTDIVRLEDTSVMRLRFTVPQTDISKITLGQTVKI
FT                   NVDSYPQVQFDGHITAIEPAVNYQSGLIQVQADIPNNGGQLRSGMFARASIILPTVKDQ
FT                   VVIPQSAISFTLYGENVYVIHEADGVKRAKQVVVKAGERRGNDVHVLSGIKAGDQIVLS
FT                   GQVRLSNDTKVRVVENDALAVPAQTPML"
FT   gene            complement(31207..31887)
FT                   /locus_tag="ASA_0025"
FT   CDS_pept        complement(31207..31887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0025"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88239"
FT                   /db_xref="GOA:A4SH67"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH67"
FT                   /protein_id="ABO88239.1"
FT                   /translation="MNERSFSRCDNRVMNKKERIFNAAHEILGEQGFHGLSIAVVAKKA
FT                   KVAAGTFYRYFSDKDDLIRQLYQHSILQCHPLVMEGVQIDEVSFQQFRRLWLNIHAFFA
FT                   DDPNALKCKLQYECSPLGAELEKDPVIMATWAPLDRFFEQGREQGLFIDLPVRALQVLS
FT                   LDCVGTLALQRQVHHFELTQEQLEAAIRASWNAILTPNFSTSMEPVHEKVDGHHVADSA
FT                   RPVW"
FT   gene            32107..32183
FT                   /gene="trnR"
FT                   /locus_tag="ASA_0026"
FT   tRNA            32107..32183
FT                   /gene="trnR"
FT                   /locus_tag="ASA_0026"
FT                   /product="tRNA-Arg"
FT   gene            32234..32309
FT                   /gene="trnH"
FT                   /locus_tag="ASA_0027"
FT   tRNA            32234..32309
FT                   /gene="trnH"
FT                   /locus_tag="ASA_0027"
FT                   /product="tRNA-His"
FT   gene            32330..32415
FT                   /gene="trnL"
FT                   /locus_tag="ASA_0028"
FT   tRNA            32330..32415
FT                   /gene="trnL"
FT                   /locus_tag="ASA_0028"
FT                   /product="tRNA-Leu"
FT   gene            32493..32569
FT                   /gene="trnP"
FT                   /locus_tag="ASA_0029"
FT   tRNA            32493..32569
FT                   /gene="trnP"
FT                   /locus_tag="ASA_0029"
FT                   /product="tRNA-Pro"
FT   gene            32763..33275
FT                   /locus_tag="ASA_0030"
FT   CDS_pept        32763..33275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0030"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88240"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH68"
FT                   /protein_id="ABO88240.1"
FT                   /translation="MHHNTVRASMLALVVVALSGCSYKPKPDEILMGAAPRQAIDAPSA
FT                   LMTSGGFCVALNAQDQLITQPCEKITRQQFNWDAGALQLEQRCLVAKGVSELVLAECQD
FT                   DSRQWQWQADRLLNHKVDRCLDVAGRRHKPGTPLRLAECYGGANQSFEWKSSASMLEQL
FT                   NLKSLIW"
FT   gene            complement(33392..34207)
FT                   /locus_tag="ASA_0031"
FT   CDS_pept        complement(33392..34207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0031"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88241"
FT                   /db_xref="GOA:A4SH69"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH69"
FT                   /protein_id="ABO88241.1"
FT                   /translation="MMFKVVVSDLDGTLLNKQHQISPRTRDTLHRLVEQGIKFVVATGR
FT                   HHVDVRSIRDTLGLDIYLITSNGAVVHDKQDQLIFNQALPAAVAAELIALDRDPSIHLN
FT                   VYYGDEWLVEEELPWLLQFHDESGFTYRLTDLATHPMDKVNKVFYIGEHEKLLRIEAHL
FT                   NQHYGDRLNVTFSLPDCLEVMHAGVHKGNAVRAVLAQHGLDMSQAVAFGDGMNDFEMLD
FT                   MVGRGVVMGNAHDRLKLALPAHEQTLSSDEDGVAVYLEQLFALSTAGAA"
FT   gene            complement(34295..35275)
FT                   /gene="lypA"
FT                   /locus_tag="ASA_0032"
FT   CDS_pept        complement(34295..35275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lypA"
FT                   /locus_tag="ASA_0032"
FT                   /product="lysophospholipase L2"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88242"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH70"
FT                   /protein_id="ABO88242.1"
FT                   /translation="MTNPYPLTSEAEVPALYQQTLPDFWRTHAIEGEFKARDGVTIRYA
FT                   ALRQAKVDRAIVIVNGRVESYLKYQELAWDLWRQGYSLYLIDHRGQGLSDRMLADKQKG
FT                   YVADFEDYVVDLKQFHDQVIMADQPAKLFLLAHSMGGAISALYLERWPDDIKAAVLSSP
FT                   MMGINLGGLPKWLAQGLAASIDTVGSWLGEPPYGPGQGSYQSHEFADNGLSHSAPRYQA
FT                   FRDLYEQHPQIKLGGVTAHWIREGIAAGDTAIAAADRIKTPLLLLQAGEDSVVDNAAQD
FT                   AFCAKARCEGGKPLRIEGAWHELFIEADPQRQAALSATLAFFERF"
FT   gene            complement(35325..36071)
FT                   /gene="trmH"
FT                   /locus_tag="ASA_0033"
FT   CDS_pept        complement(35325..36071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmH"
FT                   /locus_tag="ASA_0033"
FT                   /product="tRNA (guanosine-2'-O-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88243"
FT                   /db_xref="GOA:A4SH71"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR022724"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR033671"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH71"
FT                   /protein_id="ABO88243.1"
FT                   /translation="MTPERFKRISDMLAQRQLDLTVCMEEVHKPHNLAAIVRTADAIGI
FT                   HRVHAVWPKTWIHKRKGTARGSQNWVDVKLHPDIGSAVAELKASGMQIVATHLSESSVD
FT                   FRTIDYTRPTAILVGQEKHGIGEEALALADHHIVIPMVGMVQSLNVSVAAAAILYEAQR
FT                   QRELAGCYQRGCPLTLEEQNTILFEGGYPIYAQLCKEKEMPYPQLGPAGEILADEAWWQ
FT                   RMQLTRKGWAAQQEDPQDMEYPTDEI"
FT   gene            complement(36228..38342)
FT                   /gene="spoT"
FT                   /locus_tag="ASA_0034"
FT   CDS_pept        complement(36228..38342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoT"
FT                   /locus_tag="ASA_0034"
FT                   /product="guanosine-3',
FT                   5'-bis(diphosphate)3'-pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88244"
FT                   /db_xref="GOA:A4SH72"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH72"
FT                   /protein_id="ABO88244.1"
FT                   /translation="MYLFENLKEIASSYLPPEQVEKLRQAYVVARDAHQGQMRSSGEPY
FT                   ITHPVAVARILGDMRLDHETLMAAVLHDVIEDTPVTKADLAALFGDAVAELVAGVSKLD
FT                   KLKFRDRKEAQAENFRKMVMAMTQDIRVILIKLADRTHNMRTLGSLRPDKRRRIARETL
FT                   EIFAPIANRLGIHTMKNELEELGFEALYPMRSRVLRESVRRARGNRREIIDSIQSEIEG
FT                   RLHEAGIDSQVSGREKNLFSIYNKMEKKELQFHEVMDIYAFRVRVKDIDTCYRVLGQMH
FT                   SLYKPRPGRFKDYIAIPKTNGYQSLHTSLVGPHGVPVEVQIRTEFMDQMADKGVAAHWA
FT                   YKQDGDSSGTTAQIRAQRWMQSLLELQQSAGSSFEFIEGVKTDLFPDEIYVFTPEGRIM
FT                   ELPTGATPVDFAYTVHTDIGHACVGSRVDRHPYPLSSPLYSGQTVEIITAPGARPNAAW
FT                   LNFVVTTKARSKIRQFLKNLRTEESVVLGRRLLNHALGAKNIEDIPEPRIKQVLADTKH
FT                   ENLQGLLADVGLGNAMSVMVARRMLGELPPEEQPKSSSKKMPIKGADGMLVTFANCCRP
FT                   IPGDAIIAHISPGKGLVIHQEACRNIKGYSREPDKYLPVQWEVDKDQEQEFRTGISVEI
FT                   VNHQGALAELANVIAATGANIHAISTEEKDGRVYLVTLLITTKSRIHLANIMRKIRVMP
FT                   NVLKVSRQKN"
FT   gene            complement(38477..38752)
FT                   /gene="rpoZ"
FT                   /locus_tag="ASA_0035"
FT   CDS_pept        complement(38477..38752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="ASA_0035"
FT                   /product="DNA-directed RNA polymerase, omega subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88245"
FT                   /db_xref="GOA:A4SH73"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SH73"
FT                   /protein_id="ABO88245.1"
FT                   /translation="MARVTVEDAVKQVGNRFDLVLVAARRARQIAVQGKDPLVDEENDK
FT                   PTVIALREIELGLVNNQVMDTQDRYEQQEQEAAELAAVAAIAEGRG"
FT   gene            complement(38832..39458)
FT                   /gene="gmk"
FT                   /locus_tag="ASA_0036"
FT   CDS_pept        complement(38832..39458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="ASA_0036"
FT                   /product="guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88246"
FT                   /db_xref="GOA:A4SH74"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH74"
FT                   /protein_id="ABO88246.1"
FT                   /translation="MAQQGTLYIISSPSGAGKSSLLNALLTKHNPAGKMQLSVSHTTRA
FT                   TRPGEENGVHYHFVQVEEFKELIDRGDFLEWAEVFGNYYGTSRAAIEACLAQGIDVFLD
FT                   IDWQGARQIREQMPTKSIFILPPSRAELEQRLIGRGQDSAEVIAGRMAKAIAEMVHYDE
FT                   YDYVIINKDFELALFQLRAIIECQRLEMRQQQQAQQNLLQQLLAE"
FT   gene            complement(39758..40813)
FT                   /locus_tag="ASA_0037"
FT   CDS_pept        complement(39758..40813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0037"
FT                   /product="ADP-heptose--LPS heptosyltransferase III"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88247"
FT                   /db_xref="GOA:A4SH75"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH75"
FT                   /protein_id="ABO88247.1"
FT                   /translation="MPLFQTPPSSICILRLSAIGDCCHALALVRVIQRAWPQTRITWIT
FT                   GKIEATLFADLPGVEVIAFDKSKGWRGYLDLWRTLKGRKFDALLHLQAAMRASIATLGI
FT                   KARVKLGFDKARANDGQWLFTNHRVPSPTSPHVLDGFLAFAKELGIKDLTPDWQLPISA
FT                   EHKIWAREKIGGKPTLLICAAASKAFKNWTAEGYAALADHAANKGFQVYLCGGPAKLER
FT                   DLAADIQRLSQSKPVDLVGQTNLKQLLALIGEASLVLAPDTGPTHMATLVGTPVIGLYA
FT                   HHNPARTGPYLCRDYVVSVYQELIEQETGKPLAELGWRTRLKDPDAMGKIGIERVIATF
FT                   DRLCADRHLPG"
FT   gene            40999..41712
FT                   /gene="kdtA"
FT                   /locus_tag="ASA_0038"
FT   CDS_pept        40999..41712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdtA"
FT                   /locus_tag="ASA_0038"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88248"
FT                   /db_xref="GOA:A4SH76"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR022826"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH76"
FT                   /protein_id="ABO88248.1"
FT                   /translation="MRIQTEHNQICWYAEGVFRDPSPELFDPAWWQTHRQVVGSAIGRG
FT                   VTWFVKDESRHLVLRHYYRGGMVGKVVRDRFWFEGVESSRAMAEYTLLAKLSEQGLPVP
FT                   RPFAARMVKQGPFYRADILIERIRGAKDLVALLKQGPIADQVWHKVGQTVRQLHDAGVY
FT                   HADLNSHNLLLDKEGKVWVIDFDKGAIRSPGSWQQANLERLQRSFSKESQLHTSFHFVP
FT                   ENWQALMSGYQGKAS"
FT   gene            41783..42643
FT                   /locus_tag="ASA_0039"
FT   CDS_pept        41783..42643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0039"
FT                   /product="GGDEF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88249"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH77"
FT                   /protein_id="ABO88249.1"
FT                   /translation="MDMLKAPLREVVTRFDPTLMADAMALLEAGLWSWSPQQGVQRDLS
FT                   CLRLLGLNETGLDDLGWLERVHPDDVAVLQEALAACQSGRVPQIRLEYRILHHDGHYVR
FT                   LEERARRDVHGQVLGVVRLLESQPVAEERHGTDPLTGLESRSHFEQLLDERLATESGSF
FT                   SLLQFTVDHSAKIQQLFGEAACDAMLAKLARMVRHELRREDPFARWDQDGFILMLSQTD
FT                   RLSGLEIAERLRLEIADASLLPQRPVTVSVGLVQSQAGEHIDHLLARLATCHGQARREH
FT                   NAVVG"
FT   gene            complement(42640..43494)
FT                   /gene="madN"
FT                   /locus_tag="ASA_0040"
FT   CDS_pept        complement(42640..43494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="madN"
FT                   /locus_tag="ASA_0040"
FT                   /product="MadN protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88250"
FT                   /db_xref="GOA:A4SH78"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004779"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH78"
FT                   /protein_id="ABO88250.1"
FT                   /translation="MNYLIGVTLLWSFSFSLIGVYLAGQVDAYFFVLTRIVLASLVFLP
FT                   FLRRRWLRPDFALKLMGLGAIQLGIMYLFYYQSFLLLTVPEVLVFTIFTPLYVTLLHDL
FT                   LERRFKPVYLWGALLAVLGAAVIRFDGLTESYVLGFLVVQGANLSFAMGQVGYKVLLAR
FT                   EAQQPPQQAVFGCFYLGALAVALPAWWLLGKPQYPTSGLQWGILLWLGVGASGLGYFLW
FT                   NKGATKVSSGVLAIMNNALIPAGLLVNLLIWGKDTNLARLAIGGLLMLASLWICQRASV
FT                   SKH"
FT   gene            43537..43830
FT                   /locus_tag="ASA_0041"
FT   CDS_pept        43537..43830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0041"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88251"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH79"
FT                   /protein_id="ABO88251.1"
FT                   /translation="MAEMEAVIQRLWHQLPQIRAFAFEASNGAGSATDWCGRGEGDVEV
FT                   TDHQGGWLTAEPHLCGQDHYSAELTESDSGFLLSWEITGPRKNERLSYRYLR"
FT   gene            complement(43987..44148)
FT                   /locus_tag="ASA_0042"
FT   CDS_pept        complement(43987..44148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0042"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88252"
FT                   /db_xref="GOA:A4SH80"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH80"
FT                   /protein_id="ABO88252.1"
FT                   /translation="MSGILTTLCGGLVLIAGWQYRHRLAGLLGLLMVLLPWFFDSKLQA
FT                   MLSYALSV"
FT   gene            complement(44133..45062)
FT                   /locus_tag="ASA_0043"
FT   CDS_pept        complement(44133..45062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0043"
FT                   /product="conserved integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88253"
FT                   /db_xref="GOA:A4SH81"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH81"
FT                   /protein_id="ABO88253.1"
FT                   /translation="MRWRITSEINMRSYLLLLAIGLLWGSQFIFMHQAVTELPPIMVAA
FT                   GRALCGSLTLGLLCLFMRLKSEHTPWRTYMLIALLDATLPFIMVAWGQQYVDSAIAAVV
FT                   MGCIPFVTILMAPLLLSGEKITKGGLVSVIIGFIGVLVLFWPKLANGMNAGLLGAVAIL
FT                   FGASCFAIGLLMIKRFAKDHPVVVARNILISSAIQLMLAAPFLTDLSALTMPSQHAISA
FT                   VVVLGVFCTGLVYFLYMALIQKAGPTFASFSNYLVPLFGVMLGAMFLGEQIQSTTGVAL
FT                   ALILGSVALNQWAQQRRAQREAALCQAS"
FT   gene            45124..46098
FT                   /locus_tag="ASA_0044"
FT   CDS_pept        45124..46098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0044"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88254"
FT                   /db_xref="GOA:A4SH82"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH82"
FT                   /protein_id="ABO88254.1"
FT                   /translation="MELPLSRLDLNLLTVFDMLMQERNVTRAAERLHLSQSTVSHALGR
FT                   LRQALDDPLFVMSRREMMPTERAKTLAGPVRQALAMLEQGLRQAEGFDPASARRIFRIA
FT                   TPGSVEHGLVPALVEQLHRQAPHCRLEVCELADSDYERELEKGELDLVIGFADANHFSP
FT                   RLWREPWFNNPLVCLSPLGSELPEVLGPAELVSRPHIHTSSWGHSQAMVDLWLARFGVE
FT                   RELGVRLPSFMAVPPLMATGRYLVVVPEMIGRHFCRYYPLRLHQLNPEIPIVYLMAGHP
FT                   LTAHDQAIGWFKGLLHRLAFERYGADALGSVAQRSADQSSPAK"
FT   gene            complement(46077..47090)
FT                   /gene="trpS"
FT                   /locus_tag="ASA_0045"
FT   CDS_pept        complement(46077..47090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="ASA_0045"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88255"
FT                   /db_xref="GOA:A4SH83"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH83"
FT                   /protein_id="ABO88255.1"
FT                   /translation="MHNPIILTGDRPTGKLHIGHYVGSLRQRVEAQHHYRQFVMIADLQ
FT                   ALTDNGHNPAKVTDNVLEVMADYLAAGLDPAKTTFCLQSALPALAELTTYYLNLVSVAR
FT                   LERNPTVKAEIQQKGFERSLPAGFLIYPVSQAADITAFRATHVPVGEDQLPMLEQTNEI
FT                   VRRFNALVGKEVLTECQPILSDTGRLPGIDGKAKMSKSLGNTIELGMSAEEVKQAVFAM
FT                   YTDPNHLKVSDPGQVEGNTVFAYLDAFHPDKMLVAEMKVHYQRGGLGDMRCKQVLNDCL
FT                   QTLLAPMRARRQAALADKRQLLQLLQQGTLQARALTDEVLAEVKSAMGLDYFAGLD"
FT   gene            complement(47282..47716)
FT                   /gene="uspA"
FT                   /locus_tag="ASA_0046"
FT   CDS_pept        complement(47282..47716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uspA"
FT                   /locus_tag="ASA_0046"
FT                   /product="universal stress protein A"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88256"
FT                   /db_xref="GOA:A4SH84"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH84"
FT                   /protein_id="ABO88256.1"
FT                   /translation="MNGTYYQHILAAIDLSEDNRKVIEKAVDRARSNGAKLSVIHVDVD
FT                   LKDLYTEMIDIDIDNVQDQVIAEAKEKLETFLASVDYPIEKKLVICGDLSERVNQAVKD
FT                   YQIDLLVCGHRQSFWSLLTSSARQLMNTVPCDLLVVPLQK"
FT   gene            47974..49281
FT                   /locus_tag="ASA_0047"
FT   CDS_pept        47974..49281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0047"
FT                   /product="short-chain alcohol dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88257"
FT                   /db_xref="GOA:A4SH85"
FT                   /db_xref="InterPro:IPR010758"
FT                   /db_xref="InterPro:IPR024906"
FT                   /db_xref="InterPro:IPR024910"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH85"
FT                   /protein_id="ABO88257.1"
FT                   /translation="MGSLALPLVFLPPYCPYPARHQGNPQLLGYAVASSFGDPVMIIHP
FT                   QIQGCVARNCHPIGCRAAVLQQISSVKAAGSFNGPKRVLVLGASSGFGLASRIALTFGA
FT                   GADTVGVSFERGPSDKGLGSAGWYNNIWFRQAAEQEGRVAVNLIGDAFSDAMRQQAIDS
FT                   IRQQLGQVDLVIYSLASGIRVLPDGRQVRSALKTTGQPFSGWGLDLEQDKLVQQSLAPA
FT                   TPEEIRDTVTVMGGEDWQLWMLALQQADCLAPGARTVAYSYIGPESTYPLYRDGTIGYA
FT                   KEHLHATAEAINLQLAELGGHAWVSVCKALVTKASAYIPVLPVYLGLLMGVMKERGVHE
FT                   GCIEQMQRLFASKMYGPQGVVADGNRLIRMDDHELDPAIQAAVSTLWSKVTPDNFHTLG
FT                   DFAGLRQDFMQLNGFELPGVDYGAPVDVASLTELVP"
FT   gene            complement(49345..51041)
FT                   /pseudo
FT                   /locus_tag="ASA_0048"
FT                   /note="GGDEF domain protein; frameshift due to 95 bp
FT                   deletion"
FT   gene            51239..51763
FT                   /gene="ftn"
FT                   /locus_tag="ASA_0049"
FT   CDS_pept        51239..51763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftn"
FT                   /locus_tag="ASA_0049"
FT                   /product="nonheme iron-containing ferritin"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88258"
FT                   /db_xref="GOA:A4SH86"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR041719"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH86"
FT                   /protein_id="ABO88258.1"
FT                   /translation="MLAKAMIEKLNEQINLEFYSSNLYLQMSAWCEDKGFEGAATFLRQ
FT                   HAVEERQHMERLFTYVSETGAMPMLGAIDAPPHEFKSLGDIFRNTLEHEYHITQCINGL
FT                   AHVAFTTQDYSTFNFLQWYVAEQHEEEKLFKSIVDRLSLVGEDGKGLYFIDKELAELAK
FT                   GAPASVMDGNA"
FT   gene            51965..53149
FT                   /locus_tag="ASA_0050"
FT   CDS_pept        51965..53149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0050"
FT                   /product="predicted flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88259"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH87"
FT                   /protein_id="ABO88259.1"
FT                   /translation="MMQVDVVVIGAGAAGLMCAQQAGYRGRSVLVLDNAKKPGRKILIS
FT                   GGGRCNFTNHQAGPHAFLSGNPHFCKSALARYTQQDFIDLVDRHGVNYHEKTLGQLFCD
FT                   ESAKEIVDVLLTECDWAGVTLQFQTEILSVTRTEAGFVLGTSKGEVSCHSLVVATGGLS
FT                   MPKLGATPYGFKLAEQFGLNVLPTRAGLVPFTLHQAEKEAFADLAGVSLPVAVTAEDGT
FT                   RFKEAMLFTHRGLSGPVILQISSFWLAGEKIHINLLPELDIPMALKAWALAHPAQELKT
FT                   VLGRELPKRFVDKLVELGQLNSKPMRQYNERELEAIATLLGDWQILPNGTEGYRTAEVT
FT                   LGGVDTNELSSKTMEVRKVPGLYFIGEVVDVTGWLGGYNFQWAWSSGWVAGQYC"
FT   gene            53258..53896
FT                   /locus_tag="ASA_0051"
FT   CDS_pept        53258..53896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0051"
FT                   /product="lysine exporter family"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88260"
FT                   /db_xref="GOA:A4SH88"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH88"
FT                   /protein_id="ABO88260.1"
FT                   /translation="MFESLGVVNVWTYLVGLFFIIIAPGPNSLYVLRTGASRGVGPGYR
FT                   AALGVFVGDAILIFCAYLGVASLIRTTPLLFTLVRYLGAIYLLYLGVKILHANFVAKRE
FT                   GQESVVDPGERYFSKALTLSLTNPKAILFYVSFFVQFIDFNYAHPWLSYLVLAGMLEAM
FT                   SFVYLTLLIFGGTLMARFFRQRQTAARLGNGLIGLFFMGFAARLATLSS"
FT   gene            53998..54624
FT                   /locus_tag="ASA_0052"
FT   CDS_pept        53998..54624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0052"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88261"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH89"
FT                   /protein_id="ABO88261.1"
FT                   /translation="MDPVSPMVRQSLLLLVMLTTTPFSAATETFSFQSYQQGVLRMTLI
FT                   SPSLDGELLLRRGEQFEPLNNIVLERLFTLRVALPCQWLTDGSILYWSLPGRPLLSVTI
FT                   PAQSCVTAPSAPPPLPPVLIYGKQGKCLIDTGGNTLWRVATELAKRNRASIYQNVYAIF
FT                   VTNKRAFAGEDIHRLRSRRLYCPDPALVDHIEPEHASRMFKETVR"
FT   gene            complement(54677..55309)
FT                   /locus_tag="ASA_0053"
FT   CDS_pept        complement(54677..55309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0053"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88262"
FT                   /db_xref="GOA:A4SH90"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH90"
FT                   /protein_id="ABO88262.1"
FT                   /translation="MANFCHRYRVCTTIMEPSIDFLTKTVTNNNETTKIYEVQVKKITN
FT                   PTVNGLPIDMPAGELLYSPKRFVLRAGQQQNVKIFYKGEPDHQERYYWLTFIESPAAQL
FT                   ATKENTAATGTQEMKLALQSILVVRPRQVHFQYQLNQTVGNIINTGNTYFEFMVKQGCE
FT                   QSDIEADSKYLLPGETYRNTKISQSGNQKLIVYQSRFIAVGKDCWPD"
FT   gene            complement(55361..56976)
FT                   /pseudo
FT                   /locus_tag="ASA_0054"
FT                   /note="conserved hypothetical protein; frameshift due 1 bp
FT                   deletion"
FT   gene            complement(56998..58325)
FT                   /pseudo
FT                   /locus_tag="ASA_0055"
FT                   /note="conserved hypothetical protein; frameshift due to 22
FT                   bp deletion"
FT   gene            complement(58309..59319)
FT                   /locus_tag="ASA_0056"
FT   CDS_pept        complement(58309..59319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0056"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88263"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH91"
FT                   /protein_id="ABO88263.1"
FT                   /translation="MSLPIAASGLLVVLCFLAMSARADTAIPLRIANVLIPVSFVQALQ
FT                   DGLAVPVRLQYADADHQIDTLTDEAIGNATLLLQGGKLHLLNIDFSVGQQQALLNDKLT
FT                   AMLASEQIRTFSTDGTLLIDDNASMQLDLVAMLLTIRVSRAAFGKAQQQDDRITLTPTV
FT                   DTLTGVHRYNLGYSFARNRSGGHSDSNFLQLDSMVGAGSHHLAMNASLYNLGEPEQSGD
FT                   IYRAMYERDFDDRRVAAGMVSTWDLQTLGVVTGLTTGRIYGASYGNQAQSRKQNANQST
FT                   TPIQVFMPANGEVRVYRDGRLTDTSTQRVTKLGSRMGFTQEWGWQWWGGGNGRLP"
FT   gene            complement(59356..64264)
FT                   /pseudo
FT                   /locus_tag="ASA_0057"
FT                   /note="conserved hypothetical protein; interrupted by ISAS
FT                   complex"
FT   mobile_element  59674..63917
FT                   /mobile_element_type="insertion sequence:ISAS5"
FT   mobile_element  59754..61379
FT                   /mobile_element_type="insertion sequence:ISAS9"
FT   gene            59862..60311
FT                   /locus_tag="ASA_0058"
FT   CDS_pept        59862..60311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0058"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88264"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH92"
FT                   /protein_id="ABO88264.1"
FT                   /translation="MMPPYNWSLRQVADDIGVGIATVHGWRKQLELEGLIIRKIEPDSE
FT                   HSTEQIFTILLETAALSEHELAEYCRKHGLYPEHLVAWKQNCLAANQPKHRQLVDEQRA
FT                   VRSEKARIRALEKELRRKDKALAELAALLVLQEKLSALRDNEEDD"
FT   gene            60482..61351
FT                   /locus_tag="ASA_0059"
FT   CDS_pept        60482..61351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0059"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88265"
FT                   /db_xref="GOA:A4SH93"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH93"
FT                   /protein_id="ABO88265.1"
FT                   /translation="MPANKLTEHERTRVLQVCSEAEYASLPPSRIVPMLADRGIYLASE
FT                   ATFYRLLKAEDQLHHRAGGKPRGTYSRPTSYTAHGPNQVWSWDITHLPGEVKGERYYLY
FT                   MLMDVYSRKIVAAEVREVERGEYAAALLQRAVIMENCRNSGLILHSDNGAPMKSFTMLA
FT                   KMYELGVCSSFSRPRVSNDNPYSESLFRTLKYCPAWPADGFSDISKARAWVHSFIRWYN
FT                   TQHRHSGIKFVTPEQRHQGLDKPLLKQREAVYEAARCQHPERWSGKTRNWTPVSMVALN
FT                   PENERRAA"
FT   gene            61526..63067
FT                   /locus_tag="ASA_0060"
FT   CDS_pept        61526..63067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0060"
FT                   /product="transposase subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88266"
FT                   /db_xref="GOA:A4SH94"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017895"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH94"
FT                   /protein_id="ABO88266.1"
FT                   /translation="MSAKRIAMRKIREVLRLRLEAQLSFRQISICTKVSVGSIQKLLKS
FT                   AQALGLSWPLPTELDDGRLAALFYPQADTTISARHVVPDWPSVHQELKRKGVSKQLLWE
FT                   EYTQRYPNSCYSYSQFCDRYKSWCQLQKRSMRQIHKAGEKLFIDYCGPTVPIVSPTTGE
FT                   VRQAQVFVAVLGASNYTFAEATWSQSLPDWLQSHVRAFEFFGGTPALLIPDNLKSGVSK
FT                   ACRYDPELNPSYQQLAEHYQVAVMPARPYKPKDKAKAEVGVQIVERWILARLRHQTFFS
FT                   LAELNQCIRALLNELNERPFKQLPGNRRDAFEQLDRPALGPLPVHPYRYVAIKTVKVNI
FT                   DYHVSYEQHHYSVPHQYVGQQLELHAGDTLLQVYHQQQLVASHPRKTIPGMSTLPEHMP
FT                   ERHSKQQRWTPGRLKQWAADIGPGTLCWVSERLEEKAHVEQAYRLCLGLLSLSREYPPS
FT                   RVEACCQLANREGLVRLKQLKSVLASGRDQLPASPLSYPELPQEHENIRGPQSFH"
FT   gene            63082..63837
FT                   /locus_tag="ASA_0061"
FT   CDS_pept        63082..63837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0061"
FT                   /product="transposase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88267"
FT                   /db_xref="GOA:A4SH95"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR013690"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH95"
FT                   /protein_id="ABO88267.1"
FT                   /translation="MTQQTLTRLRNLKLTGMADAVQQQLEQASTYEGLPFIERLSLLVE
FT                   HEQLSREQRKQTRLVKQARLKLQATVQELDYQSARNLERSQVANLAQGEWLRRGQNLLI
FT                   TGPCGCGKTYLACALGYQACQQGHSTRYYRLPRLLLELSQAKVDGSYARLLGQLARIEL
FT                   LILDDWGLEAVNAEQRNALLEIMDDRYGKYSTIVVSQLPTEEWYASLGDNTLADAILDR
FT                   LMHNAHRLSLKGESMRKRRSELTQSEQSS"
FT   gene            complement(64321..64881)
FT                   /gene="matB"
FT                   /locus_tag="ASA_0062"
FT   CDS_pept        complement(64321..64881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="matB"
FT                   /locus_tag="ASA_0062"
FT                   /product="MatB protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88268"
FT                   /db_xref="InterPro:IPR016514"
FT                   /db_xref="InterPro:IPR038478"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH96"
FT                   /protein_id="ABO88268.1"
FT                   /translation="MKKALIAVILASSGLSFAHAVESTATWKATAKKDSTSALEVTALD
FT                   SLAFQYSDGSKAFNTVNGLFDVSIKGDASATDFTLKAKKLSGTLNHLSGGSTVDVGVMW
FT                   QGVPVSTSAYTTLIDTAAGTTGGSLAPLAAGFKDDTQSTTAQGAFSFNIEKATVNGADA
FT                   EFNTLPDGLWSGEVNVEFVASWA"
FT   gene            65453..66076
FT                   /gene="bvgA"
FT                   /locus_tag="ASA_0063"
FT   CDS_pept        65453..66076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bvgA"
FT                   /locus_tag="ASA_0063"
FT                   /product="two-component system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88269"
FT                   /db_xref="GOA:A4SH97"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH97"
FT                   /protein_id="ABO88269.1"
FT                   /translation="MKTVLIVDDHPAIRMAVKILLLAEGFHICGEVDNGIDALQIVKAS
FT                   TPNIVVLDIGIPKLDGIDVINRIKKSNSQSLIVVLSAQDGNHIMSRCFQAGANGFISKM
FT                   DDLMLLSSAIKACLDGKRYFPDEIISEGDQASNINSDDALLSLSDREMRVFLSLCKGCS
FT                   NKEIANNMLLSEKTISTYKSRVMRKLQVNNMVELIDLAKRYMVI"
FT   gene            66210..70894
FT                   /pseudo
FT                   /gene="bvgS"
FT                   /locus_tag="ASA_0064"
FT                   /note="two-component system sensor histidine kinase;
FT                   interrupted by ISAS3"
FT   mobile_element  69091..70322
FT                   /mobile_element_type="insertion sequence:ISAS7"
FT   gene            69154..69447
FT                   /locus_tag="ASA_0065"
FT   CDS_pept        69154..69447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0065"
FT                   /product="IS3-family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88270"
FT                   /db_xref="GOA:A4SH98"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH98"
FT                   /protein_id="ABO88270.1"
FT                   /translation="MTRQRYPETFKIEAVKQITERGRPVADVARALGVSSHSLYAWLKQ
FT                   YGKPADQQHEESALQAEIRRLKAELRQVTEERNILKEAAAYFASESRKGTRS"
FT   gene            69576..70304
FT                   /locus_tag="ASA_0066"
FT   CDS_pept        69576..70304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0066"
FT                   /product="IS3-family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88271"
FT                   /db_xref="GOA:A4SH99"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH99"
FT                   /protein_id="ABO88271.1"
FT                   /translation="MVKQSWLESGAVYGYRKIHRDLCDLGEACGKHRVAKLMRREGLRS
FT                   QTGYQRRKGHYGGKSPQAAPNTLARQFKVPAPNISWVTDITYIRTQEGWLYLAVVLDLF
FT                   SRQIIGWAMKPRMTAGLAVDALLMAVWRRKPTQPVLVHSDQGSQFTGGEWQDFLKAHNL
FT                   SCSMSRRGNCHDNAVAESFFQLLKRERIKRRIYSTRDEARSDVFDYIEMFYNPIRRHGS
FT                   NDGLSPVEFERQFICQQQSV"
FT   gene            complement(70928..71338)
FT                   /locus_tag="ASA_0067"
FT   CDS_pept        complement(70928..71338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0067"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88272"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHA0"
FT                   /protein_id="ABO88272.1"
FT                   /translation="MKTHIFLLVLPALLTPVALHAQAVGKTVSWQASASKYSQSSVSLQ
FT                   HPGQQVISTANPAEQVLAAKLTVSDSGLMLKARAINVAAGTPDVILNGKTLTSHYQMLP
FT                   ITEHYYLGYHQHPQQTESVIESGYELITYWRS"
FT   gene            71429..73144
FT                   /locus_tag="ASA_0068"
FT   CDS_pept        71429..73144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0068"
FT                   /product="two-component system sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88273"
FT                   /db_xref="GOA:A4SHA1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR011620"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHA1"
FT                   /protein_id="ABO88273.1"
FT                   /translation="MPSFGFLYAGEVWVLLENQMMLLAVFERAALMLMTLFFLTRTRPF
FT                   QRLFQKRDHTPAELVLVASIFGLFAVFSTYTGIPVEGALINVRIIAIISGGILFGPWVG
FT                   IPAGVISGLHRYLIDMDGHTSIPCLIASIIAGLLATWLHLRCRKSRLWLYGILAGMLCE
FT                   GLTMLLIWLLTEPHEVGVEIVSHIAYPMIAGALCIGLIIKLVQDLDDEKELIAAKQAKL
FT                   ALDIANKTLPFFQKVDRHSLGQVCGVICNEIHADAVAITDTRDVLAYVGVGKDYYELDE
FT                   HHAISDMTQRAVLLDQIIINNDLRQYHLSDFHSVIIIPLRENGAVSGTLKIYYRRTHSI
FT                   TSSLREMAVGLSQLISTQMEVSRIEQLKEMTRKAEFTALQSKINPHFLFNALNAISSLI
FT                   RIRPQQARQLIANLADYLRYNLNKGDELIDIQEELQQVRDYIAIEQARFGDKLEVVFEV
FT                   DDVHIQVPSLLLQPLVENAILHGIQPRSAPGRVTIEVKQLAGGIRVAVRDTGYGISQAV
FT                   IDGVAAGRVESRSIGLMNVHQRVKLLYGDGLQLRRLEPGTEVCFYLPDQEAMPC"
FT   gene            73138..73869
FT                   /locus_tag="ASA_0069"
FT   CDS_pept        73138..73869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0069"
FT                   /product="two-component system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88274"
FT                   /db_xref="GOA:A4SHA2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHA2"
FT                   /protein_id="ABO88274.1"
FT                   /translation="MLKAIIVEDEYLAREELAYLVGQHSQIEIVASFEDGLEAFKYLQD
FT                   HEVDVVFLDIQIPSIDGLLLAKNLHKSSHPPHIVFVTAYKEFAVEAFELEAFDYILKPY
FT                   NEPRIINLLQKLELAGKSQPVQGVEGSSPQNRTVNLVKGERIIVTPCEQIYYAEADEKL
FT                   TYVYTRTDRYVMNMTISEFVSRLPAEGFFRCHRSYCVNINKIREIVPWFNSTYLIRLHD
FT                   LPFEVPVSRSNIKAFRQLMRL"
FT   gene            73979..75175
FT                   /locus_tag="ASA_0070"
FT   CDS_pept        73979..75175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0070"
FT                   /product="major facilitator superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88275"
FT                   /db_xref="GOA:A4SHA3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHA3"
FT                   /protein_id="ABO88275.1"
FT                   /translation="MTKEMNRTRYLTLIGTIITQFALGSVYTWSLFNAQLSDKLDEPVS
FT                   QVAFAFGLLSLSLAVASSMAGKLQERFGVRNVTLGAGVLLGIGFFLTAHASNLAMLYLC
FT                   AGILVGFADGTGYLMTLSNCVKWFPERKGLISACSIGAYGLGSLGFKYINLLLLSNNGL
FT                   EATFQLWGLIAMSMVLVGGMLMKDAPKQAASAQQTESRDFTLAEAMRKPQYWMLALMFL
FT                   TACMSGLYVIGVAKDIGENMVGLSTAVAANAVAVIAMANLGGRLVLGILSDKMSRIRVI
FT                   TIAQLITLGGMGLLLFVPLNANLFFVAVACVAFSFGGTITVYPSLVSDFFGLNNLTKNY
FT                   GVIYLGFGLGSIIGSIVASLFGGFMATFNLILVLMVVALVLSLTIRLPAPVAVSVDRA"
FT   gene            complement(75255..76352)
FT                   /gene="purK"
FT                   /locus_tag="ASA_0071"
FT   CDS_pept        complement(75255..76352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="ASA_0071"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88276"
FT                   /db_xref="GOA:A4SHA4"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHA4"
FT                   /protein_id="ABO88276.1"
FT                   /translation="MLGGGQLGRYFVMAAHRLGYKVVVLDPDPASIAGAAADHHIVAPY
FT                   DDQTALHDLASRCAAISCEFENVPAATLALLEKQKPMRPAASAVRICQDRREEKAFLRG
FT                   ADIPVAPHLALLAGDPIPAQASALFPAILKTAREGYDGKGQWQVGNLDELASALTASGV
FT                   PCVLEKRLPLEGEFALTLARSPSGAISALPLVQNWHSGGILDQTRSPANVPALEAEAKD
FT                   IAERLIAVLDYVGVLTVEFFLVEGRLLVNEMAPRPHNSGHPSLDNAECSQFELQVRALC
FT                   DLPLPEKAEVRPAILLNLLGDLWHGGTPDWEGVLALPGVHLHLYGKGEARPGRKMGHVT
FT                   ITGRDWPTVEDTSRHVRSLLGLPPP"
FT   gene            complement(76376..76870)
FT                   /gene="purE"
FT                   /locus_tag="ASA_0072"
FT   CDS_pept        complement(76376..76870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="ASA_0072"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88277"
FT                   /db_xref="GOA:A4SHA5"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHA5"
FT                   /protein_id="ABO88277.1"
FT                   /translation="MNTPPLIGLVMGSDSDWPVLQAAARILKEHGVPYEARVVSAHRTP
FT                   DLLFEYAASARDRGLRAGGAAHLPGMVAAKTTVPVLGVPIPSRHLKGMDSLLSIVQMPK
FT                   GVPVATFAIGEAGAANAALFAVSLLSVTLDGDAPRYQQQLDDFRANERDRVLALQLEDP
FT                   A"
FT   gene            complement(76933..77235)
FT                   /locus_tag="ASA_0073"
FT   CDS_pept        complement(76933..77235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0073"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88278"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHA6"
FT                   /protein_id="ABO88278.1"
FT                   /translation="MQTETRTLLTVITEANLEPTLLRTLTREGLRGYTITDARGRGDHG
FT                   ERNASWSESGNIRLEAICSREQAERLLAHLQSRYYPDYAMIAFLQPVEIVRPEKF"
FT   gene            complement(77241..78167)
FT                   /locus_tag="ASA_0074"
FT   CDS_pept        complement(77241..78167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0074"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88279"
FT                   /db_xref="GOA:A4SHA7"
FT                   /db_xref="InterPro:IPR010293"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHA7"
FT                   /protein_id="ABO88279.1"
FT                   /translation="MLDVVVLFFLFGLLAGLVRSELKLPPALYDTLSLFLLLAIGLKGG
FT                   VGLAQQSLLPLLPQLALVILLGVVQTLAGFALLRIKMNRIDAAATAAHYGSVSVATFAV
FT                   GVNWLTERGISFESQLSIFLAVMEIPAILVGIMLARGVSRQTRWRMLAHETFLGKGVTL
FT                   LLGGMAIGYLAGPQGIAPLKPLFVDLFKGALALFLLEMGLIVARQCQDLRRHGLFLLGF
FT                   ALLMPLASAGLGLTVGKLMGLSLGGLTLLATLAASASYIAVPATLRIAVPQANPGLSLS
FT                   AVLGVTFPFNIMLGIPLYHSWARHFTE"
FT   gene            78279..79181
FT                   /locus_tag="ASA_0075"
FT   CDS_pept        78279..79181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0075"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88280"
FT                   /db_xref="GOA:A4SHA8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHA8"
FT                   /protein_id="ABO88280.1"
FT                   /translation="MLNYKQLYYFWHVARSGSVTRAAEQLHLTPQTISGQVAELELSLG
FT                   VALFSREGRRLVLTAAGRQALEQAGAIFSLGAELEHTLRHASQELTMQVGIADSVPRTL
FT                   AFELLAPAMALATPVRLICHEERAEQLFSELARHKLDMVLIDRPLPPDSGVRGYNHELG
FT                   RSPLALFASPALAARARSGFPASLEGLPLLIPGEKSATHDRLLAWYRQQGIHPHLVGQF
FT                   DDSTLMKSFGKAGMGIFPAPLAMRDEIERLYGVERIATLPEVTLSYYLVSAGRHLSHPG
FT                   VQAVMEGARQRLVELEKQK"
FT   misc_binding    79218..79396
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="cobalamin riboswitch"
FT   gene            79448..81283
FT                   /gene="btuB"
FT                   /locus_tag="ASA_0076"
FT   CDS_pept        79448..81283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="btuB"
FT                   /locus_tag="ASA_0076"
FT                   /product="vitamin B12 transporter btuB precursor"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88281"
FT                   /db_xref="GOA:A4SHA9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010101"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHA9"
FT                   /protein_id="ABO88281.1"
FT                   /translation="MSKTLLVAALLPTAAFAQTTIAVNPTLVITANRVEQPISSVLAPV
FT                   VVIDRAEIESRQVQSLPALLKTLPGVQITTLGGRGHMSSLFIRGTNSNHSLVLMNGRPI
FT                   AAMVAGTPDLSQIPLGNIERIEYIRGPRAAVYGADAIGGVINLITKTSAKNGSETHLKG
FT                   GVGSNGYGQGQVRTVQALGQQTDMNMMIGYERTDGFDVVANAQQPDRDGFDSLNGQFGL
FT                   NHGFSDAWSGDFNAQGYDNQTEMDDAYQSADQSRVQAFQYDGGLKFQSETLTSRLEASY
FT                   GENKLKSWLESKGESSAQPIHTGLTRFSWINSWSGVEGLNLTGGADWQQEQLKSDSRSS
FT                   GLAFNAPDRDNTGLFAVGSYRWQALLWELSGRTDDNEQYGRHNTWSAASGLDIDDNHNV
FT                   RLSYGTGFKAPTFLDLYYPGYENPDLKPEESKNLELGFAGRYTGWDWSLNLYRNKIQNL
FT                   IACQSAFSTCKPDNTDAEIRGVEVALGLETGPIHHDLSFDYTRAEDKNDGDQQLLRRAK
FT                   QKASWLTQVQLGPVDLSTELLYVGKRDDKNFSSFPAERVELGSYTLINLGASYGVTPQL
FT                   TLGGRIDNLFDRDYAPAYGYASAGTEFKLTADYRL"
FT   gene            81400..82191
FT                   /gene="murI"
FT                   /locus_tag="ASA_0077"
FT   CDS_pept        81400..82191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murI"
FT                   /locus_tag="ASA_0077"
FT                   /product="glutamate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88282"
FT                   /db_xref="GOA:A4SHB0"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHB0"
FT                   /protein_id="ABO88282.1"
FT                   /translation="MANILVFDSGMGGLTIYREIRRALPAHNYFYCFDNANFPYGELSE
FT                   SALIAACTRLVSHMVAEHVIDLVVIACNTASTIALPSLRAALTIPVVGVVPAIKPAAAL
FT                   TRNGCIGLLATPGTVSREYTHHLIAQFAPGKRVLLKGATELVIEAEHKLAGRPVNMALL
FT                   QEVLTDWMEGEERPDTLVLGCTHFPLLNDEIRQLMPGCQLVDSGSAVARRVAHLLATVA
FT                   EQPSQAVVQARAYCTRLDAQAQKLTAPLQAWGLSSLEEVQY"
FT   gene            complement(82210..82701)
FT                   /locus_tag="ASA_0078"
FT   CDS_pept        complement(82210..82701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0078"
FT                   /product="RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88283"
FT                   /db_xref="GOA:A4SHB1"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHB1"
FT                   /protein_id="ABO88283.1"
FT                   /translation="MNLSKFPVYVQAAILALVLALVGYLVAQALQFSLKAEVIFAVGLA
FT                   IGGFIVPLFLKRTPAAAGELASGQETCTLYVGNLPYRANEIAVRELFAEQGQVISVRLM
FT                   KDKATGKRRGFGFVEMPAADAAKAIAVLNDKEYQQRTLKVREANDKRDKDEREGSEVDA
FT                   "
FT   gene            83347..84883
FT                   /gene="rrsA"
FT                   /locus_tag="ASA_0079"
FT   rRNA            83347..84883
FT                   /gene="rrsA"
FT                   /locus_tag="ASA_0079"
FT                   /product="16S ribosomal RNA"
FT   gene            85084..85159
FT                   /gene="trnE"
FT                   /locus_tag="ASA_0080"
FT   tRNA            85084..85159
FT                   /gene="trnE"
FT                   /locus_tag="ASA_0080"
FT                   /product="tRNA-Glu"
FT   gene            85397..88286
FT                   /gene="rrlA"
FT                   /locus_tag="ASA_0081"
FT   rRNA            85397..88286
FT                   /gene="rrlA"
FT                   /locus_tag="ASA_0081"
FT                   /product="23S ribosomal RNA"
FT   gene            88412..88529
FT                   /gene="rrfA"
FT                   /locus_tag="ASA_0082"
FT   rRNA            88412..88529
FT                   /gene="rrfA"
FT                   /locus_tag="ASA_0082"
FT                   /product="5S ribosomal RNA"
FT   gene            88626..88702
FT                   /gene="trnD"
FT                   /locus_tag="ASA_0083"
FT   tRNA            88626..88702
FT                   /gene="trnD"
FT                   /locus_tag="ASA_0083"
FT                   /product="tRNA-Asp"
FT   gene            88845..89708
FT                   /locus_tag="ASA_0084"
FT   CDS_pept        88845..89708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0084"
FT                   /product="HesA/MoeB/ThiF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88284"
FT                   /db_xref="GOA:A4SHB2"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHB2"
FT                   /protein_id="ABO88284.1"
FT                   /translation="MAALKQGDGMKAEYLQRFGGIARLYGQNALRSFSQAKVCVVGIGG
FT                   VGSWAAEALARAGINQITLIDMDDICITNTNRQIHAMQGTVGRLKTEVMAERIRAINPD
FT                   CEVIEVDDFVTPDNQAEHIKREFDYVVDAIDSVKAKVALIAFCKRNKIPVIVAGGAGGQ
FT                   MDPTQITVADLAKTIQDPLAAKVRSDLRRLHNFSKNPARKFGVECVFSTEQLSYPDGNG
FT                   GTCQAKAASDGNMKMDCASGFGAVTPVTATFGLVAASRVLKKIAERGARAEKEAGNEEV
FT                   GSISEA"
FT   gene            complement(89730..90164)
FT                   /gene="sufE"
FT                   /locus_tag="ASA_0085"
FT   CDS_pept        complement(89730..90164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufE"
FT                   /locus_tag="ASA_0085"
FT                   /product="cysteine desulfuration protein SufE"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88285"
FT                   /db_xref="InterPro:IPR003808"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHB3"
FT                   /protein_id="ABO88285.1"
FT                   /translation="MNSLATYTQIGLEPNAEGIRQQFVAAHGWENQYRLIIQLGKLLPG
FT                   LPAKWQQEEFRLKGCESQAWLKGEQGEDDRWHFACDSDARIVRGLIVIVLAALNHQSAE
FT                   AIQAFDMEAYFTELGLEKHLSPSRGNGLRAIVLAIREHAV"
FT   gene            complement(90178..91398)
FT                   /gene="sufS"
FT                   /locus_tag="ASA_0086"
FT   CDS_pept        complement(90178..91398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufS"
FT                   /locus_tag="ASA_0086"
FT                   /product="cysteine desulphurase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88286"
FT                   /db_xref="GOA:A4SHB4"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHB4"
FT                   /protein_id="ABO88286.1"
FT                   /translation="MNQQEHTQLRGQFPALAQQVNGHPLVYLDNAATTQKPQAVLDAIA
FT                   HYYRADNANVHRAAHTLSGRATRAFEAARETVARFIHAPHCREVIWTRGTTEAINLVAQ
FT                   SWGMSELKAGDEIVLSTLEHHANIVPWQLIAQRTGAVIRVIPLNERGDLDLATYHAMLG
FT                   PRTRLVSVAHVSNALGTVNPVSQIVTAAKAVGALTLIDGAQAVAHLEVDVQAIGCDFYA
FT                   FSGHKLYGPTGIGVLWGRTELLERMPPWQAGGEMIDRVSFSGTTFNALPFKFEAGTPHI
FT                   AGAIGLAAAIDFFMQQDRIALVHHEQVLTDHLVAGLRQVPGLRLVGEPGQRAGAVSFLL
FT                   DDIHPQDAATLLDMQGIALRVGHHCAMPLMQSLGISGTIRASLACYNNQDDVNALLAAL
FT                   RKLSDFF"
FT   gene            91565..93577
FT                   /gene="rep"
FT                   /locus_tag="ASA_0087"
FT   CDS_pept        91565..93577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rep"
FT                   /locus_tag="ASA_0087"
FT                   /product="ATP-dependent DNA helicase Rep"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88287"
FT                   /db_xref="GOA:A4SHB5"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHB5"
FT                   /protein_id="ABO88287.1"
FT                   /translation="MKLNPNQNEAVKFVSGPCLVLAGAGSGKTRVITNKIAYLVQQCGY
FT                   NARNIAAVTFTNKAAREMKERVGQTLGRKEARGLMVSTFHTLGLDIIRREHKSLNLKAN
FT                   FSLFDDTDQLALLKELTEAELDNDKDKLSALISQISNWKNDLILPARAMRIAQGPEEVL
FT                   MAQLYERYHRQMVAYNALDFDDLIVMPTLLLKSNEEVRTRWQNKIRYLLVDEYQDTNTS
FT                   QYELVKQIVGERARFTVVGDDDQSIYSWRGAKPQNLVLLNEDFPSLKLIKLEQNYRSKG
FT                   RILKCANILIANNPHVFDKALFSELDYGVPVKVLFAKNEEHEAERIAAELMGHKFMNRT
FT                   RFKDYAILYRGNHQSRIFEKALMTNRIPYRISGGTSFFSRTEIKDIMAYLKLLVNPDED
FT                   TAFLRVVNLPRREIGPTTLEKLGQYANQRGKSLFAASFELGLEQSLSGRGLSALQAFTN
FT                   WLVRLGEQAQRGNPVEAVRDMIKEIHYEEWLYETSPSPKAAEMRMQNVSTLYRWITEML
FT                   EGDELEESMTLAQVVTRLTLRDMMERNEGEDDADQVQLMTLHASKGLEFPYVFMVGMEE
FT                   GLLPHQTSIDEDNVEEERRLAYVGITRAQTELTFTLCKERRQYGESVRPEPSRFLLELP
FT                   QDDLEWENQKKVTAEERQQKGQVGVANLRALFKKD"
FT   gene            complement(93588..95872)
FT                   /pseudo
FT                   /locus_tag="ASA_0088"
FT                   /note="GGDEF/EAL domain protein; frameshift due to 1 bp
FT                   deletion"
FT   gene            complement(95957..96412)
FT                   /locus_tag="ASA_0089"
FT   CDS_pept        complement(95957..96412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0089"
FT                   /product="cytochrome c5"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88288"
FT                   /db_xref="GOA:A4SHB6"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHB6"
FT                   /protein_id="ABO88288.1"
FT                   /translation="MSVLKKLSYLLAVGMTAASLSGVVLAADEMSPDAIAERIKPVGQV
FT                   YTAKELEGIATAGAAPVAAAPSGPRDGEAVYKGACFACHDMGIAGAPKRGDKAVWEPRI
FT                   AQGIDILKKHAIEGFTGKSGVMPARGTCVTCSDEEIENAIHYMTDNL"
FT   gene            complement(96610..97638)
FT                   /gene="tdh"
FT                   /locus_tag="ASA_0090"
FT   CDS_pept        complement(96610..97638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdh"
FT                   /locus_tag="ASA_0090"
FT                   /product="L-threonine 3-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88289"
FT                   /db_xref="GOA:A4SHB7"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR004627"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SHB7"
FT                   /protein_id="ABO88289.1"
FT                   /translation="MKALSKLKAEVGIWMTDVPAPELGHNDLLIKIRKTAICGTDMHIY
FT                   NWDEWAQKTIPVPMVVGHEYVGEVVAVGQEVRGFAVGDRVSGEGHITCGHCRNCRAGRT
FT                   HLCRNTIGVGVNRPGSFAEYLVIPAFNAFKLPDNIPDELAAIFDPFGNAVHTALSFDLV
FT                   GEDVLITGAGPIGIMAAAVCRHVGARHVVITDVNEYRLELARKMGATRAVNVSKEKLAD
FT                   VMSALGMTEGFDVGLEMSGVPSAFQDMIDKMNHGGKIAMLGIPPSTMAIDWNKVIFKGL
FT                   FIKGIYGREMFETWYKMASLIQSGLDLTPIITHHFHIDDFQQGFEAMGSGKSGKVILSW
FT                   DK"
FT   gene            complement(97707..98804)
FT                   /gene="kbl"
FT                   /locus_tag="ASA_0091"
FT   CDS_pept        complement(97707..98804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kbl"
FT                   /locus_tag="ASA_0091"
FT                   /product="2-amino-3-ketobutyrate CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88290"
FT                   /db_xref="GOA:A4SHB8"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011282"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHB8"
FT                   /protein_id="ABO88290.1"
FT                   /translation="MSNGFYRHLTEQLGQVQAEGLYKQERIITSAQQAQIAVGGEQVLN
FT                   FCANNYLGLANHKVLEQKLSAFLGTEDTILYSSCFDANGGLFETLFGAEDAIISDALNH
FT                   ASIIDGVRLCKARRYRYANNDMAELEAQLKQANADGARFKLIATDGVFSMDGVIADLKS
FT                   ICDLADKYDALVMVDDSHAVGFIGNNGRGTHEYCGVLDRVDIITGTLGKALGGASGGYT
FT                   SGKKEVIEWLRQRSRPYLFSNSLAPSIVSATIKVIDMLAEGHELRARLKENSRYFRERM
FT                   SAAGFTLAGADHAIIPVMLGDAKLASEMASRMLAAGIYVVGFSFPVVPKGQARIRTQMS
FT                   AAHTREQLDKAIDAFIGIGRELGVI"
FT   gene            complement(98858..99502)
FT                   /locus_tag="ASA_0092"
FT   CDS_pept        complement(98858..99502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0092"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88291"
FT                   /db_xref="GOA:A4SHB9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025722"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHB9"
FT                   /protein_id="ABO88291.1"
FT                   /translation="MKTRDRIIHSATELFNDQGERNITTNHIAAHLGISPGNLYYHFRN
FT                   KEDIIHSIFDQYARHLSESFTPARSNEIKLENLMGYLDAIFYLMWQFRFFYANLPDILS
FT                   RDEPLQQKYLKAQEQLRSSVVALLRSLREGGIIDVNDEDLPDLGQTIKMVVTCWIPFQI
FT                   AQAPHTRITKPLLYQGVLRVLFLLRPYIQPQVAGQIRQLEQHYSQLAQPAG"
FT   gene            99649..100608
FT                   /gene="hldD"
FT                   /locus_tag="ASA_0093"
FT   CDS_pept        99649..100608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hldD"
FT                   /locus_tag="ASA_0093"
FT                   /product="ADP-L-glycero-D-manno-heptose-6-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88292"
FT                   /db_xref="GOA:A4SHC0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011912"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SHC0"
FT                   /protein_id="ABO88292.1"
FT                   /translation="MIVVTGGAGFIGSNLVKQLNAQGRTDIVVIDDLTDGTKFVNLVDL
FT                   TIADYMDKDEFQARIVSGDEFEEWDDGIEVIFHEGACSATTEWNGKFIMEVNYEYSKDL
FT                   FHYCIEREIPFIYASSAATYGGRNDNFIEDPKFEQPLNVYGYSKQLFDQYVRRWMPEIN
FT                   SQVVGLKYFNVYGPREQHKGSMASVAFHLNTQVKQGDNPKLFEGCDGFPDGGQMRDFIY
FT                   VDDVCKVNLWFWQNPQHSGIFNCGTGRAEPFQNVAEAVIKHHQQGAIEYIPFPDHLKGR
FT                   YQSFTQADMTRLRGVGYDGEFKTVAEGVADYMAWLNRA"
FT   gene            100694..101815
FT                   /locus_tag="ASA_0094"
FT   CDS_pept        100694..101815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0094"
FT                   /product="glycosyl transferase family 4"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88293"
FT                   /db_xref="GOA:A4SHC1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHC1"
FT                   /protein_id="ABO88293.1"
FT                   /translation="MKKKVLFLMETLGGGGAEKVLVNIVNSLDDIKYDVTLLLLKREGM
FT                   YLSKIPPHVKIKYLLDAEPTGLVRRGMMYSLKKRWLNAVLSKPWLANMSFPEEYDVGVS
FT                   FLEGDSSLLLSHLDGPKKKIAWVHIDLEKHHTLPREIEKVAYESMDQIICVSEGSKHSV
FT                   LSLYPALNDITSVIYNPIDLKKIIDGGEQKIRVGSGLNVLAVGRLLNDQKAFDVLLDAH
FT                   RINISAGLNYHLTILGEGSDRSTLEAYITEHQLGDNTSLLGFKDNPYPYIAGCDIFVIS
FT                   SHYEGYPVVLVEAMTLGKPIVSTDCTGPKEALSNGEFGHLVPIANAQALADGLKMLLEN
FT                   DAIRERYAELSKQRSEFFSFERSMRDIETLLNT"
FT   gene            101906..103666
FT                   /gene="wavL"
FT                   /locus_tag="ASA_0095"
FT   CDS_pept        101906..103666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wavL"
FT                   /locus_tag="ASA_0095"
FT                   /product="polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88294"
FT                   /db_xref="GOA:A4SHC2"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHC2"
FT                   /protein_id="ABO88294.1"
FT                   /translation="MNILMALSQLEVTGAEVYATTVGNELTRRGHQVCYVSDTLTKPTL
FT                   GPVFKLRFNKRSILRRFWHVFYLIYLIKKHHIQLVHAHSRASGWSSYVACKLTGTPMIT
FT                   TVHGRQPVHASRKAFHALGFRAVAVCEDIAHQIIDNLGVDPDIVQVLRNGIETDKFQPV
FT                   PVPDNARPVIAIIGRLSGPKGELCYRLLDEVLDLDTCQVRVVSGSQVPERFCRFQNQVD
FT                   FVGYVDDVPALLAGCDLVIGAGRVAMEALLCGRPAFAIGEAKAIGLVTEQNLAEALASN
FT                   FGDIGPKDLAIDFAALKAQILPALASRGVPDVICQRIQAEYGLQGVVSGLESVYQDAVV
FT                   ETLRREMPVVMYHRFIEHDSEKGVHGTWMPIAMFEKHLRLLKWLGYETLTFRDLADRGF
FT                   IHRLEYGKKYLMITADDGYQDNLTRMLPLLEKYGYKAVVYVVTGEEHNRWDVEHPTNPD
FT                   TQISLMNGEQIKALVASGHVEIGGHTLTHPRLSKLPPEQQAHEIRENKRQLEALLGYSL
FT                   LSFAYPYGDMDDSAKEQAQAAGYRFAVATNSGPRAMHQDPYRIRRIAIFPRTDVFGLWR
FT                   KIRGNYVFRK"
FT   gene            103673..104884
FT                   /gene="waaL"
FT                   /locus_tag="ASA_0096"
FT   CDS_pept        103673..104884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="waaL"
FT                   /locus_tag="ASA_0096"
FT                   /product="O-antigen ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88295"
FT                   /db_xref="GOA:A4SHC3"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHC3"
FT                   /protein_id="ABO88295.1"
FT                   /translation="MSIRSLELLDKATTALFALVILFSFCGLFLVPAGQTILSNLLVVA
FT                   SVFGLLNYFVGKKRDVGLEDRRILWVLAAYAAMIFVNRLIHGDQYGVMRGLFYVVVFAL
FT                   MIPRKPVLLTLGYAAIVTGGIGLGIMSLWQYQSGIVRVEGFTNAILFSQAALTLAILNW
FT                   FVFQQRQLLRWIRYGALVALVAALFALYLSQSRGGWLALGGIVGYVICYKALFKPWKYI
FT                   AIAMLCIASIGITYHTNQLVQLRVADAVSDLNFAEKGSYNSSWGLRVVAWQSAWLGFLD
FT                   APLTGVGTNGFDALKQEQVARGLVPPLALNAALAHAHSQYMQNLVIRGGIGFVVLVAFL
FT                   FLPLWLSMKKMGGDAACVLIPLSFAISAFSDVPFEHQDILYLYVLSMIFIWYSSELREN
FT                   KSAL"
FT   gene            104881..105564
FT                   /gene="lbgA"
FT                   /locus_tag="ASA_0097"
FT   CDS_pept        104881..105564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lbgA"
FT                   /locus_tag="ASA_0097"
FT                   /product="LPS biosynthesis glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88296"
FT                   /db_xref="GOA:A4SHC4"
FT                   /db_xref="InterPro:IPR002654"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHC4"
FT                   /protein_id="ABO88296.1"
FT                   /translation="MIPIFVISLSRSQARRAMLIKQMKHLGLEFTFFDAVDGKALSDAE
FT                   LQHVDFPLARETCGHDLSMGEVGCAMSHIRLYEMMVEKNIERCVVLEDDIYLHMHFNAI
FT                   MESAIAKSHSEIIFLYHGKAKCWPWMKPLPEGYRLARYRTPSCSSKRGIISTAGYILTL
FT                   SGAKKLLRKAYPIRMPSDYLTGRLQLNGLTASGVEPSCMDVGLFETTIDDRNYGPHLAN
FT                   REVES"
FT   gene            105561..106613
FT                   /gene="lbgB"
FT                   /locus_tag="ASA_0098"
FT   CDS_pept        105561..106613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lbgB"
FT                   /locus_tag="ASA_0098"
FT                   /product="lipooligosaccharideD-glycero-D-manno-heptosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88297"
FT                   /db_xref="GOA:A4SHC5"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHC5"
FT                   /protein_id="ABO88297.1"
FT                   /translation="MIGYLQLLRDRIRRALGIIFFDKKTPLGLQGDISHILVIRWDAKI
FT                   GDSFASSFFFRELKKLPNKFITVITSPALAPLYREEFGVDHVIEVTKRPSYKTLCDIAL
FT                   SIPHVDLAIHLTEGMKMKDLYFLYKLSPTNIASLDDNVARVNIKLSDTTKGMLFQEKYT
FT                   YLLNMLGLMDVDTTYIIPDVARDKVIYGCDNSIIINPFGSTRYKSMSQGKVTELLTVLG
FT                   QCFPTRHFALLSSPATREDAQKMINGCGVNNVALLEGVNTIEDAIYCIRAANVVISVDT
FT                   AIVHIAAGLKKPLIAIYPLHGNEFNQWLPSPSPLTKVIFSHSPGINADMNNVESHAISD
FT                   ALSMLLSIEQ"
FT   gene            complement(106588..107652)
FT                   /locus_tag="ASA_0099"
FT   CDS_pept        complement(106588..107652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0099"
FT                   /product="ADP-heptose:LPS heptosyltransferase II"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88298"
FT                   /db_xref="GOA:A4SHC6"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHC6"
FT                   /protein_id="ABO88298.1"
FT                   /translation="MKYLVVQTKQIGDVLISTALCNNLKQNEPTGEVHYLVMDYCAGMA
FT                   QGNPNIDRLIVIEKARRNDWRYMKDLLLDIRREHYDVVVNSQGQMIGLLTCRFSGAKLR
FT                   IGFDSFPWRLGHNRIVRFRKDTEFQGNSTLVDDRFSLLKPLNLAREDRNYYLWLSEEEK
FT                   QQGRETLQTAGIDPSRPLIAMGVNSLGHYKRWPIDCFAQVAQWLIEQHNTQILIYCGPG
FT                   EEEYNRSLKPLLSTELQASVFDHIKTRSVRELVGLFAHCQLFVGNDTGPRHMAQAIDLP
FT                   LLTIVAPGGDKIIANPVNHPRYQAIDIFDAKGAETDQLSALNKNGTNEQLYRLITPEMV
FT                   TERLSTLIAQLKAT"
FT   gene            complement(107820..108683)
FT                   /locus_tag="ASA_0100"
FT   CDS_pept        complement(107820..108683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0100"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88299"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHC7"
FT                   /protein_id="ABO88299.1"
FT                   /translation="MIHSMTAYARKEFKGDWGTAVWEIRSVNQRYLETYIRLPEQLRSL
FT                   EPVLRERFRAKLQRGKVECNLRFEAAQAAASQLHINEELAKLIIDSANWVMKEAGQGQL
FT                   NPVDVLRWPGVMAAAEQDMDAVATELLGGFDQTMEDFIASRASEGANLKNLIQQRLDGI
FT                   QVEVKKVRIHLPQIIEWQRQKLTDRLTEAKVELDPARIEQEIVLLAQKIDVAEELDRLE
FT                   MHISETIKIMKKGGACGRRLDFMMQEFNRESNTLGSKSINADVTQSAVELKVLIEQMRE
FT                   QIQNIE"
FT   gene            108974..109696
FT                   /gene="rph"
FT                   /locus_tag="ASA_0101"
FT   CDS_pept        108974..109696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="ASA_0101"
FT                   /product="ribonuclease PH"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88300"
FT                   /db_xref="GOA:A4SHC8"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHC8"
FT                   /protein_id="ABO88300.1"
FT                   /translation="MSRPSDRSAAQLRPVTITRNFTKHAEGSVLVEFGNTRVLCTASVD
FT                   TSVPRFLKGKGQGWVTAEYGMLPRSTHSRMNREAAAGKQSGRTLEISRLIARSLRAAVD
FT                   LTALGEHSITVDCDVLQADGGTRTASITGACVALVDALNWMVEKGMIKQSPLKQMIAAV
FT                   SVGMYQGEAICDLEYIEDSAAETDMNVVMTEDGRIIEVQGTAEAEPFTHEELLAMLGLA
FT                   KGGIEEIIALQKQSLSLF"
FT   gene            109766..110419
FT                   /gene="pyrE"
FT                   /locus_tag="ASA_0102"
FT   CDS_pept        109766..110419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="ASA_0102"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88301"
FT                   /db_xref="GOA:A4SHC9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SHC9"
FT                   /protein_id="ABO88301.1"
FT                   /translation="MKAYQRQFIEFALEKQVLKFGEFTLKSGRKSPYFFNAGLFNSGRD
FT                   LARLGRFYAAALMDGGIEFDVLFGPAYKGIPIASATAVQLVEQHDVDVPWCFNRKEAKD
FT                   HGEGGNLVGSPLKGRIMLVDDVITAGTAIRESMDLIQANGASLAGVLIALDRQEKGKGE
FT                   LSAIQEVERDYGAHIIAIIQMGDLIAYLEEKQAEQPELAVQLAAMQAYRAQYGI"
FT   gene            110609..113038
FT                   /locus_tag="ASA_0103"
FT   CDS_pept        110609..113038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0103"
FT                   /product="copper-translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88302"
FT                   /db_xref="GOA:A4SHD0"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHD0"
FT                   /protein_id="ABO88302.1"
FT                   /translation="MTTQIQDPIHLQLPLSGMSCANCASRISTALNQLEGVTATVNFAL
FT                   EQAAIELSDPARLPEVLDSITGQGYGYGHETLSFQIRGMTCAGCSARLNKMLAALPGVI
FT                   SAEVNFSIEQARIELVPGMQTPASLRERIEALGFGAQLAQGSASGRRQQLQEREAQEAA
FT                   AAHQALLQVVISALLTLPLLVGMIAMAGLLPWHMPAWLELVLATPVQFWIGARFYRGAW
FT                   LAIKNRSANMDVLVATGTSAAYFYSLYLLLTLGVAASGKLYFEASAIIITLISLGKLLE
FT                   ARARRSTQSAIRELMALRPETATVWRGERWQSLAIDEVLRGDRLRVLVGERVPVDGKIV
FT                   SGASDLDESILTGESLPVPRGIGEGVLGGAINRSGVLEIEATTVGEDSSLSKIIVLVES
FT                   AQMGKAPLQQLVDKVSAVFVPVVMAIALFTLLVWYAIGNDFGQALLAAVAVLVIACPCA
FT                   LGLATPAAIVTGTGVAARHGILIKDVDTLQKAHAIKALIFDKTGTLTQGRPVLASWSGN
FT                   DEQLRLAAALQQASEHPLALAMREAVGKEVVLPQPDEVEVRVGAGILGKVAGHSVAIGN
FT                   ASLLAQLGIDQSLQDEEPADGATRVWVAIDGVAVGIAALADTLRPESPEAIATLRQRGI
FT                   ASWLVSGDAPAPVAHIAGKLGLDGAFDSVLPAGKVDKVEALRARTQGLVAMVGDGVNDA
FT                   PALAAADVGIAMGSGSDVAMETASITLMRSDPRLVADAIDISAATWRTIQQNLFWAFVF
FT                   NIIGIPLAALGYLSPELAGAAMALSSITVLSNSLLLKRWQPKAAHTSALIQIGKET"
FT   gene            113039..113428
FT                   /gene="cueR"
FT                   /locus_tag="ASA_0104"
FT   CDS_pept        113039..113428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cueR"
FT                   /locus_tag="ASA_0104"
FT                   /product="Cu(I)-responsive transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88303"
FT                   /db_xref="GOA:A4SHD1"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHD1"
FT                   /protein_id="ABO88303.1"
FT                   /translation="MNISKVAKATGLTAKTIRYYESIGLISAPVRSDNGYRSYTEGALR
FT                   ELRFVKRARETGFNLEECQELLALYRNEHRTSAQVKKLAQEKIVDLRSRIAGLQAMLTS
FT                   LEGLVCCCHGDENPECPILDELERG"
FT   gene            113507..114667
FT                   /locus_tag="ASA_0105"
FT   CDS_pept        113507..114667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0105"
FT                   /product="GGDEF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88304"
FT                   /db_xref="GOA:A4SHD2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHD2"
FT                   /protein_id="ABO88304.1"
FT                   /translation="MQLTQSVTRQVKQAIMAQLYTHSSFSLPCLGLLALGWSLLFHDYL
FT                   PAGEALGWLALVCLLLLCRGWHLRWRQSSLTQTPLPVLERELFIGVTITSIIWALGVLL
FT                   YMDKLPDTYRAAMMMLSSLILTGSAIMLFGSRRSLYGAVLPLGLAMLFELGAGNEQERI
FT                   VSCMLAGYLFVFLPTLLRRLRRDQVASLYHRFSNADLVAELKLVSEHLKLTSRLDGLTG
FT                   IANRAHLDYCLERAWRRCHRARAPLSLVLVDVDYFKQFNDLYGHQQGDECLQRVAALLA
FT                   EVQRREDDLAARYGGEEFALLLPCTSMQGALQIAENVRMALKDLGIPHQKSLVSGRVSC
FT                   SFGVATLVPDQSGSIAELIQKADAALYQAKHNGRDRIEVALMGKVA"
FT   gene            114698..114961
FT                   /locus_tag="ASA_0106"
FT   CDS_pept        114698..114961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0106"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88305"
FT                   /db_xref="InterPro:IPR009383"
FT                   /db_xref="InterPro:IPR038134"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHD3"
FT                   /protein_id="ABO88305.1"
FT                   /translation="MQCHRIEELLELLQPAWIKEQDLSLVQFVAKLAAEAGYDGALSDL
FT                   TDDMLIYHLKMRESDKQAMIPGLAKDHVPDFKEALLKARGIK"
FT   gene            115158..116609
FT                   /locus_tag="ASA_0107"
FT   CDS_pept        115158..116609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0107"
FT                   /product="FixG-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88306"
FT                   /db_xref="GOA:A4SHD4"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014116"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR032879"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHD4"
FT                   /protein_id="ABO88306.1"
FT                   /translation="MADHEKIDIKDVTDKSVTGTFNPNTFKASDDRFNPGNRIYVRAQT
FT                   GYWQRMRKIMGWFFVVLFVALPWLRYDGRQAVLFDVGHQQFHIFGATIWPQDLTLLAWI
FT                   FMIAAFALFFVTTFLGRVWCGYLCPQTVWTFMFIWFEEKLEGAANKRRKLDAAPWSGEK
FT                   LARKGAKHLAWILLSLGTGLTFVAYFQDVTELVPDFFTLQASGWVIFWVLFFTACTYGN
FT                   AGWMRAIMCIHMCPYARFQSAMFDKDTFIVGYDTKRGETRGARSRKADPKALGLGDCID
FT                   CDLCVQVCPTGIDIRDGLQYECINCGACVDACDQTMDRMGYPKGLISYTTEHKLAHNST
FT                   HVARPKLLGYGLVMVMMLGVFVYNAMSIMPMGLDILRDRNQLFRENSEGLIENTYTLKI
FT                   LNKTLHAQTYQLDVEGLPEHEWFGPREVTLKAGEIYTLPVSVAVDPFNLKKPTLDIQFV
FT                   LKRDGAAADDSKGTLRQASKFISRL"
FT   gene            116694..117683
FT                   /locus_tag="ASA_0108"
FT   CDS_pept        116694..117683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0108"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88307"
FT                   /db_xref="GOA:A4SHD5"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHD5"
FT                   /protein_id="ABO88307.1"
FT                   /translation="MVDDMRFNYSDLTPDLIMDALDLSGLRLDSGLIELNSYENRVYQF
FT                   QDEERRRYVVKFYRPGRWSRAQILEEHDFAARLNEAEIPVAAPLSFAGETLLEHQGYPF
FT                   AIWQSVGGRQFEVDNLDQLEWVGRYLGRIHQIGASRSFHHRVRLDVESMLHEPRELLAS
FT                   GEWLPSGLAKQFFGVLDELIKHVCDAMTLDVAQISLHGDCHPGNILWRDSPMFVDLDDC
FT                   RTGPAIQDLWMMLSGERHEQLIQLDTLLASYEEFMEFDPRELALIEPLRAMRIVHYMAW
FT                   LARRWDDPAFPRHFPWFNTDHYWRQQIATLHDQLAALKAPPLTLMPGW"
FT   gene            118061..118669
FT                   /gene="dsbA"
FT                   /locus_tag="ASA_0109"
FT   CDS_pept        118061..118669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbA"
FT                   /locus_tag="ASA_0109"
FT                   /product="thiol-disulfide interchange protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88308"
FT                   /db_xref="GOA:A4SHD6"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHD6"
FT                   /protein_id="ABO88308.1"
FT                   /translation="MKKVLFFLAAMLMIPMVHAAPEFKEGVNYDVVKQTGSAQPEVVEF
FT                   FSYYCPHCATFEPIVEQLKAGMPEGVPLKKNPVAFLGREMGPEMQRAYALASLLNVEAK
FT                   LTPAIFNKIHTQRQYPQSRADVKQIFLDNGVPAEEFDGAVDSFAVSGMVSQFDRNTESY
FT                   NIRGVPAFLVNGKYMVKIESITSQEQFSQLVNFLLAKKD"
FT   gene            complement(118774..120309)
FT                   /gene="phnE"
FT                   /locus_tag="ASA_0110"
FT   CDS_pept        complement(118774..120309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnE"
FT                   /locus_tag="ASA_0110"
FT                   /product="ABC-type phosphate/phosphonate transporter,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88309"
FT                   /db_xref="GOA:A4SHD7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHD7"
FT                   /protein_id="ABO88309.1"
FT                   /translation="MSRWHHPLPWLLALVGYSLWQQADGWLGLLDGQSWRQMGNFLATS
FT                   WPPRLDQDFLALTLTATLQSLAVATLGLAGALLLGIPFALLGSRALSLAELGPIPSPLR
FT                   GALRAFSRLIAILLRSLPELIWALLFVRLSGLGPLAAILAIAVSYGGMLAKVYNEIMES
FT                   GALQPARALLLGGSGRLQALWYGVLPAVRQELLSYTVYRWECALRASVIMGFVGAGGLG
FT                   QQLELSLRMFAGGEVVTLLLAFILLVTLADGLSAWLRHTRSPGLQLLACLGLASAMALH
FT                   QLDWRMLSFSFGGLGRFIGEFLQPDWSGPFLRTVGLGLLDTVQMALLSTLLSALLALPL
FT                   ACLARHCWPLRLLFNLLRSVPELIFASLLVIAVGLGPVAGILALTLHTTGVLARLFVET
FT                   LENADQAPRLALQLSGSGPTASFWYGLFPLVSRQWLAYSLYRGEMNLRAATILGVVGAG
FT                   GLGQQLYVSLSLFRYDQAATLILAILLLVWLAEGISRRSRLPRPAPSQRDCQI"
FT   gene            complement(120309..121070)
FT                   /gene="phnC"
FT                   /locus_tag="ASA_0111"
FT   CDS_pept        complement(120309..121070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnC"
FT                   /locus_tag="ASA_0111"
FT                   /product="ABC-type phosphate/phosphonate transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88310"
FT                   /db_xref="GOA:A4SHD8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012693"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHD8"
FT                   /protein_id="ABO88310.1"
FT                   /translation="MIAVALNGAGLRLGESRILHPLRLQIEAGECVAIIGPSGAGKTSL
FT                   LRLIGTELRGELALSLWGEDPWALSTRARQRLRSRIGMVWQQPPLPASQPVVTAVLAGR
FT                   LGQWSLVRALLSLLRPCDPDGARAELARLGLADKWQQRCGELSGGQLQRVGIARVLYQQ
FT                   PDLMLADEPVSALDPVLAQSSLDALLAQARTHGSTLIASLHAVELALERFPRIIGLREG
FT                   RVQFDCPATAVTPAMLGALYAGDQEALPCVG"
FT   gene            complement(121067..121912)
FT                   /gene="phnD"
FT                   /locus_tag="ASA_0112"
FT   CDS_pept        complement(121067..121912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnD"
FT                   /locus_tag="ASA_0112"
FT                   /product="ABC-type phosphate/phosphonate transporter,
FT                   periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88311"
FT                   /db_xref="GOA:A4SHD9"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="InterPro:IPR030836"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHD9"
FT                   /protein_id="ABO88311.1"
FT                   /translation="MTSKWIFALTTLLASLGATAAEPLRVSAIPDEAPTELQRKFAPLG
FT                   EYLAEKTGREVVFVPVNDYAAVVEALAAGKLDMAWLGGFTYVQAHRRADKVVPLVQRQE
FT                   DAQFTSKFIANADSGIKTLADTRGKDFAFGSPSSTSGHLMPRHFLAEQGINPERDFAHV
FT                   AFSGAHDATVAWVASGKVPAGALNASVWDKLVEEGKVDTAKVKVIWTTPTYFDYNWTVR
FT                   GDLDPALQEKIKQAFLSLDPAVPAQAEILKLQRASRFIETKPENYQGIEAAATQAGLLK
FT                   "
FT   gene            complement(122037..123215)
FT                   /gene="pncB"
FT                   /locus_tag="ASA_0113"
FT   CDS_pept        complement(122037..123215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncB"
FT                   /locus_tag="ASA_0113"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88312"
FT                   /db_xref="GOA:A4SHE0"
FT                   /db_xref="InterPro:IPR006406"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHE0"
FT                   /protein_id="ABO88312.1"
FT                   /translation="MPPILTSLLDTDAYKLHMQQAVFHRYPDAEVVAEFHSRNEEDLLP
FT                   MMGQIEEQLRLAGSLRLTRPELNFLAERPFFTADYLDHLRRKPLDASLLQVFEQDGRIN
FT                   VRVEGPWQDVILWEIPVLAIISEMRNRFRYPQFGVNQALDRLDQKIDKLEQDLSPEEMS
FT                   EFNLIDFGTRRRFSHAVQDAVVGRLKERLPAFRGTSNYLLAQKYQLPAVGTQAHEWFQA
FT                   HQQLGFPLEHSQRAALTSWLDEFTNHLGIALTDCITMDAFLRDFDFELASRYQGLRHDS
FT                   GDPVMWGEKAISHYQRLGIDPTDKTLVFSDGLNLDKAVQLFRHFRGRINTSFGIGTKLT
FT                   CDLPGVSPMNIVFKLMECNGGPVAKISDSPGKTLCRDADFIRNLKQAFHVGV"
FT   gene            complement(123305..123940)
FT                   /gene="pncA"
FT                   /locus_tag="ASA_0114"
FT   CDS_pept        complement(123305..123940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncA"
FT                   /locus_tag="ASA_0114"
FT                   /product="pyrazinamidase/nicotinamidase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88313"
FT                   /db_xref="GOA:A4SHE1"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHE1"
FT                   /protein_id="ABO88313.1"
FT                   /translation="MGTVASLDIDAQKGFTPLCPNELPVVGGDDIVAALNAQATLATLR
FT                   IGSKDSHPANAAWAVSDPAGMLLPLDLPNADLTWPVHCVPGTQGFELLDGLPAPIDYDF
FT                   FVWKGVEPDLHPYGTCFHDLAERRSTGLIEFLQARKVDTVLVGGLATDYCVKTSVLQLR
FT                   HAGFRVIVHLDACRGIAPDTVASAHSQMIEAGAELAQTLMDVQRLLDA"
FT   gene            124015..124665
FT                   /locus_tag="ASA_0115"
FT   CDS_pept        124015..124665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0115"
FT                   /product="MutT/nudix family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88314"
FT                   /db_xref="GOA:A4SHE2"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHE2"
FT                   /protein_id="ABO88314.1"
FT                   /translation="MLRMSLDMVVLRLYEERLELLLETRDHPPFANCWQLPALRIDETR
FT                   DRDLDTARHRLLAEWGLGHCYSEQVCTLGNLERDPRGWSTALVYLCLVDPEVEAVHGCW
FT                   HPLSALPGLSLAFDHTQLIARGLERLRIKSRYSTLPLQLLGPEFTLSEVQRAFEIILQT
FT                   PMNTAAFRKRIHRADILVDTGRKRTGKQRPAILYRLESPCCVMFDQVMHGAEA"
FT   gene            124662..125159
FT                   /locus_tag="ASA_0116"
FT   CDS_pept        124662..125159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0116"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88315"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHE3"
FT                   /protein_id="ABO88315.1"
FT                   /translation="MSKAPPRVLVSACLLGQPVRYDGQSKGIVSDWLNELGAEGRTQSF
FT                   CPEVAGGLPTPRPPAERQGDLVLTASGLDVTAEFDRGAELALALCQAQGIRFALLKEGS
FT                   PSCGSGRIYNGRFEGVSVAGEGKTTALLRRNGIAVFREEQLPELALALASATAKEADST
FT                   PN"
FT   gene            complement(125318..126217)
FT                   /locus_tag="ASA_0117"
FT   CDS_pept        complement(125318..126217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0117"
FT                   /product="Phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88316"
FT                   /db_xref="GOA:A4SHE4"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHE4"
FT                   /protein_id="ABO88316.1"
FT                   /translation="MQNKLIERLRGSLSTLLYFFNTLFWCIPIFLLGILKLLLPLKGWR
FT                   TLCNALLDGCASCWIGVNNLIQKTIIGTSFEVVGADKGSRDEWYMVIANHQSWVDILVL
FT                   QRVFNQKIPFLKFFLKKELIWVPFLGLAWWALDFPFMRRYSRKFLEKRPHLKGKDIETT
FT                   RKACARFRHIPVSVMNFVEGTRFTAHKHDKQAAPYRHLLHPRAGGIAFTLAAMGDQLHQ
FT                   LVDVTIAYPGGIPSYWDFMCGRVKEIKVQVRFLPIERKLVGDYFNDPEFQQAFQQWLNG
FT                   IWHEKDQTLSQLLSDKAQ"
FT   gene            complement(126354..127868)
FT                   /gene="comM"
FT                   /locus_tag="ASA_0118"
FT   CDS_pept        complement(126354..127868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comM"
FT                   /locus_tag="ASA_0118"
FT                   /product="ComM-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88317"
FT                   /db_xref="GOA:A4SHE5"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHE5"
FT                   /protein_id="ABO88317.1"
FT                   /translation="MSLAVVYSRASLGIAAPQVTVEVHLSNGLPAFNMVGLPETSVKES
FT                   RDRVRSALLNGNFEFPSKHITVNLAPADLPKEGGRFDLAIAIGILAASKQIPAKYLLDH
FT                   EFLGELALTGEIRPVLGVLPAVLACRDAGRTLLVPRENGPEASLIQDAEVRTAHQLLAV
FT                   TAWLAGQYELPLPEPQTTDSLPDVPDLQDVIGQSQAKRALEIAAAGSHNLLFIGPPGTG
FT                   KSMLASRLPGILPPLSEQEAQQTAAIHSIGGLTPRAGHWHHRPYRTPHHSASAVALVGG
FT                   GSHPRPGEISLAHNGVLFLDELPEFERKVLDSLREPLETGHITISRAARQVDFPARFQL
FT                   VGAMNPSPCGHYGDGQTRSSPDQILRYLGKLSGPFLDRFDLTVEVPLLPKGSLTGKAER
FT                   GESSQQIRDRVLAARERMLSRNGKLNNLLDSREIEDICRLSPQDAEFLENAIQKLGLSI
FT                   RAWHRILRVSRTIADLAGRPAIEKDHLIEALGYRAMDRLLSRLRSG"
FT   gene            128253..129899
FT                   /gene="ilvG"
FT                   /locus_tag="ASA_0119"
FT   CDS_pept        128253..129899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvG"
FT                   /locus_tag="ASA_0119"
FT                   /product="acetolactate synthase II large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88318"
FT                   /db_xref="GOA:A4SHE6"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHE6"
FT                   /protein_id="ABO88318.1"
FT                   /translation="MNGAQFLVQALKKQGVTQVFGYPGGAIMPVYDALYDGGLAHQLCR
FT                   HEQGAAMAAVGYARASGQVGVCIATSGPGATNLVTGLAEALLDSVPLVAISGQVPCSAI
FT                   GTDAFQEVDVLGMSLSCTKHSFMVTDVADLGRVLEEAFAIATEGRPGPVLIDFPKDVQL
FT                   AAVPAQNLLFAVEEPEALNPAELTLVRTLLAAAERPVLYVGGGVGMANAETQLREFAAV
FT                   TGMPAVTTLKGIGALDPDSPVYLGMLGMHGTKSANYAVQQCDLLVVVGARFDDRVTGKL
FT                   EEFAPEAKVIHLDVDAAEFGKRRAAEVGITTDLKRVLPALAMALAIDPWREHCANMARE
FT                   YAFRYDHPGQPIYAPALLKQLSARLPENSVVACDVGQHQMWVAQHMRFTSPRNHLSSAG
FT                   LGTMGFGLPAAIGAKMSRPDDEVVLVSGDGSFMMNVQELGTIRRAQLKVKMVLIDNQRL
FT                   GMVRQWQELFFDGRYSETILSDNPDFVALAAAFGIPGETITCKDQIAAALDRLLGSEGA
FT                   YLLHVAISEEENVWPLVPPGVANHKMMEQRP"
FT   gene            129896..130186
FT                   /gene="ilvM"
FT                   /locus_tag="ASA_0120"
FT   CDS_pept        129896..130186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvM"
FT                   /locus_tag="ASA_0120"
FT                   /product="acetolactate synthase II small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88319"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHE7"
FT                   /protein_id="ABO88319.1"
FT                   /translation="MNPHTFAQPAFAQHTLHIHAQPRPEVMERVLRVVRHRGFNLCALS
FT                   MEMGAEQDCQQLRITVTVESVRPIQHLWSQLVKLVDVSRVDALEQQPRIRA"
FT   gene            130199..131140
FT                   /gene="ilvE"
FT                   /locus_tag="ASA_0121"
FT   CDS_pept        130199..131140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="ASA_0121"
FT                   /product="branched-chain amino acid amiotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88320"
FT                   /db_xref="GOA:A4SHE8"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHE8"
FT                   /protein_id="ABO88320.1"
FT                   /translation="MSQPSQPQPQYIWFNGNMVPWQDAQVHVMSHALHYGSSVFEGVRA
FT                   YDTPKGTCIFRLQEHTRRLFDSAKIYWMEVPYSEAEVNEACRAVVRENGLKSGYLRPLA
FT                   FIGNVGLGLHPPLDAKAELMVAALPWGAYLGEEGLKNGVDVCVTSWNRLAPNTIPTGAK
FT                   AGGNYLSSQLISREAKRNGYAEGLALDVNGYLSEGAGENLFLVKNGVLFTPPATAAILP
FT                   GITRDTIMTLARDLGYEVREQALPREALYVADEIFMTGTAAEVTPVRSVDRMQVGAGCR
FT                   GPVTEQLQNAFFGLFNGQTKDKWNWLTPVDDK"
FT   gene            131290..133131
FT                   /gene="ilvD"
FT                   /locus_tag="ASA_0122"
FT   CDS_pept        131290..133131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="ASA_0122"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88321"
FT                   /db_xref="GOA:A4SHE9"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SHE9"
FT                   /protein_id="ABO88321.1"
FT                   /translation="MPKLRSATTTHGRNMAGARALWRATGMTDEDFGKPIIAVVNSFTQ
FT                   FVPGHVHLKDLGQLVAREIEAAGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRELIADSV
FT                   EYMVNAHCADAMVCISNCDKITPGMLMAALRINIPVIFVSGGPMEAGKTKLSDQIIKLD
FT                   LVDAMIQGADPKVSDAQSEQVERSACPTCGSCSGMFTANSMNCLTEALGLSQPGNGSML
FT                   ATHADREQLFKLAGQRIVTLAKRYYQQDDESALPRNIATKAAFENAMALDIAMGGSTNT
FT                   VLHLLAAAQEAGVDFTMADIDRMSRKVPQLCKVAPSTQKYHMEDVHRAGGVVAILGQLE
FT                   KAGLVHGDTRTVLGGSLAELLNEYDVSRQPSQEVVDFYRAGPAGIRTTKAFSQDCRWPE
FT                   LDVDRAEGCIRSLEHAYSLEGGLAVLSGNLALDGAIVKTAGVDDEHLCFRGPARVFESQ
FT                   DTAVAGILDGTVKAGEVVVIRYEGPKGGPGMQEMLYPTTYLKSMGLGKQCALITDGRFS
FT                   GGTSGLSIGHVSPEAASGGTIGLVADGDIININIPARSMVLEVADSVLAARRVAVEARG
FT                   WKPLDRQRQVSFALRAYAMLATSADKGAVRDRSKLEE"
FT   gene            133209..134729
FT                   /gene="ilvA"
FT                   /locus_tag="ASA_0123"
FT   CDS_pept        133209..134729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvA"
FT                   /locus_tag="ASA_0123"
FT                   /product="threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88322"
FT                   /db_xref="GOA:A4SHF0"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHF0"
FT                   /protein_id="ABO88322.1"
FT                   /translation="MVSAADYLRKVLLSPVYEAARVTPLQTLKKLSERLGNHVALKRED
FT                   LQPVHSFKLRGAYHKIATLTQEQKDHGVIAASAGNHAQGVALSAAKLGIKAIIVMPKTT
FT                   PDIKIDAVRRQGGNVMLFGNSFDEAYAESRRLSELEGYTLIPPFDDVEVIAGQGTIGKE
FT                   LLEQDTHLTHVFVPVGGGGLAAGVAVYIKQLLPDVKVIGVEAEGSACLKAAMEAGEPVN
FT                   LERVSLFADGVAVKRIGTETFRLCNQYLDEVVTVSNDQICAALKDIFDDCRAIAEPSGA
FT                   LSLAGLKAYSEREQVKGGRMAAILSGANVNFHSLRYVSERCEIGEKREGMLAVTIPERK
FT                   GAFLDFCRQLGPRMVTEFNYRYSDAAQASLFVSVRLTGGDEELGQIIDQLGGNGYPVVN
FT                   MTESELAKNHVRYMIGGRPARPLGERLYSFKFPEQPGALMRFLETLGCRWNISLFHYRN
FT                   HGADYGRVLCAFELPDEDVAAFHDYLREIGYGWKEVSDDPAYRLFLAS"
FT   gene            135045..136151
FT                   /gene="ompAIV"
FT                   /locus_tag="ASA_0124"
FT   CDS_pept        135045..136151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompAIV"
FT                   /locus_tag="ASA_0124"
FT                   /product="outer membrane protein A"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88323"
FT                   /db_xref="GOA:A4SHF1"
FT                   /db_xref="InterPro:IPR000498"
FT                   /db_xref="InterPro:IPR002368"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHF1"
FT                   /protein_id="ABO88323.1"
FT                   /translation="MNKSILAALVSGLLATGAVQAAAQDNTWYAGGKAGWSKYFDVDQK
FT                   QVVSDTLGALQNTGTSKDALGLGAFAGYQLNPNLGFEFGYDWLGKYTSSGELSGVRVEG
FT                   EAKSQMIQATMKIGFPVNDALDLYGRIGGGYAWTDSELSARTATDFIKETGDKHGAVFV
FT                   GALGAEYAIDRDWAARLEYQYTTPLGDASLDRSGIEMDNGLLSVGMLYRFGQHGNEVVA
FT                   PAPAPAVEPAPAVVVAPKTFSLSSDVLFEFNKATLKPAASHALDTLFSQIVAANPKDGA
FT                   ATVVGHTDRIGSDAYNQALSEQRARTVADYLIAKGLFADKVRVEGRGKSSPVTGNNCTT
FT                   GSRPALIACLAPDRRVEIHLEGVSQPVQ"
FT   gene            complement(136208..136660)
FT                   /locus_tag="ASA_0125"
FT   CDS_pept        complement(136208..136660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0125"
FT                   /product="HPP family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88324"
FT                   /db_xref="GOA:A4SHF2"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHF2"
FT                   /protein_id="ABO88324.1"
FT                   /translation="MKKWYGPFWAGLGAALAIGILGWLNVSWHTALIMAPFGASCVLLF
FT                   SLPASPLARPSKVLGGHLLTASVGLLVQWLPLPLELQLALGVGLAIALMQGLDLIHPPA
FT                   GANPLLVLMTGQEWPFLWQTVLPGALLLILLGQGFQRLKRWPLRTT"
FT   gene            136737..137291
FT                   /locus_tag="ASA_0126"
FT   CDS_pept        136737..137291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0126"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88325"
FT                   /db_xref="GOA:A4SHF3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHF3"
FT                   /protein_id="ABO88325.1"
FT                   /translation="MSEKRQQLMATAYRLFNRHGFHATGIDRIWAEAGSTKRTLYRHFP
FT                   TKDALIEAVLLSREQEFFALLEGKLAGLEGRVSRLQALLDGFGEWFGRRDFYGCNFINA
FT                   SAEFADPRHPVRKLVVAHKQALLNWVRVQLGCSIPQATGLCLLLEGAVVMAHSYQQPLA
FT                   LVQVRSLALALLCADDDATVI"
FT   gene            137368..138459
FT                   /locus_tag="ASA_0127"
FT   CDS_pept        137368..138459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0127"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88326"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHF4"
FT                   /protein_id="ABO88326.1"
FT                   /translation="MRIDHYDLQGEVQHQYQQLQTRKVRNLGPVAPVVPGNTTAGEATP
FT                   AAGPAADPVVERVVAELMRSARTTSTQGGAGQQGAMGTEGVPSLVKPEAEETNPNDGLD
FT                   NRLRLIKLMIEAMLGHEIELPKPIKSSEGEMEGVAQGEAAPQAAEPDRAVEVTDTLLEQ
FT                   EQLKVVASASVQTSDGQTLQLDLGFVLDWRQLEVSQRRTTLNALKDPLVLSLDGKIADL
FT                   TEARVNFDIDQDGKDDSLPGLSEGSGFVALDRNGNGAIDDGGELFGARSGNGFGELAAL
FT                   DEDGNGVLDERDSHFSALQFWHPDHAPIALVELGIGAILLRPLDTPFNHLGESGNQGVL
FT                   RQSGLYLTEQGKGGWVQQIDLRV"
FT   gene            complement(138547..140754)
FT                   /gene="priA"
FT                   /locus_tag="ASA_0128"
FT   CDS_pept        complement(138547..140754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="ASA_0128"
FT                   /product="primosomal protein N'"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88327"
FT                   /db_xref="GOA:A4SHF5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHF5"
FT                   /protein_id="ABO88327.1"
FT                   /translation="MNSSQTLDLVRVAVPVPLRRHFDYLSPLPLPEPGCRVEIPFGPQT
FT                   LVGLVVDHPAESQVPRAKLKPLKRVLDSTPVLGPDILALMNWSANYYQHPLGEVLPHAL
FT                   PVLVRKGEPAAYRELEFWFATQAGMDMDLNELKRAAKQQQALALLRKGPQTPSALKQEE
FT                   IQSAALTALEKKGLLEKRSLEPSHDGDWATHFDAGEGLRLNGEQALAVSAVTSQSDQFG
FT                   AFLLDGITGSGKTEVYLSILEPLLKAGKQALVMVPEIGLTPQTINRFRRRFKVPVVAMN
FT                   SAMNDRERLDAWLACRDGGAAILIGTRSAVFTPFKNLGIIIIDEEHDGSFKQQDGFRYH
FT                   ARDLAVMRAHRAGIPILLGSATPSLETLHNARTGKYHHLSLTRRAGNAQTARQVILDIK
FT                   SVRLQAGLSPQLEQLMAEHLAAGNQVMLFLNRRGYAPSLICHQCGWSAACERCDAWYTW
FT                   HQAGRRLHCHHCDSVRPLPHSCPECGSNELIGSGVGTEQLEQLLTTVFPQYPVVRIDRD
FT                   NTRRKGELETHLGDIKAGKYKILIGTQMLAKGHHFPDVTLVGLLDVDGALFSADFRAAE
FT                   KLAQLYTQVAGRAGRASKPGLVVLQSHHPEHALLQDLTQNGYGHFADTALKERHLLGLP
FT                   PFSYQGLFRAEANGRDEVQLFLARLADTLRSARYPHVQVLGPISGFMERKAGKFRMQLL
FT                   VQGPNRAPLAQLMDWAVKELDGWPETKKVRWSLDIDPTELN"
FT   gene            140902..141117
FT                   /gene="rpmE"
FT                   /locus_tag="ASA_0129"
FT   CDS_pept        140902..141117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="ASA_0129"
FT                   /product="ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88328"
FT                   /db_xref="GOA:A4SHF6"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SHF6"
FT                   /protein_id="ABO88328.1"
FT                   /translation="MKAGIHPEYVAITAKCSCGNVINTFSTMGKDLNLDVCSACHPFYT
FT                   GKQKEVSSGGRVDKFNKRFGGLTAKK"
FT   gene            141263..142720
FT                   /locus_tag="ASA_0130"
FT   CDS_pept        141263..142720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0130"
FT                   /product="nucleoside-diphosphate-sugar epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88329"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR021295"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHF7"
FT                   /protein_id="ABO88329.1"
FT                   /translation="MNNTGGVPMRNCLVMGAAGYIGSYLVPHLQGLGYRVIAGARRPCR
FT                   LPQGVEFRFADSLKPITLLPALANIDTVFYLVHAMGAGADFHRLEQQGVKNFAAAARAA
FT                   GVRRIIYLGAIQPEQCNSRHLNSRRYCGELFRDSGVPTVELRSGIIIGPGSAAFEVMRD
FT                   LVFNLPMMVTPKWVRSRTPPIALSNLLHYLGGLVEVEGVDGQVLNAVGPELLSYQQQLQ
FT                   KFAAHIGKRCPIIPIPFLSPKLSAWWLQFVTSVPQPVAKALVGGLKHDIPVDDGPLRAL
FT                   LPQTLLSFDEALAESLALEQKLGAEQQGEETPLGLRWRHPEYGFYDRTASGEAICLASP
FT                   EVVWQVLQQLGGEQRYFYMNELWVVREWMDHLIGGPARTRGRTNPDRFVKGDMLDSWQI
FT                   LGVDEGRRLDLLFNMKAPGVGRLAFNILPEESGLTRIRVTAHWHPQGAWGLAYWLAMLP
FT                   FHLFIFQGMTEAIARQAEAKAGIPVMG"
FT   gene            142900..144156
FT                   /gene="maeB"
FT                   /locus_tag="ASA_0131"
FT   CDS_pept        142900..144156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maeB"
FT                   /locus_tag="ASA_0131"
FT                   /product="malic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88330"
FT                   /db_xref="GOA:A4SHF8"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHF8"
FT                   /protein_id="ABO88330.1"
FT                   /translation="MSDLRHDLRQQALDYHAQPMPGKIAIALTKPAETAHDLALAYSPG
FT                   VAEPVREIAANPDDAYRYTGKGNLVAVISNGTAILGLGNLGPLASKPVMEGKALLFQRF
FT                   AGIDAIDIEVKHETSQQFIDTVAAIADTFGGINLEDIKAPECFEIEESLIARCNIPVFH
FT                   DDQHGTAIVTAAGLLNALEVQGKRIEQSRIVCMGAGAAATACMDLLIKCGAAPHNIFML
FT                   DRQGVIHTERTDLNRYKQRFANDTQLRTLMDVIEGADVFVGVSGPDVLPAEAVALMAPN
FT                   PVIFACSNPDPEIKPSLAHSVRDDLIMGTGRSDYPNQINNVLCFPFIFRGALDARASRI
FT                   NDAMKIAAVEAIRGLVKEPVPAEVLTAAGVSALAFGKDYVIPKPMDARLLPRVARAVAL
FT                   AAVASGVARVALPADYMLE"
FT   gene            complement(144236..144463)
FT                   /locus_tag="ASA_0132"
FT   CDS_pept        complement(144236..144463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0132"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88331"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHF9"
FT                   /protein_id="ABO88331.1"
FT                   /translation="MEKSSMSSTRMRNWNMNKLIPLSLAAVFALTSGFTMAATPTKAAA
FT                   PQATQTKVVKKHHKATHAKTPAVKVAPKTK"
FT   gene            complement(144473..145798)
FT                   /gene="rstB"
FT                   /locus_tag="ASA_0133"
FT   CDS_pept        complement(144473..145798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rstB"
FT                   /locus_tag="ASA_0133"
FT                   /product="two-component system sensor histidine kinase
FT                   RstB"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88332"
FT                   /db_xref="GOA:A4SHG0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHG0"
FT                   /protein_id="ABO88332.1"
FT                   /translation="MRRLFIQFYLLLIGCFTLAILLVGLVYQVSAERAGDRYLERMMQG
FT                   SLGLLTGELARLPPERWPVRMAEQSRQLTLPLQIGALANQPLAKEDQAFIEAGNIVIVE
FT                   GDDTFLQRIPGTDQVLIVGPVPYLSYLHELHWVDVGLLLAIGLSLGLPILLWLRPHWRG
FT                   LQRLEQTARRVGDGDLSSRTGLPPGSSLGRVGRTFDQMTEQLQAMLASRKQLTDAIAHE
FT                   LRTPLVRLRYRLAMLDPQPSAAEQQGLERDLGALDALIEEMLTYARLDRPELPLQCSEL
FT                   ELASWAGSRLPDWQTLRPEKRLDLVCPTHPLPWRGDPRLLDRALENLIGNALRHATSRV
FT                   TLAMSQQQDHYLLEVADDGPGIDPALAPQIFEPFVRLDQSRDRRTGGAGLGLAIVRSIA
FT                   RHHCGEVQLLPSAVGARFCLRLPVHLDTNRHQPLTEPPAEQP"
FT   gene            complement(145836..146543)
FT                   /gene="rstA"
FT                   /locus_tag="ASA_0134"
FT   CDS_pept        complement(145836..146543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rstA"
FT                   /locus_tag="ASA_0134"
FT                   /product="two-component system response regulator RstA"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88333"
FT                   /db_xref="GOA:A4SHG1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHG1"
FT                   /protein_id="ABO88333.1"
FT                   /translation="MQRILFVEDDPEIGQLISSWLARHDIDVLLEPRGDMALARIEAEQ
FT                   PDLVLLDIMLPGQDGLSLCRDLRPRFKGPIVMLTSLDSDMNQILSLELGANDYILKTTP
FT                   PPVLLARLRVQFRQQGQAPQAAVANTPPQRLQFGRLRIDGPGRDVRLDGDSIPLSTADF
FT                   DLLWELACHAGQILGREALFRSLRGRDYDGQDRSMDVAISRLRRKLGDDSNNPTRIKTV
FT                   RQKGYLLVPHAWE"
FT   gene            complement(146680..147813)
FT                   /gene="trmA"
FT                   /locus_tag="ASA_0135"
FT   CDS_pept        complement(146680..147813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmA"
FT                   /locus_tag="ASA_0135"
FT                   /product="tRNA (uracil-5)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88334"
FT                   /db_xref="GOA:A4SHG2"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR011869"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SHG2"
FT                   /protein_id="ABO88334.1"
FT                   /translation="MTQIQQAGADSQALRTPADYQAQLDEKRERLTQLFAGFNPPALEV
FT                   HASPAEHYRMRAEFRIWHEGDDLFHCMYAQATKEIIRVDHFPTASLLINQLMPVLLAGL
FT                   RPHFVLRRKLFQIDYLSTQSGQIIVSLLYHRKLEAEWQQAAETLQADLQAQGFDLRLIG
FT                   RAHKQKICLGDDFVIEQLNVAGRQLTYKQVENSFTQPNAAINEQMLGWALDVTRGSEGD
FT                   LLELYCGNGNFSIALAQNFRKVLATEIAKPSVDSAQFNIAANGVDNLIILRMSAEEFTM
FT                   AMRGEREFNRLKGVDLKSYQCNTIFVDPPRAGLDDATVKLVQEYDNILYISCNPETLQA
FT                   NMAVLGETHEVARFALFDQFPWTHHMEAGVYLKRKAG"
FT   gene            147968..149161
FT                   /locus_tag="ASA_0136"
FT   CDS_pept        147968..149161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0136"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88335"
FT                   /db_xref="InterPro:IPR041651"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHG3"
FT                   /protein_id="ABO88335.1"
FT                   /translation="MVGGHIMQIDGVGSAQPKGVGVSPKAPQQAQEKQASSGEEVSLHQ
FT                   PPKWAQVLVQQALQFALEINGQRYQAPKAQEPEVVTPETLFDFQSVADNVLQFITGRLG
FT                   AARADGKSDDDLTEMMEQARKGVDMGFGAAREQLGDWATENEDIKTGIDQSYKLIQDGL
FT                   EEFEKEFFGKVSTTEMGAAEMASRQQGYLEIQTKDGDKVVLRFNDSWQVKSENSESGSQ
FT                   FSLKSSQSFSFSLEGDLSSDEMDSIGKLIKGIDDLAGNFFSGNFEDLLKKAGELKLDDS
FT                   QLASYSLKLKQSVKLSQTYQGASSLQDLLKPLADYLPKLNQVQQQADTLLPESQQQADT
FT                   LLPESQQQALTPAVLAARGQTEPAQVNSFTSFNQRMLEALRMIGQFQPATEPASKSV"
FT   gene            149252..149791
FT                   /locus_tag="ASA_0137"
FT   CDS_pept        149252..149791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0137"
FT                   /product="putative cobalmin adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88336"
FT                   /db_xref="GOA:A4SHG4"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHG4"
FT                   /protein_id="ABO88336.1"
FT                   /translation="MNPNPKKPRDKRELCYPFIFETQFQCDYEIATDELCCQVGAVLAH
FT                   LPAEEETREIVADLGALQRLIYNLNGSVRGKLGIFEEDLAWLKTRYDHYNEASRGRVTG
FT                   FVLPRGPQPIPTLHLCRCGSKKVVRLLVRLEESGVRFDPILYRFANLLANFFFVLTVYL
FT                   KQLWQVEEVPYVSINY"
FT   gene            149891..151573
FT                   /locus_tag="ASA_0138"
FT   CDS_pept        149891..151573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0138"
FT                   /product="HAD-superfamily phosphatase, subfamily IIIC:FkbH"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88337"
FT                   /db_xref="InterPro:IPR010033"
FT                   /db_xref="InterPro:IPR010037"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHG5"
FT                   /protein_id="ABO88337.1"
FT                   /translation="MTTIHLSGSSFLMPGNLAWRSLAVHGEVQVAPHGQWLQTLMNPSE
FT                   AVAPQTHIIIWLWEDLVPAQTLVAWSGLAQEAQQLAVAAFVASLCQPLQQRLQRRPQDH
FT                   LLVGVCSRSPVSVFGAAPSALACLAHECERQLAHLRRQHPGLDDLHLQLWLQQQGRHHC
FT                   FDNRNHYLMSCPFSMAGLASLAQWIAALLQRLHRPAHKVLVLDCDNTLWGGVVGEDGVG
FT                   GVLLGQDGVGRLYQAFQQAAIYWHGQGVILALCSKNLADDVWRLFDQHQGMVLERQHIA
FT                   AAEIGWESKSAGLRRLAARLNVGLDSLVFWDDSELERAEVRANCPEVTVITPPAEIWGW
FT                   PDALMTLAELQSRHQSRDDGLRQGSYQAQAEANAVRQQLGDEQAFLQQLGLRAGWQPLS
FT                   QSTQLRAEQLSQKTNQFNLSARRYQAGELAQLASTQGEVWLASLRDKFADHGMTALLVL
FT                   RPLNDGAVLLDTLAISCRVLGRGFEHWLLAQVAARLMAKGVDQLVISMVPTDRNQPARD
FT                   FLATLPTRSITTPAGLTPLADEMFLCLDLPSLSLPFLEFYANE"
FT   gene            151560..151778
FT                   /locus_tag="ASA_0139"
FT   CDS_pept        151560..151778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0139"
FT                   /product="putative acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88338"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHG6"
FT                   /protein_id="ABO88338.1"
FT                   /translation="MPMNDLIALVRQQFPHASINEQAALGLGSFPEWDSLGHFNLLLLI
FT                   EQHFAVRFEPQELADIRQALLRKGVAE"
FT   gene            151775..152539
FT                   /locus_tag="ASA_0140"
FT   CDS_pept        151775..152539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0140"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88339"
FT                   /db_xref="GOA:A4SHG7"
FT                   /db_xref="InterPro:IPR003679"
FT                   /db_xref="InterPro:IPR028345"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHG7"
FT                   /protein_id="ABO88339.1"
FT                   /translation="MKQAIEQALSELGIPKGSALMVHSDAMVVAQFPGMGNAQGIATFW
FT                   MHLEQWLAGDLLVPTFTYSPMAGECFDPAATPSKVGLMTEVFRQRDGVTRTLDHIFSFA
FT                   ISGPHGAELAARECHDCFGQESPFGWLAEQDGWLLGLGCHPDRITFTHYVEQRLAVPYR
FT                   YHKLFEGQVCVAGALRDWQADYYVRDLALASEIDLSRLVALLQERGAWHQTLCQRVPVW
FT                   AVSCRDFILAASELVATAPFALIRAGGESHAV"
FT   gene            152529..152933
FT                   /locus_tag="ASA_0141"
FT   CDS_pept        152529..152933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0141"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88340"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHG8"
FT                   /protein_id="ABO88340.1"
FT                   /translation="MQFDHIGLVVPDLASGEAYCREVLGLTRFSVAVEDPLQKVWVQFV
FT                   HDEGGLCYELVAPATEDSPVTQVLKTRRNVINHLAYRVPCLAESAARLRDQRHLPLGPS
FT                   QPAIAFGGAHVQFFLSPLGHIVELIEAPTA"
FT   gene            152930..154216
FT                   /locus_tag="ASA_0142"
FT   CDS_pept        152930..154216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:153608..153610,aa:Trp)
FT                   /locus_tag="ASA_0142"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88341"
FT                   /db_xref="InterPro:IPR012353"
FT                   /db_xref="InterPro:IPR032589"
FT                   /db_xref="InterPro:IPR032610"
FT                   /db_xref="InterPro:IPR032622"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHG9"
FT                   /protein_id="ABO88341.1"
FT                   /translation="MSFSPKSDYLPTDWDDQGQLGEQLHRLLTLLFPLNRSLTGDGVRQ
FT                   TLALIRQHCLPDLQIREVASGTECFDWTVPDEWNVQQAYIVGPDGRKVVDFKDHNLHLV
FT                   GYSEPVRCTLSLAELQPHLHSLPDMPDAIPYVTSYYKRRWGFCLPHKVREALPGESEQE
FT                   ILLSSYTCHPSMANNELSGPCVGVFLMAWLASLPKRRYSYRLMLVPETLGAIVYLSRHL
FT                   DHLKWHTLAGFNLTCLGDERSYSFLPSRQGNTLADRIGRHVLGHLAPGYKAYSFLERGS
FT                   NERQLCAPGIDLPVTTLMRSKYGCYVEYHTSLDDLSLVTPAGLAGGFLALRRAIECLEL
FT                   DERCEVTVLGEPQLGKRGLYPDLSTRYSGWQVREMMNLLAYSDGQLTLFEIAETIKVPF
FT                   WRVAPLARSLLDAGLLRQHSPVLENALTK"
FT   gene            154229..155464
FT                   /locus_tag="ASA_0143"
FT   CDS_pept        154229..155464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0143"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHH0"
FT                   /protein_id="ABO88342.1"
FT                   /translation="MYGVGKYDSDHTSAPYRISHVLYGRKMPLYLPWSCFKERLMKCPY
FT                   CHGDNTLVFLERKMPTVLSAYSGNFPVKVAEMQISACKDCLVGFASKKLSSEELTEIYD
FT                   NYLYISPLNNIGVTKYDGMIDTIKKHFSVNDEIIEIGCSEGYLLKKLRDIGFSNVTGIE
FT                   PGPQADSAKALGLNVIKGYFDATHAKNKIDGYYLMHVFEHFEEPFSIFRLMSSTLNETG
FT                   KIVIEVPNFGGFHVQHLFYYNLYFMQVLSRDNDLKVIDFCIENGSLRVVFTKSENTQCR
FT                   EVDLVFDKIKYMPNLVDIKNSCESSRERVNDFLRGKDTVFWWGAGSASVILLNEIERDV
FT                   LDNTKIVVIDGDRNKSNLTIPGVNLKVNHYSTIGNLHINNLVIASSFYKEIFDSIRLSG
FT                   ITYDHVEVFSYA"
FT   mobile_element  complement(155527..156280)
FT                   /mobile_element_type="insertion sequence:ISAS8"
FT   gene            complement(155547..155948)
FT                   /pseudo
FT                   /gene="insB"
FT                   /locus_tag="ASA_0144"
FT                   /note="InsB; in frame TGA and TAA"
FT   gene            complement(155911..156252)
FT                   /gene="insA"
FT                   /locus_tag="ASA_0145"
FT   CDS_pept        complement(155911..156252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insA"
FT                   /locus_tag="ASA_0145"
FT                   /product="InsA"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88343"
FT                   /db_xref="GOA:A4SHH1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR024431"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHH1"
FT                   /protein_id="ABO88343.1"
FT                   /translation="MMGAFETQLFMAFITVHCLRCHYLHGKTPAGHIHYRCPACSHVFQ
FT                   LTYTYEAREPSVKEKIVEMAFNGSSIRDAARVLNIGINTVLRTLKTHPKASDNRKSCAG
FT                   RCHAYLRTR"
FT   gene            complement(156617..156880)
FT                   /locus_tag="ASA_0146"
FT   CDS_pept        complement(156617..156880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0146"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88344"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHH2"
FT                   /protein_id="ABO88344.1"
FT                   /translation="MRDSLITRITALAHQFRLGQSVAASQTLPILLQETLTKQGSLPPD
FT                   LIASLLHSQERQDWLGLADYLEYELVHILTTPSSPTIAGDVS"
FT   gene            complement(156877..158091)
FT                   /locus_tag="ASA_0147"
FT   CDS_pept        complement(156877..158091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0147"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88345"
FT                   /db_xref="InterPro:IPR002826"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHH3"
FT                   /protein_id="ABO88345.1"
FT                   /translation="MSDELFAQHGRLIRQRWPTLWPRLLAQDVESIQAELQAASLPEVA
FT                   VLHLYGTGLGDLPRALLGRSSLKRLEVKIMNGALFALVLRLLDQQDWLADSKVELMMAG
FT                   DESEIRPPFFALPPELQLVEDAAARIRDRLVSEIDLPFASARFDAEHPAVTRRLAENRE
FT                   LLTSDGDVASLFGLARGKHALIVASGPTLQHNLATLQKQLQSRRQDYLLISVDTALAFL
FT                   LRHGIRPDIVVTIDEAIYGDRLPAAQSAQTPLVYYPMVPTAALLAWQGPRKAAYSRSPM
FT                   YQTLRQEIPKGTLHSGGSVIHPAVDLAVQMGCQQVILLGTDFAFPGELTHSGWADGALG
FT                   PRASQALSWTLDGHGRRVKTNPNFSAYRIELERYIARHPEVHFWNSSREGAEIAGCSYH
FT                   QEYLL"
FT   gene            complement(158084..159130)
FT                   /gene="neuB"
FT                   /locus_tag="ASA_0148"
FT   CDS_pept        complement(158084..159130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="neuB"
FT                   /locus_tag="ASA_0148"
FT                   /product="sialic acid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88346"
FT                   /db_xref="GOA:A4SHH4"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR020030"
FT                   /db_xref="InterPro:IPR036732"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHH4"
FT                   /protein_id="ABO88346.1"
FT                   /translation="MQIAHQSIGPAQAPYVIAELSANHNGNLERALAIMTAAKAAGASA
FT                   VKLQTYRPDTITLRSDRPEFQIHGGLWDGHSLYDLYEWAHTPWEWHQALFAKGRELGLT
FT                   VFSSPFDFSAVDLLESLDCPAYKIASFELVDLPLIRYAAQTGKPLIMSTGMANEAEIAA
FT                   AVEMALKHGSGQLALLHCVSGYPAPAAEYNLRTIPMLRQRFGVEVGLSDHTLGSATATA
FT                   ATALGATLVEKHFTLARADGGPDCAFSMEPSELTELIASVNTAHAALGVADYQLTQSEQ
FT                   GNRAFRRSLYLVKDIAAGEVLTAAHIKSVRPALGLPPADYDRLIGKRVSRDMAANQPLS
FT                   WEWIDKDE"
FT   gene            complement(159137..160393)
FT                   /gene="flmD"
FT                   /locus_tag="ASA_0149"
FT   CDS_pept        complement(159137..160393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flmD"
FT                   /locus_tag="ASA_0149"
FT                   /product="flagellum modification protein FlmD"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88347"
FT                   /db_xref="GOA:A4SHH5"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="InterPro:IPR020023"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHH5"
FT                   /protein_id="ABO88347.1"
FT                   /translation="MAFNVAFRLDAGAEIGLGHLMRCLAIADRLRAAGAECHFLCHDLP
FT                   AHLLPLLHAHHHHPLTTQDDAGPLPQLQPDWLVFDHYQIDHVVEQELAVHCDRLLVIDD
FT                   LADRPHHCQLLLDQGPLRTAADYQPLIPADCRLLLGTDYALLRPACRQLARQQTSQWQR
FT                   GLICFGGADPAGACLTTLNSLARLPWARTIQWTLVAGGANPFWPELEQRVAELPELKIT
FT                   LLRQSDQMAQLMNQHDFTIGAAGGMTWERACLGLPTLAVPIVDNQQFNDEVIARFQLAE
FT                   RLTLDELAEPARLMQALQQLARQADDYRQRGQQQVDGLGLDRLTAWLLPQPDYQLIPDG
FT                   QQWRFQQDDRLLLTLTLCGPQLVWQAHPSLTPQQWQELAHRLQTIFSQFPLYLAEPPKI
FT                   APPAPWQPAPQGWQLGIGA"
FT   gene            complement(160383..161078)
FT                   /gene="neuA"
FT                   /locus_tag="ASA_0150"
FT   CDS_pept        complement(160383..161078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="neuA"
FT                   /locus_tag="ASA_0150"
FT                   /product="CMP-N-acetylneuraminic acid synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88348"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR020039"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHH6"
FT                   /protein_id="ABO88348.1"
FT                   /translation="MAIAIIPARGGSKRIPRKNIRPFCGQPMLAYAIQAARAAGCFSRI
FT                   VVSTDDEEIADLARQLGAEVPFLRPASLADDHTGTTPVVIDAIRQLDGLGIQAEYYCCI
FT                   YATVPLIQAGDLSAAHDRLLASRAPFVYTVAEFGFPIQRAVRMDAQGRVSPFWPEQMAQ
FT                   RSQDLEPAYQDAGQFYWGSRAAWLGGISPVGGEGIGHILPRHRVVDIDTPEDWHLAELL
FT                   YRVLSQDGV"
FT   gene            161244..161780
FT                   /gene="flmH"
FT                   /locus_tag="ASA_0151"
FT   CDS_pept        161244..161780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flmH"
FT                   /locus_tag="ASA_0151"
FT                   /product="flagellar modification protein FlmH"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88349"
FT                   /db_xref="GOA:A4SHH7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHH7"
FT                   /protein_id="ABO88349.1"
FT                   /translation="MVLSMSYGVELRPVQPWDLPTLRRWRNQDEVRLQMVEQALISPRQ
FT                   QRQWFASSRERPDQQHWVLWCRGQRAGYVNLKGEARHLLQGQPVADAGLYLGTSTVRHP
FT                   MLAVAAALSQLDQGFDTFELGCIRTLVRACNGAALRLNEQLGYRQHGQEGDFLALELQP
FT                   ADYYAARERLRRFFR"
FT   gene            161777..162010
FT                   /locus_tag="ASA_0152"
FT   CDS_pept        161777..162010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0152"
FT                   /product="putative acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88350"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHH8"
FT                   /protein_id="ABO88350.1"
FT                   /translation="MTTALEQVFADALGIDVGTVSDGLAYNSIPQWDSVAHMGLIAQLE
FT                   DCYGVLLDTDDIIDMSSVAKAREILAKYGVAL"
FT   gene            162010..162759
FT                   /gene="fabG"
FT                   /locus_tag="ASA_0153"
FT   CDS_pept        162010..162759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="ASA_0153"
FT                   /product="3-oxoacyl-[acyl-carrier protein] reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88351"
FT                   /db_xref="GOA:A4SHH9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHH9"
FT                   /protein_id="ABO88351.1"
FT                   /translation="MQGLLQGKRVLITGAGRGIGLAIARQFAAQGAELWLGGRDEAAMS
FT                   QLAAALGAEFGVTCQPLCFDVAEPQAVKQAFQQLFAQTRQLDVLVNNAGILEEGLLGMV
FT                   NQAQLEQTFSHNAFSVVYCSQYAARLMQRSGGGSIINLASLMGRVGAAGLSSYAGSKAA
FT                   VIGITQSLAKELATSQIRVNAIAPGFIDTEMARAIPDQKFAERLASIAMGRIGTPDEVA
FT                   KVALFLASDLSSYVTGQVIGVDGGMLV"
FT   gene            162759..164129
FT                   /locus_tag="ASA_0154"
FT   CDS_pept        162759..164129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0154"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88352"
FT                   /db_xref="GOA:A4SHI0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHI0"
FT                   /protein_id="ABO88352.1"
FT                   /translation="MKQLHPLLAHLHEDNPAPAWLDPLDGWLSYGELAQRVTQVAATYP
FT                   SERSLVYLPFFTRTSHLLHYLAALRLGHAVMLADPVLPSSQHDASCQQFAVTCRVNEEG
FT                   KLIRLRDTSPLLHPELAVLLPTSGSTGSAKWVRLSGRNLAANAASIADYLALTAAERAI
FT                   TSLPLFYSYGLSVLNSHLLVGASLVQSEGSVLDRGFWQQVEQHGVSSFAGVPFTYQMLA
FT                   RLRFDWARYPSLQTLTQAGGRLEPALAQQFAEQALLLGRRFFVMYGQTEATARMAWLAA
FT                   HEVVTHPDAIGRAIPGGHFSLRELEGGKPGEGELVYRGDNVMLGYASTISDLAQGAQLQ
FT                   ELATGDLARSDEAGRYYICGRLSRFLKLFGKRISLAEVESQLHRWGWSGACGGRDDCLL
FT                   VVVEPRGELTADGLQRELAQWLQAPPRAVRVIQVAQLPRTANHKIDYAALTRLAEEA"
FT   gene            164129..165187
FT                   /locus_tag="ASA_0155"
FT   CDS_pept        164129..165187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0155"
FT                   /product="acyl protein synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88353"
FT                   /db_xref="GOA:A4SHI1"
FT                   /db_xref="InterPro:IPR007534"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHI1"
FT                   /protein_id="ABO88353.1"
FT                   /translation="MESLLAAPIFDLPQAAKQALLLARLNALTRHHVEHCPPYANVLHA
FT                   FGWTAEAADYGALPYLAARLFKLAQWQSVPEAEVFKVLTSSGTTGAPSRIVLDRETAAL
FT                   QSKVLVKILQEFVGKQRLPMLLVEQPALIQNRNGFSARGAGALGLSFLGRDHTYALDEQ
FT                   MRPNWPVIEAFCDKYAGQPVLLFGFTFMVWQCLLEPLRERGLHMPFEQGILFHSGGWKK
FT                   LQHLAVDNPAFKARCREQLGLGRVHNFYGMVEQVGSIFVECEQGHLHAPVFADLQVRDP
FT                   LTHQPLGVGQPGLLQVLSAIPGSYPGHSLLTEDLGVLLGEDDCPCGRHGRYFQVSGRQQ
FT                   GAEVRGCSDTFQ"
FT   gene            165166..166371
FT                   /locus_tag="ASA_0156"
FT   CDS_pept        165166..166371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0156"
FT                   /product="acyl-CoA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88354"
FT                   /db_xref="GOA:A4SHI2"
FT                   /db_xref="InterPro:IPR008670"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHI2"
FT                   /protein_id="ABO88354.1"
FT                   /translation="MQRHLPVTPPQAVEGLWLTGPDVNFVAPAASWQTFCPQPLSCFAP
FT                   VICDFVAALSARLQQEGRRHPDLAAFGFWLRPRQLARERQRLQGRGPMGVTFHLVPSNV
FT                   PTVAFYSWLMALLMGNPCVVRLSSRRDPVQEAMLAILNDLFSQFEWQGIAMRTRFIRYG
FT                   YDEGTTGWLSARCRLRIIWGGDETIRQVRAIPLSPSAQEVVFPDRRSMAVLDSHWLAGL
FT                   DAVGWQQTLGALQQDCTRFNQQACASPTTLCWLGEPDDELRRRLLETLFAPFADDPALV
FT                   MERLIHSQQNAALDGEMQLSAFPGVTLLTPASSLRLAHVGGGTVAEFVADSLNELLLQP
FT                   WDMQTCVWVGAHKAQLEDALPNAPTCRIDRVVAPGQALAFEWHWDGIDMLQVCSRGLAQ
FT                   HE"
FT   gene            166543..167496
FT                   /locus_tag="ASA_0157"
FT   CDS_pept        166543..167496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0157"
FT                   /product="glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88355"
FT                   /db_xref="GOA:A4SHI3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHI3"
FT                   /protein_id="ABO88355.1"
FT                   /translation="MKVSVLVPVYNLARFIEPCLLSLLSLLGQQTDFEFEVIAIDDGSS
FT                   DDSWSIMQRLARQWPGLRVLQNKKNIGVCLTIRALLEQARGTYMVYVDGDDLALPGKLQ
FT                   ALTNHLDRHPDCGFVYHEAEVFDSDSNRTTSLFSSDYYNAKYIPDRAGPEHLVQYGLFF
FT                   NTSSCAFRRHERMLDAVNLDCHVVNDYSWHIINSSYLGGNIDRISQVYGRYRVHGGSIC
FT                   GTIRASDECRKLALQDMLAACDLALDAGMDELLVKRGKSHLWFSAALYFLRARNWALFD
FT                   HFITDSVQYQWFFDDRHEFAWQHKNEPERVLEKIFG"
FT   gene            167533..168498
FT                   /locus_tag="ASA_0158"
FT   CDS_pept        167533..168498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0158"
FT                   /product="glycosyl transferase family 8"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88356"
FT                   /db_xref="GOA:A4SHI4"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHI4"
FT                   /protein_id="ABO88356.1"
FT                   /translation="MKKIIHAAFCIDDSFSVHLAALIHSLGKYLNQDFQLKCHILARLN
FT                   GENIFKLSKLNSENIVIKFHDNLPSYKNIPISSLYNNRLNEVAYYRFAIPNVLQNIEKV
FT                   LFIDADMIAVGDVSSLWSIEMGEAVVAVVSDHILGYDKEKQQERGISSGKYFNAGFMLM
FT                   DLDKWREKNISEQALGLLIDNNGFEHNDQDALNIILEKKTFYLDTKWNAQPNHLAQQDV
FT                   PMPVLVHFCGQEKPWHAYCIHPFKDHYLESRAETEYACEPLQAYLDQDDMEILSRLKMK
FT                   FPNGARVVVWGAGQRGRRLCYEMINNMSQYSIVHFVDNCR"
FT   gene            168691..169095
FT                   /pseudo
FT                   /locus_tag="ASA_0159"
FT                   /note="putative SAM-dependent methyltransferase; in frame
FT                   TAA. Only 135 aa (of 330) present. Continues in asa1830?"
FT   mobile_element  complement(169105..170268)
FT                   /mobile_element_type="insertion sequence:ISAS4"
FT   gene            complement(169128..170159)
FT                   /locus_tag="ASA_0160"
FT   CDS_pept        complement(169128..170159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0160"
FT                   /product="IS630-family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88357"
FT                   /db_xref="GOA:A4SHI5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHI5"
FT                   /protein_id="ABO88357.1"
FT                   /translation="MPILPPLPRPQLRRIHKIIHATRDKGHARRLMAILLLHEGRTVTD
FT                   VHHLTGAARSTIGRWLRWYRDEGIDALEALPAGRAPVLPIAKMVTLLVLLMQFSPQDFG
FT                   YQRSRWCTELLAIKINRLTGLNVAASTLRRWLPRMGIVWRRPVPTLRIKDPAYQEKMAN
FT                   IDAALARCNADNPVFYEDEVDIDLNPKLGADWMFRAQQKRVVTPGQNAKHYLAGVLHAG
FT                   NGRVLYVSGIKKNSSLFIAMLEKLRHHYRRAKTITLILDNYIIHKSKQTERWLKKNPKF
FT                   CLVFQPVYSPWVNHIERLWHKLHETITRNHQCRGMANLLARVKYFMDTVSPFPGNGYGT
FT                   AKV"
FT   gene            170268..170627
FT                   /locus_tag="ASA_0161"
FT   CDS_pept        170268..170627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0161"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88358"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHI6"
FT                   /protein_id="ABO88358.1"
FT                   /translation="MVNTAVFEHVRNRDTLEEIESYVSDTGCLAIHTLIPATVPKDPNW
FT                   MYLLPVHCAFHTNQSMGLLMRSWGYKCSVYNEHSKMWVLFRENADAVWPRVDKLNKSLG
FT                   WRYLHFKDGFMDYWK"
FT   gene            complement(170872..172015)
FT                   /pseudo
FT                   /locus_tag="ASA_0162"
FT                   /note="putative polysaccharide biosynthesis protein;
FT                   frameshift due to 7 bp duplication"
FT   gene            complement(172012..173016)
FT                   /locus_tag="ASA_0163"
FT   CDS_pept        complement(172012..173016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0163"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88359"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR020025"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHI7"
FT                   /protein_id="ABO88359.1"
FT                   /translation="MFDNKTLLITGGTGSFGKMLVKTVLERYKPKRLIIYSRDELKPFE
FT                   MQQVFNDPCMRYFIGDVRDANRLNMAMRGVDYVVHAAALKQVPAAEYNPMECIKTNIHG
FT                   AENVIQAALLNQVKKVIALSTDKAANPINLYGATKLASDKLFVAANNIAGQDPTRFAVV
FT                   RYGNVVGSRGSVVPFFQKRIDQGASTLPITHAEMTRFWITLPQGVDFVMNNFPRMKGGE
FT                   IFVPKLPSVRITDLATAMAPQLAQEIIGIRPGEKLHEVMCPSDDSYHTFEFDDFFIIGP
FT                   TINFNNRNNDFSVTAAGEKGVMVEQGFEYNSRNNSDFLTVAQLKELNDKVVME"
FT   gene            complement(173238..175067)
FT                   /gene="malZ"
FT                   /locus_tag="ASA_0164"
FT   CDS_pept        complement(173238..175067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malZ"
FT                   /locus_tag="ASA_0164"
FT                   /product="maltodextrin glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88360"
FT                   /db_xref="GOA:A4SHI8"
FT                   /db_xref="InterPro:IPR004185"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017069"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHI8"
FT                   /protein_id="ABO88360.1"
FT                   /translation="MTHPFLYHPQVAPWFKESADSLQLTLFSELDAPIREVWLRHEPDN
FT                   EEYLLAMTPVSTRDRLQVWQVTLPLIKGQDIHLYCFKCLTDEEQWWLHGAGVSSAMPPR
FT                   EQHFRFNSLHQPPAWVQDQVFYQIFPDRFCNGDPALSVKHHEYEYRGKAVISKVWGEPV
FT                   SRHEEGLGACEFYGGDLAGIDAKLHYLQSLGVTALYLNPIFDSPSNHKYDTQDYFKVDA
FT                   HLGSNAQFAELTRNLHQRGMKIILDAVVNHTSTQHPWFCPPQGANSNPDSPWRSFYTFD
FT                   NEGDYVSWKGIRSLPKLDFSSEQVQDAIYRADDAILRYWMRAPYQIDGWRFDVIHMLGE
FT                   RGTAEGNHGHVRAIRGAVKQENPDAYVLGEHFFEASQWLQGDQEDGAMNYYGFAHPIRA
FT                   FLAGQDIAYHPIKISAEELDSWLKLARAHIPFKNQLAQFNLLDSHDTARFLHLLGEDKQ
FT                   RMQLAATLLLTYIGVPSIYYGDEVGLSGGKDPDCRRCFPWETTAWDHVLHDHYRRLIQI
FT                   RKQRPALRRGDIQTLYAGPHSYVFARTLQSDQVVVACNRHPTEPRTISLPLWQTASPAS
FT                   RFTDAFNGDKYEVVQGQVQVTIPANSARVLLSS"
FT   gene            complement(175074..175904)
FT                   /locus_tag="ASA_0165"
FT   CDS_pept        complement(175074..175904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0165"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88361"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHI9"
FT                   /protein_id="ABO88361.1"
FT                   /translation="MSMDRLFDKIKQLPTIPQLLHELMQSFSDENARIDQIAGKIAMDQ
FT                   VISVKVLRMANSAALRRGNDVTSIEQAVIRLGFNRLRSVVVASGIIGTFKAPPSFDKNK
FT                   FWTETFQVATIAKTLAQEAKVLDPETAFTCALIHNIGELLIQSTLPEEAELINMAIQKG
FT                   SSRVEAQREMLGYDYAQLGAELARRWNLSEAFVDAISQQLDPLSHDPVSKEAVLIRLAV
FT                   FISFAWNAGVPAQAIIARFPKPLADQLGLDPKSLAGQLETLHEQGNALADLLTQ"
FT   gene            complement(176060..176479)
FT                   /gene="hslJ"
FT                   /locus_tag="ASA_0166"
FT   CDS_pept        complement(176060..176479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslJ"
FT                   /locus_tag="ASA_0166"
FT                   /product="heat shock protein HslJ"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88362"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHJ0"
FT                   /protein_id="ABO88362.1"
FT                   /translation="MPRFLLLLLALLLLSACSSTPSFVQQDLQHHHWVLDKLDGQAIAA
FT                   SRDNPPDFEIGEHFTVNGIAGCNRYFGQGHLEGDRFWVTSLGSTEMACQAPLDTIEQAV
FT                   ITTLLEGATLSGTTQTLILKGKQHSLEYTLRDWVL"
FT   gene            complement(176692..178053)
FT                   /locus_tag="ASA_0167"
FT   CDS_pept        complement(176692..178053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0167"
FT                   /product="molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88363"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR042054"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHJ1"
FT                   /protein_id="ABO88363.1"
FT                   /translation="MFIGFDYGTSNCAVAVMEQGSPRLLTLGGSRYLPSTLHAPHRDAI
FT                   AGLLAEGLAPAQQAEYLKLRGPVVTRAQAVRRQMREEGLIDELSFGAAALERYLEEPDD
FT                   GYYIKSPKSFLGAYGLKVPQIALFEDIVCAMMLHVRREAEQQLGTQVRRAVIGRPVNFQ
FT                   GLAGEESNRQAIAILTEAARLAGFEQVEFLYEPVAAGFEFEARLDEDAVVLVVDIGGGT
FT                   TDCSMLRMGPSHRDQLDRSGDLLGHSGQRIGGNDFDIRLTVEGMMPLLGMHETLKTGKP
FT                   LPHPLFWDAAAINDVSAQGRFYSLDTARQLQDLQLDSLPGSKLGRLANLRAHKLSHQLV
FT                   WRAEQGKIALSEQELNRQSLSELEKGLEAELSREQLASASALLLEKIGELMDEAIANAG
FT                   VQPDRIFVTGGSARSPLIAAFIRQKLPTIPLEGGDDFGSVAAGLARYAARLFAD"
FT   gene            complement(178231..179220)
FT                   /gene="ldhA"
FT                   /locus_tag="ASA_0168"
FT   CDS_pept        complement(178231..179220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ldhA"
FT                   /locus_tag="ASA_0168"
FT                   /product="D-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88364"
FT                   /db_xref="GOA:A4SHJ2"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHJ2"
FT                   /protein_id="ABO88364.1"
FT                   /translation="MKVAVFSTKSYDKEHFNQANSQYGYELEFFDVRLEAKTARLAHGF
FT                   PVVCLFVNDDADREVLTELAANGTKVIALRCAGYNNVDLAAAKELGLKVVRVPAYSPEA
FT                   VAEHAVGLMMTLNRRIHKAYQRTRDANFSLEGLVGFNMHGRTAGIIGTGKIGIATLRIL
FT                   KGFGMRLLVSDPYPSQAAIDLGAEYVDLDTLFRQSDVISLHCPLFKENYHLLNKEAFAK
FT                   MKDGVMIINTSRGGLLDSNAAIEALKTARIGALGLDVYEEEEDLFFSDKSNEVITDDVF
FT                   RRLSACHNVLFTGHQAFLTREALHAIADTTLGNLKAIESLGHSDNEVE"
FT   gene            complement(179298..179756)
FT                   /gene="creA"
FT                   /locus_tag="ASA_0169"
FT   CDS_pept        complement(179298..179756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="creA"
FT                   /locus_tag="ASA_0169"
FT                   /product="CreA"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88365"
FT                   /db_xref="InterPro:IPR010292"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHJ3"
FT                   /protein_id="ABO88365.1"
FT                   /translation="MNTGLLLACCLMAMPALADKADPIGEVSTAFKLFGPNHKILVEAF
FT                   DDPKIAGIACYLARPKTGGVKGGLGLAEDPSHASLSCHQTGPISLPAKLKAGEEVFDVS
FT                   TSLVFKEQKVVRFYDEKRNTLVYLTYSTKLVDGSYKSAVSAVPIMPWG"
FT   gene            complement(179930..180784)
FT                   /locus_tag="ASA_0170"
FT   CDS_pept        complement(179930..180784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88366"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHJ4"
FT                   /protein_id="ABO88366.1"
FT                   /translation="MKWFLRLCLCLPLLAQAQTLTVKVPSRPINDLDKEYQLKLLELAL
FT                   THAGQPFRIEQVELNLNQYSLQQQLSKGKTINVFWMGTSSALESSLIAVPIPLFRGLEG
FT                   LRLSFIHSDAQEKFNRINSLADLKQLKAAQGVGWADNKILENAGIPTYSGRYSTLFRLI
FT                   NDGDKLDFFPRSLVEIFAERSELVAQYPNLVIDQRLLIRYPFAEFFFVCPEYPKLAKAI
FT                   QTGLERAYADGSFMTFFRENPKIREALASANLAKRVTIQLPNPDMTPLLNSIPAQYWEY
FT                   PPR"
FT   gene            complement(180835..181221)
FT                   /locus_tag="ASA_0171"
FT   CDS_pept        complement(180835..181221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0171"
FT                   /product="DnaK suppressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88367"
FT                   /db_xref="GOA:A4SHJ5"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHJ5"
FT                   /protein_id="ABO88367.1"
FT                   /translation="MCDFMTKDQLAFYKGQIERQILELEDRLNSQASQAIATDTNEMAD
FT                   EIDRASIEEARRLELNRIEHDKLHLRKLQGALRRINEGDFGYCESCGDEISLKRLQARP
FT                   ESRFCVECQSTKEFNDTHVYRRVA"
FT   gene            181662..183020
FT                   /gene="glnA"
FT                   /locus_tag="ASA_0172"
FT   CDS_pept        181662..183020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="ASA_0172"
FT                   /product="glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88368"
FT                   /db_xref="GOA:A4SHJ6"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHJ6"
FT                   /protein_id="ABO88368.1"
FT                   /translation="MAIVKSGFNMDSIKGWMESNRITEVECLFPDFTGNARGKIIPANK
FT                   FLREGGMRLPEVIFTQTVTGEYPDDDSMIDPLERDMQLYPDPNTIRFVPWALEPTAQVI
FT                   HDCFDINGNLIDIAPRSVLRRVLSFYEKQGWKPVVAPELEFYLVKRNEDPDYPLVPPIG
FT                   RNGRPETARQSFSIDAVNEFDPIFEDMYDYCEAQELEVDTLIHESGAAQMEINFLHGDA
FT                   IDLADQVFLFKRTMREAAHRHGIYATFMAKPMSDEPGSAMHIHQSLEDVNGRNLFGTDN
FT                   GGNSEQFMHFIAGLQKYTPAVTALLAPNVNSYRRLTFGESAPRNVQWGVENRTCGLRVP
FT                   FSDASARRVENRFAGADANPYLALAATLACGYLGMMEKLEPLPEMKSSAYDLPYSLPRS
FT                   LEEALSHLEQCEPIKEMLGERFIRAFVAVKRKEYETYFGVISRWEREFLLLNV"
FT   gene            183163..184581
FT                   /gene="spuC"
FT                   /locus_tag="ASA_0173"
FT   CDS_pept        183163..184581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spuC"
FT                   /locus_tag="ASA_0173"
FT                   /product="putrescine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88369"
FT                   /db_xref="GOA:A4SHJ7"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHJ7"
FT                   /protein_id="ABO88369.1"
FT                   /translation="MIDERVPLKSKEPRSKYNAAHDTTREWQQLDASHHLHPFTDFQAL
FT                   NQKGSRIITRAEGIYLEDSDGRRILDGMAGLWCVNMGYGRQELVEAATKQMQQLPYYNL
FT                   FFQTAHPPVIELATLLAEVTPPHLNHVFFTGSGSECNDTVLRMVRHYWASKGQPDKQVI
FT                   ISRHNAYHGSTVAGASLGGMKGMHAQGGLPIPGIVHIDQPYHFGEGQGMSAHEFGLERA
FT                   RQLEQKILELGVDKVAAFIGEPIQGAGGVIIPPDSYWPEIQRICDHYGILLIADEVICG
FT                   FGRTGHWFASEGFGIKPDLMCLAKGITSGYLPMGAVMVGDRVARVLVEEGGEFNHGFTY
FT                   SGHPVACAVAIANIKLMQSESIVKRIHDTIGPYLQRRWRELADHPLVGETRGKGLVAAL
FT                   EIVQDKQTNSRFPAGLQAGMTCREFCFNNGLVMRAVGDTMIISPPLVITEEQVDELVNL
FT                   ARLSLDLTAAKLKG"
FT   gene            184636..185733
FT                   /gene="potF1"
FT                   /locus_tag="ASA_0174"
FT   CDS_pept        184636..185733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potF1"
FT                   /locus_tag="ASA_0174"
FT                   /product="ABC-type putrescine transporter, periplasmic
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88370"
FT                   /db_xref="GOA:A4SHJ8"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHJ8"
FT                   /protein_id="ABO88370.1"
FT                   /translation="MSFKTGMIAASVALVMASTGAMANEKVLHVYNWSDYIAPETLENF
FT                   QKETGIKVVYDVFDSNEVLEAKLLAGSSGYDIVVPSNPFLAKQIKAGVFQKLDKSKLSN
FT                   WQNMDADLLKALEPSDPGNQYSIPYLWGTIGYAYNAEKVKTVLGKDAPVNSWDLVFKPE
FT                   NMAKLKECGVSFLDSPTEMLPAALQYLGFKPDSQKPDELKQAEALFLSIRPYTAYFHSS
FT                   KYISDLANGNLCVAVGYSGDLQQSKARAAEANNGVALTYTIPKEGAGSFFDMIAIPADA
FT                   KNAEAAHTFINYLMKPEVIASITNFVQFPNGNKAATPLVDEAIRTDPGIYPNAETLQKI
FT                   YTFPDLPAKVQRLMTRSWTKIKSGK"
FT   gene            185849..186934
FT                   /gene="potF2"
FT                   /locus_tag="ASA_0175"
FT   CDS_pept        185849..186934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potF2"
FT                   /locus_tag="ASA_0175"
FT                   /product="ABC-type putrescine transporter, periplasmic
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88371"
FT                   /db_xref="GOA:A4SHJ9"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHJ9"
FT                   /protein_id="ABO88371.1"
FT                   /translation="MHTTKTVTMTLALGLASLAHAAPVVHFYNWSDYIGETTLSDFQQA
FT                   TGIKTVYDVFDSNETLEGKLLTGRTGYDLVVPSNNFLAKQITAGAFQKLDPALLPNLVN
FT                   LDPVLLKQLDKVDPGHQYAVPYLWGTNGIGYNVDKIKDVLGVDKIDSWAVIFEPENMQK
FT                   LSRCGVAFLDSADEMIPAVLNYLGLDPNSHKPEDIKRAEEQLLKVRPYVTYFHSSKYIG
FT                   DLANGDICVAAGFSGDILQAAARADEAGKGINIAYSIPKEGGNLWFDMMAIPADATNVK
FT                   EAHALINYVLQPEVIAKVSNYVGYANPNAKAGEYMDESVRDDESVYPPQAVLERLYVQQ
FT                   AHPRAVQRLITRSWTKIKSGT"
FT   gene            187011..188165
FT                   /gene="potG"
FT                   /locus_tag="ASA_0176"
FT   CDS_pept        187011..188165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potG"
FT                   /locus_tag="ASA_0176"
FT                   /product="ABC-type putrescine transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88372"
FT                   /db_xref="GOA:A4SHK0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHK0"
FT                   /protein_id="ABO88372.1"
FT                   /translation="MAIASSAYKKALEGNQQRKEVLVKIDRVSKQFDETLAVDNVSLNI
FT                   HKGEIFALLGGSGSGKSTLLRMLAGFERPTEGRLFLDGVDITDMPPYERPINMMFQSYA
FT                   LFPHMTVAQNIAFGLKQDGLPKAEVDARVEEMLKLVQMAQYARRKPHQLSGGQRQRVAL
FT                   ARSLAKRPKLLLLDEPMGALDKKLRSQMQLELVEIIERVGVTCVMVTHDQEEAMTMAER
FT                   IAIMHLGCIEQIGSPMDIYETPASRLVCEFIGNVNLFDGLLVEDEQDHATIACADLEQP
FT                   IYVGHGISSRAENKKVTYALRPEKLLMSTQKPTEIEHPDFNWTKGEVYDIAYLGGHSVY
FT                   HIQLPSGKIVQAFIANAERHGKRPTWDDQVFLYWEDDSGVVLQS"
FT   gene            188162..189067
FT                   /gene="potH"
FT                   /locus_tag="ASA_0177"
FT   CDS_pept        188162..189067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potH"
FT                   /locus_tag="ASA_0177"
FT                   /product="ABC-type putrescine transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88373"
FT                   /db_xref="GOA:A4SHK1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHK1"
FT                   /protein_id="ABO88373.1"
FT                   /translation="MKALRRLKRLGGRQLVIGIPFFWLFLFFLLPFIIVVKISFAEADV
FT                   AIPPYTDVVSWADNQLTILLNLGNYLLLQEDELYIAAYIGSLKIAFISTVLCLLIGYPM
FT                   AYTIARANKETQTVLLLLIMMPTWTAILIRVYAWMGILSNNGLLNSLLMGIGLIDEPLQ
FT                   ILNTNLAVYIGIVYSYLPFMVLPLYANLVKHDQSLLEAASDLGARNLTRFWRITVPLSK
FT                   NGIIAGCMLVFIPVVGEFVIPELLGGPETLMIGKVLWQEFFNNRDWPVASALAVVMLAV
FT                   LIVPIILFNRNQAKELEGKV"
FT   gene            189064..189906
FT                   /gene="potI"
FT                   /locus_tag="ASA_0178"
FT   CDS_pept        189064..189906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potI"
FT                   /locus_tag="ASA_0178"
FT                   /product="ABC-type putrescine transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88374"
FT                   /db_xref="GOA:A4SHK2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHK2"
FT                   /protein_id="ABO88374.1"
FT                   /translation="MKRFGFAKMMLWLGLLFIYLPMVIMVIYSFNSSKLVTVWGGWSLK
FT                   WYFGLLDNKQLIGSVLRSLEIALYTAVAAVALGTVAAFVLTRIPHFRGRTLFGGMVTAP
FT                   LVMPEVITGLSLLLLFVAMAQLVGWPAERGMLTIWIAHTTFCTAYVAIVVSARLRELDL
FT                   SIEEAAMDLGAKPWKVFFLITIPMIAPSLAAGGMMSFALSLDDLVLASFVSGPGATTLP
FT                   MEVFSAVRLGVKPEINAVASLILLSVSLFTFSSWYLMARAEKRRRAEIAMTTQMQAVA"
FT   gene            189946..190656
FT                   /locus_tag="ASA_0179"
FT   CDS_pept        189946..190656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0179"
FT                   /product="MOSC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88375"
FT                   /db_xref="GOA:A4SHK3"
FT                   /db_xref="InterPro:IPR005163"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHK3"
FT                   /protein_id="ABO88375.1"
FT                   /translation="MRMRIFIFSGQGTELVPGLVSAINKQATTIPLWCGFGGLGGDEQS
FT                   DPRHHGGPDRALHYYPADHYPWWHNWQTAMGLAAPRTPWQPAAFGENLSGLGLTEEQAC
FT                   IGDVYRLGEALIQISQPRSPCFKLNLRFGYPQLSQVMQLSVRCGWLLRVLEEGTVAPQE
FT                   TMELVDRPYPALTVKRTADILFNQVRHEADLLLLLENPALSPNWRQHAANWLEHGVVAD
FT                   WQRRLLGPAEFQFS"
FT   gene            190811..190887
FT                   /gene="trnP"
FT                   /locus_tag="ASA_0180"
FT   tRNA            190811..190887
FT                   /gene="trnP"
FT                   /locus_tag="ASA_0180"
FT                   /product="tRNA-Pro"
FT   gene            complement(191170..191697)
FT                   /locus_tag="ASA_0181"
FT   CDS_pept        complement(191170..191697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0181"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88376"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHK4"
FT                   /protein_id="ABO88376.1"
FT                   /translation="MSAKLATKPSRALLTQLESMLDEVQTPECRHWLEQELEGYSLCSH
FT                   LPWYRIVACRQRGHFLDLKTGKYLTCHINSQTLSQRDLAQIQFIYAREPAAHYLLQRNS
FT                   GIEPWPEQLLEDYQEQLIPGHLCLQAWHEPVSSLRSQLMEGIEHFISEYPKHAALQPQH
FT                   SFKALRHQHWHI"
FT   gene            complement(191822..192286)
FT                   /locus_tag="ASA_0182"
FT   CDS_pept        complement(191822..192286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0182"
FT                   /product="Thioesterase (4HBT) superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88377"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHK5"
FT                   /protein_id="ABO88377.1"
FT                   /translation="MKHILKKMALSGIANLFAERMPFNKLIGMQVTHYDFDKVELRIKM
FT                   DDKLIGNPFHNILHGGVTASLLDVAGGMIVAASCIDELEDFSPNYLKERFSRLGTIDLR
FT                   VDYLRPGRGNEFIATAHIIRAGSKVAVARMELHNEEGTHIAFGTGTYLVG"
FT   gene            192420..194243
FT                   /gene="recQ"
FT                   /locus_tag="ASA_0183"
FT   CDS_pept        192420..194243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recQ"
FT                   /locus_tag="ASA_0183"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88378"
FT                   /db_xref="GOA:A4SHK6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHK6"
FT                   /protein_id="ABO88378.1"
FT                   /translation="MTVIAETLPDTPLALLQAVFGYQQFRPGQLEIIEQIVAGRDAMVL
FT                   KPTGGGKSLCFQIPALLRPGLGVVVSPLISLMKDQVDSLRANGVAAIYINSALSREEMI
FT                   QNFAAMRRGEIKLLYVSPERLLQHEFMDRLAELPLGLFAIDEAHCVSQWGHDFRPEYAA
FT                   LGRLKQWFPQVPVVALTATADEATRSDMLHRLELNDPFIHTASFDRPNIRYSLVEKFKA
FT                   AEQLLRYVQSQKGNCGIVYCSSRNRVEEVAERLSRHGSKAAPYHAGLPLAQRQQTQDAF
FT                   LKDDIEIVVATVAFGMGIDKPNVRFVVHYDIPKNIESYYQETGRAGRDGTPAEALLLYD
FT                   PADIGRVRRLLDNIENPQQLQVEQYKLNVMAAFAEAQTCRRQVLLNYFGEYNDKPCGNC
FT                   DICLDPPKSYDGTEDAQKALSCVWRVGQNFGVGYVVEVLRGSLNQRIKDHGHDKLSTYG
FT                   IGKDQSHEYWMSVIRQLIHKGLLTQNITRNLVLQLTEASRPVLRGEMKLELAVPRLQPI
FT                   SSRKEKRNGLLDNANYDKRLFKELRGLRKQIAEDEEVPPYVVFNDATLVEMAQLMPMTE
FT                   AEMLAINGVGHRKLERFGEAFMDLIIDYCRR"
FT   gene            complement(194345..194647)
FT                   /locus_tag="ASA_0184"
FT   CDS_pept        complement(194345..194647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0184"
FT                   /product="cytochrome c553"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88379"
FT                   /db_xref="GOA:A4SHK7"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHK7"
FT                   /protein_id="ABO88379.1"
FT                   /translation="MQRWVYALPLLALAWGHLAKAADIEAGKAKAAVCAACHGVEGKAL
FT                   IPHYPHLAGQNHAYLVKQLKAFKDGSRQEPLMVPFMAPLTEADMENLAAFYASLK"
FT   gene            194752..196179
FT                   /locus_tag="ASA_0185"
FT   CDS_pept        194752..196179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0185"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88380"
FT                   /db_xref="GOA:A4SHK8"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SHK8"
FT                   /protein_id="ABO88380.1"
FT                   /translation="MKLINTFATELPWACEPVVPQPLREPRLLHLNRGLLAELGLDGVS
FT                   DTDWLACCGLGQPLPGMQPVAQVYAGHQFGGYSPRLGDGRALLLGEQLATDGQRWDLHL
FT                   KGAGKTPFSRFGDGRAVLRSSIREYLASEALHALGIPTTRALVLVGSKEPVYREQEETG
FT                   ATVLRTAPSHLRFGHIEYFAWSGQGEKIPALIDYLLRYHFPELENGAELFAEVVRRTAR
FT                   LIAKWQAAGFCHGVLNTDNMSLLGLTLDYGPYGFIDAYVPDFVCNHSDPDGRYALDQQP
FT                   AVGYWNLQKLAQALAGHVDGDALATSLAQYEHQLMLHYSELMRAKLGLTQWEEEDPALF
FT                   RQLFQLLASQGVDYHLFLRRLGEVTGTGEWPASLLALLPDPDLWQGWLELYRVRLTREG
FT                   GEDAVRKAQMDAINPKYVLRNALAQQAIDAAEGGDMTQFERLLAALQQPYDEQPEYADL
FT                   ATPVPQWYCGGELSCSS"
FT   gene            196190..196477
FT                   /locus_tag="ASA_0186"
FT   CDS_pept        196190..196477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0186"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88381"
FT                   /db_xref="InterPro:IPR022080"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHK9"
FT                   /protein_id="ABO88381.1"
FT                   /translation="MNWRVNRIELEQGVVMLDCPGLCWDTFPALAEGLLQKWELGLVDK
FT                   VWGADRHSWRLEFEGSQLRLEYEHYSGCWLAAVQPADREVVIWLGRLHKD"
FT   gene            196519..197322
FT                   /locus_tag="ASA_0187"
FT   CDS_pept        196519..197322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0187"
FT                   /product="conserved integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88382"
FT                   /db_xref="GOA:A4SHL0"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHL0"
FT                   /protein_id="ABO88382.1"
FT                   /translation="MAAGRISSIKIELSVGGRIISPLNYRQWWRYGFPNPINQKGHNMN
FT                   LTPAQHRTALVRLSLFHILIIASSNYLVQLPITIFGFHTTWGAFSFPFIFLATDLTVRI
FT                   FGAGLARKIIQTVMLPALTVSYVLSVLFFEGSFQGVGNLAEFNLFVARIALASFMAYLV
FT                   GQFMDVVVFNRLRLLRAWWVAPAASTLFGNLVDTIAFFSIAFWRSTDPFMADHWVEIAT
FT                   VDYVFKLLISLGLFVPLYGVLLRYLSRKLVGEAGLAGLQTATRQA"
FT   gene            197364..197516
FT                   /gene="ryhB"
FT                   /locus_tag="ASA_0188"
FT   misc_RNA        197364..197516
FT                   /gene="ryhB"
FT                   /locus_tag="ASA_0188"
FT                   /product="rhyB sRNA"
FT   gene            complement(197594..198079)
FT                   /gene="rraA"
FT                   /locus_tag="ASA_0189"
FT   CDS_pept        complement(197594..198079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rraA"
FT                   /locus_tag="ASA_0189"
FT                   /product="regulator of ribonuclease activity A"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88383"
FT                   /db_xref="GOA:A4SHL1"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR010203"
FT                   /db_xref="InterPro:IPR014339"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHL1"
FT                   /protein_id="ABO88383.1"
FT                   /translation="MEYNTSELCDIYQDMVDVLEPMLCSFGGRASFGGVITTVKCFESN
FT                   GLIRELVKENGVGRVLLIDGGGSMRRALIDSDIATTAAENEWEGIVCYGCVREVDILED
FT                   LDIGIQALAAIPVGADSKDVGETDLPVNFGGVTFLPDDHLYADTTGVILSPEALDIE"
FT   gene            198225..199196
FT                   /locus_tag="ASA_0190"
FT   CDS_pept        198225..199196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0190"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88384"
FT                   /db_xref="GOA:A4SHL2"
FT                   /db_xref="InterPro:IPR032255"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHL2"
FT                   /protein_id="ABO88384.1"
FT                   /translation="MLIRHKLILNTALVAVAMLVLSALFLYSSQVSRHLAEAQRNVDGL
FT                   EIAMLNLRRAEKDFLIRKDLTFVERFNKELADFHTLNRTLSTDDNISVVHGELARLDQQ
FT                   MGLYGKAFNDLVSQQQTIGLGPEDGLYGRLRAAVHQVEEGLKQLDQQGLLVTMLQLRRA
FT                   EKDFMLRSDIQYLERFQTLHKSFQDNLAALPEADRGKLEQASQQYRQDFVALVQGMQVL
FT                   GLKEDEGLRNQMRDLVHQTEQGFAAVGQHIADELVRQTSRLNSLMLVCGGVIIVLIGVM
FT                   SVLLGRSIDRPISRVNDTVNRIRHRAAEPGGQRGESQRDQHP"
FT   gene            complement(199376..200878)
FT                   /gene="mgtE"
FT                   /locus_tag="ASA_0191"
FT   CDS_pept        complement(199376..200878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgtE"
FT                   /locus_tag="ASA_0191"
FT                   /product="magnesium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88385"
FT                   /db_xref="GOA:A4SHL3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHL3"
FT                   /protein_id="ABO88385.1"
FT                   /translation="MVITSCFESGILWGGHPANRFQEFRFMSHPVKNSAKQREKDRRRI
FT                   LTLLLADDALTDSLLDPQSAQDAAQRDQTGEIIRLVNRLPAADVADTLESLPPDERHAL
FT                   WQLVNEEKHGQILVEASETVWDSLINGMSDKALLHALRSLDIDDQIYLGQYLPRNLMGR
FT                   LLTSMAPPQRDRVRDVIRYGKHTVGAMMDFEIITVRAEVSLATVQRYLRLRAKIPVNTD
FT                   KLFVIDRRNRLQGELPLTTLLLHKPDTLVANVMERDPVTFDPEDNDEAAARTFERDDLI
FT                   SAAVVDAKGKLMGRLTVAEVVDLVYEESDTDLRRMGGISEDEDLFAPVSKAVKTRWAWL
FT                   AINLCTAFVASRVIGLFEHTISQLVALAALMPIVAGIGGNTGNQTITMIVRALALQHIQ
FT                   AGNISFLLWRELGVALVNGLVWGGTMGVATYLLYQDPALGAVMTLAMMINLLVAALMGV
FT                   MIPMTMTRLGRDPAIGASVMITAITDTGGFFIFLGLATLFLI"
FT   gene            complement(200951..202357)
FT                   /gene="cysG"
FT                   /locus_tag="ASA_0192"
FT   CDS_pept        complement(200951..202357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysG"
FT                   /locus_tag="ASA_0192"
FT                   /product="siroheme synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88386"
FT                   /db_xref="GOA:A4SHL4"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR012409"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR019478"
FT                   /db_xref="InterPro:IPR028281"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037115"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SHL4"
FT                   /protein_id="ABO88386.1"
FT                   /translation="MDYLPIFCRLDNKPVLLVGGGEVAERKARLLLDAGARLTVVSPAL
FT                   DPELAALATSGTIDWLAAEFEPAHLTGKWLVVAATDRREVNALVYQSANQAGIFANVVD
FT                   DPKRSSFIMPSIIDRSPLMVAISSGGKAPVLARLLREKLEALLPQHLGAVAAFAGGLRA
FT                   RVKARFASMGERRQFWERLLSADRLGQALARGDKASANQLADTLFAEETGAKGEVILVG
FT                   AGPGDPGLLTLHALRHMQQADLVVYDQLVSDEVMALVRRDARRIFVGKQAGNHCVPQEG
FT                   INQLLLEEASKGQRVVRLKGGDPFIFGRGGEELETLVGSGVGFQVVPGITAASGCAAYA
FT                   GIPLTHRDHAQSVRFVTAHGKGGTQDLDWPLLARDQQTLVFYMGLSSCATIRQKLTAHG
FT                   KAGTTPVALIERGTQLNQRVIRGTLDQLPELAVGVESPALIMVGSVVTLADKLAWFGQT
FT                   NHGVQAAALA"
FT   gene            complement(202370..203182)
FT                   /gene="nirC"
FT                   /locus_tag="ASA_0193"
FT   CDS_pept        complement(202370..203182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirC"
FT                   /locus_tag="ASA_0193"
FT                   /product="nitrite transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88387"
FT                   /db_xref="GOA:A4SHL5"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR024002"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHL5"
FT                   /protein_id="ABO88387.1"
FT                   /translation="MYTETINKCAANAARINRFERSDKLGFWLSSAMAGAYVGLGIILI
FT                   FTLGNLVDPSIRPLVMGATFGIALTLVIIAGSELFTGHTMFLTFGVKTGKITMTDLLRI
FT                   LPQTWAGNLLGSIAVALIYSYGGSLLPDAGSLAHKVALAKTQAPALTLFMKGILCNWLV
FT                   CLAIWMALRTEGAAKFIAIWWCLLAFIASGYEHSVANMTLFALSWFGAHSEAYTLGGIG
FT                   HNLLWVTLGNTVSGALFMGLGYWYATPKADRPVAVTDANAAASQTQTA"
FT   gene            complement(203234..203551)
FT                   /gene="nirD"
FT                   /locus_tag="ASA_0194"
FT   CDS_pept        complement(203234..203551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirD"
FT                   /locus_tag="ASA_0194"
FT                   /product="nitrite reductase (NAD(P)H), small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88388"
FT                   /db_xref="GOA:A4SHL6"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017881"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHL6"
FT                   /protein_id="ABO88388.1"
FT                   /translation="MKFACQLNDILPGTGVCALIEGRQIALFRPSAAAEVFAIDNRDPF
FT                   FAANVLSRGLICEHEGALWVASPLKKQRFRLSDGHCFENPAMSIASYAVEVRDQQVWVA
FT                   V"
FT   gene            complement(203548..203658)
FT                   /locus_tag="ASA_0195"
FT   CDS_pept        complement(203548..203658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0195"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88389"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHL7"
FT                   /protein_id="ABO88389.1"
FT                   /translation="MKLACQLNDIFPGTGVCALLEGRQNMPVSLDVEVQS"
FT   gene            complement(203658..206204)
FT                   /gene="nirB"
FT                   /locus_tag="ASA_0196"
FT   CDS_pept        complement(203658..206204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirB"
FT                   /locus_tag="ASA_0196"
FT                   /product="nitrite reductase (NAD(P)H), large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88390"
FT                   /db_xref="GOA:A4SHL8"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHL8"
FT                   /protein_id="ABO88390.1"
FT                   /translation="MSKVRLAVIGNGMVGHRFIEELIERADPDRFEITVFGAEPRPAYD
FT                   RVHLSSYFSHHTSEDLSLVKPGFYEKHGIRLLLGEAVKKIDRAAREVHSNKGTVVGYDK
FT                   LVLATGSYPWVPPIAGSQHHECFVYRTIEDLKAIRSAAKSGKSGVVIGGGLLGLEAAGA
FT                   LKALGLETHVVEFAPVLMAEQLDGQGGQLLRRKIESMGVQVHTSKSTSEILMHGGRDAQ
FT                   HRLAFADGSTLEVDVVVFSTGIRPQDTLGRYSELAIAERGGVAVDDHCLTSDPDIYAIG
FT                   ECAAWQGRFFGLVAPGYKMAQITVDHLLGGDSRFEGADMSAKLKLLGVSVGSIGDAHGR
FT                   TPGSHSYVFQDDQAGVYKRIVVSEDNSRLLGAVLVGDVDDYGNLLQLMLNAMPLPAHPD
FT                   TLILPAYAGAKPTLGVDALPSTAQICSCFDVSKGDIAQAVAEGHTTLAAIKQHTKAGTG
FT                   CGGCVPLISQVLNAELVKQGIEVNNHLCAHFPHSRQELFHLVKVEGIKSFNELLARHGH
FT                   GYGCEVCKPTVGSILASCWNGYVLNPLNTQLQDTNDIFLGNMQKDGSYSVIPRMAGGEV
FT                   TPEGLLAVAEVARDYKLYTKITGAQRIGLFGAQKDDLPAIWRKLLAAGFETGQAYAKAL
FT                   RMAKTCVGSTWCRFGVQDSVGLGVFLENRYKGIRTPHKMKFGVSGCTRECAEAQGKDVG
FT                   IIATDAGWNLYVGGNGGMKPRHADLLASDLDRETLIKLIDRFMMFYVTSADKLQRTSVW
FT                   LGNLEGGVDYLREVIVDDKLGLNATLERDIQVLIDSYECEWSRTLNEEEQLKRFSHFIN
FT                   SGKRDPDVQFVSERDQHRPATPAERIPVYQIEVEAK"
FT   gene            complement(206495..207415)
FT                   /locus_tag="ASA_0197"
FT   CDS_pept        complement(206495..207415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0197"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88391"
FT                   /db_xref="GOA:A4SHL9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHL9"
FT                   /protein_id="ABO88391.1"
FT                   /translation="MTTPDFNLLLTLDALLDEGSVAGAARRLKLSPSAMSRALARLRDT
FT                   TGDPLLVRAGRGLVPTPRALALRERVSQLVQEAEAVLRPQQEIDPAHLVRTFRLRSSDG
FT                   FMESVGAALLARLAAEAPGVRLHFIAKPDKESHPLRSGELDFETGVIGTNTAPELRTQA
FT                   LFQDRFVAVVRPGHPLCEGPLTAVRYAAARHVLVSRRGQEHGPIDEALAALKLERAIAT
FT                   LVPGFATALALVRGSDLVATVPALHCASLHADLVTLPLPFPLPGITLALLWHPRLDADP
FT                   AHRWLRTVIRETCARAPYQATQKER"
FT   gene            207600..209000
FT                   /locus_tag="ASA_0198"
FT   CDS_pept        207600..209000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0198"
FT                   /product="major facilitator superfamily (MFS) protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88392"
FT                   /db_xref="GOA:A4SHM0"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHM0"
FT                   /protein_id="ABO88392.1"
FT                   /translation="MPMSHSITIPTPFARRAGLLALGLATLLPMLAGSMANMVLPALGQ
FT                   VFAVPFASVQWVLVAYLLGITCLTVVAGRLGDRFGRRRLLLWGMALFALASLLCALAPT
FT                   IGWLIAARVLQGAGAACMLSLALAMVGQLVPPERRGWSMGLLGTLSACGTALGPSFGGL
FT                   LIGAFGWQAPFLLLVPVSLLALGAGMLGLPPEGALPQRERVNLASLSMLVMALLCYGLA
FT                   LTSGGILALGLWAGALLVTALFIRRERLDPSPLLPLVLLAEPRLRGGLLASALVASVMV
FT                   VTLLIGPFYLRGVFDLDMATVGLMISGGPLLAALTGMPAGWLVDRFGVLWVVRLGLAVM
FT                   VIAALGLATLTAGYGPLGYLLPILLLTAGYALFQTANNSAVVGGASEQARGAVAGLLTL
FT                   SRNLGQLTGAAGLGGLFATLVGTHNLSMAMPTDLVFGTQVTFALTGLLTGLALWLVGRR
FT                   REEALAVV"
FT   gene            complement(209074..210402)
FT                   /gene="hslU"
FT                   /locus_tag="ASA_0199"
FT   CDS_pept        complement(209074..210402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="ASA_0199"
FT                   /product="ATP-dependent protease HslVU, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88393"
FT                   /db_xref="GOA:A4SHM1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SHM1"
FT                   /protein_id="ABO88393.1"
FT                   /translation="MSEMTPREIVHELDRHIIGQADAKRAVAVALRNRWRRMQLGEEMR
FT                   HEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLT
FT                   DVAIKLVRETEMEKMKYRAEEAAEERILDALLPNPRNTWGEEEKADNSNTRQIFRKKLR
FT                   EGQLDDKEIELELSASPMGVEIMTPPGMEEMANQLQGLFQNLGQNQKKKRKIKVKEAMK
FT                   ALIEEEAARLVNPEELKQKAIAAVENNGIVFLDEIDKICKRGESSGPDVSREGVQRDLL
FT                   PLVEGCTVNTKHGMVKTDHILFVASGAFQVARPSDLIPELQGRLPIRVELTALTTDDFE
FT                   RILTEPNASLTDQYKALMATEGVNIEFTKDGIRRLAEAAWQVNERTENIGARRLHTVME
FT                   RLMEDISFDASEKSGETFVIDTDYVNAHLGKLIEDEDLSRFIL"
FT   gene            complement(210467..211000)
FT                   /gene="hslV"
FT                   /locus_tag="ASA_0200"
FT   CDS_pept        complement(210467..211000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslV"
FT                   /locus_tag="ASA_0200"
FT                   /product="ATp-dependent protease HslVU, peptidase subunit
FT                   HslV"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88394"
FT                   /db_xref="GOA:A4SHM2"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SHM2"
FT                   /protein_id="ABO88394.1"
FT                   /translation="MTTIVSVRRNGQVVIGGDGQVSLGNTVMKGNARKVHRLYNGKVLA
FT                   GFAGGTADAFTLLERFEAKLQAHQGNLERAAVALAKDWRTDRALRRLEALLAVADEHKS
FT                   FIITGNGDVVQPEQDLIAIGSGGNFAQSAAIALLENTELDAKTIVEKSLKIAGDICVFT
FT                   NGNHTIEVLDYSAK"
FT   gene            complement(211192..212019)
FT                   /gene="ftsN"
FT                   /locus_tag="ASA_0201"
FT   CDS_pept        complement(211192..212019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsN"
FT                   /locus_tag="ASA_0201"
FT                   /product="cell division protein, FtsN"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88395"
FT                   /db_xref="GOA:A4SHM3"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHM3"
FT                   /protein_id="ABO88395.1"
FT                   /translation="MATRDYVGNSPRRRAGGRNTKKAAPRRFPVIPALLAGALLAGFGG
FT                   FLYMINGKGSDAPTIEEQVKANKPKTQNNALPQEKWSYIERLENKQVDVIAPPPQPGVL
FT                   PPPPAETLTLQPEKLPQPVPTDIPQPGTPIGQVQPYKPQPVQPAKPAPVASAQEQVIDR
FT                   QADRERMEREIRAELERERAAAPKPQVAAATGDDSGRYMMQCAALRSQDSAESLKARIA
FT                   FTAGLSSSLQVVNGAGGAVYKVMVGPFSGKAATDAANRKLQSAGISGCIPKKG"
FT   gene            complement(212023..213768)
FT                   /gene="argS"
FT                   /locus_tag="ASA_0202"
FT   CDS_pept        complement(212023..213768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="ASA_0202"
FT                   /product="arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88396"
FT                   /db_xref="GOA:A4SHM4"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHM4"
FT                   /protein_id="ABO88396.1"
FT                   /translation="MKEHIHHLLEQTVANLKSAGVLPADLEARVQVDRCKEKAHGDLAT
FT                   NLAMLLAKPARKNPRELAAAIIENLPASDLIAKVEIAGPGFINFFFDQRWLAGQVETMV
FT                   TSANANVKLPTPQTVVVDYSAPNVAKEMAVHHIRSTVLGDVAARALEFLGHKVVRANHI
FT                   GDWGTQFGMLIAYLEKMANEHASDMALKDLEAFYTQAKRCYDEDEAFAERARNYVVKLQ
FT                   GGDEYCRTMWKKLVDMTMEQNQINYDRLNVSLTNKDIMGESMYNDMLPEIVADLKAKGL
FT                   AVESEGATVVFLDEFKNKDGEPMGVIIQKSDGGFLYTTTDIACAKYRYETLGADRVMYF
FT                   IDSRQHQHLMQAWTITRKAGYVPESVPLEHHAFGMMLGKDGRPYKTRSGGTVKLVDLLN
FT                   EAEERATALLESRNSDLSAEEKANVVNAIAMGAVKYADLSKNRTTDYIFDWDMMLSFEG
FT                   NTAPYLQYAYTRIQSIFRKANIDASTLIGNVTLNEEAEEVLAQKLIQFSDAVNGVADKG
FT                   MPHLLCTYLYELSGNFMTFYEACPINKDGVDEATRQSRLLLCTATAKVLKLGLGVLGIH
FT                   TLERM"
FT   gene            214082..214648
FT                   /locus_tag="ASA_0203"
FT   CDS_pept        214082..214648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0203"
FT                   /product="ATP-dependent protease La (LON) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88397"
FT                   /db_xref="GOA:A4SHM5"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHM5"
FT                   /protein_id="ABO88397.1"
FT                   /translation="MKLALFPLSAHLLPGGIMPLRIFEPRYQRMIAEAGDQGFVLCMLD
FT                   PRQPDALRNMYPIATRVRIVDFDQLPDGLLGITVLGMERVRIADLWQESDGLRVGEVEL
FT                   LPLWQTGRLNADQHSLVSALQEVFNDYPEYAALYHNPDWDDASWVAQRWLEVLPIPVEQ
FT                   KQWLLAAENNLPALSLLRGLLVATH"
FT   gene            214730..215350
FT                   /gene="sigY"
FT                   /locus_tag="ASA_0204"
FT   CDS_pept        214730..215350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigY"
FT                   /locus_tag="ASA_0204"
FT                   /product="RNA polymerase sigma-70 factor, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88398"
FT                   /db_xref="GOA:A4SHM6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHM6"
FT                   /protein_id="ABO88398.1"
FT                   /translation="MAYTGQPQSTLRRISPPMDNPDGDLKSLLIRVAEHADKAAFATLF
FT                   THFAPRIRSYGLRHLGSEANAMELVQETMLLVWQKARLYHPEKGAPTTWIYTVMRNQSF
FT                   DMLRRRRASKEDLCAEELWPMLEFRAEEEHLSGGEDAVLTRQMAHYLATLPEPQQQVVR
FT                   GIYLQEFSQQELAERLGVPLGTIKSRLRLALQKLKEQVEQGHD"
FT   gene            215343..216020
FT                   /locus_tag="ASA_0205"
FT   CDS_pept        215343..216020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0205"
FT                   /product="transcriptional regulator, ChrR family"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88399"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012807"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR025979"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHM7"
FT                   /protein_id="ABO88399.1"
FT                   /translation="MIKTHPTHAMLRAFAADELPLPLAVGVSAHCELCPECAASLRACE
FT                   EELARQYLEPTEQPAEVSEPMPAGLDAVLAGILQQPVASQAELGQPASSTPELQVAGHS
FT                   YRLPRVLARHHAPKWRHIGAIRQHSLPLDEMGARASLLHIEAGGRIPEHTHQGYELTLL
FT                   LAGNMQDGDTCYQAGDFIWRDASHAHSPHTPDGCLCYTVQDAPVQFTKGLSRLLNGITH
FT                   RLY"
FT   gene            complement(216084..216899)
FT                   /gene="bacA"
FT                   /locus_tag="ASA_0206"
FT   CDS_pept        complement(216084..216899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bacA"
FT                   /locus_tag="ASA_0206"
FT                   /product="bacitracin resistance protein BacA"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88400"
FT                   /db_xref="GOA:A4SHM8"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SHM8"
FT                   /protein_id="ABO88400.1"
FT                   /translation="MTESYALFVAFVLGIVEGLTEFLPVSSTGHMIIVGHLLGFEGPKA
FT                   ATFEVVIQMGSILAVVAVFWRRLFGLIGIHFGQKPPQDHATLSLVHIILGMLPAVIIGL
FT                   GIHSWIKANLFGPETVMYALVAGGILLIIAEKFRPTVRSETLDDISYKQAFGIGLFQCL
FT                   ALWPGFSRSGATISGGMLMGISRQAAAEFSFILAVPMMVAASGLDLYKSRDLLSMADFP
FT                   MFAVGFITAFVVAMIAIKTFLALIRRLDFIPFAIYRFIVAFAVYLVFVA"
FT   gene            complement(217158..218153)
FT                   /locus_tag="ASA_0207"
FT   CDS_pept        complement(217158..218153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0207"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88401"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHM9"
FT                   /protein_id="ABO88401.1"
FT                   /translation="MDDNYLAAPDRYQRQPYRSVGRHGLRLPSIGLGLGHNFGEGSDPA
FT                   RVKAMVHQAFDLGITHFDLANNYGPPPGSAETCFGGVLKRSLAPYRDELIIASKAGYVM
FT                   WDGPYGDGGSAKYLFASLHQSLRRLGLDYLDIFYHHRPDPRTPLEETCQVLALMVRQGK
FT                   ALYVGLSNYPAELAARAANRLAELGTPCLVNQLKYSLFQREIEAETLPVCREQGVGVVA
FT                   FSPLAGGLLSDRYLAGIPADSRAASGSPFLKPEQITPDKLARIRALHTLAQQRGQDLSQ
FT                   LALQWVLRDPVVSCALIGASSPEQIVNAVDALALPPLDEPLQRQIETTLA"
FT   gene            complement(218305..219285)
FT                   /gene="galM"
FT                   /locus_tag="ASA_0208"
FT   CDS_pept        complement(218305..219285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galM"
FT                   /locus_tag="ASA_0208"
FT                   /product="galactose mutarotase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88402"
FT                   /db_xref="GOA:A4SHN0"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013458"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015443"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHN0"
FT                   /protein_id="ABO88402.1"
FT                   /translation="MTPFELENEEGLRLRGLDFGATLTSLTLPVAGSRREVLLGCADEA
FT                   YPAQQVWLGAVAGRFANRIGGAELVHDGQHWALDANQPPHCLHGGQEGFHHRIWQIKEQ
FT                   ESDRVKLVLLSKAGDQGFPGNLRVTMEYRLEQYDLVVEFRASTDAPTPISLTSHAYFNL
FT                   DGGSKGGDVRDHAISLNADYFLPTDGSGLPLAIAPVEGPFDLRVARPMGLDWLSHPQQR
FT                   QAKGYDHAFLLNGPEQGRAAQVVSGDKQLTMEVYTNQPSLQFYTGNWLASTPNRSGQPH
FT                   QDYDGFCLEAQQLPDSPNRPALGDPWLLPGQHYHHQTRYRFIPAD"
FT   gene            complement(219377..220525)
FT                   /gene="galK"
FT                   /locus_tag="ASA_0209"
FT   CDS_pept        complement(219377..220525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galK"
FT                   /locus_tag="ASA_0209"
FT                   /product="galactokinase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88403"
FT                   /db_xref="GOA:A4SHN1"
FT                   /db_xref="InterPro:IPR000705"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019539"
FT                   /db_xref="InterPro:IPR019741"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022963"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHN1"
FT                   /protein_id="ABO88403.1"
FT                   /translation="MTPSQRVSAVFVEQFEQQPDLLVRAPGRVNLIGEHTDYNDGFVLP
FT                   CAIDYETCVAIGLRNDSQVQVIAADYDNQRDRFDLHQPIEHHPSQRWSDYVRGVVKYLQ
FT                   ERGQALHGLNLVVSGNVPQGAGLSSSASLEVAIGQAFKEALGLHISQAEIALNGQQAEN
FT                   QFVGCNCGIMDQMISASGKQDHALLIDCRSLETRLIPMPSDLAVLIVNSNVRRGLVDSE
FT                   YNTRRQQCETAARHYGVKALRDLDLTALEAGKAGLDEVCYRRARHVVGDNTRTLAAADA
FT                   LESGDLVRLGQLMAESHAAMRDDFEITVPPIDGLVEIIKARLGREGGVRMTGGGFGGCV
FT                   VALLRPAQVAEVIAAVDAEYPARFGIKADSYVCRASAGAGKL"
FT   gene            complement(220522..221583)
FT                   /gene="galT"
FT                   /locus_tag="ASA_0210"
FT   CDS_pept        complement(220522..221583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galT"
FT                   /locus_tag="ASA_0210"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88404"
FT                   /db_xref="GOA:A4SHN2"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR005850"
FT                   /db_xref="InterPro:IPR019779"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHN2"
FT                   /protein_id="ABO88404.1"
FT                   /translation="MMFNPVDHPHRRFNPLTGQYVLVSPHRAKRPWQGQVEKVSQAPSQ
FT                   SHDPDCFLCAGNQRVTGDKNPDYQGTFVFTNDFAALMQDTPATRGDQDPLLKLEAARGT
FT                   SRVICFSPDHGKTLPELPRPAIEAVITTWMEQVAELSSQWQWVQVFENKGAVMGCSNPH
FT                   PHGQLWGSDFLPNEIAREEQHQRDWLAEHGRPLLVEYVERELADRSRIVVETAHWLAVV
FT                   PFWAAWPFETLLLPKTHVPSLLSLTPELQQDLAVALKELTSRYDNLFECSFPYSMGWHF
FT                   APPHSDCPEAWQLHAHFYPPLLRSATVRKFMVGFEMLAETQRDLTPEQAAERLRALSPI
FT                   HYKHTSQANEEAL"
FT   gene            complement(221664..222677)
FT                   /gene="galE"
FT                   /locus_tag="ASA_0211"
FT   CDS_pept        complement(221664..222677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="ASA_0211"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88405"
FT                   /db_xref="GOA:A4SHN3"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHN3"
FT                   /protein_id="ABO88405.1"
FT                   /translation="MKVLVTGGCGYIGSHTCLALQTAGMEPVVVDNLCNSKVGVLARIA
FT                   AISGRAPLFYQGDIRDPALLDRIFAEQQIAAVIHFAALKAVGESTRLPLEYYENNLAGT
FT                   LTLLQAMKRAGVNSLVFSSSATVYGDPASTPIREDFPRSATNPYGRSKLIIEEILEDLQ
FT                   RAEPHWSITLLRYFNPVGAHESGTMGEDPQGIPNNLMPFLTQVAIGRRDCLSVFGNDYP
FT                   TIDGTGVRDYIHVMDVAEGHVKALQHCARQGGVHIYNLGTGQGQSVLQMIAAFEAASGQ
FT                   PLPCRIEPRRPGDIAECWADPSKAERELNWRANRDLATMCADSWRWQSRNPQGYEA"
FT   gene            222882..223886
FT                   /gene="lacI"
FT                   /locus_tag="ASA_0212"
FT   CDS_pept        222882..223886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacI"
FT                   /locus_tag="ASA_0212"
FT                   /product="lactose operon repressor LacI"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88406"
FT                   /db_xref="GOA:A4SHN4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHN4"
FT                   /protein_id="ABO88406.1"
FT                   /translation="MSTIKDVARLANVSVATVSRVMNNSPKASAASREVVQKAMAELGY
FT                   TPNANARALVSKTCDTMGVLVGDVADPFFGALIKGVAAVAVEQGLHLLMGNGFHRAQQE
FT                   RESIDLLIGKRCEALVVHSKALSDEELIDYALRVPGMVLINRDIPALKGRCIALNNRQG
FT                   AATATRHLLELGHRHIAFLSSDHAIEDATLRLQGYQDALTEAGLRADPELVESGMPNEE
FT                   GGERAMLNLLAKGQPITAVVAYNDAMAAGAISVLADNGLKVPEEVSVVGFDDIIYARYL
FT                   RPKLSTMRYPIELMAAQAAKLALQLAAGESEAVQSRIYTPTLINRHSVAPVRA"
FT   gene            224087..227177
FT                   /pseudo
FT                   /gene="lacZ"
FT                   /locus_tag="ASA_0213"
FT                   /note="beta-galactosidase; frameshift due to 1 bp
FT                   insertion. CAZY family GH2"
FT   gene            227412..228398
FT                   /gene="mglB"
FT                   /locus_tag="ASA_0214"
FT   CDS_pept        227412..228398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mglB"
FT                   /locus_tag="ASA_0214"
FT                   /product="ABC-type galactose transporter, periplasmic
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88407"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHN5"
FT                   /protein_id="ABO88407.1"
FT                   /translation="MKKITTVAAVLMSLMAGATAHAETRLGVTVYKYDDNFMAVVRKAI
FT                   EKEAAANPGVELLMNDSQNDQSKQNDQIDVLLAKGVKALAINLVDPAAAPVVIEKARGE
FT                   DIPVVFYNKEPSTADLASYEKAYYVGTDSKESGIIQGQLIAKHWKAHPEWDLNKDGVIQ
FT                   FVLLKGEPGHPDAEARTSYVVKTLNDGGLKTEQLHMDTGMWDTAMAKDKMDAWISGPNA
FT                   NKIEVVIANNDGMAMGAVESLKAQGKTAIPVFGVDALPEALAMVKSGAMAGTVLNDAAN
FT                   QAKATFELTKNLAEGKPAGEGTQWTIVDKVVRVAYVGVDKDNLSQFE"
FT   gene            228452..229972
FT                   /gene="mglA"
FT                   /locus_tag="ASA_0215"
FT   CDS_pept        228452..229972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mglA"
FT                   /locus_tag="ASA_0215"
FT                   /product="ABC-type galactoside transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88408"
FT                   /db_xref="GOA:A4SHN6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015862"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHN6"
FT                   /protein_id="ABO88408.1"
FT                   /translation="MADMTTQQQSEWLLEMIDVSKSFPGVKALDNVNLRVRPHSVHALM
FT                   GENGAGKSTLLKCLFGIYEKDQGKIFFKGQEVNFTSSKEALENGVSMVHQELNLVLQRT
FT                   VMDNMWLGRYPTKGWFVDHGKMYDDTKRIFDELDIDIDPKVKVGTLSVYQMQMIEIAKA
FT                   FSYDAKIVIMDEPTSSLTEKEVNHLFKIINKLKEKGCGIVYISHKMEEIFQLCDEITIL
FT                   RDGQWVATQPLKGMTMDQIIGMMVGRELTQRFPEKTNQPKEVILEVEHLTAKNQPSIQD
FT                   VTFNLHKGEILGIAGLVGAKRTDIVETLFGIRDHSAGAIKLHGKVVANHTAHEAILNGF
FT                   ALVTEERRSTGIYSRLDIAFNSLIANMDSYKGSMGLLSNNKMKSDTQWVIDAMRVKTPT
FT                   QQTQIGSLSGGNQQKVIIGRWLLTQPEILMLDEPTRGIDVGAKFEIYQLILELAKKDKG
FT                   IIIISSEMPELLGITDRIMVMSNGRVAGIVNTKETDQSEILRLASLYL"
FT   gene            229989..230999
FT                   /gene="mglC"
FT                   /locus_tag="ASA_0216"
FT   CDS_pept        229989..230999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:230505..230507,aa:Trp)
FT                   /gene="mglC"
FT                   /locus_tag="ASA_0216"
FT                   /product="ABC-type galactoside transporter, permease
FT                   subunit MglC"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88409"
FT                   /db_xref="GOA:A4SHN7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR030158"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHN7"
FT                   /protein_id="ABO88409.1"
FT                   /translation="MESAKNFNLMQALKENAIYLVLLVLLMVIVIQEPSFLSLTNFSNI
FT                   LTQSSVRVIIALGVAGIIITQGTDLSAGRQVGLAALIAATMLQALTNVNKVFPSLGEVP
FT                   IPVVILLVCAVGALIGLVNGLIVAYLNVTPFITTLGTMIIVYGINSLYFDSVGASPVAG
FT                   FDPRFSSFAWGFIRIGGFKLSYLTFYAAIASVFVWVLWNKTRFGKNIFAIGGNPEAAKV
FT                   SGVNVAVNLVMIYALAGVFYAFGGMLEAGRVGSATNNLGFMYELDAIAACVVGGVSFAG
FT                   GVGTVAGVITGVLIFTLINYGLTYIGVSPYWQFIIKGGIIILAVALDSMKYAKKK"
FT   gene            231051..232784
FT                   /locus_tag="ASA_0217"
FT   CDS_pept        231051..232784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0217"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88410"
FT                   /db_xref="GOA:A4SHN8"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHN8"
FT                   /protein_id="ABO88410.1"
FT                   /translation="MPFKVKIYLLLLLAILVTIGTAWFSVNHFISGYIRTQSTQNINEQ
FT                   IALVKEKLAGDINQKILLAANLNFGVTNVKKTLQETGFHNIVKVIGDMAFDVGGVINDA
FT                   AKVDALRKLIPEANNQITISPLQQVDGKPVITILVPRGADSAYLYYLDMSEFKRLLEKV
FT                   SGEGRYFSLADGQGNVLYSSKPQGESESRPNQLDIRGSSWTLTGYVDLDYIRAMTQALN
FT                   GKIVMALLAVAVLVLVLAMLALNVAYRPILSLRDLVLELSRGSGDLTRRLAVTSKDDLG
FT                   QISAGINRFIERLQEMMREVQGASGQLNTGIEGLANQTGAAQSLLADHVRETEQVVTAI
FT                   NEMSRTAVSVSESAASTAQLTGQSQQLADQSRQVVDQAMASVMALVDEVAATARSIEAM
FT                   QQDVQQIGSVLGVIGSIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRSLAARTQKS
FT                   TAEIQTMLASLQRGTQTVVDAMSNTKQSCQGAAENTTKVNESLDLMAGEVVEINDLISH
FT                   IATAAEQQSAVAEEINRNMSAIAEVIRQLTSNGEETVASSASMQKTYDRLREIVGHFRL
FT                   A"
FT   gene            complement(232825..233093)
FT                   /gene="csrC"
FT                   /locus_tag="ASA_0218"
FT   misc_RNA        complement(232825..233093)
FT                   /gene="csrC"
FT                   /locus_tag="ASA_0218"
FT                   /product="csrC sRNA"
FT   gene            complement(233388..233756)
FT                   /locus_tag="ASA_0219"
FT   CDS_pept        complement(233388..233756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0219"
FT                   /product="transcriptional regulator, CopG family"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88411"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHN9"
FT                   /protein_id="ABO88411.1"
FT                   /translation="MGLADLKKKHNLHHQKKFTIDEFIEDADFYAKGKPKVVSLELSLH
FT                   RDEALTALAFIERGEHLKPSYKKATFSLSTAAIDELGNLTQQDGMNKSLLLRLFTHYFS
FT                   SLSPEERQTIYERLQEHN"
FT   gene            complement(233758..234405)
FT                   /locus_tag="ASA_0220"
FT   CDS_pept        complement(233758..234405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0220"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88412"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHP0"
FT                   /protein_id="ABO88412.1"
FT                   /translation="MILLVGGEKGGSGKSCLAQNLAVDLRTRFHGEVLLVDCYPQRTTS
FT                   DWIQERNDNPDLPQINCVQLYGNIRNDLLSLKNRYDYVIVDCGGQDNRALRSTMAVATH
FT                   ALIPLRPKRRDLKTLPHMEDLITTCKMVNPTLKAAVVLTQCPALPNQVKRILEAKEVCS
FT                   SFGVDVLNAITYSRNVYDDSEEKGLSVMEIEPDGKSAEEIRTIAKEFLELEV"
FT   gene            complement(234505..234858)
FT                   /locus_tag="ASA_0221"
FT   CDS_pept        complement(234505..234858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0221"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88413"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHP1"
FT                   /protein_id="ABO88413.1"
FT                   /translation="MDMHKTSILVMHFSPTLPHPLFKLFSLVEFISQPCVTGRLDLTQK
FT                   VIRITPCSVTKEIVMKIKSLFLLAALVLPATPSLVSAQGAPAIPMVVCHVDKAPQMLVP
FT                   EYVCQWYGGRQHY"
FT   gene            235429..236649
FT                   /gene="arcA"
FT                   /locus_tag="ASA_0222"
FT   CDS_pept        235429..236649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcA"
FT                   /locus_tag="ASA_0222"
FT                   /product="arginine deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88414"
FT                   /db_xref="GOA:A4SHP2"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHP2"
FT                   /protein_id="ABO88414.1"
FT                   /translation="MSKFYVGSEVGQLRRVMLHRPNLSLKRLTPSNCQDLLFDDVLSVE
FT                   RAGQEHDKFAQVLRDQNVEVFLLTNLLAETLDVPEAKTWLLQHQVSDYRLGSSLANDVR
FT                   CFLADMPHRELARILSGGLTYSEMPYSGVNMVVGMHAPTDFIIEPLPNHLFTRDTSCWV
FT                   YGGVSINPMAKAARRRETNHVKAIYRWHPQFAGQDFIKYFGDEDHDYDNSTIEGGDVLV
FT                   IGRGSVLIGMSERTTPQGVEHLARSLFKHGQAKQVIVMQLPKHRSCMHLDTVMTHMDID
FT                   TFSVYPEVIRKDVNCWSLTPGGATGMNIKEEGYFVSAIEKALGVDQLKLITTGGDSFEA
FT                   EREQWNDANNVLTVRPGVVVGYERNTYTNEKYDKAGITVLSIPGEELGRGRGGARCMSC
FT                   PMERDGI"
FT   gene            236712..237638
FT                   /gene="arcC"
FT                   /locus_tag="ASA_0223"
FT   CDS_pept        236712..237638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcC"
FT                   /locus_tag="ASA_0223"
FT                   /product="carbamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88415"
FT                   /db_xref="GOA:A4SHP3"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHP3"
FT                   /protein_id="ABO88415.1"
FT                   /translation="MKKPTVVVALGGNALLRRGEPLEADIQRKNIATAAKTIALIAQEY
FT                   NVVLVHGNGPQVGLLALQNSAYTKVSPYPLDVLGAESQGMIGYMLIQELKNLMPSRNVT
FT                   ALLTQVQVDPKDPAFANPTKFIGPVYEEAEARALAEEKRWVVKADGKFFRRVVPSPLPQ
FT                   RIVEGDAIETLIAQGHLIICTGGGGIPVTWDGKCLTGIEAVIDKDMSAAYLAKQIKADA
FT                   LLILTDADAVYLDWGKPTQHPLRVTSPDELAGVKFDAGSMGPKVEASCEFVKATGGMVG
FT                   IGSLEDGLAILKGEAGTNIIATRTVGV"
FT   gene            237741..238745
FT                   /gene="argF"
FT                   /locus_tag="ASA_0224"
FT   CDS_pept        237741..238745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argF"
FT                   /locus_tag="ASA_0224"
FT                   /product="ornithine carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88416"
FT                   /db_xref="GOA:A4SHP4"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SHP4"
FT                   /protein_id="ABO88416.1"
FT                   /translation="MAFNLRNRNFLKLLDFTPREIQYMIDLAIDLKKAKYGGYERKHLT
FT                   GKNIALIFEKTSTRTRCAFEVAAFDQGAQVSYLGPSGSQIGHKESMKDTARVLGRMYDG
FT                   IEYRGYGQEIVEELGAYAGVPVWNGLTNEFHPTQILADFMTMLEHGKGKRLDQIKFAYL
FT                   GDARNNMGNSLMVGAAKMGMDIRLVAPKAFWPEEDLVAKCRLIAEETGACITLTEDVKE
FT                   GVLGTDFLYTDVWVSMGEAKEAWDQRVKLMTPYQINMDVINATKNPDVKFMHCLPAFHN
FT                   DETTMGKEVADKYGMKGLEVTEDVFESEHSIVFDEAENRMHTIKAVMVATLGD"
FT   gene            238832..240274
FT                   /locus_tag="ASA_0225"
FT   CDS_pept        238832..240274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0225"
FT                   /product="arginine-ornithine antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88417"
FT                   /db_xref="GOA:A4SHP5"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHP5"
FT                   /protein_id="ABO88417.1"
FT                   /translation="MHGYHTTEGSWTMTKFKFPSAYTILFVLIALVAALSWVVPAGKYD
FT                   MIMNDALGKEVPVAGTYKLVEGNPQGIVDVLLAPIDGLYNHDTYEAGAIDVSLFILIIG
FT                   GFLGIVTKTGAIDAGIERVTDRLRGREEWMIPILMALFAAGGTIYGMAEESLPFYTLLV
FT                   PVMMAARFDPVVAAATVLLGAGIGTLGSTINPFATVIAANAAGISFTDGIWLRVAMLVA
FT                   GWLLCVAYVMRYAKMVRNDPSKSLVADKWEENRAHFLGNKSDQMLEFTLTRKIVLGIFV
FT                   AAFAVMIYGVAVLGWWMAQISGVFLAAAIIVGVISRMSEEELTTNFIDGARDLLGVALI
FT                   IGIARGIVVVMDNGMITHTILHSAEGIVTGLSTVVFINVMFVLEVVLSFLVPSSSGLAV
FT                   LTMPIMAPLADFANVGRELVVTAYQSASGLVNLVTPTSAVVMGGLAIAKVPYVRWLKWV
FT                   APLLGILTVLIVVCLSLGAVLS"
FT   gene            complement(240467..240958)
FT                   /locus_tag="ASA_0226"
FT   CDS_pept        complement(240467..240958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0226"
FT                   /product="arginine repressor"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88418"
FT                   /db_xref="GOA:A4SHP6"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHP6"
FT                   /protein_id="ABO88418.1"
FT                   /translation="MVKTLSRPVEQEPDLAQLDACRQIIGQHCYSTQEEIRRELSMRGF
FT                   ADISQSTISRLLRRLGVAKAQNANGKKVYTLVDDQLEPAGSTRSIHDMVREVVHNQQMV
FT                   LIHTTPGAATVVARLLDRNANPEIMGAVAGNDVVLVAPRHISRTRQAHAAVVRTLEQAR
FT                   "
FT   gene            complement(241160..241624)
FT                   /gene="pyrI"
FT                   /locus_tag="ASA_0227"
FT   CDS_pept        complement(241160..241624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrI"
FT                   /locus_tag="ASA_0227"
FT                   /product="aspartate carbamoyltransferase, regulatory
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88419"
FT                   /db_xref="GOA:A4SHP7"
FT                   /db_xref="InterPro:IPR002801"
FT                   /db_xref="InterPro:IPR020542"
FT                   /db_xref="InterPro:IPR020545"
FT                   /db_xref="InterPro:IPR036792"
FT                   /db_xref="InterPro:IPR036793"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SHP7"
FT                   /protein_id="ABO88419.1"
FT                   /translation="MSEKNQLQVEAIRHGSVIDHVPAGQGIKILKLFQLIETQERITVG
FT                   FNLKSGALGKKDLIKIENTRLTAEQANQLALFAPKATVNIIEDFAVVKKHQLELPEFIT
FT                   GVFHCPNSNCISHNEPVDSYFRVREVKGVVRMKCKYCEKSFTQDIVSERY"
FT   gene            complement(241642..242562)
FT                   /gene="pyrB"
FT                   /locus_tag="ASA_0228"
FT   CDS_pept        complement(241642..242562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="ASA_0228"
FT                   /product="aspartate carbamoyltransferase, catalytic
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88420"
FT                   /db_xref="GOA:A4SHP8"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SHP8"
FT                   /protein_id="ABO88420.1"
FT                   /translation="MTNPLYKKHVISISDLTRPDMELVVATAQRLKAEPDTRLLKDKLI
FT                   ASCFFEASTRTRLSFETAVQRLGGNIIGFADGGNTSAKKGETLADSIKIIGSYSDAVVM
FT                   RHPKEGAARLASEFSRVPVINGGDGSNQHPTQTLLDLFSIHETQGKLDGLNVAFVGDLK
FT                   YGRTVHSLAQALSLFNCRFFFISPDALAMPDYICEELEEKGIRFSVHETMEEVMPELDI
FT                   LYMTRVQKERFDETEYKHMAAKFVLELATLEGAKPTMKILHPLPRVDEIDVAVDKTPYA
FT                   YYFQQAENGVYARQALLALVLNETV"
FT   gene            complement(242837..243379)
FT                   /locus_tag="ASA_0229"
FT   CDS_pept        complement(242837..243379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0229"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88421"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHP9"
FT                   /protein_id="ABO88421.1"
FT                   /translation="MLNYRLLQQLAPLNFRGERKTESLPDYLDRVAPQVPFIPHCVLSQ
FT                   WIYRHWRGFESNWSFIDLARHQFECEQWPTERIIAQTGSRHMEVIERWGEMLRHNRYVR
FT                   RSWLGDYMLTQGTWSEPIIVLATTPDSRYPDGQPLPQPYCLLEGHHRLAYLRSMAEDQQ
FT                   PLQTEHSVWVCRPVHGT"
FT   gene            243581..243657
FT                   /gene="trnW"
FT                   /locus_tag="ASA_0230"
FT   tRNA            243581..243657
FT                   /gene="trnW"
FT                   /locus_tag="ASA_0230"
FT                   /product="tRNA-Trp"
FT   gene            243964..245334
FT                   /locus_tag="ASA_0231"
FT   CDS_pept        243964..245334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0231"
FT                   /product="phosphatidylserine decarboxylase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88422"
FT                   /db_xref="GOA:A4SHQ0"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR022237"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHQ0"
FT                   /protein_id="ABO88422.1"
FT                   /translation="MNEAVETRLNKSRPGGWVPRDSAHIARWIRRMKHYVANQPGELVP
FT                   PIAELRDLVNADPWLHAQAEAMFKEAWRHKHLTPLGQVEVRSFEEFLGLLNGIMTTAPE
FT                   AYQDIPTHEPSGLIGFPINALLDWPMATQSGYHFFANALINQQFKKILDYWALFLQSPA
FT                   SRYVLNEPVSKLDKETLVVPWLGKAAKSEMVKVACGALGEGTNPTPGSFEQIFQCDPSA
FT                   EYHGFSCWDDFFTRTFRPDVRPVSAPEDDNVIVNACESAPLQVKKGVSRSDQFWLKGQP
FT                   YSLDNMLDFDDLAPRFDGGTVYQAFLSALSYHRWHNPVSGTIRKVRVVNGTYYLENQFE
FT                   GFVDPQGADPSAPNNSQPFLTSVATRALIFIEADNPKIGLMCVVPVGMAEVSSCDVTVR
FT                   AGDRVKKGDPLGMFHFGGSTHCLVFRPGVKLEFEFYGQTPSLDAGNMRLNTAIARVR"
FT   gene            245589..247478
FT                   /locus_tag="ASA_0232"
FT   CDS_pept        245589..247478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0232"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88423"
FT                   /db_xref="GOA:A4SHQ1"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHQ1"
FT                   /protein_id="ABO88423.1"
FT                   /translation="MNLSLRGKLLATSLGVVLITVCLLGMTAFYTLKNQTLSAIDSEAR
FT                   NYASAYAEGIGKWMQDRRESLTAQVNVIANHPTSELVPHLQQTLRSGGFGLAYYGSEEG
FT                   VMTRNDPSLNKGDYDPRARPWYQDAVKVGKLIITEPYVSVTMQQLVVTLAEPVMQQGRL
FT                   AGVVGANLALEQLIKDVLAMRVQGDGYAMLLDKSGLIVAHPNKDLALKKSQDLAPELDA
FT                   NRLVGMSQQGGLQAVQIGGRDTKMLVLPIPNTDWLLAMVMHEDVLMEPLQSLLLQLSLI
FT                   SAGLILVFGLVLTSTFKYLFQDLGRVAGALHDIAHGEGDLTVHINTRSKDEVGQLAESF
FT                   NQFVARLHGIVSRLRDVTVELAAQSRTQAAGALARSQRVRQQQDEIVMVATAVTEMASA
FT                   TQEIAGNAEFAATTSGDAVKLAVAGQSQVGQSQRSITGLADEVADASQIIVELDAHAQK
FT                   ISGILATISGIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRVLSKRTHDSTDEIQQ
FT                   MIETLQQTTRRAVGGMETSRQLAGTSVEDAEAANQSLSLINQAIGSISDMATQIAAAAE
FT                   EQTSVTSEISRNTENIRHVSQELAEQAGEEAAQAAELKSLTERLEQEIGRFRL"
FT   gene            complement(247548..248060)
FT                   /gene="blc"
FT                   /locus_tag="ASA_0233"
FT   CDS_pept        complement(247548..248060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blc"
FT                   /locus_tag="ASA_0233"
FT                   /product="outer membrane lipoprotein (lipocalin)"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88424"
FT                   /db_xref="GOA:A4SHQ2"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002446"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022271"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHQ2"
FT                   /protein_id="ABO88424.1"
FT                   /translation="MRSLFCLLCGLLLTACTGMADGIRPVTGFQLDRYLGTWYEIARLD
FT                   HSFERGLEEVSASYSLRDDGGVRVINRGKQSNGSWREAEGKAYFVDKPDEARLKVSFFG
FT                   PFYGGYNVIDLDPDYQLSLVTSYNHDYLWILSRSPNPPKAKVDALVAKARGLGFATDKL
FT                   IWVKQPG"
FT   gene            complement(248076..248846)
FT                   /locus_tag="ASA_0234"
FT   CDS_pept        complement(248076..248846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0234"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88425"
FT                   /db_xref="GOA:A4SHQ3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHQ3"
FT                   /protein_id="ABO88425.1"
FT                   /translation="MLYQPRMIVILQGHKVGYMADQVFRYDPSHYLLMPLPCECECFAS
FT                   PEQPLVGFSLEINVATLQELLLELGDSLPAPAVQKSGVHSVPLSEEMFCAAERLIDLMD
FT                   KPHHARVLGPQTVREMLFYALHEGGGPALQALANRHNHVGQIARVLRMIESRFADNLTM
FT                   EELAREVNMSVSAFHHHFKAVTSTSPLQYIKSFRLHKARLMMLHDGIKAGAAAAKVGYE
FT                   SNSQFSREYKRYFGSTPTDQASRFRDGQLRIIEG"
FT   gene            249107..250276
FT                   /locus_tag="ASA_0235"
FT   CDS_pept        249107..250276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0235"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88426"
FT                   /db_xref="GOA:A4SHQ4"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHQ4"
FT                   /protein_id="ABO88426.1"
FT                   /translation="MSMNNFTLHTPTKILFGKGQVAQLREQLPSDARILIIYGGGSVVR
FT                   TGLLAQIRDELAGMTLFEFGGIEPNPTYETLMGAVALARAERIDFLLAVGGGSVLDGTK
FT                   FIAAAAHYDEARDPWHILETVGNEVRSAIPLGAVLTLPATGSEMNMGAVVTRRSTGDKV
FT                   HFFSPFVMPRFAVLDPVLTYTLPARQVANGVVDAFIHILEQYLTYPVNAKVQDRFAEGL
FT                   LLTLVEEGPKALVEPENYEVRANIMWSATMALNGLIGAGVPQDWATHMLGHELTALHGL
FT                   DHAQTLAVVLPALLQAKRQQKHAKLLQYAERVWDLRSGSESDRIDGAIAATRDFFERMG
FT                   VKTRLRDYGLSELGIDTLIGKLAEHGMTAIGEHGDIDLVQSQHIYEAAW"
FT   gene            250784..252307
FT                   /gene="pntA"
FT                   /locus_tag="ASA_0236"
FT   CDS_pept        250784..252307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntA"
FT                   /locus_tag="ASA_0236"
FT                   /product="NAD(P) transhydrogenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88427"
FT                   /db_xref="GOA:A4SHQ5"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008142"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="InterPro:IPR026255"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHQ5"
FT                   /protein_id="ABO88427.1"
FT                   /translation="MQIGIPRESLAGETRVAATPATVEQLKKLGFEVAIEAGAGQLASF
FT                   DDAAFEAAGASVVPSVWQADLIFKVNAPTDAEIAQIKDGATLVSFIWPAQNPELVKKLS
FT                   ERNINVMAMDMVPRISRAQSLDALSSMANIGGYRAVVEAAHQFGRFFTGQITAAGKVPP
FT                   AKVLVIGAGVAGLAAIGTAGSLGAIVRAFDTRLEVAEQIESMGGEFLKLDFGSEDGASS
FT                   DGYAKVMSDEFIAAEMALFAQQAKEVDIIITTALIPGRPAPKLITKEMVDSMKPGSVIV
FT                   DLAAATGGNCEYTKPTELFVTPNGVKVIGYTDLPGRLPAQSSQLYGTNLVNLMKLMCKE
FT                   KDGQVAIDFEDVVQRNMTVIQAGEVTFPPPAISVSAAPQKPAAAPIKKAEEKQPSNKKF
FT                   VFGALGIAAFGWVAAVAPAAFLSHFTVFILACVVGYYVVWNVSHSLHTPLMSVTNAISG
FT                   IIVVGALLQIGQGSTLVTALSFVAVLIASINIFGGFTVTQRMLKMFRKD"
FT   gene            252319..253803
FT                   /gene="pntB"
FT                   /locus_tag="ASA_0237"
FT   CDS_pept        252319..253803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntB"
FT                   /locus_tag="ASA_0237"
FT                   /product="NAD(P) transhydrogenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88428"
FT                   /db_xref="GOA:A4SHQ6"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHQ6"
FT                   /protein_id="ABO88428.1"
FT                   /translation="MSQGLVTASYIVAAVLFILSLAGLSKQETAKHGNLFGIAGMAIAL
FT                   LATVFNPETSGVHWIILAMVIGGAIGVRLALKVEMTEMPELVAVLHSFVGMAAVLVGFN
FT                   SFIDLHPSAPAEVVVSVGSNLDATLAAARAAFEQAASVAQVEHLSGAMLNIHLVEVFLG
FT                   VFIGAVTFTGSVVAFGKLRGLISSKPLMLPHRHKLNLLAVLASLALMVYFVNAGGSTFA
FT                   LLVMTLIAFAFGWHLVASIGGADMPVVVSMLNSYSGWAAAAAGFMLSNDLLIVVGALVG
FT                   SSGAILSYIMCKAMNRSFISVIAGGFGSDGVASTADQEMGEYRETSAEEVADLLKNSSS
FT                   VIITPGYGMAVAQAQYPVAEITQKLRDRGIKVRFGIHPVAGRLPGHMNVLLAEAKVPYD
FT                   IVLEMDEINDDFNDTDVVLVIGANDTVNPAAMEDPGSPIAGMPVLEVWKAQNVIGFKRS
FT                   MNTGYAGVQNPLFFKENTQMLFGDAKASVEAILKAL"
FT   gene            253900..254652
FT                   /locus_tag="ASA_0238"
FT   CDS_pept        253900..254652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0238"
FT                   /product="ABC-type amino acid transporter, periplasmic
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88429"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHQ7"
FT                   /protein_id="ABO88429.1"
FT                   /translation="MMWRKGWILLCLWWGWTVQANEQPSLTLLTELWPPYVMRLDDGSL
FT                   GGADLELARKVLTKMGYRTTVKVLPWKRVLQEARFQNGDAIVDAFFEERRLEWLHYPDE
FT                   PLSQSGEVIFFPLNKPVDFQSLASLKGLHIGTQADYAYGEAFLTATEFTRFPMTGESNM
FT                   IKQLHMMMAGRLDAVVMNQRVGLHLLKGQGLQDLVGHSIKTVTDNNRNFLAFTHKPGHE
FT                   RLAYQFSLALKAFKQTPEYQALLARYGL"
FT   gene            254826..255503
FT                   /locus_tag="ASA_0239"
FT   CDS_pept        254826..255503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0239"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88430"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHQ8"
FT                   /protein_id="ABO88430.1"
FT                   /translation="MTPMMQATPLRQTSALTDEERHLIASFEPAVEALSALFGPGCEVV
FT                   LHAFDSLHASVIKIANGHITGREEGAPVTDFALNKLQSAAGSQWSSYFSRTREGGLLKS
FT                   SSITISNREGKPIGMLCVNFSLETPLGALLDTFSLPAAPAPLNNETFASSVDDLVAQVI
FT                   HKVDQDASLGSSVRNKAIVHRLYDMGIFEIKDAAQLVAEMLGISRHTVYLHIRNHKADL
FT                   NEQ"
FT   gene            255529..256836
FT                   /locus_tag="ASA_0240"
FT   CDS_pept        255529..256836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0240"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88431"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR021144"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SHQ9"
FT                   /protein_id="ABO88431.1"
FT                   /translation="MRNTAMKAQWTDFITLLKREVVPALGCTEPMSVALAAANCRKLLG
FT                   QTPTRVSVWVSGNLFKNGMGVGVPGTGMIGLPVAAAVGFTGGNPDAGLEVLNTLTPAQV
FT                   EEAKALLPIIKVDVKDVPDVLYAEVLAEVEGHSARVVICTDHTRIVLMELDGEVLMEQN
FT                   SAPGVQIQPAKSDKPAMTLREIVAFALEVPLAEIDFIGAAATMNQALADEGLQGYGLRI
FT                   GKILTEQVERKLLSDDLMTLAMRLSSAASDARMDGAMLPAMSNSGSGNQGIAATMPVVA
FT                   AARFLKASDEQLTRALVMSHLVAIYIKTHQNKLSALCAASTAAMGSGAAITWLLGGQFE
FT                   QISHCINNMIGDVSGIICDGAGSACSMKVSTSTSAAVKSSLMAINNLHVPQSEGIVSDD
FT                   VDETIANLGRLSKLGMLDTDIEIINIMRAKQQGKAQ"
FT   gene            257076..258476
FT                   /locus_tag="ASA_0241"
FT   CDS_pept        257076..258476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0241"
FT                   /product="sodium/dicarboxylate symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88432"
FT                   /db_xref="GOA:A4SHR0"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHR0"
FT                   /protein_id="ABO88432.1"
FT                   /translation="MTLSVIGNLAIAAILLLFLYRLQQKHVSFTRRVFAGLGLGILFGA
FT                   ALQLLYGAGAGVIGQTIDYLDIVGSGYVKLLQMIITPLIMVSIIGAILKLNGGTALGKI
FT                   SAMTIGVLIFTTMLAAGAGILMSNLFGLTAEGLTAGAAETARGAALQTTLGSVESMSFA
FT                   KMVLEFIPANPFLDMTGSRKTSTIAVVIFSIFIGLSATGIARKKPEIFESFGRFMEVAH
FT                   VIVMRMVTLVLRLTPYGVLALMAKVVSGSNYADILNLLNFVMASYGAIAIMFAVHLLLV
FT                   GLVGINPLRFLKKIMPVLAFAFTSRTSAGSIPMNVQTQTKALGIPEGIANFAASFGSTI
FT                   GQNGCAGIYPAMLAVMIAPTVGVNPMDPGFIMTLIAIITVSSFRVAGIGGGATFAALIV
FT                   LSALDFPVALAGLLISIEPLIDMGRTALNVSGSITAGTVTSRLLGETDMQVFNSEHEVC
FT                   LDGEESTI"
FT   gene            258564..259892
FT                   /locus_tag="ASA_0242"
FT   CDS_pept        258564..259892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0242"
FT                   /product="NADH oxidase, water-forming"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88433"
FT                   /db_xref="GOA:A4SHR1"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHR1"
FT                   /protein_id="ABO88433.1"
FT                   /translation="MRILIIGGEAAGMSAAAKARRLAKDAEIVVYEASEVISFGACGLP
FT                   YFVGDEFQEPGYMAEFTPEQFAAKGIEVKTGHRVLSLDASAGTVQVEHQGDVFTDTYDR
FT                   LMVATGAREVMPPIPGLQQQGVFGLRRMADGLALKAAVQDKRNTRALVIGSGFIGLEVV
FT                   EALVHQGKEVRLIELADRVIPDAFDSEITRHIETELREQGVCVHLGERVEALLGDGRVT
FT                   GVRTDKGEYEADIVVVCTGVKPNTEFLADTGIKRLANGAIEVDRQGRTSLANVWSAGDC
FT                   ASVWHSVKQQQVYVPLATIANKLGRMVGENLAGAEQVFPGTLGSAALKVLGLEAGRTGL
FT                   SEQEAQAMGIDYRTVVIKDKCHTNYCPGQSDIHVKLVYEAGSKRLLGGQILGRKGAVHR
FT                   IDALAVAITMGVTTEQLGMLDFAYAPPFSRTWDVLNVAGNVAK"
FT   gene            complement(260110..260883)
FT                   /locus_tag="ASA_0243"
FT   CDS_pept        complement(260110..260883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0243"
FT                   /product="lipoprotein, ComL family"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88434"
FT                   /db_xref="GOA:A4SHR2"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR017689"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHR2"
FT                   /protein_id="ABO88434.1"
FT                   /translation="MDRMLLMGKKSHLLMSLALVATLITGCSSTKPKVPDEPPETLYQK
FT                   ARLKLDAGNYVNAIELLEALDSRYPFGAYSNQVQLDLIYAYYKQDDTAQAIANIDRFIR
FT                   LNPAHKNIDYVFYMRGLTNMAGDYNFFQDFLGINRDDKDPSYARQAFQDFKTLLQNYPN
FT                   SVYAADARARMIGLKNRLARYDLSVAEYYVKRDALIAAANRAKLIVETYPDTAETEKAL
FT                   EIMVESYDTLKMPTLAQHAREVLAKNYPDNRLGRG"
FT   gene            260983..261963
FT                   /gene="rluD"
FT                   /locus_tag="ASA_0244"
FT   CDS_pept        260983..261963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluD"
FT                   /locus_tag="ASA_0244"
FT                   /product="ribosomal large subunit pseudouridine synthase D"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88435"
FT                   /db_xref="GOA:A4SHR3"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHR3"
FT                   /protein_id="ABO88435.1"
FT                   /translation="MSQHIELTGEFQDHQFGQRLDQALAELFPDYSRTRIKEWILQDRV
FT                   TLDGQVANTPREKVLAGQQVHVDVELEDDTRWDAQDIALNIVYEDEHILVIDKPAGLVV
FT                   HPGAGTPDGTILNALLHRYPDIAEVPRAGIVHRLDKDTTGLMVVAKTVPAQTHLVEALQ
FT                   ARQITREYEAIAIGHMTAGGTVDAPIGRHPTQRTHMAVVPNGRPSVTHYRVHEKFRGHT
FT                   RLRLRLETGRTHQIRVHMSHIKHPLVGDPAYGGRLRPLRNATPELTLALRNFNRQALHA
FT                   TMLQLAHPITGEVMQWHSPTPQDMLDLMEVMRADTLANPDDLVWN"
FT   gene            262099..262848
FT                   /locus_tag="ASA_0245"
FT   CDS_pept        262099..262848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0245"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88436"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHR4"
FT                   /protein_id="ABO88436.1"
FT                   /translation="MKWIEPDWPAPARVRALSTTRDGGVSQGVFAGLNLGAHVGDEVVR
FT                   VEANRARLQQAAQIPGPLNWLNQVHGTAVHQVSKQYDVVPDADAACAHEVGLACIVMTA
FT                   DCLPVLFCDRAGTVVAAAHAGWRGLLGNEQGGVLEASIQAMGCNPADILAWLGPAIGPG
FT                   AFEVGGEVRDAFMAQQAEAEAAFVPSSNEGKWLADIYLLARLRLARAGVSAVYGGEFCT
FT                   FGDGERFYSYRRDGQTGRMASLVWLAQ"
FT   gene            263023..265596
FT                   /gene="clpB"
FT                   /locus_tag="ASA_0246"
FT   CDS_pept        263023..265596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpB"
FT                   /locus_tag="ASA_0246"
FT                   /product="chaperone clpB"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88437"
FT                   /db_xref="GOA:A4SHR5"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHR5"
FT                   /protein_id="ABO88437.1"
FT                   /translation="MRLDRLTSKFQIAISDAQSLALGRDHQFIEPVHLMTALVNQDGGS
FT                   IRPLLTLTGMDINTLRSRLGIELDRLPKVSGVEGDVQLSSGLRRLLNVCDKLAQQRKDQ
FT                   FISSELFVLAALDEKGNLGELLRAQGLTKEKLEAAIDKVRGGRKIDDANAEENRQALEK
FT                   YTIDLTERAELGKLDPVIGRDEEIRRTIQVLQRRTKNNPVLIGAPGVGKTAIVEGLAQR
FT                   IINGEVPEGLKNKRVLSLDMGSLVAGAKYRGEFEERLKAVLSDLAKEEGNVILFIDELH
FT                   TMVGAGKGEGAMDAGNMLKPALARGDLHCVGATTLDEYRQYIEKDAALERRFQKVLVEE
FT                   PSVEDTIAILRGLKERYELHHHVQITDPAIVAAAQLSHRYIADRQLPDKAIDLIDEAAA
FT                   SIRLQIDSKPESLDRLERRIIQLKLEQQALMKEDDDASRKRLDLISKEIGEKDREYNEL
FT                   DEVWKAEKAALAGTQHIKAALEQARQDLDVARRAGDLGRMSELQYGRIPELEKQLDLAT
FT                   QAEMQETSLLRNRVTDVEIADVLARWTGIPVARMLEGERDKLLRMEDKLHSRVIGQEEA
FT                   VEAVSNAIRRSRAGLSDPNRPIGSFLFLGPTGVGKTELCKALAEFLFDTQDAMVRIDMS
FT                   EFMEKHSVARLVGAPPGYVGYEEGGYLTEAVRRRPYSVILLDEVEKAHPDVFNILLQVL
FT                   DDGRLTDGQGRTVDFRNSVVIMTSNLGSDLIQEHHSEKDYDEMKALLMEVLTRSFRPEF
FT                   INRIDETVVFHPLGEDHIKSIARIQLKSLMGRLEAQGYEVEVSEALLEKLVHAGFDPVY
FT                   GARPLKRAIQHKVENPLAQALLSGRIVPGKKLLLGADSNGLTMNQ"
FT   gene            complement(265894..266886)
FT                   /gene="asnA"
FT                   /locus_tag="ASA_0247"
FT   CDS_pept        complement(265894..266886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnA"
FT                   /locus_tag="ASA_0247"
FT                   /product="aspartate-ammonia ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88438"
FT                   /db_xref="GOA:A4SHR6"
FT                   /db_xref="InterPro:IPR004618"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SHR6"
FT                   /protein_id="ABO88438.1"
FT                   /translation="MKQHYIRSQQQISFVKEMFSRQLAQQLGLMEVQAPILSRVGDGTQ
FT                   DNLSGSENAVQVKVKTLPGHSYEVVHSLAKWKRQTLGRFGFGPGEGIYTHMKALRPDED
FT                   KLTPIHSVYVDQWDWEKVMPSERRDLAYLQETVRGIWAAIKATERAVCAEHELTPFLPG
FT                   EIQFLHSEALLARYPDLDAKGRERAIAKELGAVFLIGIGGALSHGERHDVRAPDYDDWS
FT                   SHSELGLAGLNGDILVWNPVLEDSFEISSMGIRVDAEALRRQLAITGDEGRLQYDWHRD
FT                   LLAERMPQTIGGGIGQSRLAMLLLQKEHIGQVQVGVWPSEMKAAIPGML"
FT   gene            267010..267501
FT                   /gene="asnC"
FT                   /locus_tag="ASA_0248"
FT   CDS_pept        267010..267501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnC"
FT                   /locus_tag="ASA_0248"
FT                   /product="transcriptional regulator AsnC"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88439"
FT                   /db_xref="GOA:A4SHR7"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHR7"
FT                   /protein_id="ABO88439.1"
FT                   /translation="MRYLQRECKKVPENYRIDNLDQAILTALMENARIPYAELAKQLAV
FT                   SPGTIHVRVEKMKQAGIIEGTRVQVNPKKLGYDVCCFIGINLKSAKDYPSALAKLQALD
FT                   EVVEAYYTTGHYSIFMKVMTRSIDELQTVLIHKIQTIDEIQSTETLISLQNPILRDVKP
FT                   "
FT   gene            complement(267523..268287)
FT                   /locus_tag="ASA_0249"
FT   CDS_pept        complement(267523..268287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0249"
FT                   /product="ABC-type amino acid transporter, periplasmic
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88440"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHR8"
FT                   /protein_id="ABO88440.1"
FT                   /translation="MRKLPLLCLLFPLWLQAKELVIGGTLEPPLKFLDDKAQPGGLDVD
FT                   VVTAIFNKLKIPIKIELTDAGARLTLNAETGVYDLVMTHSYKPERESYLLYPQQSHLRH
FT                   SWHFFVRKADMLRIRYDTLEDLKPWRIGLTKDFAYTPELAAALKDPAYQIQEIPINQLQ
FT                   LRKLIAGRIDTVPMPLVTAFAQIREEGLEGKLDYLPKPLKASPYYTVWTRAKADADTPA
FT                   MMAAYDAELLRMKRDGRLKAIYDKYGIPYIEP"
FT   gene            268373..268717
FT                   /locus_tag="ASA_0250"
FT   CDS_pept        268373..268717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88441"
FT                   /db_xref="GOA:A4SHR9"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHR9"
FT                   /protein_id="ABO88441.1"
FT                   /translation="MANPEIESELDGIDRLSVCFYRLGLSLAALLLVCRGASLLIGQDF
FT                   LAPSVWLTALVVASGVCGLCLHVYDKRIRFILQVFAWGGLVLSVSGAPEVLVLGASLAT
FT                   LSGLASLDGG"
FT   gene            complement(268638..269060)
FT                   /locus_tag="ASA_0251"
FT   CDS_pept        complement(268638..269060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0251"
FT                   /product="CBS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88442"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHS0"
FT                   /protein_id="ABO88442.1"
FT                   /translation="MLHIRDHMGRLTHFLTPQLGLAEALDRLHQSGLSGLPVLDDQQQL
FT                   VGFLSEQDCIPSLITGSYHCDTRTQVEDMMSRTPLSVDPDDSILDLARQMTGAKPKIYP
FT                   VLEQGKVIGIISRHQVMQARRASPTTPPIPAPRALR"
FT   gene            269184..269906
FT                   /locus_tag="ASA_0252"
FT   CDS_pept        269184..269906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0252"
FT                   /product="short chain dehydrogenase/reductase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88443"
FT                   /db_xref="GOA:A4SHS1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHS1"
FT                   /protein_id="ABO88443.1"
FT                   /translation="MTKGEVMRSLVTGCGRRLGFYLCEQLVAAGWQVTGSYRSERPELA
FT                   RLRALGVTLVQVDFACEEQVGQLIEVLASQQDLALVIHNASAFEPEAADPAAQLAQFDQ
FT                   FYRVHMAAPFRLNRALAPQLARNANASIIHITDIYIHAPAPQFASYVATKAGAHSLAMS
FT                   FARELAPAIRVNTIEPGPILFLDEHGDAWRQQVLAKTPLAREGGLEPIWQAVQLLMGND
FT                   YMTGASIRVDGGRSLAVI"
FT   gene            complement(269832..270392)
FT                   /locus_tag="ASA_0253"
FT   CDS_pept        complement(269832..270392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0253"
FT                   /product="7,
FT                   8-dihydro-6-hydroxymethylpterin-pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88444"
FT                   /db_xref="GOA:A4SHS2"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHS2"
FT                   /protein_id="ABO88444.1"
FT                   /translation="MFYLCSIGSNLDPHIHVSQVVGELLEHFGRLQLSSVIQTKPVGMH
FT                   SRHDFLNCLFVAESGLTAQQLKTLFIAMELAHGRDRSDPNCKVLDRPLDIDILASSAAD
FT                   DFAATRVDAYLNELLAELYGQGEVHDRKVTLPLHTRLMKGKVIEELQVGLTPLRLSQGS
FT                   DDRQAAAAIYPDAGPRHVVVPHQ"
FT   gene            270715..272115
FT                   /locus_tag="ASA_0254"
FT   CDS_pept        270715..272115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0254"
FT                   /product="two-component system sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88445"
FT                   /db_xref="GOA:A4SHS3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHS3"
FT                   /protein_id="ABO88445.1"
FT                   /translation="MTKVRPRSLLQVVLMGFVLVLMPLGGMIWHDSQALEHLSQLTSDE
FT                   LERAVRDTRRATLLTTQAIDLERTLRRYAVLGDERILASYQQQLASYRSLLAAHQGSIP
FT                   DAEAYIGLEQVLAWLESLQDLAKARAASASPQFDEFNQINQQLEVITRGQVDEHVSRVR
FT                   AMIAELMREIWWVSGFVAVLSLLLVLLFTYLIIHPVRQIESRILSLGAGVEPDKRPVDG
FT                   PAELVVLGERINWLHDKLKELEQQKYQFLRHVSHELKTPLAVLREGSDLLGEQLVGPLT
FT                   PDQQEICQMLEENSRRLQTLIERLLDFNRLSQQEVFTLTPVALAPLLSELTAEYRLALE
FT                   SKQISVHLPTDPIMLQAEPYRLRLILDNLFSNAVSYGARGGQIWIRAGQDANGGWLEVA
FT                   NEGPVIPVAERERIFEPFEQGSIVRQGLLKGSGMGLSIARESAMSLGGELVLIEDEQAD
FT                   VCFRLTLK"
FT   gene            272124..272639
FT                   /locus_tag="ASA_0255"
FT   CDS_pept        272124..272639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0255"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88446"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHS4"
FT                   /protein_id="ABO88446.1"
FT                   /translation="MKQCVVPVLMMGLLTGCSLLPARDPAASPDLALAKRMEFANKEMQ
FT                   VRLQYSDWLLASHAQQRAQERQRLKGATDVESRVSLAMVNTHPSELVANRRAGLDKLKS
FT                   LLPELGLDAQAFLRSWIALGEELLVRDSRRDDQSQEVQRLRRQIEQLSAIDEQLNQRKL
FT                   NGSGEALP"
FT   gene            272636..273916
FT                   /locus_tag="ASA_0256"
FT   CDS_pept        272636..273916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0256"
FT                   /product="two-component system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88447"
FT                   /db_xref="GOA:A4SHS5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHS5"
FT                   /protein_id="ABO88447.1"
FT                   /translation="MSRILLVDDDVSLLKLMSMRLRSQGYEVDTADSAEGALDRLRQQR
FT                   ADLVLSDLRMAGMDGLALFERIQSQWLGLPVIIMTAHGTIPDAIQATRSGVFSFLTKPI
FT                   DKDELFATIEHALSLTRPKQQQEWQSLILTRNPQMEQLLIQANSIAGMEVPVLIMGPSG
FT                   SGKGVMTQALHQASSRRDKPLHVINCAALPWPALDLQLFGEDGQSGLFEQAKGATLFLD
FT                   EIGDLSESLQAKLLQVLQEYGQGTPEVRVISSSHQDLVTAMEEGRFREDLFYRLNVANI
FT                   TLPPLSARSEDIPLLARQALDEYRSRHSDCAALGFSPESLAMLAAAAWPGNVRQLYSVV
FT                   EQLASLCCSPVIGVSMVESALSGGGGGIPSFNEARAEFEKEYLIRLLRTTEGNVTLAAN
FT                   MAGRNRTDFYKLLNRHGIEAANFKSKG"
FT   gene            complement(273972..274454)
FT                   /locus_tag="ASA_0257"
FT   CDS_pept        complement(273972..274454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0257"
FT                   /product="Chloride channel protein EriC"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88448"
FT                   /db_xref="GOA:A4SHS6"
FT                   /db_xref="InterPro:IPR009476"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHS6"
FT                   /protein_id="ABO88448.1"
FT                   /translation="MSPLIAIAITTGILSAVWGWVAVTLGLISWVGFLGCTSYFASSGG
FT                   YKALLQTMLCNGSGMLWALLLIHGDAWWGAGMAGYVMTGVVATLMCVQAKQQWLGYIPG
FT                   TFAGCCATFGAAGEWRLILPSLVIGALFGYLMKASGLWLSQKTQKAQTSTAVVDPA"
FT   gene            274827..275831
FT                   /locus_tag="ASA_0258"
FT   CDS_pept        274827..275831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0258"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88449"
FT                   /db_xref="GOA:A4SHS7"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR022867"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHS7"
FT                   /protein_id="ABO88449.1"
FT                   /translation="MLIKRRSSHHPTEQDVTPEAVYQDRRLILKGLGLGAATLAFPAQA
FT                   GVLDLFSADKPAPAASTRPLNIRAAARPEGVIITPEEKATTHNNFYELGTDKGDPARNA
FT                   HYLKPEPWQLRVEGEVAKPFTLDVWDLINKTELEERIYRLRCVEAWSMVLPWSGISLAE
FT                   LIRRAEPTSRAKFVAFETLYDPEQLPGQASRSLGGGIDYPYVEGLRIDEAMNPLSFLAM
FT                   GLYGKTLPAQNGAPIRLVVPWKYGFKSIKSIVSIRLVEEMPPTTWNLLASNEYGFYANV
FT                   NPEVDHPRWSQASERFIGEGGIFGAKRQPTLMFNGYADEVASLYQGMDLRQWY"
FT   gene            275822..276454
FT                   /locus_tag="ASA_0259"
FT   CDS_pept        275822..276454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0259"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88450"
FT                   /db_xref="GOA:A4SHS8"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR022837"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHS8"
FT                   /protein_id="ABO88450.1"
FT                   /translation="MVLRLTAVHIKSLRVLVHLGSLGFLLWLGYALPAGLLGGDPVQGL
FT                   THYLGKGALNLLLITLLVSPLAKRWRQGQLIKLRRPLGLWCAAWAGLHFMVWLGLDLQF
FT                   DWRLIGGELVKRSYILVGAVALLLLAALSLTSIPALLRVMGPAWQKLHNWIYAVALLVP
FT                   VHYWWSVKSGWQEPLIYLLLACALLWPRREKLLRPWRQRQRQKLKEA"
FT   gene            complement(276502..276744)
FT                   /locus_tag="ASA_0260"
FT   CDS_pept        complement(276502..276744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0260"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88451"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHS9"
FT                   /protein_id="ABO88451.1"
FT                   /translation="MIPRSFLLILCLFSTLGWAAQARLDMPALVKLLLAQGYHDIREVE
FT                   LEGDKFEVETLDADEQRVQLLVDAYTGDITKKEAD"
FT   gene            276814..277146
FT                   /locus_tag="ASA_0261"
FT   CDS_pept        276814..277146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0261"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88452"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHT0"
FT                   /protein_id="ABO88452.1"
FT                   /translation="MNRALSLLGLLLPVMAQATTPNEALLQQAVSEGRVRPFHEVMEVA
FT                   SLLPVRVLRVDLGEEDGIWLYELKLIDSENSVIKVGYRADNLEMVWLKGHHLERLFEPR
FT                   PPQEED"
FT   gene            277253..277909
FT                   /locus_tag="ASA_0262"
FT   CDS_pept        277253..277909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0262"
FT                   /product="two-component system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88453"
FT                   /db_xref="GOA:A4SHT1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHT1"
FT                   /protein_id="ABO88453.1"
FT                   /translation="MRILIVEDEKTLAGQLAEQLRLSGFVTDLCHDGNEAGFLGETEPY
FT                   DAIILDLGLPGRDGLSVLKEWRSKGIDTPVLVLTARGQLHEKIEGLNAGADDYLTKPFQ
FT                   VAELVARVQALVRRAAGNASSILEIGGVRLDMAASQVWYEGTPIKLTAHEFRVLGYLMQ
FT                   HRGKVVSRSELIDHIYAQDFDRDSNTVEVFIGRIRKKTHADLIETVRGLGYRINE"
FT   gene            277947..279296
FT                   /locus_tag="ASA_0263"
FT   CDS_pept        277947..279296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0263"
FT                   /product="two-component system sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88454"
FT                   /db_xref="GOA:A4SHT2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHT2"
FT                   /protein_id="ABO88454.1"
FT                   /translation="MRLVRTLRGRLVVIALVWCGLFLFATGFSLQTMMRNYWQEAEADG
FT                   LRLQLYDLLSRLEIQPDGLPIVTEPMADPRFRQPYSGYYWLLELGDEVVSRSRSLWDVH
FT                   LKVQGLKSAFGDPDLFVGRGPNKEPLLIMTRTVLLPGSDRTFTLVMAKDSRALTQTLKK
FT                   TRISLFLGLGFAATGLVLGFMFQIVYGLRPLHLLRRELGRVHQGHQEGFRLRYPLEIQP
FT                   LVEDINRLLHHYSELLQRARSHTGNLAHALKTPLSIMRNQVAQLSPEDQAAIGEQLDQI
FT                   QRHIDYHLGKARVTGAAKILGVSTPVRARVEYICRAFSRLYPGKEVDLQVPANLAVGVE
FT                   EQDFDEMVGNLLENAYKWSAGQLRISSAELGGWITLRIEDDGPGMSEDQIAKAVLRGVR
FT                   FDEKVPGSGLGLNIVSDLAEAYRGNLIMGRAELGGLAASLSLPKVARVES"
FT   gene            279428..279889
FT                   /locus_tag="ASA_0264"
FT   CDS_pept        279428..279889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0264"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88455"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHT3"
FT                   /protein_id="ABO88455.1"
FT                   /translation="MTDDPWALCHLDDSFDSSVLGIKGAQLQWFEDRDSLIAFLLEDFI
FT                   DLLADAGELDEDEVASARERFTLLVEQIRDDRGLMDALNDLASGLRRIAWLGPLSELAE
FT                   VSDDFAAGLRRYFWTQYDGDEDDPDAWVPEELWPQLVECAEEYMQEGDF"
FT   gene            complement(279967..282447)
FT                   /locus_tag="ASA_0265"
FT   CDS_pept        complement(279967..282447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0265"
FT                   /product="trimethylamine-N-oxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88456"
FT                   /db_xref="GOA:A4SHT4"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006658"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR041460"
FT                   /db_xref="InterPro:IPR041954"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHT4"
FT                   /protein_id="ABO88456.1"
FT                   /translation="MTFFTDKNTNLSRRNLLKGLGACAALPLLAGIFPKSARAKAISTA
FT                   LEQFPTLVPAQKGILTGAHWGAFEAIVEDGRMVRVQPVADDPAPNDLIDMAPYQVHAKN
FT                   RIKYPMVRKSWLEHGPGARPELRGADEWVRVSWDKAIELVAGEIGRVQSDFGPQAIHAG
FT                   SYGWKSVGMFHNSRTLLHRLMNLAGGFTGYAGDYSAGAAQVIMSHVMGSIEVYEQQTAW
FT                   PNVIEHAELVVLWGVNAQVTLKNSWNMPDHEGQAGFQALKEKGTRIISIDPVYNETAKL
FT                   AGAEWIAPNAYTDVAMMLGVAHTLYTEQKHDQAFLDRYTSGFDKFLSYLLGKDDGQPKS
FT                   AEWASTVCGVDAAVIRQLALDMASKRTMIMAGWGMQRQHHGEQPNWMLVTLAAMLGQIG
FT                   LPGGGYGFSYHYSSGGSPTTKGGILAGISAGNAPKNSPAPIPVARIADCLANPGKTIDF
FT                   NGRQLSYPDIKLVYVAGGNPFHHHQDTNNLLKAWRKPQTVIVHEPYWTATAKHADIVLP
FT                   ATTSYERNDLEMGGDYSQRYVFPMHQCVPPQHESRNDFDIFSAIATKLGLLEAYTEGKD
FT                   EMLWLKQMYDGMAAQARGARVALPPFNMFWESNNYIRFPIPEANRQWIRHADFRENPLL
FT                   NPLGTPSGKIEIFSNTIAGMGYADCAGHPKWYEPKEWVKSETASRYPLSLNTSHPTQRL
FT                   HSQLDNTPLRDKFAIADREAILIHPDDAKARGIQDGDLVRAFNDRGQILVGALVSKDIR
FT                   PGVVRICEGAWFDPAKPGEAGAICKNGNVNCLTFDEGTSSLAQGNCGHMAQLQIEKYRG
FT                   PALANTAHAVPANG"
FT   gene            complement(282470..283600)
FT                   /locus_tag="ASA_0266"
FT   CDS_pept        complement(282470..283600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0266"
FT                   /product="DMSO/TMAO pentaheme cytochrome c subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88457"
FT                   /db_xref="GOA:A4SHT5"
FT                   /db_xref="InterPro:IPR005126"
FT                   /db_xref="InterPro:IPR009154"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="InterPro:IPR038266"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHT5"
FT                   /protein_id="ABO88457.1"
FT                   /translation="MLGKLLRKTWFWLLLLGALLGVAALGVTMTVMHKTSSTEFCVSCH
FT                   SMQTPLAEYQGSVHFQNVKGIRAECADCHIPNEPSAYLWTKIRAVKDIYHEAIGTLDTP
FT                   EKYESHKLRMAQTVWDQLKANDSATCRSCHSYAAMDILAQRPNARADHPVAIKEGQTCI
FT                   DCHRGVAHIMPDMSELAAAGASELAQAAAQTPANVTTRYAIATAPLFLDAAAKTDEGTL
FT                   MPSTKVEVLANENGRAQVQIEGWQQDGVSEVFYAAPGKRILSVLVGDAAKKSLVTGQSE
FT                   TDSATNLTWHQVKLTAWVDKTQLIGDQGKLWQYASTLMSNNCTGCHGLTALDHFNANQW
FT                   IGVIKGMESRTSLTPEQARMLTQYVQKHASDMSAAH"
FT   gene            283967..285937
FT                   /gene="topB"
FT                   /locus_tag="ASA_0267"
FT   CDS_pept        283967..285937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topB"
FT                   /locus_tag="ASA_0267"
FT                   /product="DNA topoisomerase III"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88458"
FT                   /db_xref="GOA:A4SHT6"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHT6"
FT                   /protein_id="ABO88458.1"
FT                   /translation="MRLFIAEKPSLGRAIADVLPKPHKKGDGFIETAAGDVVTWCIGHL
FT                   LEQAEPDAYDAAFKQWRMEQLPIIPAQWQLVAKPKTKTQLTVIKRLIKLADCVVNAGDP
FT                   DREGQLLVDEVIDFLGYPKTRPVQRCLISDLNPPAVRRALDKLRDNKEFVPLAVSALAR
FT                   SRADWLYGINMTRAYTLLGRKGGCSELLSVGRVQTPLLGLVVRRDLEIEAFVPKPFYEV
FT                   LAHLVTDGNERFSAKWLPSEACLPWQDEEGRVLNRALAEKVVSRINGQPASVEEVEEQA
FT                   RKQAAPLPYNLSSLQIDAAKRFGMDAKRVLDVCQGLYERHKLITYPRSDSRHLPSEHFN
FT                   RAAQVREAIAATAPALARAVSEADGKIRSKAWNDSKVDAHHAIIPTEKRGNESSLSGDE
FT                   AKIYGLVARQYLLQFYPPFEYNDSKVLLRIAGGLFQAKARRILKAGWKALLGVEEDDDE
FT                   EKAGTLPALKEGEQLLCERGELLEKMTQAPKSFTDATLLAAMTGIARYVQDPEIRKTLR
FT                   ETDGLGTEATRAGIIDLLFRRRFLVRQGKSIKGTPTGRALILALPTTATTPDMTALWEQ
FT                   SLGQIAERHASYQQFMGPLTDQLNALIEGARQDSGASFSALPKAVPGAGKPHFTRRKSS
FT                   AGTTGTPRKSAGKRPAKSKAT"
FT   gene            complement(286018..287373)
FT                   /gene="ktrB"
FT                   /locus_tag="ASA_0268"
FT   CDS_pept        complement(286018..287373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ktrB"
FT                   /locus_tag="ASA_0268"
FT                   /product="potassium uptake protein KtrB"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88459"
FT                   /db_xref="GOA:A4SHT7"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHT7"
FT                   /protein_id="ABO88459.1"
FT                   /translation="MINWRSSYAFALHRDDNSRWSEAKLILGSFLVILLIGTIFLVQPS
FT                   SHNGEVTFVNALFTATSAISVTGLGVVDTGTAFTLQGQVFLLILMEIGGLGQMTMTLLL
FT                   IAMFSKRVGLRQQVLAKEALGQEGSVNIVGLVRRIVLFAFIAQLIGTAVMAIRWVPDMG
FT                   WEHGLYVSFFHAVSAFNNAGFSLFSNNLMNYRDDPIISLTIAGLLVLGGIGFTVVVDLV
FT                   RNRRWRKLKLHSKLMLVMTPALLLLGTLMFWLLERNNPGTLGATSFGGQWLAAFFHSAS
FT                   ARTAGFNTIDIGLMTPAALLFLMMLMFIGAGTTSTGGGIKVTTFAVVLLATRAFLSKRP
FT                   HVTAFGRTLSPQIVTRSLAIIMVSTMVLMLAMFLLMVTEDLPFDKIMFETVSAFATVGL
FT                   STGITASLSEPGKLILVLVMICGRLGPLTLAFMLARPSETRIKYPEESVYTG"
FT   gene            complement(287370..288023)
FT                   /gene="ktrA"
FT                   /locus_tag="ASA_0269"
FT   CDS_pept        complement(287370..288023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ktrA"
FT                   /locus_tag="ASA_0269"
FT                   /product="potassium uptake protein KtrA"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88460"
FT                   /db_xref="GOA:A4SHT8"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHT8"
FT                   /protein_id="ABO88460.1"
FT                   /translation="MNNQFAVIGLGLFGSALCEELQRQDAEVLAIDIDESKTRQIATLC
FT                   SHVVVADATDEATVAELGLANFDIVFVAIGDNLETSILTTLVLKEAGVKKVWVKARDKF
FT                   HAKILHKVGADKVINPEWDMGRRVAQSMLDNRLFDYLELGHDMVLTEVVIGLQQNARNL
FT                   GDLHLLQQNDFQLLAIKRGDVLHNVLTGKMELQLGDILIMAGNKHAIDHWLETL"
FT   gene            288151..289188
FT                   /gene="murB"
FT                   /locus_tag="ASA_0270"
FT   CDS_pept        288151..289188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="ASA_0270"
FT                   /product="UDP-N-acetylpyruvoylglucosamine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88461"
FT                   /db_xref="GOA:A4SHT9"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHT9"
FT                   /protein_id="ABO88461.1"
FT                   /translation="MKLTPHASLLTLNTLALDAHCLWLAEVDNLDDLPQILASPELAEL
FT                   PRLVLGGGSNILFCNDFAGLVVLNRLKGIALQDEGEHWLLHVAAGEDWHQLVCHALQQG
FT                   WYGLENLALIPGTVGAAPVQNIGAYGVELARFCAYVEAFNWQRGQLERIKAADCHFGYR
FT                   DSIFKHACQDSHFITAVGLRLPKAWTPMLGYGPLAALGDSPTAQAIFDTVCATRMAKLP
FT                   DPNLLGNAGSFFKNPVVTTTLADTLKQQYPQMPCYPAGEGQAKLAAGWLIDQCGLKGFA
FT                   IGRAAVHQEQALVLVNLGGASAMELIALAAHVRDSVEQKFGVVLEHEVRFMGLTGETWL
FT                   DEVLA"
FT   gene            289185..290150
FT                   /gene="birA"
FT                   /locus_tag="ASA_0271"
FT   CDS_pept        289185..290150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="birA"
FT                   /locus_tag="ASA_0271"
FT                   /product="biotin-(acetyl-CoA-carboxylase) ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88462"
FT                   /db_xref="GOA:A4SHU0"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHU0"
FT                   /protein_id="ABO88462.1"
FT                   /translation="MTLTPIRQTLITLLSDGQFHSGEQLGEQLGISRAAVGKHMAALKE
FT                   LGLDLFSLTGKGYRLAVPMALYDQTQLQALAPMAPVHCFPVIDSTNQYLLERVNQLQSG
FT                   ESCLAECQTAGRGRRGKPWVSPFGCQLILSMYWRLEQGMAAAMGLSLAVGVAVVQALES
FT                   LGYPGVELKWPNDLYYQGRKLAGILVEMSGSAGASCNLVIGVGLNLAMPAREGERIDQA
FT                   WSELRHIQPELVDRNLLAARMLGHLQQAMLTFEQQGLSHFVDDWNRLDHFAGRPVRLLM
FT                   GEQEIRGIARGIDDRGALRLETSEGIKFYLGGEISLRRGD"
FT   gene            complement(290231..291169)
FT                   /gene="coaA"
FT                   /locus_tag="ASA_0272"
FT   CDS_pept        complement(290231..291169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaA"
FT                   /locus_tag="ASA_0272"
FT                   /product="pantothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88463"
FT                   /db_xref="GOA:A4SHU1"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHU1"
FT                   /protein_id="ABO88463.1"
FT                   /translation="MTTEHNPYLQFTREQWALLRDAVPLTLTEHDLQTLRGINEKVSLQ
FT                   EVEEIYLPLSRLLNLYVKAKQRRSRVLEQFLGQSRGKGTYIISIAGSVAGGKSTTARIM
FT                   QALLERWPEHPRVELVTTDGFLYPNKVLEERGLMRRKGFPESYDIRHLVEFVANIRAGH
FT                   EKVEAPVYSHLIYDIIPDEKKVVEQPDILILEGLNVLQSGMDYPQEPHRVFVSDFVDFS
FT                   IYVDAETELLRTWYVERFLKFRSGAFSDPDSYFHHYAKLAESEASKIANTIWQDINYLN
FT                   LQENILPTRERANLILTKGHEHAIEQIKLRK"
FT   gene            291431..291515
FT                   /gene="trnY"
FT                   /locus_tag="ASA_0273"
FT   tRNA            291431..291515
FT                   /gene="trnY"
FT                   /locus_tag="ASA_0273"
FT                   /product="tRNA-Tyr"
FT   gene            291554..291628
FT                   /gene="trnG"
FT                   /locus_tag="ASA_0274"
FT   tRNA            291554..291628
FT                   /gene="trnG"
FT                   /locus_tag="ASA_0274"
FT                   /product="tRNA-Gly"
FT   gene            291803..292987
FT                   /gene="tufB"
FT                   /locus_tag="ASA_0275"
FT   CDS_pept        291803..292987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tufB"
FT                   /locus_tag="ASA_0275"
FT                   /product="elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88464"
FT                   /db_xref="GOA:A4SHU2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SHU2"
FT                   /protein_id="ABO88464.1"
FT                   /translation="MSKEKFERNKPHVNVGTIGHVDHGKTTLTAAITNVLAKHFGGKAF
FT                   AFDQIDKAPEERERGITINTSHVEYDTAIRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLGRQVGIPYMIVFMNKCDMVDDEELLELVEMEVRELLTEYDF
FT                   PGDDLPVVRGSALKALEGDAAWEEKIIELANHLDTYIPEPERAIDLPFLMPIEDVFSIA
FT                   GRGTVVTGRVERGIVKVGETVEIVGIKDTVSTTCTGVEMFRKLLDEGRAGENIGALLRG
FT                   VKREDVERGQVLAKPGSIKPHTKFESEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   TIELPEGVEMVMPGDNIKMVVTLIAPIAMDDGLRFAIREGGRTVGAGVVASVIA"
FT   gene            293041..293117
FT                   /gene="trnX"
FT                   /locus_tag="ASA_0276"
FT   tRNA            293041..293117
FT                   /gene="trnX"
FT                   /locus_tag="ASA_0276"
FT                   /product="tRNA-OTHER"
FT                   /note="tRNA-Sup"
FT   gene            293178..293549
FT                   /gene="secE"
FT                   /locus_tag="ASA_0277"
FT   CDS_pept        293178..293549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="ASA_0277"
FT                   /product="preprotein translocase subunit SecE"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88465"
FT                   /db_xref="GOA:A4SHU3"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHU3"
FT                   /protein_id="ABO88465.1"
FT                   /translation="MSVSSESQGGSKDTLLWGLVFIILAAAVVGNYLLNDVVAAVRALG
FT                   VVVVIAAAGAVALQTTKGKATLAFARESRLEVRKVVWPTRQEAIQTTLIVLAVTAVMGL
FT                   LLFMLDGALVWLVNLITGV"
FT   gene            293559..294110
FT                   /gene="nusG"
FT                   /locus_tag="ASA_0278"
FT   CDS_pept        293559..294110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="ASA_0278"
FT                   /product="transcription termination/antitermination factor
FT                   NusG"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88466"
FT                   /db_xref="GOA:A4SHU4"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHU4"
FT                   /protein_id="ABO88466.1"
FT                   /translation="MTEQREQRMRWYVVQAFSGYEGRVAKSLREHIKMHGMEDMFGEVL
FT                   VPTEEVVEMRAGQKRKSERKFFPGYVLVQMLMDETTWHLVRNVPRVMGFIGGTSDRPAP
FT                   ISDKEADAILNRLQDAHDKPRPKTLFEPGEMVRVADGPFADFNGTVEEVDYEKSRVKVS
FT                   VLIFGRSTPVELDFGQVEKG"
FT   gene            294244..294672
FT                   /gene="rplK"
FT                   /locus_tag="ASA_0279"
FT   CDS_pept        294244..294672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="ASA_0279"
FT                   /product="ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88467"
FT                   /db_xref="GOA:A4SHU5"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SHU5"
FT                   /protein_id="ABO88467.1"
FT                   /translation="MAKKVTAYIKLQVKAGSANPSPPVGPALGQHGVNIMEFCKAFNAR
FT                   TEKLEKGSPTPVVITVYSDRSFTFETKTPPAAFLLKKAAGIQSGSAKPNKDKVGKVTVA
FT                   QLQEIAKTKEPDMTGADLDAKVRCIAGSARSMGLVVED"
FT   gene            294677..295378
FT                   /gene="rplA"
FT                   /locus_tag="ASA_0280"
FT   CDS_pept        294677..295378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="ASA_0280"
FT                   /product="ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88468"
FT                   /db_xref="GOA:A4SHU6"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SHU6"
FT                   /protein_id="ABO88468.1"
FT                   /translation="MAKLSKRMRVIREKVDGTKEYSINEAIALLKELATAKFVESVDVA
FT                   VNLGIDARKSDQNVRGATVLPHGTGRDVRVAVFTQGANAEAAKAAGAELVGMDDLADLV
FT                   KKGEMNFDVVIASPDAMRVVGQLGQILGPRGLMPNPKVGTVTPNVAEAVKNAKAGQVRY
FT                   RNDKNGIIHTTLGKVSFDEVQLKENLESLLVALKKAKPSSAKGIFIKKVSISTTMGAGV
FT                   AVDQASLEAQG"
FT   gene            295635..296135
FT                   /gene="rplJ"
FT                   /locus_tag="ASA_0281"
FT   CDS_pept        295635..296135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="ASA_0281"
FT                   /product="ribosomal subunit protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88469"
FT                   /db_xref="GOA:A4SHU7"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SHU7"
FT                   /protein_id="ABO88469.1"
FT                   /translation="MALGLEDKKAIVAEVNEAAKGALSAVVADSRGVTVDKMTVLRKTA
FT                   REAGVYMRVVRNTLLRRAVEGTEFACLNDVLTGPTLIAFSNEHPGAAARLFKEFAKANQ
FT                   KFEIKAGAFNGEFIAAAQIDRLATLPTYDEAIAKLMATMKEASAGKLVRTIAAVRDQKQ
FT                   AAA"
FT   gene            296187..296549
FT                   /gene="rplL"
FT                   /locus_tag="ASA_0282"
FT   CDS_pept        296187..296549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="ASA_0282"
FT                   /product="ribosomal protein L12"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88470"
FT                   /db_xref="GOA:A4SHU8"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SHU8"
FT                   /protein_id="ABO88470.1"
FT                   /translation="MSITKDQIIEAVASMSVMEVVELIEAMEEKFGVSAAVAVAAGPAA
FT                   EAVEEKTEFDVVLTAAGANKVAVIKAVRAATGLGLKEAKDLVEAAPANLKEAISKDEAE
FT                   TLKKQLEEAGASVEIK"
FT   gene            296661..300800
FT                   /gene="rpoB"
FT                   /locus_tag="ASA_0283"
FT   CDS_pept        296661..300800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="ASA_0283"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88471"
FT                   /db_xref="GOA:A4SHU9"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SHU9"
FT                   /protein_id="ABO88471.1"
FT                   /translation="MHQQSGPYHRPGQHKTVLRQSCPAGQSGSLISELRNPMVYSYTEK
FT                   KRIRKDFGKRDQVLDTPYLLSIQLDSFKQFIEADPEGEYGLEAAFRSVFPITSYSGSAE
FT                   LQYVSYRLGEPVFDVKECQIRGVTYSAPLRVKLRMVLYDREAAAGTVKDIKEQEVYMGE
FT                   IPLMTENGTFVINGTERVIVSQLHRSPGVFFDHDKGKTHSSGKVLYNARVIPYRGSWLD
FT                   FEFDAKDNLFVRIDRRRKLPASIILRALDFSSEEILANFFETIGFEVKDGKLMMDLVPE
FT                   RLRGETATFDIVANGAVVVETGRRVTARHIRQLEKDAVTQIEVPVEYVVGKVAAKNYTH
FT                   PQTGEMVVTANQALSLEAVANLSQAGFKHFEVLFTNELDHGAYMSETLRIDSSSSRLEA
FT                   LVEIYRMMRPGEPPTREAAEQLFENLFFSSERYDLSTVGRMKFNRRLSREDETGAGTLT
FT                   KDDIVEVMKRLIDIRNGNDEVDDIDHLGNRRIRSVGEMAENQFRVGLVRVERAVKERLS
FT                   LGDLDTLMPQDLINAKPISAAVKEFFGSSQLSQFMDQNNPLSEVTHKRRISALGPGGLT
FT                   RERAGFEVRDVHPTHYGRLCPIETPEGPNIGLINSLSVYSRTNEYGFLETPYRKVIDGV
FT                   ITDEVDYLSAIEEGKYVIAQANAATTEDGRLKDELIPCRHKGESTFMNADQIQYMDVSP
FT                   QQIVSVAAALIPFLEHDDANRALMGSNMQRQAVPTLRADKPLVGTGMERAVAVDSGVTV
FT                   VAKRGGMIDYVDASRIVIKVNEDELLPGEAGIDIYSLTKYTRSNQNTCINQRPCVMLGE
FT                   PVMAGDVVADGPSTDLGELALGQNLRVAFMPWNGYNFEDSILVNERVVQEDRLTTIHIQ
FT                   ELACISRDTKLGPEEITADIPNVGEAALSKLDESGIVYVGAEVKGGDILVGKVTPKGET
FT                   QLTPEEKLLRAIFGEKASDVKDSSLRVPNGVYGTVVDVQVFTRDGVEKDKRAKEIEEMQ
FT                   LKEAKKDLTEEFKILEDGIFGRSRNLLLAAGYSEDRLNKLDRTKWFELAIEDEAKQIEL
FT                   EQIAEQHIELKADFDKKFENKRRKIIQGDDLAPGVLKIVKVYLAVKRRIQPGDKMAGRH
FT                   GNKGVISKICPVEDMPHDEYGRPVDIVLNPLGVPSRMNIGQILEVHLGLAAKGIGEKID
FT                   RMIKEQRALHEMRDFLQQVYDLGEKDTKQVDIAELSDDDVRTLVGNLRKGLPVATPVFD
FT                   GAKEHEIKALLKLADLPESGQISLFDGRTGNVFERKVTVGYMYMLKLNHLVDDKMHARS
FT                   TGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMYK
FT                   NIVDGDHRMEPGMPESFNVLLKEIRSLGINIELDEE"
FT   gene            300892..305196
FT                   /gene="rpoC"
FT                   /locus_tag="ASA_0284"
FT   CDS_pept        300892..305196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="ASA_0284"
FT                   /product="DNA-directed RNA polymerase, beta prime subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88472"
FT                   /db_xref="GOA:A4SHV0"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SHV0"
FT                   /protein_id="ABO88472.1"
FT                   /translation="MKDLLKFLKAQTKTEEFDSIKIGLASPDMIRSWSFGEVKKPETIN
FT                   YRTFKPERDGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGH
FT                   IELASPTAHIWFLKSLPSRIGLLLDMTLRDIERVLYFESYVVIEPGMTNLERSQMLSEE
FT                   NYLDALEEWGDEFDAKMGAEAILALLRAIDLEGEVKTMREELDQTNSETKRKKTTKRLK
FT                   LMEAFLQSGNKPEWMIMTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLDLAAPDIIVRNEKRMLQESVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQ
FT                   NLLGKRVDYSGRSVITVGPTLRLHQCGLPKKMALELFKPFIYGKLESRGLATTIKAAKK
FT                   MVEREEAVVWDILDEVIREHPVLLNRAPTLHRLGIQAFEPTLIEGKAIQLHPLVCAAYN
FT                   ADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPASGEPIIVPSQDVVLGLYYMTRAR
FT                   INAKGEGMVLAGPKEAEKVYRAGLADLHARVKVRITEYLRQADDSLVERTELKNTTVGR
FT                   AILSLILPKGMEYALIDEPKVLTAAEQADLDANPQNWIKSVSNKALGKKLISRLLNTCY
FT                   RKQGLKDTVIFADQLMYTGFHYAALSGASVGIDDMVIPDAKKDIIAAAEAEVAEIQDQF
FT                   LSGLVTAGERYNKVIDIWASANERVSKAMMENLSKERDVNSLGEEEEQASFNSIFMMAD
FT                   SGARGSAAQIRQLAGMRGLMAKPDGSIIETPIVANFREGLNVLQYFISTHGARKGLADT
FT                   ALKTANSGYLTRRLVDVAQDMVITEDDCGTVEGLWMTPLIEGGDVVEPLRERVLGRVVA
FT                   DDVIKPGTEDEILVARNTLLDEQLCDLLERNSVDRVKVRSAITCETDFGNCAHCYGRDL
FT                   ARGHLVNKGEAVGVIAAQSIGEPGTQLTMRTFHIGGAASRAAAESSIQVKNTGSIKLQN
FT                   AKFVHNSDDKLVITSRSTELTIMDDMGRTKESHKLPYGSVLEVKDGQAVSAGDTVANWD
FT                   PHTHPIITEVAGRLQFEHMIDGVTITRQTDELTGLSSIVVLDVNERPSAGKEMRPTVKL
FT                   VDQNGKDVMIPGTDVAAQYFLPGKAIVNLEDGANVGVGDAVARIPQESSGTKDITGGLP
FT                   RVADLFEARQPKEPAILAEISGTISFGKETKGKRRLVITPTDGGDVYEEMIPKWRNLNV
FT                   FEGEKVEKGEVLADGPESAHDILRLRGISPVANYIANEVQDVYRLQGVKINDKHIEVIV
FT                   RQMLRKCEILSAGDTDLIEGEQVEVARVKIANRKLVAEGKTPATFRHILMGITKASLST
FT                   ESFISAASFQETTRVLTEAAVGGKRDELRGLKENVIVGRLIPAGTGFAYHHARINQRAA
FT                   AARAVGVPQVTADEAQQNLADLLNASGSFDEE"
FT   gene            305393..306109
FT                   /locus_tag="ASA_0285"
FT   CDS_pept        305393..306109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0285"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88473"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHV1"
FT                   /protein_id="ABO88473.1"
FT                   /translation="MTVGIEEVMLPEEQLIGRTFTDEDRELLRSYGGLIEGLAELFGKH
FT                   CEVVLHSLENLHESVIKIANGFNTGRNEGAPITDLALRMLKDIENTGQDYTQSYFARSR
FT                   TGALMKSSTIAIRNSDKQVIGLICINLHINAPFHEFVAEFFPTPQQVERQSPETFANSV
FT                   EELVAQTVDNTIDEINRDPTVANNAKNRFIVTQLFEKGIFDIKDSINLVADKLNISKHT
FT                   VYLYIRQRKQGEDENE"
FT   gene            306135..306515
FT                   /locus_tag="ASA_0286"
FT   CDS_pept        306135..306515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0286"
FT                   /product="putative translation initiation inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88474"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHV2"
FT                   /protein_id="ABO88474.1"
FT                   /translation="MAKEVIATDKAPAAIGPYVQATKLGELVFTSGQIPLDPATMEIVA
FT                   GGVEAQAEQVMKNLVAVLKAAGADTSKVLKTTCFLSDMNNFVAFNQVYARYFGDSAPAR
FT                   SCVEVARLPKDVLVEVEAIAYV"
FT   gene            306602..306994
FT                   /gene="dsrE"
FT                   /locus_tag="ASA_0287"
FT   CDS_pept        306602..306994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsrE"
FT                   /locus_tag="ASA_0287"
FT                   /product="intracellular sulfur oxidation protein DsrE"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88475"
FT                   /db_xref="GOA:A4SHV3"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR017463"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHV3"
FT                   /protein_id="ABO88475.1"
FT                   /translation="MSLSFALLVTGPAYGTQSASTAYRFALSLIEQGHRLSHLFFYQDG
FT                   VCNGNELHAPASDESNLVALWRELAIGQGIRIDVCVAAAMRRGVLDETEAKGAGKVQFN
FT                   LQAPFCLSGLGQLAEASLTADRFVQF"
FT   gene            307004..307360
FT                   /gene="dsrF"
FT                   /locus_tag="ASA_0288"
FT   CDS_pept        307004..307360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsrF"
FT                   /locus_tag="ASA_0288"
FT                   /product="intracellular sulfur oxidation protein DsrF"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88476"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR017462"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHV4"
FT                   /protein_id="ABO88476.1"
FT                   /translation="MNKIAFICRRGPHGTAAGREGLDALLATSALTESLAMFLIGDGVL
FT                   QLVREQQPQAILQRHYAPTFKLLELYDIEEVYVCADSLAERGLTMDDLLIPAESLSRAD
FT                   ICRQWGQCATHICF"
FT   gene            307368..307658
FT                   /gene="dsrH"
FT                   /locus_tag="ASA_0289"
FT   CDS_pept        307368..307658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsrH"
FT                   /locus_tag="ASA_0289"
FT                   /product="intracellular sulfur oxidation protein DsrH"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88477"
FT                   /db_xref="GOA:A4SHV5"
FT                   /db_xref="InterPro:IPR007215"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHV5"
FT                   /protein_id="ABO88477.1"
FT                   /translation="MIQLILTSPFLSQDLEQALCYRQPDDLLVLMQDAVIAATAPQWCE
FT                   RLADIPLYVMREDLQARGLQQRIGMDLDLDLDMAGLVALIAEKGSPQTWGG"
FT   gene            307755..308216
FT                   /gene="rpsL"
FT                   /locus_tag="ASA_0290"
FT   CDS_pept        307755..308216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="ASA_0290"
FT                   /product="ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88478"
FT                   /db_xref="GOA:A4SHV6"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SHV6"
FT                   /protein_id="ABO88478.1"
FT                   /translation="MTTGHKISRPRICGEDFSHVYEVIIRSLLMATINQLVRKPRIKLV
FT                   VKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVTSYIGGEGHNLQ
FT                   EHSVVLIRGGRVKDLPGVRYHTVRGALDCAGVKDRKQARSKYGVKRPKA"
FT   gene            308310..308780
FT                   /gene="rpsG"
FT                   /locus_tag="ASA_0291"
FT   CDS_pept        308310..308780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="ASA_0291"
FT                   /product="ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88479"
FT                   /db_xref="GOA:A4SHV7"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SHV7"
FT                   /protein_id="ABO88479.1"
FT                   /translation="MPRRRVVGQRKILPDPKFGSELLAKFVNVVMVDGKKSVSEAIVYG
FT                   ALDIIATKSGKDHLAVFEEALDNIRPAVEVKSRRVGGATYQVPVEVRPVRRNALAMRWL
FT                   VDAARKRGEKSMAQRLAGELLDAADNKGSSVKKREDVHRMAEANKAFAHFRW"
FT   gene            308849..310960
FT                   /gene="fusA"
FT                   /locus_tag="ASA_0292"
FT   CDS_pept        308849..310960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="ASA_0292"
FT                   /product="translation elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88480"
FT                   /db_xref="GOA:A4SHV8"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SHV8"
FT                   /protein_id="ABO88480.1"
FT                   /translation="MTMARTTPIERYRNIGISAHIDAGKTTTTERVLFYTGVSHKIGEV
FT                   HDGAATMDWMEQEQERGITITSAATTAFWSGMGKQFQPHRINIIDTPGHVDFTIEVERS
FT                   MRVLDGAVMVYCAVGGVQPQSETVWRQANKYKVPRIAFVNKMDRTGANYLRCVEHIKTR
FT                   LKGTPVPLQLNIGSEENFKGVIDLVKMKAINWSEADQGVSFDYEEIPAELLEQAQEMRM
FT                   SLVEAAAEASEDLMEKYLGGEELTEEEIKKALRLRVLNNEIILVTCGSAFKNKGVQAML
FT                   DAVVDYLPAPTDVAAIDGLKLDGVTKDERHASDDEPFAALAFKIATDPFVGNLTFFRVY
FT                   SGVVNSGDSVLNSVKEKRERFGRIVQMHANKREEIKEVRAGDIAAAIGLKDVTTGDTLC
FT                   DEKSPIILERMEFPEPVISIAVEPKTKADQEKMGLALGRLAQEDPSFRVWTDEESGQTI
FT                   IAGMGELHLDIIVDRMRREFKVEANVGKPQVAYRETIRETVKDVEGKHAKQSGGRGQYG
FT                   HVVIDMYPLEAGKAYEFVNDIKGGVIPGEYIPGVDKGIREQLKSGPLAGYPVMDLGVRL
FT                   HFGSYHDVDSSELAFKIAASMAFKSGYMKANPVLLEPIMKVEVETPEDYMGDVIGDLNR
FT                   RRGLIEGMEDGPSGKIVRALVPLAEMFGYATALRSATQGRASYAMEFAKYSDAPNNVAQ
FT                   AVIEERKSK"
FT   gene            311015..312199
FT                   /gene="tufA"
FT                   /locus_tag="ASA_0293"
FT   CDS_pept        311015..312199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tufA"
FT                   /locus_tag="ASA_0293"
FT                   /product="translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88481"
FT                   /db_xref="GOA:A4SHU2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SHU2"
FT                   /protein_id="ABO88481.1"
FT                   /translation="MSKEKFERNKPHVNVGTIGHVDHGKTTLTAAITNVLAKHFGGKAF
FT                   AFDQIDKAPEERERGITINTSHVEYDTAIRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLGRQVGIPYMIVFMNKCDMVDDEELLELVEMEVRELLTEYDF
FT                   PGDDLPVVRGSALKALEGDAAWEEKIIELANHLDTYIPEPERAIDLPFLMPIEDVFSIA
FT                   GRGTVVTGRVERGIVKVGETVEIVGIKDTVSTTCTGVEMFRKLLDEGRAGENIGALLRG
FT                   VKREDVERGQVLAKPGSIKPHTKFESEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   TIELPEGVEMVMPGDNIKMVVTLIAPIAMDDGLRFAIREGGRTVGAGVVASVIA"
FT   gene            312311..312853
FT                   /gene="gmhB"
FT                   /locus_tag="ASA_0294"
FT   CDS_pept        312311..312853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmhB"
FT                   /locus_tag="ASA_0294"
FT                   /product="D,D-heptose 1,7-bisphosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88482"
FT                   /db_xref="GOA:A4SHW0"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHW0"
FT                   /protein_id="ABO88482.1"
FT                   /translation="MSKPAIFLDRDGVINEDTGYVSQVDDFHFLPGVIEALQLLKKKGY
FT                   LLIVVTNQSGIARGYFSEDHFMNLTEWMDWSLADRDVDLDGIYFCPHHPDHGAPCDCRK
FT                   PEPGMLLLAQQELGIDMSRSYMVGDKPSDLKAAASAKVGHKVMVRTGKPVTDAGIALAD
FT                   AIYDNLHDFAVSLPVTG"
FT   gene            313296..314832
FT                   /gene="rrsB"
FT                   /locus_tag="ASA_0295"
FT   rRNA            313296..314832
FT                   /gene="rrsB"
FT                   /locus_tag="ASA_0295"
FT                   /product="16S ribosomal RNA"
FT   gene            315033..315108
FT                   /gene="trnE"
FT                   /locus_tag="ASA_0296"
FT   tRNA            315033..315108
FT                   /gene="trnE"
FT                   /locus_tag="ASA_0296"
FT                   /product="tRNA-Glu"
FT   gene            315346..318235
FT                   /gene="rrlB"
FT                   /locus_tag="ASA_0297"
FT   rRNA            315346..318235
FT                   /gene="rrlB"
FT                   /locus_tag="ASA_0297"
FT                   /product="23S ribosomal RNA"
FT   gene            318361..318478
FT                   /gene="rrfB"
FT                   /locus_tag="ASA_0298"
FT   rRNA            318361..318478
FT                   /gene="rrfB"
FT                   /locus_tag="ASA_0298"
FT                   /product="5S ribosomal RNA"
FT   gene            318837..319154
FT                   /locus_tag="ASA_0299"
FT   CDS_pept        318837..319154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0299"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88483"
FT                   /db_xref="InterPro:IPR007458"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SHW1"
FT                   /protein_id="ABO88483.1"
FT                   /translation="MEQVNKSTFSDVLEYVRMSRRQNKLKREIADNEKKIRDNQKRVLL
FT                   LDNLSDYIKPGMSIDEVQAIIANMRTDYEERVDDHIIKNAELSKERKDLSAKLKAMSSS
FT                   K"
FT   gene            319405..322455
FT                   /locus_tag="ASA_0300"
FT   CDS_pept        319405..322455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0300"
FT                   /product="membrane carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88484"
FT                   /db_xref="GOA:A4SHW2"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHW2"
FT                   /protein_id="ABO88484.1"
FT                   /translation="MASQDSSVPSADGKYKRKRRPWWRWLFCFLFLLCLAAAIALVGYE
FT                   MQTSRLQSQEISRYAAKLTYQVEAGPSKQIIFPEDGPFDKRLGYVLLPMMQERLLQRGY
FT                   QVSEQTHFSDALYDYASRGFFVPYTEKVQAGLTLHDCRAEPFYQFKYPTHYYPDFASIP
FT                   PLVIQSLLFIENRDLLSNEQPLANPAVDWPRFAKAAMSQVGKALDMQDQSAGGSTLATQ
FT                   VEKYRHSPDGLTLSPTEKIRQMASASVRAYRLGPETLEARKLVAWAYLNSVPLSAAPGY
FT                   GEVHGLGDGLWVWFGANVNEVNRLLDPARNQDAALEEQGLALRQVVSLMIAHRRPSYYL
FT                   AQGRDALATLTDSYLRLFVQEGMITPPLMEAALKAKLGFRDFLQSPAMTRVNNNKGLQV
FT                   ARTRLSRQLGVQLYDLDRMDLSADTSLNMPLQNEISRYLQQLADPAFAAQVGLFGERLL
FT                   SPEKTGDVRYSFTLFEKSPEGFKVRVQTDNTDQPFDINEGSKLELGSTAKLRVLTTYLE
FT                   IIAELHDNYSDMPAESLRKIEVSGQDNLSRWAVSYLMTAKDKSLPLMLEAALDRQYSAS
FT                   PHEGFFTGGGMHTFNNFRREDNGRIPPIRDALRESINLPFVRLMRDIVRYSLYREGNRA
FT                   QLLKDDKDPRRTEYLAKFADKEGQTYLLRFWRKYRGKTADEQLDTFLDGLKPSAVRLAA
FT                   VHRYLMPDASQETFAAFLAKRLPRDKLSDRRIEQLYTSYGPGKYSLPDQGYIARVHPLE
FT                   LWLLAYLKEFDKATFADAVEASRDERQEVYSWLFKTRHRSARDSRIRTMLEVEAFLDIH
FT                   QRWAKLGYPFDHLVPSLATALGSSGDRPAALAELMGIIQNGGIRAPTLRIEHLSFAKGT
FT                   PFETNFEPIHTEGTRVLPAEVATALRNALSKVVEGGTARRIAGAFALPDGTVLPMGGKT
FT                   GTGDNRIETVGRYGNVTSSLARNRTATFVFFLGEDHFGTLTAYVPGSQSDKFRFTSALP
FT                   VQVLKGMAPLLMPYLQPGTHTQCMAGN"
FT   gene            complement(322546..323091)
FT                   /locus_tag="ASA_0301"
FT   CDS_pept        complement(322546..323091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0301"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88485"
FT                   /db_xref="InterPro:IPR006839"
FT                   /db_xref="InterPro:IPR023153"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SHW3"
FT                   /protein_id="ABO88485.1"
FT                   /translation="MTGIKKPMSQYQDDNELEDWGPSKTQLKRDAEVLQKLGAEIVSLS
FT                   HSELEKIPLDEELADAVELGRKLKPKKDESFRRHLQFIGRLMRSRDIEPIEEALSIIKN
FT                   RHSTVNARLHRLEQWRERLITEGDSALNELMSQFHELDRQKLRQLIRSANKERELNKPP
FT                   VAYREMYQYLRGEIEDLL"
FT   gene            323183..324526
FT                   /gene="pmbA"
FT                   /locus_tag="ASA_0302"
FT   CDS_pept        323183..324526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmbA"
FT                   /locus_tag="ASA_0302"
FT                   /product="modulator of DNA gyrase PmbA"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88486"
FT                   /db_xref="GOA:A4SHW4"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHW4"
FT                   /protein_id="ABO88486.1"
FT                   /translation="MDQQDQIRQDQAHLEAVVAEALEIAKGLGASLAEVSISKQTGLSV
FT                   NTRGCELESIEFNKDGALGIAVYRDGCKGSSSTTDLGKPAIRAAVEAAMEIARHTSADD
FT                   CAGLANAELLAWDAPDLQLCHQIELDPQRGIELAIECERLALGRDARIKHSDGAGFSSH
FT                   LGIKVYGNSHGFVKGYAASRNSLSCVLIGELDGDMQRDYGYSSSRDLGGLWSPQRIADE
FT                   AVERTVSRLGARKISTRHAPVLFHPDTAAGLWGHLVMAISGGNLYRKSSFLLDKLGKQI
FT                   LPQWLTIQEFPHLLGGLASTPFDGEGVLTRNMDIVRNGELMSWLLTSYSARKLGLTTTG
FT                   HAGGIHNWQVSNTGQDFQGMLKEMGTGLLVTELMGQGVNIVNGDYSRGAAGFWVENGEI
FT                   AYPVEEITIAGNLSEMFSHIVAVGCDEDERSSLKTGSVLVENMKLAGH"
FT   gene            complement(324618..325874)
FT                   /gene="murA"
FT                   /locus_tag="ASA_0303"
FT   CDS_pept        complement(324618..325874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="ASA_0303"
FT                   /product="UDP-N-acetylglucosamine1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88487"
FT                   /db_xref="GOA:A4SHW5"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SHW5"
FT                   /protein_id="ABO88487.1"
FT                   /translation="MDKFKIDGRCTLNGEVTISGAKNAALPILFATLLCDEEIHLSNVP
FT                   RLKDVGTTLKLLEMLGATTKVNGNVTVLTGAVNNHVAPYELVKTMRASILALGPLAARF
FT                   GAADVSLPGGCAIGARPVNLHVHGLELMGAKIAIEDGYIKARVDGRLKGAHILMDMVSV
FT                   TGTENLMMAATLADGRTVIENAAREPEVVDLANFLNALGAKVQGAGTDTLTIDGVERLH
FT                   GGSYSVQPDRIETGTFLVGAAVTGGKVTCRKTDPSLLEAVLVKLEEAGALIEKGADWIT
FT                   LDMTGRTLKPVTIKTAPYPAFPTDMQAQFTVLNAVAKGTGMVTETIFENRFMHVPELVR
FT                   MGADIELQGNVAICRDTEQLKGAQVMATDLRASASLVLAGFVAEGSTIVDRIYHIDRGY
FT                   EDIEHKLQGLGGCIERIKG"
FT   gene            complement(325890..326147)
FT                   /locus_tag="ASA_0304"
FT   CDS_pept        complement(325890..326147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0304"
FT                   /product="BolA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88488"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHW6"
FT                   /protein_id="ABO88488.1"
FT                   /translation="MQVSEIEAILLEALPLSEVHVKGDGSHYQVIAVGDMFDGMSRVKK
FT                   QQAIYAPLMDKIASNAIHALSIKAFTDAEWKRERKFLLPS"
FT   gene            complement(326147..326566)
FT                   /locus_tag="ASA_0305"
FT   CDS_pept        complement(326147..326566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0305"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88489"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHW7"
FT                   /protein_id="ABO88489.1"
FT                   /translation="MEGLRHGSRRDQPALRQAERAGRPHSPEWHRCSDRPAACSQRQAV
FT                   GHQVMKFSGDLQAPQVNALWQRRADWWQEDQLELSGVTTLDSAGLALLVKWAKAVLVRG
FT                   ATPQLVGASTDFYTLANLYGVAGLFQSTPLTTEDA"
FT   gene            complement(326416..327048)
FT                   /locus_tag="ASA_0306"
FT   CDS_pept        complement(326416..327048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0306"
FT                   /product="toluene tolerance protein Ttg2D"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88490"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="InterPro:IPR042245"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHW8"
FT                   /protein_id="ABO88490.1"
FT                   /translation="MFKKIALLLGLMTSMLFSLVAHATNAADPYALVDEAAKQTFARLK
FT                   ADKSQVKSNPDHLRVIIREELLPYVDNRFAAYKVLGNQIKQTTPAQRDAFVEVFTEYMV
FT                   SSYADALAHFDKQTVKVEPGKAPGDSNITAVNVSVKEAGKPDIFLEFKLRKNNKTGEWK
FT                   AFDMVAEGISLLSAKQNELGGLIRQNGIDAVIAQLRAHNAKPLVIKS"
FT   gene            complement(327058..327549)
FT                   /locus_tag="ASA_0307"
FT   CDS_pept        complement(327058..327549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0307"
FT                   /product="toluene tolerance protein TTG2C"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88491"
FT                   /db_xref="GOA:A4SHW9"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR030970"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHW9"
FT                   /protein_id="ABO88491.1"
FT                   /translation="MKFSKVEFLVGAFMLAGIGAILALALQVAGLSFKPEGETYTLRAH
FT                   FDNIGGLKVRSPVKVGGVVVGRVSDITLDAKSQVPVVSLLMQKSAGEFSETSTLSILTS
FT                   GLLGEQYIGLMPGFSDEEMGTSMLKDGDMIEDTKSAIVLEDLIGKFLYSQSSDTKSDSK
FT                   "
FT   gene            complement(327557..328336)
FT                   /locus_tag="ASA_0308"
FT   CDS_pept        complement(327557..328336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0308"
FT                   /product="ABC-type transporter, permease subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88492"
FT                   /db_xref="GOA:A4SHX0"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHX0"
FT                   /protein_id="ABO88492.1"
FT                   /translation="MLISQVSKLGRVGVRVISSIGRATIMLFHALAGKPEPRKHFPLLL
FT                   QQLYVVGVQSVAIILVSGLFIGMVLSLQGYNVLKDFGAEQSLGPLVSLSLLRELGPVVT
FT                   GLLFAGRAGSALTAEIGLMKATEQLSSLEMMAVDPLRRVVAPRFWAGVISMPLLAFMFS
FT                   LIGIFGGKLVGVDLLGVDEGSFWSAMQASVDWQDDIMQGAIKSLIFALVVTWIALFNGY
FT                   DAKPTSAGISQATTRTVVHSSLAVLGLDFILTAVMFG"
FT   gene            complement(328336..329136)
FT                   /locus_tag="ASA_0309"
FT   CDS_pept        complement(328336..329136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0309"
FT                   /product="ABC-type transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88493"
FT                   /db_xref="GOA:A4SHX1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030296"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHX1"
FT                   /protein_id="ABO88493.1"
FT                   /translation="MDNCLNNDLITISDLTFSHGDRLLYDGINLTIPRGKVTAVMGPSG
FT                   IGKTTLLRLIGGQIKPESGHILFDGEDIPTLSRSRLYEVRKRMSMLFQSGALFTGMTVY
FT                   DNVAFPLREHSGLPEELIHTIVMMKLQAVGLRGAAQLMPSELSGGMARRAALARSIALD
FT                   PDLIMYDEPFVGQDPITMAVLVKLIKELNSALGITSVIVTHDVNEVLTIADYAYIIANR
FT                   KVVAHGTPAQLREEHNPEVEQFLLGLPDGPVPFHFPAGDLLQDL"
FT   gene            329344..330339
FT                   /locus_tag="ASA_0310"
FT   CDS_pept        329344..330339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0310"
FT                   /product="sugar phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88494"
FT                   /db_xref="GOA:A4SHX2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHX2"
FT                   /protein_id="ABO88494.1"
FT                   /translation="MSVKPEKVSELFDFRRSARTVLDIEKQAIDGLYQYLNDAFDKACE
FT                   LVLRCSGKIVVTGMGKSGHIGSKIAATLASTGTPAFFLHPGEASHGDLGMISSGDLIIA
FT                   ISNSGESDEILALLPVLKRRGIQLICMTGNPASTMAKEANVHLCIKVDKEACPLGLAPT
FT                   SSTTATLVMGDALAVALLEARGFTADDFALSHPGGSLGKRLLLRVGDLMHSGDLLPQVG
FT                   IDATISQALLEVSRKGLGMTAVVNDEGLLAGLFTDGDLRRILDLQVDIHHTSIAKVMTT
FT                   NCVTVGPEMMAAEAVKLMETRKINGLLVVDGDKRPLGAFNMHDLLKAGVI"
FT   gene            330339..330893
FT                   /locus_tag="ASA_0311"
FT   CDS_pept        330339..330893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0311"
FT                   /product="3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88495"
FT                   /db_xref="GOA:A4SHX3"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHX3"
FT                   /protein_id="ABO88495.1"
FT                   /translation="MQNVPTLYGPVTRSQYDRAAQIRLLVCDVDGVLSNGLIYMGNDGE
FT                   ELKTFCTRDGAGMRALLNAGIEIAIITGRNSRIVSDRMKSLGVQHLVQGADQKLPHFEA
FT                   LLTKLGLEASQAAYMGDDTIDLPVMQACGLGIAVADAHPLVLARADMVTRLAGGVGAVR
FT                   EVCDLILQAQGHGDYQPEASV"
FT   gene            330890..331450
FT                   /locus_tag="ASA_0312"
FT   CDS_pept        330890..331450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0312"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88496"
FT                   /db_xref="GOA:A4SHX4"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHX4"
FT                   /protein_id="ABO88496.1"
FT                   /translation="MSRQTLLFALLFLVALAAWQIGDVDLTPEPTTKAENYQPDFTARN
FT                   LVTTRFDVNGRRTERLESEYAEYYQIIEQATFNKPVVYMFDKQGEAEWKVTADTGVLNT
FT                   DDNVILRDKVHLDGLLPTSFISTLDTPYLELDLVTQNVRSNQHVSIVGKEFQTEGVGLK
FT                   GHLERKYFELLDQGHAIYFNEKR"
FT   gene            331437..331964
FT                   /locus_tag="ASA_0313"
FT   CDS_pept        331437..331964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0313"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88497"
FT                   /db_xref="GOA:A4SHX5"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHX5"
FT                   /protein_id="ABO88497.1"
FT                   /translation="MKNANLALAALLLCGTVSAKESDFAEKVYVDAVRQVAEMQDNRIT
FT                   FSDDVIITQGTIKIKADKVVVIRSGDKGAEVMTAYGKPATFFQILDNGKPVNAHGNSIR
FT                   YELKNRLVTITGNGQLKQEDSQVNGDLIRYDIVKQKMIAESKGPTQRVKTVFLPDQVEN
FT                   FDKPADQKKQGK"
FT   gene            331968..332693
FT                   /locus_tag="ASA_0314"
FT   CDS_pept        331968..332693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0314"
FT                   /product="ABC-type transporter, ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88498"
FT                   /db_xref="GOA:A4SHX6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHX6"
FT                   /protein_id="ABO88498.1"
FT                   /translation="MAVLKAAGLQKSYKRRMVVSDVSLEVGTGQIVGLLGPNGAGKTTS
FT                   FYMIVGLVQSDAGLITIDDQDISQQPMHIRARNGIGYLPQEASIFRRLSVFDNLMGVMQ
FT                   TRKGLSREEREDKVEQLLEEFNITHIRDNLGQSLSGGERRRVEIARALAAEPRFILLDE
FT                   PFAGVDPISVIDIKKIIQHLKDRGLGVLITDHNVRETLDVCEKAYIVSHGKMIAEGAPA
FT                   EILADEQVKRVYLGDQFSL"
FT   gene            332759..334198
FT                   /gene="rpoN"
FT                   /locus_tag="ASA_0315"
FT   CDS_pept        332759..334198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoN"
FT                   /locus_tag="ASA_0315"
FT                   /product="RNA polymerase sigma-54 factor"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88499"
FT                   /db_xref="GOA:A4SHX7"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHX7"
FT                   /protein_id="ABO88499.1"
FT                   /translation="MKPTLQLRLGQSLTMTPQLQQAIRLLQLSTLELQQEIQQALDNNP
FT                   LLEQEENDVQETSPEEPVDDSQLDSSDAMAQDQMPDELPVDTTWEDVYSAGTAQSAGPI
FT                   HDGEDSVYQGETTENLQDYLLWQMRLTPFSDLDAAIALAIIDAIDDSGYLTVSLEDIQA
FT                   AVSSEDVEVELDEVEAVLKRVQHFDPVGIAARSVQECLLIQLGQYAPELPWLNEAREVI
FT                   KEHMDLLGNRDYRTLARKTKLKESDLKEVLDLIQQLEPRPGNGIIQSDSQYVIPDVTVV
FT                   KKGNKWVVELNPDSAPRIRVNETYAAMARQARTSQDTQFIRSHLQEAKWFIKSLESRND
FT                   TLLKVATCIVEQQQGFFEYGEEAMKPMVLNDIAEAVEMHESTISRVTTQKYMHTPRGIF
FT                   ELKFFFSSHVNTEGGRECSSTAIRALIKKLVTAENPAKPLSDSKIADLLAEQGIMVARR
FT                   TIAKYRESLLIPPSNQRKRLV"
FT   gene            334220..334507
FT                   /gene="yfiA"
FT                   /locus_tag="ASA_0316"
FT   CDS_pept        334220..334507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfiA"
FT                   /locus_tag="ASA_0316"
FT                   /product="Sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88500"
FT                   /db_xref="GOA:A4SHX8"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHX8"
FT                   /protein_id="ABO88500.1"
FT                   /translation="MQINLTGHHVEITEALRDYVNNKFAKLERHFDHINNVHVVLSVEK
FT                   LNQIAEAKLHVSGGEVFANSQHADMYAAIDTLLDKLDRQIIKHKDKLNQK"
FT   gene            334510..334956
FT                   /gene="ptsN"
FT                   /locus_tag="ASA_0317"
FT   CDS_pept        334510..334956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsN"
FT                   /locus_tag="ASA_0317"
FT                   /product="nitrogen regulatory IIA protein PtsN"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88501"
FT                   /db_xref="GOA:A4SHX9"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHX9"
FT                   /protein_id="ABO88501.1"
FT                   /translation="MQLEHILSRDCTKSAVPCTSKKRALEIISELAAERLGTSRQTLFE
FT                   CLLAREKMGSTGIGAGIAIPHGRIGDEFPPTAILMTFAEPIPFDSIDNQPVDLLFALLV
FT                   PESECKQHLKTLSLMASKLGDKAVCRQLRQATSDEDLYQIMTSA"
FT   gene            334999..335865
FT                   /locus_tag="ASA_0318"
FT   CDS_pept        334999..335865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0318"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88502"
FT                   /db_xref="GOA:A4SHY0"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SHY0"
FT                   /protein_id="ABO88502.1"
FT                   /translation="MQLIVVSGRSGSGKTVALRVLEDLGYYCVDNLPVNLLPQLIVSVE
FT                   SQYDKLAVSIDVRNLPVSADKLETLLAQVRNEGRVEFSSFFFDAENSTLLKRYGESRRL
FT                   HPLSRKQLSLDEAIREETNLLAPLSSTADLRIDTTSLSIHDLSELIKTRVLGKKENELV
FT                   LVFESFGFKYGIPKDADFVFDARFLPNPHWIPELKPFTGKDEPVARYLSSQPDVMQFIL
FT                   QIENMLATWLPHLERNNRSYVTVGIGCTGGQHRSVFIAEQLAGAFRLLGKNVQIRHRTL
FT                   DKSTPQH"
FT   gene            335886..336158
FT                   /gene="ptsO"
FT                   /locus_tag="ASA_0319"
FT   CDS_pept        335886..336158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsO"
FT                   /locus_tag="ASA_0319"
FT                   /product="phosphocarrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88503"
FT                   /db_xref="GOA:A4SHY1"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHY1"
FT                   /protein_id="ABO88503.1"
FT                   /translation="MTVSASVEVKNKLGMHARPAMMLFELVQGFDAHVLLRNEDGIEAD
FT                   ADSVIGLLMLDSAQGKQVEVQVEGPEEVEALAAVVALFTSGFNEE"
FT   gene            complement(336178..338091)
FT                   /pseudo
FT                   /locus_tag="ASA_0320"
FT                   /note="BglB-family transcriptional antiterminator;
FT                   frameshift due to 10 bp duplication"
FT   gene            complement(338195..338935)
FT                   /locus_tag="ASA_0321"
FT   CDS_pept        complement(338195..338935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0321"
FT                   /product="4-hydroxy-2-oxoglutarate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88504"
FT                   /db_xref="GOA:A4SHY2"
FT                   /db_xref="InterPro:IPR010763"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHY2"
FT                   /protein_id="ABO88504.1"
FT                   /translation="MSLIPNYYRNRVCLNVLAGSKQNAVDIYEAAEGHVLVGVLSKNYP
FT                   DVPSAVADMRDYAKLIDNALSIGLGAGDPRQSAMVAELAGQLQPQHVNQVFTGVGASRA
FT                   LLGQPETLVNGLISPTGTPGMVKISTGPLSAQQPDGIVPIDTAIALLKDMGGSSVKFFP
FT                   MGGLDCRDEYQAVAEACARHGFWLEPTGGIDLDNFEEIVRIALDAGVEKVIPHVYSSII
FT                   DSESGQTRPQDVRTLLATVKRLLA"
FT   gene            complement(339044..340159)
FT                   /gene="selA"
FT                   /locus_tag="ASA_0322"
FT   CDS_pept        complement(339044..340159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="selA"
FT                   /locus_tag="ASA_0322"
FT                   /product="L-seryl-tRNA selenium transferase family"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88505"
FT                   /db_xref="GOA:A4SHY3"
FT                   /db_xref="InterPro:IPR006337"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHY3"
FT                   /protein_id="ABO88505.1"
FT                   /translation="MPSVYEKYQLKPVINASGRMTILGVSTPEQEVVDAVSFGLGHYFE
FT                   VKDLVNKTGAYLAGLLDVEDAVVVSCASAGIAQSVAAMIVRGDPYRLEQLHAHAHGVPS
FT                   EIVLPKGHNVNFGAPVGTMVNLGGGKVVEAGYANECSPAQLAAAINPNTAAILYIKSHH
FT                   CVQKSILSVAEAAEVAKARQLPLIVDAAAEEDLRLYYNQGADLVIYSGAKAIEGPTSGL
FT                   VLGKCQYVEWVKQQANGIGRAMKVGKEGILGLTRAIERYLEKEKESGAAMVAKMAPFIE
FT                   RLNQLPGVSAKVVWDSAGRDIARTDIAFDHQQIGMTTVHLVARLQQGNPAIYCRGYKAN
FT                   EGHIEIDVRSVTAPQLDQIHAAIANLVQENR"
FT   gene            complement(340143..341282)
FT                   /gene="dho"
FT                   /locus_tag="ASA_0323"
FT   CDS_pept        complement(340143..341282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dho"
FT                   /locus_tag="ASA_0323"
FT                   /product="dihydroorotase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88506"
FT                   /db_xref="GOA:A4SHY4"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR020043"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHY4"
FT                   /protein_id="ABO88506.1"
FT                   /translation="MHDMIIRAGRLGNGELIDIAIRDGKIAALGQLPAKTEAKQTLDLA
FT                   GRVHVSAGWIDGHTHCYPASPIYHDEPDKVGVESGVTTVIDAGSTGADDVDDFQRLASG
FT                   CKTRVHALLNISRIGLLRQNELADSRDLDMALASAAIARHPNFIIGIKARMSGSVVGEN
FT                   GLQPLRMAKALQQAHGRLPLMVHVGNTPPDLDEIVALLGEGDLLTHCFNGKPNRILTPA
FT                   GELRVAVREAMQRGLLLDIGHGGASFSFEVAELAIRQGIQPHTISSDIYCKNRIKGPVY
FT                   SLAHVMSKFLAIGMTLEQVLACVTDHAADALRLTGKGRLEVGADADLTLFELASGPTLF
FT                   MDTEVQSRSGDLQLLPLAALVGGDLVLTHYGKSHHAFCL"
FT   gene            complement(341325..341957)
FT                   /locus_tag="ASA_0324"
FT   CDS_pept        complement(341325..341957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0324"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88507"
FT                   /db_xref="GOA:A4SHY5"
FT                   /db_xref="InterPro:IPR025456"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHY5"
FT                   /protein_id="ABO88507.1"
FT                   /translation="MDEKLRNNFWYADWSFPIFVGLLSAGVFAGTHMYYLYGVGAFNEV
FT                   AFVAMLKAGMDTGAFGASFLFARIIEGSLVGILDIGGAIQTGVGLGVPALLLGAGILYP
FT                   VENFGASLVTGMVIGLAIGYIIILARKFTINQSNSTYGADVMMGAGNSSGRFLGPLIIL
FT                   SAMGASIPIGLGSLLGALLFYVWSKPITGGAILGAMLLGTFFPVALA"
FT   gene            complement(341969..342745)
FT                   /locus_tag="ASA_0325"
FT   CDS_pept        complement(341969..342745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0325"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88508"
FT                   /db_xref="GOA:A4SHY6"
FT                   /db_xref="InterPro:IPR020042"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHY6"
FT                   /protein_id="ABO88508.1"
FT                   /translation="MFLIIFIKSLIIGGLVGVGVGAGAARMFHAPTVQGMGAFRTLGEL
FT                   NSCEGDPASHFSFGLGFFFNAWASTVAAGAFTQDVDHRILPNWGAAALMIRNRDLASTL
FT                   HDPKKMAIACGIIGAIVVAFLNSTAAAVPAALQVTAVKVLVPAANLLVNTVMPVIFWLA
FT                   AIEAGKKSGFWATIFGGLAQLIMGNAVPGLVLGILIGKGVEESGWNHVTKVMMSAIVLL
FT                   FVLSGFFRGFDLKLIESFHMGIPLWLENVHNLLANK"
FT   gene            complement(342786..343082)
FT                   /locus_tag="ASA_0326"
FT   CDS_pept        complement(342786..343082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0326"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88509"
FT                   /db_xref="InterPro:IPR020037"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHY7"
FT                   /protein_id="ABO88509.1"
FT                   /translation="MKEDFTTQVIVNGKGATRQQAFAAALSQVQHTLLKDNPRVMLRIE
FT                   PVEVQVLKAEESVRVEKFLFFFLPRQRREFRVQLEITVKVTSLDADKVTFTLV"
FT   gene            complement(343082..343447)
FT                   /locus_tag="ASA_0327"
FT   CDS_pept        complement(343082..343447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0327"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88510"
FT                   /db_xref="InterPro:IPR020034"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHY8"
FT                   /protein_id="ABO88510.1"
FT                   /translation="MSAIKLVIGDRLGKGQKVGAGAESAGASVTVIPGMAADMKLGDVM
FT                   NKEQADLGISFCGSGGAGAITAQTKYGYKCRYGMRSVEEGVTAINDGCVVLGFGFMDKE
FT                   ELGQKLVEAFVKKHGRA"
FT   gene            complement(343466..343825)
FT                   /locus_tag="ASA_0328"
FT   CDS_pept        complement(343466..343825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0328"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88511"
FT                   /db_xref="GOA:A4SHY9"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR020044"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHY9"
FT                   /protein_id="ABO88511.1"
FT                   /translation="MHTETHDQNLTPDSPALLHQTDLILARIHILLGDQGIRPNEVQKQ
FT                   MLASHVKAMVWRSHSGESLPEVDLSLFDEISPLSLRLAEQVVAWLDKLAYEEAHLLSVH
FT                   FEVAKENELSSVLNQ"
FT   gene            complement(344142..345272)
FT                   /gene="degS"
FT                   /locus_tag="ASA_0329"
FT   CDS_pept        complement(344142..345272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degS"
FT                   /locus_tag="ASA_0329"
FT                   /product="DegS serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88512"
FT                   /db_xref="GOA:A4SHZ0"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011783"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHZ0"
FT                   /protein_id="ABO88512.1"
FT                   /translation="MKIPPLISYLGKSVGFGLTVAALLLLLFPDFRGGAQLPGIITNAR
FT                   ELSFSYAAHRAGPAVVNIYTRSFSRNQGNQAELRPQGLGSGVIMNQRGHVLTNYHVIAD
FT                   ADQIIVALQDGRVFSAELVGTDQLTDLAVLYIESDNLPVIPQDPDRQPDVGNVVLAIGN
FT                   PYNVGQTITQGIISATGRLGLSSMGPDGNGRQDLLQTDAAINEGNSGGALVNGRGDLVG
FT                   INTAAYHLNGNQKSYGISFAIPYRLAKRIMDELITNGRVIRGYLGISSVELNPIVARMM
FT                   NLGDLRGLVIESLDPDGPASKGGLKRGDVLLKINGEALSGVRSAMDKIVESRPGTKLTI
FT                   SVFRDGKPLEVEVTIEEDLRYQQGKANTNVSGANAS"
FT   gene            complement(345362..346723)
FT                   /gene="degQ"
FT                   /locus_tag="ASA_0330"
FT   CDS_pept        complement(345362..346723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degQ"
FT                   /locus_tag="ASA_0330"
FT                   /product="DegQ serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88513"
FT                   /db_xref="GOA:A4SHZ1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHZ1"
FT                   /protein_id="ABO88513.1"
FT                   /translation="MRKPLSVLSVLALSVGIAMSAAPVQAALPSLLANNQEMPSLAPVL
FT                   EQVTPAVVNISVSGKKITRQRLPEQFRFFFGPNMPDEQVSEQPFQALGSGVIIDAKKGY
FT                   VITNAHVVHEADEIKVNLKDGREYAAKKIGEDKQSDIALLQIKAEDLVQIKFADSDELR
FT                   VGDYALAIGNPFGLGQTVTSGIVSALGRSGLNIENLENFIQTDAAINSGNSGGALLNLR
FT                   GELIGINTAILGPNGGNIGIGFAIPSNMVRDLSEQIVKYGEVRRGQLGITGSELTSDIA
FT                   KTFGYNKKDGAFVNQVMPDSAAAKAGIKPGDIIVSIDGKAIRSFGELRAKIATMGADKQ
FT                   VALGLIRDGKEETVKVMLKKADDSEILASVLHPALEGAKLSTTSEPVTGVAVSDIAARS
FT                   PAAASGLQKGDIIIGVNRLRVNSLAELTKALKNKPDVLALNIQRGESSLYLVIR"
FT   gene            complement(346805..347185)
FT                   /locus_tag="ASA_0331"
FT   CDS_pept        complement(346805..347185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0331"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88514"
FT                   /db_xref="GOA:A4SHZ2"
FT                   /db_xref="InterPro:IPR009386"
FT                   /db_xref="InterPro:IPR035440"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHZ2"
FT                   /protein_id="ABO88514.1"
FT                   /translation="MSLLNGILLAVAALIIGIIIGRFTVRSRDAGRLEQELKKAHTELE
FT                   SYQGQINTHFADSAALMEQLAEQYQTLYRHMAEQSKFLAKAQEPLFREALLEESADTPA
FT                   NEEPGVPPRDYAGASGLLKQSS"
FT   gene            347326..348420
FT                   /locus_tag="ASA_0332"
FT   CDS_pept        347326..348420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0332"
FT                   /product="ATPase, AFG1 family"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88515"
FT                   /db_xref="GOA:A4SHZ3"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030870"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHZ3"
FT                   /protein_id="ABO88515.1"
FT                   /translation="MTPQQKYQQDLQRPGFVADPAQAMAVTRLERLYQDLCQSPTPTRS
FT                   RGLLGWLQKPKAKEPVLGLYMWGGVGRGKTWLMDTFFESLPGTRKLRIHFHRFMHRVHD
FT                   ELKGLTGQADPLKLIASKLASETDVICFDEFFVSDITDAMLLGTLFQELFGHGVVLVAT
FT                   SNIPPQDLYRNGLQRARFLPAIELIERHCEVLNVDGGIDYRLRTLEQAEIYHFPLDQQA
FT                   KSNLDRYFQQLTGLEQVNAGSVEINYRQLTSLGMGEGVLYMEFEQLCCTPRSQGDYIEL
FT                   ARLFHTVLLANVQPMGAGTDDAARRFIAMVDEFYERHVKLIMSAAVPMTELYGNGLLNF
FT                   EFKRCLSRLQEMQSHEYLARVHLP"
FT   gene            348687..349115
FT                   /gene="rplM"
FT                   /locus_tag="ASA_0333"
FT   CDS_pept        348687..349115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="ASA_0333"
FT                   /product="LSU ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88516"
FT                   /db_xref="GOA:A4SHZ4"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SHZ4"
FT                   /protein_id="ABO88516.1"
FT                   /translation="MKTFVAKPETVKRDWYIVDAEGKTLGRIATEIASRLRGKHKAEYT
FT                   PHVDTGDYIIVVNAEKVHVTGKKFTDKIYHSHSGFPGGIKSISFDKLIKRKPEMVIEAA
FT                   VKGMLPKGPLGRAMFRKLKVYAGAEHAHAAQQPQVLDI"
FT   gene            349131..349523
FT                   /gene="rpsI"
FT                   /locus_tag="ASA_0334"
FT   CDS_pept        349131..349523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="ASA_0334"
FT                   /product="30S ribosomal subunit protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88517"
FT                   /db_xref="GOA:A4SHZ5"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SHZ5"
FT                   /protein_id="ABO88517.1"
FT                   /translation="MAENQYYGTGRRKSSTARVFIKAGSGKIVINQRSLEQYFGRPTAR
FT                   MVVRQPLELVEMTEKLDLYITVNGGGISGQAGAIRHGITRALMQYDETLRAELRKAGFV
FT                   TRDARKVERKKVGLHKARKRPQYSKR"
FT   gene            349819..350412
FT                   /gene="petA"
FT                   /locus_tag="ASA_0335"
FT   CDS_pept        349819..350412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petA"
FT                   /locus_tag="ASA_0335"
FT                   /product="ubiquinol-cytochrome c reductase, iron-sulfur
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88518"
FT                   /db_xref="GOA:A4SHZ6"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019470"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHZ6"
FT                   /protein_id="ABO88518.1"
FT                   /translation="MSNAPVDTGRRRFLTWSTVAVGGVGAAFTAVPFIKSWNPSAKAKA
FT                   AGAPVEVDISKLEPGQLIRVEWRGKPVWVVKRTKQTLDALAAHDGQLRDPASDEPQQPD
FT                   YAHNGYRSIKPEIFVAVGICTHLGCSPSYLPDNFGEQVQGVTSGFFCPCHGSKFDMAGR
FT                   VFQGVPAPLNLVIPPYQYLSDTTILVGADDGKEA"
FT   gene            350415..351632
FT                   /gene="petB"
FT                   /locus_tag="ASA_0336"
FT   CDS_pept        350415..351632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petB"
FT                   /locus_tag="ASA_0336"
FT                   /product="ubiquinol-cytochrome c reductase, cytochrome b"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88519"
FT                   /db_xref="GOA:A4SHZ7"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR030689"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHZ7"
FT                   /protein_id="ABO88519.1"
FT                   /translation="MFSKLMGWIDYRFPLTAMYNDHMAKYPAPKNLNFWYFFGSLAMLV
FT                   LVNQIITGIWLTMNYNPSAEGAFASVEYIMRDVDYGWLLRYMHSTGASAFFVVVYLHMF
FT                   RGMIYGSYQKPRELLWIFGMLIFLVLMAEAFMGYLLPWGQMSFWGAQVIISLFGAIPVI
FT                   GEDLTLWIRGDYVISGATLNRFFALHVIALPLVLVMLVAMHILALHEVGSNNPDGIDIK
FT                   KHKDANGWPLDAVAFHPYFTVKDMIGVAGFLFFFCAIIFFKPDMWGYFLEKPNFEVANG
FT                   LKTPAHIAPVWYFTPFYAILRAVPDKLLGVIMMGLSIVVLFLLPWLDRCKVRSVRYRST
FT                   LHKLNIAQFVVCFVILGILGVLPSTPTLTLVAQFCSLGYFGFFVLLFFYSKNERTKPLP
FT                   ERVTFK"
FT   gene            351629..352363
FT                   /gene="petC"
FT                   /locus_tag="ASA_0337"
FT   CDS_pept        351629..352363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petC"
FT                   /locus_tag="ASA_0337"
FT                   /product="ubiquinol-cytochrome c reductase, cytochrome c1"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88520"
FT                   /db_xref="GOA:A4SHZ8"
FT                   /db_xref="InterPro:IPR002326"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHZ8"
FT                   /protein_id="ABO88520.1"
FT                   /translation="MKRIIFAVLALLPSLALAAGGTFPLDKADYDLNDKASLQRGATTF
FT                   MNYCAGCHSTQYQRYNRVAQDLGIPDELMRENLIFTGAQIGDLMKISMSEKDAAKWFGA
FT                   PPPDLTLVARVRGADWVYTYLRSFYVDETRPFGVNNAVFPSVGMPHVLEPLQGTPRAEF
FT                   ATHTVDGVDVQQVVSVKSDGNGEMNNEEYDQTVLDLVNFLVYSAEPVQQERERMGFWVL
FT                   GFIVIFFIFTVLLKKEFWRDVH"
FT   gene            352451..353080
FT                   /gene="sspA"
FT                   /locus_tag="ASA_0338"
FT   CDS_pept        352451..353080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspA"
FT                   /locus_tag="ASA_0338"
FT                   /product="stringent starvation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88521"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034341"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHZ9"
FT                   /protein_id="ABO88521.1"
FT                   /translation="MAVAANKRSVMTLFSGANDMFSHQVRIVLAEKGVSVDICQVDPSN
FT                   LPDELAELNPYNTVPTLVDRELALYTSRIIMEYLDERFPHPPLMPVYPVARGNSRLMMH
FT                   RIELDWYSLADKIMAGTDVDAARAELRDNLLAIAPIFGEMPYFMSEEFGLVDCYMAPLL
FT                   WRLPSLGIDFAGRGAKELKAYMVRLFERESFQASLTEAEREIRAGV"
FT   gene            353077..353502
FT                   /gene="sspB"
FT                   /locus_tag="ASA_0339"
FT   CDS_pept        353077..353502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspB"
FT                   /locus_tag="ASA_0339"
FT                   /product="stringent starvation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88522"
FT                   /db_xref="InterPro:IPR007481"
FT                   /db_xref="InterPro:IPR036760"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI00"
FT                   /protein_id="ABO88522.1"
FT                   /translation="MSMEPTMTPSRPYLLRAFFDWLLDNELTPHLVVNVNIPHVMVPMQ
FT                   FVQDGQIVLNIAPRAVGQFHMDNEAVSFSARFGGVSQQVYIPMAAILAIHARENGVGAL
FT                   FPPEPGYDLWLEQAEAPVEPEPEPPRPTGRPTLKVIK"
FT   gene            complement(353556..354134)
FT                   /locus_tag="ASA_0340"
FT   CDS_pept        complement(353556..354134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0340"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88523"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI01"
FT                   /protein_id="ABO88523.1"
FT                   /translation="MKKQTLLLGLLAGTLLLQGCAAVVVGGAAGTAKASGDRRTLGAQW
FT                   DDQAIELKAANLLADNKPLSTASKISVYSNNGRVLLVGQTPSDAYKLEAGKVVARIDGV
FT                   RHVYNELRLGQPVNIGVRSNDSWITSKVRADMLGAKNFDSAKVKVVTENGEVFLIGLVT
FT                   RQEGDQAVEIARHVSGVKRVIKAFEFAQN"
FT   gene            complement(354139..354729)
FT                   /gene="gmhA"
FT                   /locus_tag="ASA_0341"
FT   CDS_pept        complement(354139..354729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmhA"
FT                   /locus_tag="ASA_0341"
FT                   /product="phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88524"
FT                   /db_xref="GOA:A4SI02"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI02"
FT                   /protein_id="ABO88524.1"
FT                   /translation="MTDRIKENYTESIQTKIAAAEALPDAIHTAAQMLTICLLNGHKVM
FT                   ACGNGPSAALAQLFISELVNCYETERPSLPGMALTPDMATISAIATDHGFEEVYAKQIR
FT                   ALGQAGDILVVITTTGNSRSLIKAAEAALSRDMTIVVLGGGDGGEIAGLLGPNDVEIRV
FT                   PSARRPRILEVNLLTLHCLCDLIDQTLFPQQED"
FT   gene            complement(354739..355008)
FT                   /locus_tag="ASA_0342"
FT   CDS_pept        complement(354739..355008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0342"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88525"
FT                   /db_xref="GOA:A4SI03"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI03"
FT                   /protein_id="ABO88525.1"
FT                   /translation="MTRNYRCRGGEIDLIMRQGDTLVFVEVRYRAHASHGGAASSVTRS
FT                   KQHKIVLAARHYLTQHAINEASQACRFDVIAFEDDQPNWIQNAF"
FT   gene            complement(355041..356948)
FT                   /locus_tag="ASA_0343"
FT   CDS_pept        complement(355041..356948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0343"
FT                   /product="lipoprotein, LppC family"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88526"
FT                   /db_xref="InterPro:IPR007443"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI04"
FT                   /protein_id="ABO88526.1"
FT                   /translation="MNLNRVTKQLSVSRLFGIILAAALLAACASGPNQPSGQPGMPSAF
FT                   SDLTKNAQWYLEQVDPVKPAEAFTWQVMAARSYLALGQAKPASALYQQLQKQAQSAEQK
FT                   AQLQLLQAHLLLAQGNANQALILLEGKPDVPLDADTQKNWYRQRVVLQLDINNKFGAAK
FT                   SLILMEPYLAQNELATNHQQIWSLLKSMTPSTLQALEEAPAPDVTTGWLRLAALVNEFG
FT                   AQPSQLARQLAGWKQAFPDHPAQKDMPAGLGDLATSHINALQQIAVFLPLSGNLEPQGA
FT                   AIRNGMLMSYKENQSQFTLNFYDTQTKAMGELYKQAIQEGANMIIGPLLKDRVEELLKA
FT                   NPTVPVLALNELDKPIVNDSTFYFSLSAAADAAQAAQYLYGQGYRKPLLIAAQGRIGYS
FT                   SIKAFEQAWATVSQDKPVVATFGARNEVQGMVKNALSGRSTARAGEVVQLSAAAPRSID
FT                   VVYVVANSLETRMIKPYVDISVNPMGSLPIYSSSRSYDSATTEVASELNGMHISDMPLL
FT                   LGGYEQQREQIALLWPQTQGDLMRLFALGYDAVSLAENLQQMRKVNAMQQPGMSGQLSV
FT                   DANGNIVRVLDWATYQNGELVSDSAAPQLEGAPNEGSIGTDEPAVAEPVSVTDEQGATL
FT                   "
FT   gene            357028..357861
FT                   /locus_tag="ASA_0344"
FT   CDS_pept        357028..357861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0344"
FT                   /product="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88527"
FT                   /db_xref="GOA:A4SI05"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI05"
FT                   /protein_id="ABO88527.1"
FT                   /translation="MSDIPTLYIVPTPIGNLADITQRALDILRSVDLVAAEDTRHTGIL
FT                   LSHYQISVPTFALHDHNEQQKADVLIGRIKEGKTVALVSDAGTPLISDPGYHLVTRCRE
FT                   AGVKVVPLPGPCAAITALSAAGLPTDRFAFEGFLPAKSKGRDDRLQAVIEDTRSLVFYE
FT                   SPRRVQDTVEAIARILGERQVVVCRELTKTFESIHGLPASEMLTWLGQDDNRCRGEIVL
FT                   VVAGASKTEEELPAEAIRTLGLLVTELPLKKAAALTAEIHGVKKNALYKYGLEHY"
FT   gene            358078..358388
FT                   /gene="rnpB"
FT                   /locus_tag="ASA_0345"
FT   misc_RNA        358078..358388
FT                   /gene="rnpB"
FT                   /locus_tag="ASA_0345"
FT                   /product="RNAse P RNA component"
FT   gene            358790..359500
FT                   /gene="lfiM"
FT                   /locus_tag="ASA_0346"
FT   CDS_pept        358790..359500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfiM"
FT                   /locus_tag="ASA_0346"
FT                   /product="lateral flagellar motor switch protein, LfiM"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88528"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI06"
FT                   /protein_id="ABO88528.1"
FT                   /translation="MAQLFNSADCELTYQEFIAVSSPEHDDGLIWVEARSLLDTQRVAY
FT                   FSISPSVIYRLAVLFFGGSLRNQGETASHSKGLTDTEQRLVLRLCQYQVDIWSSCLGLG
FT                   DLEWQLTLITRDVLPVSRLWMAAATLTVGSFSHGWQLWLVPPAESTGPAAGHALQDGTL
FT                   EQALTHIPTRLRVVMGQLSMTLADLECLKVGDVLSLDLPELVPALIGNRPCFSGRIAEH
FT                   KGSLVYQVATVVEE"
FT   gene            359508..359885
FT                   /gene="lfiN"
FT                   /locus_tag="ASA_0347"
FT   CDS_pept        359508..359885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfiN"
FT                   /locus_tag="ASA_0347"
FT                   /product="lateral flagellar motor switch protein, lfiN"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88529"
FT                   /db_xref="GOA:A4SI07"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR012826"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI07"
FT                   /protein_id="ABO88529.1"
FT                   /translation="MNEHTMNDPLDLDGLDQLFGDDISMPSAADYMAPTSSSKQRDLSF
FT                   FRQIPVKVTLEVASTEVSLGELMRVEEGAVIELDKLAGETLDVRVNGRLLAKGEVVVVN
FT                   GKYGLRLVDVIDTNLLGGMDD"
FT   gene            359885..360619
FT                   /gene="lfiP"
FT                   /locus_tag="ASA_0348"
FT   CDS_pept        359885..360619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfiP"
FT                   /locus_tag="ASA_0348"
FT                   /product="lateral flagellar assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88530"
FT                   /db_xref="GOA:A4SI08"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI08"
FT                   /protein_id="ABO88530.1"
FT                   /translation="MRHLLFALLLCSLPSWGADMTLFSVLPGAEGGEDYNIKLQILFFM
FT                   TLLGLLPTLLLMMTSFTRIIIVLAILRQAMGLQQSPPNRVLIGISLILTIVIIRPVWTD
FT                   MYQHAFIPYDQNEISLSEGIARAEKPLRHFMLAQTREPDLEQMLRISGEPTSLTKDEVP
FT                   FGVLLPAFVLSELNTAFQIGFMLFIPFLVIDLVVASVLMAMGMMMLSPLIISLPFKLMV
FT                   FVLVDGWSMTVGTLAASFGSGG"
FT   gene            360621..360890
FT                   /gene="lfiQ"
FT                   /locus_tag="ASA_0349"
FT   CDS_pept        360621..360890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfiQ"
FT                   /locus_tag="ASA_0349"
FT                   /product="lateral flagellar biosynthetic protein, LfiQ"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88531"
FT                   /db_xref="GOA:A4SI09"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI09"
FT                   /protein_id="ABO88531.1"
FT                   /translation="MTPEQSVALIGGAVNLVVVMVSVLIVPSLIVGLVVSVFQAATQIQ
FT                   EQTLSFLPRFLVTLMTLIFTGNWLLSQITTLFHDLFLKIPGLIG"
FT   gene            360887..361669
FT                   /gene="lfiR"
FT                   /locus_tag="ASA_0350"
FT   CDS_pept        360887..361669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfiR"
FT                   /locus_tag="ASA_0350"
FT                   /product="lateral flagellar biosynthetic protein LfiR"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88532"
FT                   /db_xref="GOA:A4SI10"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006303"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI10"
FT                   /protein_id="ABO88532.1"
FT                   /translation="MNSLLSLSAADLTAWLGQWWWPFIRIATAFWVMPVFGDGRIPPQV
FT                   RLLFAFIISLLIAPMLKEMPVVDPFSTGALVLTVEQLLFGLLFGLCVQMLFMIMTMAGQ
FT                   ILSMQMGLAMAVMNDPSNGDSAPIVSQLMLIFCSLLFLGLNGHLVTLDVLVQSLRSWPP
FT                   GSSLDLLDMKGVIGLFGWCIGAALILTLPAVVAMLMVNLTFGVMNRTAPSLNIFSLGFP
FT                   MTLLLGLVTMAISISGVPARYLDLVTHVLEQLRALTPS"
FT   gene            361666..362802
FT                   /gene="lfhB"
FT                   /locus_tag="ASA_0351"
FT   CDS_pept        361666..362802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfhB"
FT                   /locus_tag="ASA_0351"
FT                   /product="lateral flagellar biosynthetic protein, LfhB"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88533"
FT                   /db_xref="GOA:A4SI11"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI11"
FT                   /protein_id="ABO88533.1"
FT                   /translation="MSQNSAQDKTEEASSQKLRKAREEGQIARSKELSSAGLLLLGGLA
FT                   MQWMVPSFGHFFAELMKRPQRFDWQGARDPQMMIHWTAEALLSMLWVLLPLFGFLALLL
FT                   VLLSIVPGGMVLTWKKLLPSAEKLNPLKGLKRMLSTHSLMELLKSVLKILLIGSTLALM
FT                   LQHQWPLLMMMNRMPPQAAMEQALQILSQAFILLGSVQMLIAVLDVPYQRWSLNKQLRM
FT                   TKQEVKDEHKNSEGRPEIKAKIRQVQGMLARARIEQRVPQADVIIVNTTHYAVAIKYDP
FT                   ERANAPYVIAKGVDGMAERIRQVAKQHDKMVMSLPDLTRAIYYSTRVDQEVPAGLYTAV
FT                   AYVLNHVLQLRAYAAGKGKKPTPLAPLHVPPELRQPER"
FT   gene            362806..364881
FT                   /gene="lfhA"
FT                   /locus_tag="ASA_0352"
FT   CDS_pept        362806..364881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfhA"
FT                   /locus_tag="ASA_0352"
FT                   /product="lateral flagellar biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88534"
FT                   /db_xref="GOA:A4SI12"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006301"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI12"
FT                   /protein_id="ABO88534.1"
FT                   /translation="MNWRVLTQSYTAIPMLLLAILAMMILPLPGWLLDVLFTFNIVLAV
FT                   LVLLVSVSARRPLDFSVFPTVLLVATLMRLSLNVASTRVVLLHGHEGHEAAGKVIQAFG
FT                   EVVIGGNYVVGLVVFVILMIINFVVITKGGERISEVSARFTLDAMPGKQMAIDADLNAG
FT                   TMDQHQARARREEIAREADFYGAMDGASKFVRGDAIAGLLVLIINLVGGLAIGIFQHSL
FT                   PVAEAFQSYALLTIGDGLVAQIPSLLMSTAAAIIVTRVSDEGEMSDQVGQQILASPRVI
FT                   YTAAAIMLILGLVPGMPMLAFLSFAAVLAWAGWSVSKRRVNDPDLDAAQELTRQMVQSE
FT                   PQGLEWQDLPPVDAVAIELGYRLVPLAEADKGAELLARVRGIRKTLSEQYGFLLPEIRV
FT                   RDNLQLQPDQYRIKLSGVALAAGNVDCQRLMAISSGETYGVLDGELTQDPAYGMNAVWI
FT                   SPENKAKALNLGYSVVDSATVIATHTSKLLREQLDSLFGHDEVGKLGQYLATQSPRLAE
FT                   ELNLALTQMQQLRVFRQLLKEQISLTDIRTIATTLLDASELTKDPVLLASDVRCALKRQ
FT                   IVRQAIGSRDILAAFTLDDRLEQTLLAAMNQSQQQGKIQLDSFPVDPQLLAQLQQNMPL
FT                   VKEQLQQQGHAPVLVVMPQLRPLMARYARSFSKGLKVLSYNEIPEELRVEVIGTLG"
FT   gene            365305..366681
FT                   /gene="lafK"
FT                   /locus_tag="ASA_0353"
FT   CDS_pept        365305..366681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lafK"
FT                   /locus_tag="ASA_0353"
FT                   /product="two-component system lateral flagellar response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88535"
FT                   /db_xref="GOA:A4SI13"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029995"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI13"
FT                   /protein_id="ABO88535.1"
FT                   /translation="MLSDLSIKKNSRPIGIESAPHLLLIRPSLSNGNDIEGILLAQGYA
FT                   VSCVDSIKKSKFILADNSVALILLDIDVMTEAGPQLVHEFCDVDCVILVNEQQAYLAAE
FT                   AMRAGAIDYIVKPFGCQQMLDAVRGALRLRQSIPNLIATSAMSLQVLQLARRAAKTSAT
FT                   ILIGGESGTGKERLARYIHDMSNRASKPFIAVNCAAIPESMIESILFGHNKGAFTGATG
FT                   TQPGKFELAQGGTLLLDEISELPLSLQAKLLRVLQEKEVERLGSHQTITLDVRIIAASN
FT                   KDIRTLVTMGQFREDLFYRLDVLPMSWPALRERPDDILPLAEYFIERHAPQQGYRLSEN
FT                   ARKQLLAYGWPGNVRELDNVMQRSLIMARGLHIQAVDLMLPSYTIESDDALPEAFSSPE
FT                   GLSETRRYAEFQFVLETLRRFRGHRTRTAEALGMTTRALRYKLAAMREQGVDIEQQIQN
FT                   "
FT   gene            366694..367020
FT                   /gene="lfiE"
FT                   /locus_tag="ASA_0354"
FT   CDS_pept        366694..367020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfiE"
FT                   /locus_tag="ASA_0354"
FT                   /product="lateral flagellar hook basal body protein, LfiE"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88536"
FT                   /db_xref="GOA:A4SI14"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI14"
FT                   /protein_id="ABO88536.1"
FT                   /translation="MKIEMMSSQVTLLQQMQEMQRVANQAPSIELNDASNVSFTDAMRD
FT                   VVGRVNEQQNIASKLMTAVDAGQSDDLVGAMVASQKAGLSFSALMQVRNKLMTGFDDIM
FT                   RMPL"
FT   gene            367026..368780
FT                   /gene="lfiF"
FT                   /locus_tag="ASA_0355"
FT   CDS_pept        367026..368780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfiF"
FT                   /locus_tag="ASA_0355"
FT                   /product="lateral flagellar M-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88537"
FT                   /db_xref="GOA:A4SI15"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI15"
FT                   /protein_id="ABO88537.1"
FT                   /translation="MMTELVTSPQGASDSFRTRVQEGLRNWRSLSRDNKSILTIALLAA
FT                   IVAGTIVVILWTSSKNYVPLYGKQELYDTANIMEMLEKEQVPFRLEKSSGQILVPESQL
FT                   AHVRMALAARGVRAAMPSGLEGLDTVTGLGTSEFMEGARYRHALEGELARTIISLDAVR
FT                   SARVHLAIPKRTLFVGRDEEKPSASVMMDLQPGQAMEPGQVEAIANLVAGSISGMKPGA
FT                   VTIVDQAGQLLSAELGDKAGFGKQSVQQMEYVRKLEQYIRQRASDMLYPMLGTSNFRVQ
FT                   IAADVNFNAVEETQQQLDPQGVVTKESTKSDKTIDALALGIPGALSNRPPETTPKNEQP
FT                   AQNQVEANTDTQKNDSRTERQEVSKQYENSRTIVHTRYQQGRLEKMNVSILLNQQSAPK
FT                   DGWSAEQLEQIRQMVERSVGFDNARGDQISLQVFDFTAAVPIVPPESGWWETPYWQDSL
FT                   RYLVGGLLGLTLVFFGIRPLVKHLVRTQQLPDEEPTEEQDEPQEPTVGLSMRRDDDAAL
FT                   TAPMMSNGLIRADNQMEPQFSSLNLEALPEPGSELEVQLQHLQLLVEKDTARVAEVVRS
FT                   WVSGNEQR"
FT   gene            368767..369795
FT                   /gene="lfiG"
FT                   /locus_tag="ASA_0356"
FT   CDS_pept        368767..369795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfiG"
FT                   /locus_tag="ASA_0356"
FT                   /product="lateral flagellar motor switch protein LfiG"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88538"
FT                   /db_xref="GOA:A4SI16"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI16"
FT                   /protein_id="ABO88538.1"
FT                   /translation="MNNVNLNQNAVDIDIDNLEKAAILLLSMGTEAAAKVMQKLSRDEV
FT                   QRLISKMAGLSGVSSMEAKWTLQQFFNQYREQSGIGSASWEYLEQTLDLALGQRLSRSL
FT                   LDSLYGDVMSQDIQRLQWVPADVLARFFRNEHPQMQAVLLAFLPPQTASAVLDALPGSV
FT                   HDDLLVRVASLNSVSEHVLGELRLTLDRCLAYVADQSGAKVNGVRQVADILNRYQGDKE
FT                   QILSLLREHDGDMALEIEKNMFDFMALRRQSDETLQRLVQELPSDLLALALKNTEASFR
FT                   KVVLGAMPKRMAQALDAQIQGQGSVSLRKVEQAREEVMQLVRELVEQGEVEFQLFEEPT
FT                   VN"
FT   gene            369808..370500
FT                   /gene="lfiH"
FT                   /locus_tag="ASA_0357"
FT   CDS_pept        369808..370500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfiH"
FT                   /locus_tag="ASA_0357"
FT                   /product="lateral flagellar assembly protein FliH"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88539"
FT                   /db_xref="GOA:A4SI17"
FT                   /db_xref="InterPro:IPR000563"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI17"
FT                   /protein_id="ABO88539.1"
FT                   /translation="MSHNVRKLATGTTRLYRFPSLGQSGEEAQSQQEQFEFGYQQGLEQ
FT                   GHDEGYQTGYQQGLTSGLVDGEAKGLQQGQTRGFSLGLAEGRASFDQALVPFAKLQAQW
FT                   ESLTRSRMQEQKELVAQLVTQVAKRVIQAEFTLNPQQVLNQVEQALASLPAASEELVIY
FT                   LSEGDRQRLAEQGVTRCEGWPLQVDSTLSVGDARIETRAAVIEVNTGERLASCIEQLNS
FT                   TLELPQDA"
FT   gene            370493..371833
FT                   /gene="lfiI"
FT                   /locus_tag="ASA_0358"
FT   CDS_pept        370493..371833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfiI"
FT                   /locus_tag="ASA_0358"
FT                   /product="lateral flagellar FliI-like assembly ATPase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88540"
FT                   /db_xref="GOA:A4SI18"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI18"
FT                   /protein_id="ABO88540.1"
FT                   /translation="MHEALQQALTSALDSFEDVPGFRRYGRLVRVTGLTLEVVGCQLVM
FT                   GQRCRVDTATGAPLLAEVVGFNRDISYLMPLQPMSGLYAGARVLPIDGEETIQVGEHLL
FT                   GRVVDGLLQPLDGRPLRDDGERVALFAIPPNPLLRTPVREPLDVGIRAINGLNGLLTVG
FT                   KGQRLGLFAGSGVGKSMLLGMMTRNTTAQIVVVGLIGERGREVREFIEHSLGPEGLARA
FT                   VVVAAPADQSPLMRLRAAQLCHRIAEYFREQGRDVLLLMDSLTRYAQAQREIVLAIGEP
FT                   PATRGYPPSVFSMLTQLVERAGNGIHQDGSLSAFYTVLAEGDDQQDPVVDAARAILDGH
FT                   IVLTRRLAEEGHYPAIDIGASVSRVMPQVVPAEWQTLAVTLRQLWGRYQQVRELLPLGG
FT                   YQPGADPQMDEAVQRYPAIAAFLQQGIHEETPFVQVMTGLKQVLGKS"
FT   gene            371843..372259
FT                   /gene="lfiJ"
FT                   /locus_tag="ASA_0359"
FT   CDS_pept        371843..372259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfiJ"
FT                   /locus_tag="ASA_0359"
FT                   /product="lateral flagellar protein, LfiJ"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88541"
FT                   /db_xref="GOA:A4SI19"
FT                   /db_xref="InterPro:IPR012823"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI19"
FT                   /protein_id="ABO88541.1"
FT                   /translation="MLKSYLGLQQNALEVMGKERQRLREEAMREEKRALRLQDVISSLS
FT                   TGSATFHPLLWQNKQQMEGQLRHLLVHQVQQSALARLDLEHHEGQVLKQFGRVKGLELL
FT                   LDKRNLAQRQQQESREQRQLDELSSLRHRVLREG"
FT   gene            complement(372263..372706)
FT                   /gene="lfgN"
FT                   /locus_tag="ASA_0360"
FT   CDS_pept        complement(372263..372706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfgN"
FT                   /locus_tag="ASA_0360"
FT                   /product="lateral flagellar protein, LfgN"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88542"
FT                   /db_xref="GOA:A4SI20"
FT                   /db_xref="InterPro:IPR007809"
FT                   /db_xref="InterPro:IPR036679"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI20"
FT                   /protein_id="ABO88542.1"
FT                   /translation="MSVDPKLRVKQLIIGVQQDCGRYAELQQQLLRQHSLLAAHDVNGL
FT                   AEHNQRQTQLMAAVQQQAQQRCQHLLALGLKPDEKGMATLIAKLPASLQKNVASQWQQL
FT                   EQLLQQCLRQNELNGRLLAGQIETINTLLGQEQPYGKLESFPD"
FT   gene            complement(372703..372978)
FT                   /gene="lfgM"
FT                   /locus_tag="ASA_0361"
FT   CDS_pept        complement(372703..372978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfgM"
FT                   /locus_tag="ASA_0361"
FT                   /product="lateral flagella anti-sigma-28 factor, LfgM"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88543"
FT                   /db_xref="GOA:A4SI21"
FT                   /db_xref="InterPro:IPR007412"
FT                   /db_xref="InterPro:IPR031316"
FT                   /db_xref="InterPro:IPR035890"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI21"
FT                   /protein_id="ABO88543.1"
FT                   /translation="MKITRTDPLYVQTQLQRKPESATTQPQARASQADAQISTTAQFVN
FT                   QARAQLATTSDVDMEKVNQIRQAISDGKLELDMDALSQAILDMHRR"
FT   gene            complement(373055..373735)
FT                   /gene="lfgA"
FT                   /locus_tag="ASA_0362"
FT   CDS_pept        complement(373055..373735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfgA"
FT                   /locus_tag="ASA_0362"
FT                   /product="lateral flagellar basal body P-ring biosynthesis
FT                   protein, LfgA"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88544"
FT                   /db_xref="GOA:A4SI22"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="InterPro:IPR039246"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI22"
FT                   /protein_id="ABO88544.1"
FT                   /translation="MLSYPLQAVPTDLSRHLDTRLKEDASDALNSYLQQQGWSAPEADY
FT                   QVWISPAVTHLPPCQQAIRLQAGGQYRQPWGRRPYLAECTEPAWQLRARVEVTLMLPVW
FT                   VTAQEIQKGQAIRAGDLVEKSLDISRLQRGFVPSSESLVGSKSTRNLRMGQLIGELDLQ
FT                   KAWAVREGEGVLIRAGLDGFSATTRGKALANGAIGDGIKVRNISSGKEIQAWVIDKGEV
FT                   ETRF"
FT   gene            373907..374296
FT                   /gene="lfgB"
FT                   /locus_tag="ASA_0363"
FT   CDS_pept        373907..374296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfgB"
FT                   /locus_tag="ASA_0363"
FT                   /product="lateral flagellar basal body protein, LfgB"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88545"
FT                   /db_xref="GOA:A4SI23"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI23"
FT                   /protein_id="ABO88545.1"
FT                   /translation="MSISFDSALGVHPYALDVRADRARILAGNLANVDTPGYLARDVDY
FT                   KTILGRVAQQVATGDASASISQGVMANDMQHPLYRIPYQVSMDGNTAELSVEQSKFANN
FT                   ATDFQTSLTFLNMKITGIAKAIEGR"
FT   gene            374299..374724
FT                   /gene="lfgC"
FT                   /locus_tag="ASA_0364"
FT   CDS_pept        374299..374724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfgC"
FT                   /locus_tag="ASA_0364"
FT                   /product="lateral flagellar basal body rod protein, LfgC"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88546"
FT                   /db_xref="GOA:A4SI24"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI24"
FT                   /protein_id="ABO88546.1"
FT                   /translation="MSFNRIYDIAGSAMRAQTVRLDTVASNLANVDSAAGSEDAAFRAI
FT                   KPVFSTLYQRVQDADSLGAAQVQIAGIVQSDRQVDKRLEPTNPLADQDGFVYYSNVNAV
FT                   EEMADMMSASRGFETSVEVINRINSMQQGLLRLGQGV"
FT   gene            374728..375420
FT                   /pseudo
FT                   /gene="lfgD"
FT                   /locus_tag="ASA_0365"
FT                   /note="lateral flagellar hook capping protein, LfgD;
FT                   frameshift due to 1 bp deletion"
FT   gene            375441..376634
FT                   /gene="lfgE"
FT                   /locus_tag="ASA_0366"
FT   CDS_pept        375441..376634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfgE"
FT                   /locus_tag="ASA_0366"
FT                   /product="lateral flagellar hook protein LfgE"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88547"
FT                   /db_xref="GOA:A4SI25"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR011491"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037058"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI25"
FT                   /protein_id="ABO88547.1"
FT                   /translation="MSFSIGLSGLRAVNQELSVISNNVANASTAGFKSSRAEFAAIYGV
FT                   EMNNVSQNFDRNGDVMRTGKGLDLAISGSGFFVLKDSNGQTSYTRAGMFQRDASNYLTT
FT                   ANGTRLQGYTTNDAGELQSGVVGDIQVKAGSLPAKASDQLEFVANLKADASIITPPPPP
FT                   APAFDPNKSETFSYSQSSKVYDSLGTEHTVTQYFVKTGANAWDVHYTFNGAVVPPVGAK
FT                   MNFDLNGKLDIAASTIPASLALAPAGASPIALQLDMSRVSQYASDFNATRNQSNGYAAG
FT                   DLTGVKVDADGGVYATFTNGQNLLQGQVVMANFTNPNGLIQTNNTTWQQSFSSGQPVLG
FT                   APGTGTMGSLTAGAYESSNVDLTGELVSLMTSQRNYQANAKTISSADKMTQVLFNSF"
FT   gene            376669..377379
FT                   /gene="lfgF"
FT                   /locus_tag="ASA_0367"
FT   CDS_pept        376669..377379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfgF"
FT                   /locus_tag="ASA_0367"
FT                   /product="lateral flagellar basal-body rod protein LfgF"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88548"
FT                   /db_xref="GOA:A4SI26"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI26"
FT                   /protein_id="ABO88548.1"
FT                   /translation="MSGAQHTLMAQQIRANNLANVNTAGFRADFERVSAYALTGDGYPS
FT                   RVMAREEMAGTDFKAGALMQTGRKLDVAVRGEGFITVQTADGKEAYTRAGNLEVDAEGL
FT                   LTLNSRPVLGDGGEMVLPAYRDLSFGKDGSLSITPPGGGARLDVGRLKLVNPDPVELVK
FT                   GPDGLFRLRQGGDAETSEQVVLASGFLEGANVNAVDELISSMSLTRNFELQVKLMKTAD
FT                   DQARQGARLISGQG"
FT   gene            377444..378229
FT                   /gene="lfgG"
FT                   /locus_tag="ASA_0368"
FT   CDS_pept        377444..378229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfgG"
FT                   /locus_tag="ASA_0368"
FT                   /product="lateral flagellar basal-body rod protein LfgG"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88549"
FT                   /db_xref="GOA:A4SI27"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI27"
FT                   /protein_id="ABO88549.1"
FT                   /translation="MHAALWVSKTGLSAQDAKMASISNNLANVNTVGFKRDRVAFEDLF
FT                   YQVQRQPGAQQDQQNLSPIGIQMGNGVRVVGTQKVFTPGQFQNTNQELDMAVVGAGFFG
FT                   VERPDGETAYTRNGQWHRNAEGLLVNSDGLPMLPQIQIPDNATKVSIGTDGTVSATLPG
FT                   QQENVELGRITLTNFTNPAGLEALGGNLYRATGASGEAIEGVPGEEAMGAIKQFTLESS
FT                   NVNVVEEMVDMITTQRAYEMNAKVVSAADQMLKFVTQAL"
FT   gene            378229..378900
FT                   /gene="lfgH"
FT                   /locus_tag="ASA_0369"
FT   CDS_pept        378229..378900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfgH"
FT                   /locus_tag="ASA_0369"
FT                   /product="lateral flagellar L-ring protein, LfgH"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88550"
FT                   /db_xref="GOA:A4SI28"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI28"
FT                   /protein_id="ABO88550.1"
FT                   /translation="MMKAMWRYLWVVLLLGGCATYELKAPEPGDEKWAPSRPKLSVSAR
FT                   GEDGSLYRGDYMMTLFQDRRAYRIGDILTVVLEERTQSSKKANTSMSKNSSMNVPAPSI
FT                   GGKVRSDWGASLSADRDFDGGATSSQQNTLAGSITVTVAEVMPNGVLGIRGEKWIRLNQ
FT                   GDEYIRLGGMVRVEDIDQSNRISSQRIADARITYAGRGALADSNQMGWLGRFFSSAFAP
FT                   F"
FT   gene            378909..380015
FT                   /gene="lfgI"
FT                   /locus_tag="ASA_0370"
FT   CDS_pept        378909..380015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfgI"
FT                   /locus_tag="ASA_0370"
FT                   /product="lateral flagellar P-ring protein, LfgI"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88551"
FT                   /db_xref="GOA:A4SI29"
FT                   /db_xref="InterPro:IPR001782"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI29"
FT                   /protein_id="ABO88551.1"
FT                   /translation="MNKWFITLLCLSLPWWANAAPPAKRALLDIADVQGMRTNQLVGYG
FT                   LVVGLSGTGDRSQVKFTGQSMANMLKQFGVQLPDDLDPKLKNVAAVSVQATLPALAGKG
FT                   QLVDVTVTSIGDAKSLRGGSLLLTPLRGIDGDVYAVAQGNLVVAGVKAEGQSGSSVTIN
FT                   VPTAGIIPNGAIIEREAVSNFADKPEVTLNLHQPNFKTARNVEREINRQLGPVARAVSA
FT                   GRIQVTAPKDESQRISFMALLQDIQVDMGKERPRVVFNSRTGTVVMGQGVKVHKAAVSH
FT                   GSLTVTIGESQNVSQPNAFSNGQTTTTPNSKVQVDRERNNMFVWPDGTSLEVIVKAVNS
FT                   LGATPDDVMAILQALDEAGALEGELVVI"
FT   gene            380024..380422
FT                   /gene="lfjJ"
FT                   /locus_tag="ASA_0371"
FT   CDS_pept        380024..380422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfjJ"
FT                   /locus_tag="ASA_0371"
FT                   /product="lateral flagellar protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88552"
FT                   /db_xref="InterPro:IPR019301"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI30"
FT                   /protein_id="ABO88552.1"
FT                   /translation="MTRITSEPGFYQDLNELQQIKSNPDQRAALDAAAGQFEVSFLQTV
FT                   LKHMRSASDAMQDEDDKIIKGEDLYRDMYDSQLAMSLVKRGGMGLKEQMVSQLVPTLKN
FT                   AEPVVALESQTLAAFSQPLNSAKMRKVD"
FT   gene            380422..381741
FT                   /gene="lfgK"
FT                   /locus_tag="ASA_0372"
FT   CDS_pept        380422..381741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfgK"
FT                   /locus_tag="ASA_0372"
FT                   /product="lateral flagellar hook-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88553"
FT                   /db_xref="GOA:A4SI31"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI31"
FT                   /protein_id="ABO88553.1"
FT                   /translation="MSMLNIGLSGLNAAQIALNVTAQNIANVNTIGYSRQEAMMGSLSG
FT                   FGRLDNGMGVEVTGVRRITDDYLVSQHWRSRSSTGASYSFHQYINTTEQLLGSESMNIA
FT                   KGLDSFFASLSAALDSPETPAQRSQIVSSAGALANRFGQLNESMLTQEKQIDDQLNSTV
FT                   SQVNSYLKQVAELNTQISEQASKGVNTSVLEDSREQIVRELSTFMEVRVNRQSDGSFSL
FT                   SLPQGQPLVLAGSSSTLSLAGDSLSLSFGPQSFDVPKLHGGSLAGVIEYRTTVLRPLRD
FT                   ELNQIAKKLADDFNAKQSGGVDLHGNPGKSLFTYDPLNPSGTLKIADGFTGDDLAFAKA
FT                   GGGSGDNRNLQELLTIKDSQYDAYSALLGRMAVQSGQAKATMEADANMEKQLATKLSSV
FT                   SGVNTDEEGVKIMAYTKAYQANAKVISTSDQLFNSILNMF"
FT   gene            381752..382651
FT                   /gene="lfgL"
FT                   /locus_tag="ASA_0373"
FT   CDS_pept        381752..382651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfgL"
FT                   /locus_tag="ASA_0373"
FT                   /product="lateral flagellar hook-associated protein, LfgL"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88554"
FT                   /db_xref="GOA:A4SI32"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR013384"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI32"
FT                   /protein_id="ABO88554.1"
FT                   /translation="MRISTNQIQLSMLDNLQHGFGEYARLDRQISANKRILQPSDDPVG
FT                   SVRLLGLKKEQVAMEQYQKNIANAKSQLSQGEQQLETMTNMLMRLRELTQTAATGSLSE
FT                   DDRRAVASETAVLKDGLLDLANARNESGSSLFAGSQVNQIAIVKTPSGDYQYQGDALTR
FT                   EVSIAKGVTVGLNQTADQLFIQNGDFFKQLDAMVEAMESGAPDAADQARNMLDRSKTLQ
FT                   DDISQMVSSIGARINLLDQVDEGHAEKGVYSKEVSNQIESLDYASAVTQQAHVLMALQV
FT                   QQQAFAKVNGLSLFNYMP"
FT   gene            382670..385009
FT                   /locus_tag="ASA_0374"
FT   CDS_pept        382670..385009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0374"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88555"
FT                   /db_xref="InterPro:IPR002826"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI33"
FT                   /protein_id="ABO88555.1"
FT                   /translation="MMQIQQTRLGGVAETPAQPRLRGRVTAQTASQPASKTERHPNIVR
FT                   LDRWALIGTAQQRIAHAQGGEQALSQVWGELKRLEQQLGQNRAASGDLVSRLKLLEEKL
FT                   TQPKAPLTSELRPRLLASAMDSRVHYSSDRLDFLTPKASAERLVFSFPQTSSAAEVILP
FT                   AGANEAEVVSRLDRALRKENIQVRLNELGKLELSVPDQYRRKLDEPVLLSGEGIRIPAG
FT                   NPVPVQFKLKPGQLTQLGEGIDKGELKQEQQRLKRLLGEIEQSVRELKQFRQKMVKQLD
FT                   RVKARSQNLKQEELEQLQGKLSLQLKEGGFMGTMSGLLAQANVSRQNVVSLADLIGYLS
FT                   FSSPLQLASNIMIDYFPQHAEVIARRWPAVLACLQDQDINRVPAELVEGLSSTLTINGI
FT                   QLTSRHDRVREAENIAAMSPAKAIELTLYGSGLGDVPRVLLKRKRLRRLNIKIMNSAIF
FT                   ALVLHLTEQLDWLSDPRVELLLPEENELVMSPFLFLSSELELADESAAKIRDRVLIQSR
FT                   REVLNREFEDEWVFKRFDENLALLRQDQDVAALFGTMKGREAYVLATGPTLASHFERLK
FT                   QVREQADRPMFICVDTALRPLLEQEIRPDIVVTVDRNIHSGILHPDWSHDIKLVYMPMV
FT                   DNGVLASWQGPRYGAYEALDTYVRLSRKLRRASLFTGGSVIHPATDLAVRMGAGQVTLF
FT                   GADFSYPGEKSHTGWDDGVLGGHARYGRRTVPNGHGKPVRTLLSFCIYLNYMELYVKIH
FT                   PEVVFRNSSREGARILGTSYHEEFAG"
FT   gene            385006..385281
FT                   /locus_tag="ASA_0375"
FT   CDS_pept        385006..385281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0375"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88556"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI34"
FT                   /protein_id="ABO88556.1"
FT                   /translation="MIDVASFKTGAENLAIMLREGRDESACFECGRLLQLLTPLMIHLP
FT                   AELQVCLVTLAKQLLQCQERHDWVGLCDYLEYELPHLLDEIELALV"
FT   gene            385468..387539
FT                   /pseudo
FT                   /gene="lafA"
FT                   /locus_tag="ASA_0376"
FT                   /note="lateral flagellin; interrupted by ISAS3"
FT   mobile_element  complement(386176..387407)
FT                   /mobile_element_type="insertion sequence:ISAS7"
FT   gene            complement(386194..386922)
FT                   /locus_tag="ASA_0377"
FT   CDS_pept        complement(386194..386922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0377"
FT                   /product="IS3-family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88557"
FT                   /db_xref="GOA:A4SH99"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH99"
FT                   /protein_id="ABO88557.1"
FT                   /translation="MVKQSWLESGAVYGYRKIHRDLCDLGEACGKHRVAKLMRREGLRS
FT                   QTGYQRRKGHYGGKSPQAAPNTLARQFKVPAPNISWVTDITYIRTQEGWLYLAVVLDLF
FT                   SRQIIGWAMKPRMTAGLAVDALLMAVWRRKPTQPVLVHSDQGSQFTGGEWQDFLKAHNL
FT                   SCSMSRRGNCHDNAVAESFFQLLKRERIKRRIYSTRDEARSDVFDYIEMFYNPIRRHGS
FT                   NDGLSPVEFERQFICQQQSV"
FT   gene            complement(387051..387344)
FT                   /locus_tag="ASA_0378"
FT   CDS_pept        complement(387051..387344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0378"
FT                   /product="IS3-family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88558"
FT                   /db_xref="GOA:A4SH98"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH98"
FT                   /protein_id="ABO88558.1"
FT                   /translation="MTRQRYPETFKIEAVKQITERGRPVADVARALGVSSHSLYAWLKQ
FT                   YGKPADQQHEESALQAEIRRLKAELRQVTEERNILKEAAAYFASESRKGTRS"
FT   gene            387663..388946
FT                   /gene="lafB"
FT                   /locus_tag="ASA_0379"
FT   CDS_pept        387663..388946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lafB"
FT                   /locus_tag="ASA_0379"
FT                   /product="LafB"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88559"
FT                   /db_xref="GOA:A4SI37"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI37"
FT                   /protein_id="ABO88559.1"
FT                   /translation="MQIDPASTAMQLVAIERKNMDALLKKQMDGIKGQQSALSTLNTKL
FT                   STFQTMLKDLNKASNLQAQKATMSQDGVMTVTSNGKASSGQYNFFVEQLAQSHQIGLSL
FT                   DSETAPLPADGVFSLTVKGKTIDIDLATLPAGSTVKDLVSHINDAKDNPGVKATLVRTD
FT                   GKVNMVLTSKDSGLENAIVVNYRGDASNSLGAAISGKTDITKAQDAKLRMGGDNPLTIT
FT                   SASNKIENVVDGLTLQLTKAQKNGDAPLLVNIEQDKEAVTGSLKKFVDSYNELIDELAK
FT                   MTSSDPKAPGALSSDSGVRSLKSVLSNSVRDLPNGLSLSSLGIKTDKAGKLSFSETDFN
FT                   KALEKDPELLGKALMGDDGLLKRMSDSLDPYTKRDGALKGRKSGLEASEKRVNERMEAL
FT                   DRRMDSAYKRYLNQFTTMNQMLQTMGSL"
FT   gene            389001..389393
FT                   /gene="lafC"
FT                   /locus_tag="ASA_0380"
FT   CDS_pept        389001..389393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lafC"
FT                   /locus_tag="ASA_0380"
FT                   /product="LafC"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88560"
FT                   /db_xref="GOA:A4SI38"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI38"
FT                   /protein_id="ABO88560.1"
FT                   /translation="MFEHQDGYDAYQFAATQAKAASADPHQLVLMLIDGLLDEMARAEG
FT                   HILAKQFERKGQTINKCLQILGGLDSALDMEKGGELAANLHRLYDYCGQRLFEISVSND
FT                   VAGFAEVRCILLELKEGWEAMAQHPR"
FT   gene            389516..389854
FT                   /gene="lafX"
FT                   /locus_tag="ASA_0381"
FT   CDS_pept        389516..389854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lafX"
FT                   /locus_tag="ASA_0381"
FT                   /product="LafX"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88561"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI39"
FT                   /protein_id="ABO88561.1"
FT                   /translation="MSMTGSKPLSTELETRQRQLLGLGRLILQQARAGQWDAVRLTDSR
FT                   LAQFIQHMLKQPDLWSSLEPARAQVRNWQQEALLLCQQETALREQEWHDLSRKREGLQA
FT                   YGEVQEWA"
FT   gene            389845..390933
FT                   /gene="lafE"
FT                   /locus_tag="ASA_0382"
FT   CDS_pept        389845..390933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lafE"
FT                   /locus_tag="ASA_0382"
FT                   /product="LafE"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88562"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI40"
FT                   /protein_id="ABO88562.1"
FT                   /translation="MGMIQFAGVDSVANLESTGFNRLARQPDEQGEMYQPLDLLFTEEL
FT                   TTLPAEVADDADVGTDVVDTVPEDATEQLESFTNMPPMFILNDEAASLSSARLAQPDVE
FT                   MNSGKEGGAVQDRAPSISVALRSLSVYGRSETERPHIVEQTTLGKDKPAFSVTDFSRMM
FT                   VGQQAAQTGDLPLRDKLIASLQPLLGGKVPFELDSGVPELKGGMGNLLSSPLSRPSEYQ
FT                   WAPAKLADNPAHWGQQLVDVLKDKVELQVNQQIKQAHIRLDPPELGRLELTVRVDGDRL
FT                   NVQLNVTNPAVRDALIQSMERLRMSLAPHHVGGVEVNVGQGGEQGQQEKWQQQQIMAGR
FT                   RQWQEDIEPTDSTMRDWLNTLV"
FT   gene            390971..391429
FT                   /gene="lafF"
FT                   /locus_tag="ASA_0383"
FT   CDS_pept        390971..391429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lafF"
FT                   /locus_tag="ASA_0383"
FT                   /product="LafF"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88563"
FT                   /db_xref="GOA:A4SI41"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI41"
FT                   /protein_id="ABO88563.1"
FT                   /translation="MRRVMKWLMVVVMALCLLAVLAYGIYLKRDLVAVWLGLAEPKPEL
FT                   SATPLFKPMERFVISLEGGAESHYLVLELALVTHNPAQLNTLNELTPLIRNAMVQYFSH
FT                   RTHDDVKKELQNITALQSSLLGKLVTTLQGYGYKTYLDEVLITKVLVQ"
FT   gene            391444..392151
FT                   /gene="lafS"
FT                   /locus_tag="ASA_0384"
FT   CDS_pept        391444..392151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lafS"
FT                   /locus_tag="ASA_0384"
FT                   /product="LafS"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88564"
FT                   /db_xref="GOA:A4SI42"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012845"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI42"
FT                   /protein_id="ABO88564.1"
FT                   /translation="MPIGIHRLSLPIRPLARVSRAILTRYLPLVKRAASHLRSQVSACF
FT                   DQEDMEQVGMMGLLEAWRRYDSEPDPQFESYAFKRIRGAMLDELRRLDWRPRQLRQQVH
FT                   SHNQAQRELYNRLGRAPTEQELAVSLNCTVEEVRQLAYASQAEALQSLEEWLENGGKAP
FT                   ATESDDVDMAMTISKVLTSLDKREQLLLSLYYQQELNMKEIALVLGLTESRVCQLHKQC
FT                   VLQLKQRLVDSIY"
FT   gene            392151..393056
FT                   /gene="lafT"
FT                   /locus_tag="ASA_0385"
FT   CDS_pept        392151..393056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lafT"
FT                   /locus_tag="ASA_0385"
FT                   /product="LafT"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88565"
FT                   /db_xref="GOA:A4SI43"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR022522"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI43"
FT                   /protein_id="ABO88565.1"
FT                   /translation="MLHHLWWSSLNSAGAFMQKQIGLGVIFICVLGGFMMAGGKPIALW
FT                   QPAELIIIIGAAVGSMFLGNSKEVMHEMWRQMKQCFKSNKDEKEIYRELLTLMHQLLEE
FT                   TRNKGMKALDEHIENPQQSSVFLMYPQISEDPQLLGFIIDNLRLLGMGKITPHELDTML
FT                   EQEIMAIEEDMLKPAHALHKTGEACPGFGILAAVMGIIITMQQLDGPLSNIGVHVAAAL
FT                   VGTFIGIFLCYCLLEPISNAMEEMVKRRIGLLMCIKSILIAQLRGKTPLISVDSGRKML
FT                   EPDVKPSFLELEEWVTNRAM"
FT   gene            393056..394003
FT                   /gene="lafU"
FT                   /locus_tag="ASA_0386"
FT   CDS_pept        393056..394003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lafU"
FT                   /locus_tag="ASA_0386"
FT                   /product="LafU"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88566"
FT                   /db_xref="GOA:A4SI44"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI44"
FT                   /protein_id="ABO88566.1"
FT                   /translation="MRNHEQIIIKRQQRRSSAPKGGGAWKVAFADFTLAMMAFFMVLWI
FT                   LAVSSQEEREAVASRLRDYSIMDSEANPFDISNSPYPVDLGGNPSVLEELSPKFVEEGQ
FT                   RMPKHMERNRSIFSDGVSGGYENLLVGKIEGEAQMKQLAGFIGSLADQMQAKNNLELQL
FT                   VPQGLRILIRDDDEREMYSRGSARISPFFRHMLMALAPIFQRVENRVMISGHTDSTPFA
FT                   GDNYSNWELSSDRAMMARRVLLAGGMPPERVGQVVAMSDTMLENTADPRGSENRRIELL
FT                   VMTSQAEKNLEQLFSAQTQAAVKQAKDDTSHGKP"
FT   gene            complement(394384..395388)
FT                   /locus_tag="ASA_0387"
FT   CDS_pept        complement(394384..395388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0387"
FT                   /product="membrane bound lytic murein transglycosylase D"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88567"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI45"
FT                   /protein_id="ABO88567.1"
FT                   /translation="MTRALYWLVGTLLLTSPYCYSYHNYHWQAGFPTPIQGRGVELVTQ
FT                   QTQFLLRQRDHLQKRITQSQPMIRWVEQQVRERKLPTMLAFLPLIESSYRLDVVSAAGA
FT                   AGPWQLMPATAARFSIPMIAGFDGRYSLPLATDAALTYLSWLYQFFGQDWLLALAAYNA
FT                   GEGRVLKAILDAGTRNVWELSLPTETRLYVARFIALSQLLDRAEQYQFFLPSWQEGDNL
FT                   QVIRHPNGCSLLDWAMAKGVAMNEVSRWNPAWQLPSPPGVTNCPIVYSRGKVTLPPTNN
FT                   GSTLLQKAISLESLHDPLLLKAARGLDMSRGAIRLESLPDPLGLETKRPLLTP"
FT   gene            395496..395792
FT                   /locus_tag="ASA_0388"
FT   CDS_pept        395496..395792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0388"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88568"
FT                   /db_xref="GOA:A4SI46"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI46"
FT                   /protein_id="ABO88568.1"
FT                   /translation="MITRVKKTPKSGKAIQKFLLYLILANFVLMGLYVMHAGELTFGAN
FT                   LLLTFLLIIYNLLLCQLVCLRARRAGDDYIIYPVVGVSIILCAVVLYRFIISP"
FT   gene            396032..396490
FT                   /gene="mraZ"
FT                   /locus_tag="ASA_0389"
FT   CDS_pept        396032..396490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraZ"
FT                   /locus_tag="ASA_0389"
FT                   /product="MraZ protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88569"
FT                   /db_xref="GOA:A4SI47"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI47"
FT                   /protein_id="ABO88569.1"
FT                   /translation="MLRGAHAISLDSKGRLAIPTKYRDWLRDESDGQLVCTIDIAHPCL
FT                   LLYPLNEWEEIERKLKMLSSMNPVERRLQPLLLGHATECELDGNGRLLLSQPLRSHAGL
FT                   DKKIMLVGQLNKFELWDEARWHQQVNDDIQGLPEDDWASSPRLQDFSL"
FT   gene            396491..397429
FT                   /gene="mraW"
FT                   /locus_tag="ASA_0390"
FT   CDS_pept        396491..397429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="ASA_0390"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88570"
FT                   /db_xref="GOA:A4SI48"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SI48"
FT                   /protein_id="ABO88570.1"
FT                   /translation="MTQAAEHITVLLHEAVEGLAIKPDGIYVDGTFGRGGHSRLILQHL
FT                   GPNGRLIAIDRDPQAIAEAAKIQDPRFEIVHGPFSGIVSYLDERGLLGKVDGFLLDLGV
FT                   SSPQLDDAERGFSFMKDGPLDMRMDPTSGQSAAQWLARADVDDIAWVLKTFGEERFAKK
FT                   IARAIVHDRVTEPYVRTRQLAEMIARVNPSKEKGKHAATRSFQAIRIYINSELDEIETA
FT                   LNGALQALAPEGRLSVISFHSLEDRLVKHFIRKHEKGPEVPRGIPLTEAQLAGGRKLKS
FT                   VGKALKPSEHEVTENSRSRSSVLRVAQRLAE"
FT   gene            397433..397747
FT                   /gene="ftsL"
FT                   /locus_tag="ASA_0391"
FT   CDS_pept        397433..397747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="ASA_0391"
FT                   /product="cell division protein FtsL"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88571"
FT                   /db_xref="GOA:A4SI49"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI49"
FT                   /protein_id="ABO88571.1"
FT                   /translation="MSEVRVHLAKEILADLWRHKLPVVLAFAVLITAFGVILVTNMTRG
FT                   LTAKQNDLMAEEDRLNIEWRHLLLEQGTLAEHSRVASLAMDKLQMARPLVTTEKVITQP
FT                   "
FT   gene            397744..399498
FT                   /gene="ftsI"
FT                   /locus_tag="ASA_0392"
FT   CDS_pept        397744..399498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsI"
FT                   /locus_tag="ASA_0392"
FT                   /product="peptidoglycan synthetase FtsI"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88572"
FT                   /db_xref="GOA:A4SI50"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI50"
FT                   /protein_id="ABO88572.1"
FT                   /translation="MKRKASAKTPPKAKAPSLYPWRFRTLVFFIGIAFAGLILRLAWIQ
FT                   VIDPDRLRQEGDMRSLRTTSTQAVRGMITDRNGEQLAVSVPVEAVWADPKTVHESGAIH
FT                   NERAWLALSAVLKLDINTLKHRISNPSKRFVYLQRQVTPAVAEYIKGLKLGGIYLRPEA
FT                   RRFYPTGEISAHLVGVTNIDGSGIEGIERSYNEWLTATPGEMRVRKDRQGRVIERLGLV
FT                   KEGKNANDLQLSIDQRVQALAYRALKHATDENKATSGSMVMLDIKTGEVLAMVNTPSYN
FT                   PNNRGQYQSFRVRNRVVTDTYEPGSTIKPLILLSALQAGVTSWKDIIPGGPLFIGAKQI
FT                   RDVSIHKATNLYDILRYSSNIGMSRIALRMPAQEMINTLSMVGFGMDTGSGLMGESSGM
FT                   LPQRRRWSDIERATLSFGYGLRVTPLQLASAYATLANKGKRVPLSIVKVTTPPKGEQVI
FT                   DHNNATAMLQALEYVVSNAIPKAQIPGYRVGGKSGTAKVAVAGGYGKDYMAWFAGFAPA
FT                   SNPRFVMVVVINEPKGSAYYGGAVATPPFAEAMGGVLQLFNIRPDAIPPSVPPKLARTE
FT                   ATHAAPRT"
FT   gene            399597..401081
FT                   /gene="murE"
FT                   /locus_tag="ASA_0393"
FT   CDS_pept        399597..401081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="ASA_0393"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelateligase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88573"
FT                   /db_xref="GOA:A4SI51"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI51"
FT                   /protein_id="ABO88573.1"
FT                   /translation="MLHRALDSLLRPFGINAPALSLTDIQLDSRRVGPGCLFIAIRGHQ
FT                   MDGRRFIEQAVAQGATAIVFEEDGEFVAPPLTIPCIGIRDLPARLSELAGYFYEQPANK
FT                   LDLVGITGTNGKSTTALLVANWRTLLGGKAGVMGTIGNGLFGELVEAENTTGSAVQVQA
FT                   NLASLQQQGAALVAMEVSSHGLVQHRVAALPFAAAVFTNLSRDHLDYHGTMEAYGAAKE
FT                   ELLKLVDEPCAVINADDQLGRQWLAAYPGAVAFSVNGPIADHPGRQLTAQDPHFHQQGF
FT                   RTQINSSWGNGVLSAPLLGRFNVSNVLAAMGAMLVLGYDFNVLLATAPQLQPVTGRMEC
FT                   FGGGNAPLAVVDYAHTPDALEKALQALRVHCEGQLWCLVGCGGDRDRGKRPMMAAMAEQ
FT                   HADRVILTDDNPRTEEPAQIMADMVAGLRDPAAVQVEHDRVKAIALALGQASKQDIILV
FT                   AGKGHEDYQIIGTDKRHYSDRETVVAALHTLLESFT"
FT   gene            401078..402433
FT                   /gene="murF"
FT                   /locus_tag="ASA_0394"
FT   CDS_pept        401078..402433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="ASA_0394"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanineligase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88574"
FT                   /db_xref="GOA:A4SI52"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI52"
FT                   /protein_id="ABO88574.1"
FT                   /translation="MMTLRLADLAQVLDARLIGEDGEITTVSTDTRTLGKGALFVALRG
FT                   ERFDAHDFCDQAVAAGASALLVERELSLAIPQLVVTDSLKGLGHIGKLVRERINPKVLA
FT                   ITGSCGKTTVKEMTTAILRHEGEVLATAGNFNNEVGVPLTLLRLEPQHQFAVMELGANH
FT                   PGEIAWTTSLARPDAALINNVAAAHLEGFGSLEGVFHAKSEIFEGLSEQGTAIVNADSA
FT                   FWPKWQAAGIHCAFSIEDQNQPFHARGIALNGQGCAEFVMVTPNGELSLTLAIPGRHNV
FT                   ANALAAAAGCLALGASLASVKAGLEQMAPVKGRFCVQRWGGLTLVDDTYNASVESVLAG
FT                   IDALTAMGGYKVLVFGDMKELGEESAEQHARVGRHASECGLDAVLTVGEQSRHTADAAA
FT                   GRHFDNKASLFEVLAQMINTHQEISILVKGARGSRMEDIVKMVVDRQESATC"
FT   gene            402427..403509
FT                   /gene="mraY"
FT                   /locus_tag="ASA_0395"
FT   CDS_pept        402427..403509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="ASA_0395"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88575"
FT                   /db_xref="GOA:A4SI53"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI53"
FT                   /protein_id="ABO88575.1"
FT                   /translation="MLVWLAELLTPHFTFFNVFSYLTFRAILSIITGLVVALWMGPHLI
FT                   RRLQILKFGQVIRNDGPESHLSKRGTPTMGGLMIIAAIFISVLLWSRLDNPYVWLVLFV
FT                   LGAYGAIGFADDYLKVVRKNTDGLIARWKYFWQSAVALLVAVFLYTTATHDGQTQLVVP
FT                   FLKDVMPQLGLMFIVLTYFVIVGTSNAVNLTDGLDGLAIMPTVMVAGGFALIAWATGNV
FT                   NFANYLHIPYVPYTSELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIA
FT                   VLVRQEFLLVIMGGVFVMETVSVILQVGSYKLRGVRIFRMAPIHHHYEKKGWPEPRVIV
FT                   RFWIITLMLVLLGLATLKVR"
FT   gene            403513..404796
FT                   /gene="murD"
FT                   /locus_tag="ASA_0396"
FT   CDS_pept        403513..404796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="ASA_0396"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88576"
FT                   /db_xref="GOA:A4SI54"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI54"
FT                   /protein_id="ABO88576.1"
FT                   /translation="MVIIIGLGKTGLSCVDYFLGRGVMPLVMDTRANPPGKDQLPAEVE
FT                   LIHGLDGDLLKQAHMIVASPGIALATPELKAAAEFGVSIVGDIELFVRETQVPVIAITG
FT                   SNGKSTVTTLVGEMIAEAGLKVGVGGNIGTPALELLKQPMDLCVLELSSFQLETTHSLR
FT                   AAASVVLNLSEDHMDRYQGMADYRAAKMEIHQHSKHILVNRDDAQTQPDVGQVWQSFGL
FT                   DCNGYGRCLLDGRHWLTLHGEPLLPVDEMKIVGAHNQANALAAMALCDAVGIPREPQLA
FT                   VLRRFEGLPHRARFVREVNGVRWINDSKATNVGATLAAVAGVREAVKGRLLLLAGGQGK
FT                   GQDFGPVQALLGHQIDHMYCFGQDADILLALGEQTERVSDLDAAVAKAAADARPGDWVL
FT                   LAPACASLDQFKSFEARGDHFTKMVLAL"
FT   gene            404793..405977
FT                   /gene="ftsW"
FT                   /locus_tag="ASA_0397"
FT   CDS_pept        404793..405977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="ASA_0397"
FT                   /product="cell division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88577"
FT                   /db_xref="GOA:A4SI55"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SI55"
FT                   /protein_id="ABO88577.1"
FT                   /translation="MSALRSVAGLLQRWLLPARPAGLYDRQLVVLALALMAVGLVIVAS
FT                   ASIPEGIAINNDPFMFVKRHGLFLVMALGISWFVLQVPMARWQHYNGPMLVLAILMLVL
FT                   VLLVGRSVNGSIRWLPLGPFNLQPAEFGKLALFVYLAGYLVRRQSEVRERFIGFMKPMA
FT                   VLFVVAILLLAQPDLGSVVVMFVTSLGMLFLAGARLGQFIGLILVGVSAVVTLVIAEPY
FT                   RMRRVTSFLDPWADPFGSGYQLTQSLMAFGRGSWFGEGLGNSIQKMEYLPEAHTDFVFA
FT                   ILGEELGYAGVLGALFLIFALSFKALKLGHQALVAERLYEGYLAIGIGIWFSFQTFVNV
FT                   GAASGMMPTKGLTLPLVSYGGSSLIIMMVAVSMLVRIDFELRQASAQARVREVS"
FT   gene            405974..407059
FT                   /gene="murG"
FT                   /locus_tag="ASA_0398"
FT   CDS_pept        405974..407059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="ASA_0398"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88578"
FT                   /db_xref="GOA:A4SI56"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SI56"
FT                   /protein_id="ABO88578.1"
FT                   /translation="MSKTLLVMAGGTGGHVFPGLAVADRLKAQGWTIHWLGTADRMEAE
FT                   LVPAHGYPISFIDIQGVRGNGIKRLLAAPYRIVKSVLQARRVLKTIRPDVVLGMGGFAS
FT                   GPGGVAAWLSGIPLLLHEQNAAAGLTNKLLARLAKRVLMAFPGAFAPSRRTAVVGNPVR
FT                   PEVVALPDPQRSSSTEPLHLLIVGGSLGARVLNEQVPAAVAAAGVPIEVRHQCGKGNRE
FT                   SVAQAYAKQGVEAEVSEFIKDMADAYAWADLVVCRAGALTVSEVAAAGVAAIFVPLPHA
FT                   VDDHQTRNALTLVDGGAAEFLPQSELTTASLAARLSWLAGRRETLLNMAQAARHVAITD
FT                   AAERVADECKRLAAGQNEREL"
FT   gene            407056..408510
FT                   /gene="murC"
FT                   /locus_tag="ASA_0399"
FT   CDS_pept        407056..408510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="ASA_0399"
FT                   /product="UDP-N-acetylmuramate--alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88579"
FT                   /db_xref="GOA:A4SI57"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SI57"
FT                   /protein_id="ABO88579.1"
FT                   /translation="MTKVELAKLRTMIPEMRRVRRIHFIGIGGAGMGGIAEVLANEGYQ
FT                   VTGSDLARNAVTERLASLGAHIFVGHSAEHVSEASVVVVSTAIKQDNPELLAARELRIP
FT                   VVRRAEMLAELMRFRHGIAIAGTHGKTTTTSLVASIYAEADRDPTFVIGGLLNSAGTNA
FT                   RLGSSRYLIAEADESDASFLHLQPMVSIVTNIEADHMETYGGDFSKLKATFIDFLHNLP
FT                   FYGLAVVCVDDPVIRGMLPEIARPTITYGLSDDADVQVLDFVQTSNRSCFRVRRKDAGE
FT                   LAVTLNLPGIHNALNAAAAIAVATEDGIGDDAIICALAKFEGVGRRFQQYGEFETGRGK
FT                   AMLVDDYGHHPSEVKVTINAARTGWPDKRLVMVFQPHRYTRTRDLYEDFSDVLSKVDVL
FT                   VMLEVYAAGEEPIPGADGRALCRSIRSRGSLEPIFAATPDDVPAILADLIGEGDLVLTQ
FT                   GAGNVGALSRRLGEMKLSIDSMKSGA"
FT   gene            408608..409360
FT                   /gene="ftsQ"
FT                   /locus_tag="ASA_0400"
FT   CDS_pept        408608..409360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="ASA_0400"
FT                   /product="cell division protein FtsQ"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88580"
FT                   /db_xref="GOA:A4SI58"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI58"
FT                   /protein_id="ABO88580.1"
FT                   /translation="MEASAQGRTKGGFIAGVAFFILVMWGLYQTALDVKGWLTDANRLP
FT                   MSELLLQGQHQYLQTDELRSAVLDGVELRNFFELDVNELQARLNALPWVAQVSVRKKWP
FT                   NKIKVYLTEQAVAARWNGNRFVNTKGEVFSAPDRVKTPLMQLSGPEDQAAKVLEASRQY
FT                   EAQLAARGYKLLGVNLTPRHAWELTLDGNIQLFLGRADIALRLQRFIDAFPVIEPRERV
FT                   AYVDLRYDTGMAVGWKKNEEKVNDQNRR"
FT   gene            409341..410600
FT                   /gene="ftsA"
FT                   /locus_tag="ASA_0401"
FT   CDS_pept        409341..410600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="ASA_0401"
FT                   /product="cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88581"
FT                   /db_xref="GOA:A4SI59"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI59"
FT                   /protein_id="ABO88581.1"
FT                   /translation="MTKTADRNLIVGLDIGTTKVAVLVGEVLPDGELNVIGMGSHASRG
FT                   MDKGGVNDLDSVVKSLRRAVEEAEMMADCQISSVYLGLSGKHIDCRNETGMVPISDEEV
FT                   TQEDVDNVIHTAKSVRLSDELRVLHVLPQEFAIDYQEGIKNPVGLSGVRMAAKVHLITC
FT                   HNDMARNIEKCVEKVGLRVDQLIFSALASSYAVLTEDEKELGVCVVDIGGGTMDMSLFT
FT                   GGALRHTKVIPYAGSTVTSDIAYAFGTPPLDAEAIKVRYGCALGRLVSKEDNIEVPSVG
FT                   GRPARSLQRQTLAEVIEPRYTELLSMVNDELVRVQSELKAQGVKHQLAAGVVLTGGAAQ
FT                   IEGIVECAEQIFQSQVRVGEPMNIRGLSDYVQAPVYSTAVGLLQYGRTHQSSGSSKEYA
FT                   AKASVGGLVKRVSNWLRGEF"
FT   gene            410641..411792
FT                   /gene="ftsZ"
FT                   /locus_tag="ASA_0402"
FT   CDS_pept        410641..411792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="ASA_0402"
FT                   /product="cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88582"
FT                   /db_xref="GOA:A4SI60"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI60"
FT                   /protein_id="ABO88582.1"
FT                   /translation="MFEFMDSHTDEAVIKVIGVGGGGGNAVEHMVRQNIEGVEFITVNT
FT                   DAQALRNSSANTTLQIGGGITKGLGAGANPEVGRDAAMEDREALRELLTGSDMVFIAAG
FT                   MGGGTGTGAAPIVAEVAREMGILTVAVVTKPFSFEGKKRMGFAAHGIEELSKNVDSLIT
FT                   IPNDKLLKVLGRGISLLDAFKAANDVLLGAVQGIAELITRPGLINVDFADVRTVMREMG
FT                   TAMMGTGSASGDDRAEEAAEKAISSPLLEDVDLAGARGILVNITAGMDMTIEEFETVGN
FT                   AVKAFASENATVVVGTVIDPEMHDELRVTVVATGIGAERKPDITLVKNNMVQERPARQP
FT                   LISEALQSRVMEEAPAKVVNAEPQARREPDYLDIPAFLRKQAD"
FT   gene            411894..412817
FT                   /gene="lpxC"
FT                   /locus_tag="ASA_0403"
FT   CDS_pept        411894..412817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxC"
FT                   /locus_tag="ASA_0403"
FT                   /product="UDP-3-O-acyl-N-acetylglucosamine deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88583"
FT                   /db_xref="GOA:A4SI61"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SI61"
FT                   /protein_id="ABO88583.1"
FT                   /translation="MIRQRTLKTSVQATGVGLHSGRKVTMTFRPAPVNTGIVYLRTDLD
FT                   PVVALPANADQVRDTVLCTALVNEAGVRVSTIEHLSAALAGMGIDNLYVEVDAPEIPVM
FT                   DGSAHPFIYLLQEVGIREQNAAKQFVRIKQSIRVEDGDKWAEFHPYRNGFKMDLEIDFQ
FT                   HPVFEGRNQRCVLDFSGASFVKEISRARTFGFMRDIEYLRSQNLALGGSLENAVVLDDY
FT                   RVLNEDGLRCEDEFVKHKMLDAIGDLYMCNRSIIGEFRAYKTGHALNNKLLRALLAKQE
FT                   AWELVTFEGEGAKAPIAYYDNGLVLA"
FT   gene            412967..413872
FT                   /locus_tag="ASA_0404"
FT   CDS_pept        412967..413872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0404"
FT                   /product="membrane peptidase, M23/M37 family"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88584"
FT                   /db_xref="GOA:A4SI62"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI62"
FT                   /protein_id="ABO88584.1"
FT                   /translation="MSITLILNGKQRRKLHLPKQRLAWVGGILFSVLALGGGWLWQSWH
FT                   QKMDALEVALAMAEQQTSTQGADEAREQLAMLAAQVGTIQGQLGRINALGERLTEQADL
FT                   DPEEFNFKELPPMGGPSYDVDLEVNLNELQDSMKHLSQQLSSREEQLSVLESFIMNHHI
FT                   ADAGFISGSPVKQERVWISSGFGGRVDPFNGRAKMHKGVDFRGKPGTPILATGPGIISW
FT                   AGRHPEFGNMVEVNHGNGLVTRYAHNSKLLVEVGTLVDQGQKIALMGRTGRATGVHLHY
FT                   EVLKDGRQVNPARFLNARRG"
FT   gene            413932..416652
FT                   /gene="secA"
FT                   /locus_tag="ASA_0405"
FT   CDS_pept        413932..416652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="ASA_0405"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88585"
FT                   /db_xref="GOA:A4SI63"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SI63"
FT                   /protein_id="ABO88585.1"
FT                   /translation="MISTLLTKIIGSRNDRTLKALRKIVKQINAMEPQFEALSDSELQA
FT                   KTAEYRQRLEQGETLDQLLPEAFATVREASKRVFGMRHFDVQLIGSMVLDSNRIAEMKT
FT                   GEGKTLTATLPAYLNALSGRGVHVVTVNDYLAKRDAEANRPLFTFLGMTVDCNVPGMDA
FT                   SQKRDAYAADITYGTNNEFGFDYLRDNMAFSPEQRVQRPLNYALVDEVDSVLIDEARTP
FT                   LIISGPAEDSSALYIQVNKLIPQLIKQDKEDTEEYTGEGHYTVDEKNRQALLTENGQIF
FT                   VEELLKREDLLAEEDSLFSATNISLLHHVNAGLRAHTLFERNVDYIVQKDEIVIVDEHT
FT                   GRTMPGRRWSDGLHQAVEAKEGVKIQNENQTLASITFQNYFRLYDKLAGMTGTADTEAF
FT                   EFQQIYGLDTVVIPTNKPMVRKDMGDLVYLTAQEKYAAIVEDIRGCVSRGQPVLVGTVS
FT                   IENSELLSGILTKENIPHKVLNAKFHAMEAEIVAQAGQLGAVTIATNMAGRGTDIVLGG
FT                   NWQAEIAQLDNPTDEQIAELKAAWQVRHDEVLAAGGLHIIGTERHESRRIDNQLRGRSG
FT                   RQGDPGSSRFYLSMEDTLMRIFASDRVTGMMKKLGMEEGEAIEHPWVTKAIENAQRKVE
FT                   GRNFDIRKSLLEFDDVANDQRKVVYEQRNELLDTNDISETIHVIRDDVYGAVIDEYIPP
FT                   QSLEEMWDVPGLEARLKADFGLDLPLQQWLAEDDKLYEEKLRERILDEATKLYAHKQEL
FT                   VGVEVLRNFEKAVMLQTLDGLWKEHLAAMDHLRQGIHLRGYAQKNPKQEYKRESFDLFT
FT                   QMLETLKRDVVSILSRVQVQERDVEALEEQQRQQSEAAPRTYTHATAESQLADEEAAGE
FT                   EGHTTFVRDEQKIGRNDPCPCGSGKKYKHCHGQLT"
FT   gene            416736..417899
FT                   /locus_tag="ASA_0406"
FT   CDS_pept        416736..417899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0406"
FT                   /product="TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88586"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI64"
FT                   /protein_id="ABO88586.1"
FT                   /translation="MPTGWDASAHERWRGGQRQAAIQQLLIKLNSTAAKPVALQLQFAY
FT                   YLFLCDDPASATQVLEMAHQAAPDNDEVLRNLCVCLSRSGQHERAVERLQTLLVRTPED
FT                   FHALDGLCTSQAKRGRYVEAAAAGTRALILKDRAVRQQPQGWSLPDGEPDAWLAGRAGK
FT                   QNVIAFSLWGSAPRYLRGAVDNMLAASYLYPGWRVRFYVDESVPSTLLATLGELGAEVC
FT                   MQASGQSLRQRLCWRFQVANDPQVGRFLVRDVDSVPGVRERVAVDGWLASGRWFHIMRD
FT                   WWSHTDLVLAGMWGGVAGVLPPLDTYQPEAMETPNIDQWFLRDTLWSYLAQSCLVHDRC
FT                   FTPPGAIPWPLPAPDGTEHVGQDIFTAQGALQARRLAPWIATLPCLR"
FT   gene            417905..418315
FT                   /gene="mutT"
FT                   /locus_tag="ASA_0407"
FT   CDS_pept        417905..418315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT"
FT                   /locus_tag="ASA_0407"
FT                   /product="7,8-dihydro-8-oxoguanine-triphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88587"
FT                   /db_xref="GOA:A4SI65"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI65"
FT                   /protein_id="ABO88587.1"
FT                   /translation="MMEQKKRIWVAVGVIENEQGDIFIAKRSSDRHQGDRWEFPGGKVE
FT                   AGEDLLTALDRELWEEIGIRVLDCAPFMELHHDYPEKQVLLDIWKVTRFSGEPFGKEGQ
FT                   ECLWVPLASLHEYQFPDANGPIVGRLQASLAV"
FT   gene            complement(418392..418586)
FT                   /locus_tag="ASA_0408"
FT   CDS_pept        complement(418392..418586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0408"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88588"
FT                   /db_xref="GOA:A4SI66"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SI66"
FT                   /protein_id="ABO88588.1"
FT                   /translation="MVTKVKCPTCKTELEWGPQSPFRPFCSKRCQLIDLGEWADEEKRI
FT                   PGPINPDLLPYPDEGEQWQ"
FT   gene            complement(418596..419318)
FT                   /locus_tag="ASA_0409"
FT   CDS_pept        complement(418596..419318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0409"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88589"
FT                   /db_xref="GOA:A4SI67"
FT                   /db_xref="InterPro:IPR009777"
FT                   /db_xref="InterPro:IPR027462"
FT                   /db_xref="InterPro:IPR036268"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI67"
FT                   /protein_id="ABO88589.1"
FT                   /translation="MIYDFPLNEKSRTYLRLESLFSQIRDNLDSDQSWAHIAFFKGLFD
FT                   LQELLERGDLRADLIKDLERLGQRLSHWASLPDVDLEQIKQMQQESTQLSRNLLSASRP
FT                   GARLKEDRLLGSIRQRFSIPGGLCAFDVPQLHHWLGTPTMVRNQQMQLWLSDINLLMNA
FT                   ITLLLRLWRESGNFSDEIATNGFFQDTAENAELIRIRLPDAQQCYPTLSGHKNRFALRF
FT                   LPTTEQQIGDVPFQLACC"
FT   gene            complement(419356..419970)
FT                   /gene="coaE"
FT                   /locus_tag="ASA_0410"
FT   CDS_pept        complement(419356..419970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="ASA_0410"
FT                   /product="dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88590"
FT                   /db_xref="GOA:A4SI68"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI68"
FT                   /protein_id="ABO88590.1"
FT                   /translation="MYIVAITGGIGSGKTTIANQFAELGIDIVDADVIAREVVEPGTPA
FT                   LAAIAAQFGPEMLDPQGQLDRRRLRERVFSDPDAKAWLNGLLHPLIRQEMLRQCANARS
FT                   PYCLLVVPLLIENRLTQLANRVLVIDVDEATQIERTCRRDGVSRAQAEAILAAQASRAE
FT                   RLAAADDVLDNQNDAAETIKRRILALHETYMAFASQQASQV"
FT   gene            complement(419990..420865)
FT                   /gene="tapD"
FT                   /locus_tag="ASA_0411"
FT   CDS_pept        complement(419990..420865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tapD"
FT                   /locus_tag="ASA_0411"
FT                   /product="type IV prepilin peptidase TapD"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88591"
FT                   /db_xref="GOA:A2T195"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="InterPro:IPR014032"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2T195"
FT                   /protein_id="ABO88591.1"
FT                   /translation="MTLLLELAHGLPWLYFSLVFLFSLMIGSFLNVVIHRLPIMLEREW
FT                   QAEYRSYFSSDTPQPEDDERYNLMVPRSCCPRCNHPITALENIPLLSWLWLKGRCRGCQ
FT                   AAISARYPLVELLTALLSVVVAMTLTPGWGTLAALLLTWVLVALTFIDLDKMLLPDQLT
FT                   LPLLWGGLLFNLLGGYVPLGDAVIGAMAGYLVLWSLYWAFKLLTGKEGMGYGDFKLLAA
FT                   LGAWLGWQALPIVLLLSSLVGAIFGIGLILLRNHHQSKPIPFGPYLAIAGWIALLWGDS
FT                   ITRWYLSTIL"
FT   gene            complement(420930..422169)
FT                   /pseudo
FT                   /gene="tapC"
FT                   /locus_tag="ASA_0412"
FT                   /note="type IV pilus assembly protein TapC; frameshift due
FT                   to 1 bp deletion"
FT   gene            complement(422298..424004)
FT                   /gene="tapB"
FT                   /locus_tag="ASA_0413"
FT   CDS_pept        complement(422298..424004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tapB"
FT                   /locus_tag="ASA_0413"
FT                   /product="type IV pilus assembly protein TapB"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88592"
FT                   /db_xref="GOA:A2T193"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR013374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:A2T193"
FT                   /protein_id="ABO88592.1"
FT                   /translation="MTSSPNSGLALSLAASSLLSESDSQRYLSQAKAQRKPFVTFLIEN
FT                   EILDSKALADFCELEYGVPLLDLAAFDLAEIPQKYLNQKLIEKHHVLPIYTQGHTLYIA
FT                   MSDPTNVSALEDFGFSFGLHTEALLVEENKLTAAIGKLMESEQDALGMEEIDESEISEL
FT                   EVSDENSRLDESVNTADDDAPIVKYINKIMMDAIKRGASDLHFEPYETKYRIRFRIDGI
FT                   LHEIATPPVNLANRFSARLKVMARLDIAERRLPQDGRIKLKLSRNKSMDMRVNTLPTMW
FT                   GEKIVIRLLDSSAARLNIEQLGFDDRQKAQYLRALSKPQGMILVTGPTGSGKTVSLYTG
FT                   LNILNITEVNISTAEDPVEINLPGVNQVQVNPKAGLTFASALRSFLRQDPDVVMVGEIR
FT                   DLETAEIAIKAAQTGHLVLSTLHTNSAAETLTRMMNMGVPAFNIASSVTLIMAQRLARK
FT                   LCDHCKAPEVVPEAELLELGFTQQQLAAGLRLFKPVGCKECSGGYKGRVGIYEIMLMSE
FT                   NIAKLIMQGANSLQIAAIAQKEGMRTLRVSGLEKARLGVTSLAEINRVTTN"
FT   gene            complement(424008..424436)
FT                   /gene="tapA"
FT                   /locus_tag="ASA_0414"
FT   CDS_pept        complement(424008..424436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tapA"
FT                   /locus_tag="ASA_0414"
FT                   /product="type IV prepilin TapA"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88593"
FT                   /db_xref="GOA:A2T192"
FT                   /db_xref="InterPro:IPR001082"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A2T192"
FT                   /protein_id="ABO88593.1"
FT                   /translation="MKKQSGFTLIELMIVVAIVAILAAIALPAYQTYTQKARFTEVISA
FT                   TGPFKTAIEICAQTTGSLGGCDAGTNGVPAEVSGANGNVQSVKVDSTTNAITAEGVAAS
FT                   FGGTAYTYILVPTLTSGKINWAPNPSGTVGTCVGAGIC"
FT   gene            complement(424771..425628)
FT                   /gene="nadC"
FT                   /locus_tag="ASA_0415"
FT   CDS_pept        complement(424771..425628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="ASA_0415"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88594"
FT                   /db_xref="GOA:A4SI72"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI72"
FT                   /protein_id="ABO88594.1"
FT                   /translation="MFQQDISRAVRAALLEDLGQALTKLDQPDASADITAQLIPADRIA
FT                   SARVITREAGVFCGQPWVDEVFAQLGGEVKVEWLVQDGEPLSPNQELFRLHGPARVLLT
FT                   GERNALNFVQTLSGVATLTARYVAELAGTRCRLLDTRKTLPGLRTAQKYAVTCGGGKNH
FT                   RIGLYDAYLIKENHILACGGISEAITEAHRLNPGKPVEVEVESLAELAQALLAGADIVM
FT                   LDNFDVPMMREAVTLNQGRAKLEVSGNVTLDTLAEYAATGVDFISVGALTKHVRALDLS
FT                   MRFV"
FT   gene            complement(425633..426103)
FT                   /locus_tag="ASA_0416"
FT   CDS_pept        complement(425633..426103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0416"
FT                   /product="predicted aspartyl protease"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88595"
FT                   /db_xref="GOA:A4SI73"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR011969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR034122"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI73"
FT                   /protein_id="ABO88595.1"
FT                   /translation="MHPMARRFWLLAWLSLMGLLTLYFHHSSQPTVTASGELLLKADAS
FT                   GHYRLEGAINGQPVQLLLDTGATRVTVPLHVAERIGLTPSGHSRVNTAAGTIQVQTGQI
FT                   ETLAMGPLTLYDLPIFINPAAGGDEILVGMNALGRLELRQKDRQLLLRPLQE"
FT   gene            426253..426825
FT                   /gene="ampD"
FT                   /locus_tag="ASA_0417"
FT   CDS_pept        426253..426825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampD"
FT                   /locus_tag="ASA_0417"
FT                   /product="N-acetyl-anhydromuramyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88596"
FT                   /db_xref="GOA:A4SI74"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI74"
FT                   /protein_id="ABO88596.1"
FT                   /translation="MTQPKAFFSIDSDGWCEQARKVPSPHHNERASVDDISLLVVHGIS
FT                   LPPGEFGGPWIDDLFLGRLDPTAHPYFASIHQLRVSAHCLIRRDGELVQYVPFGARAWH
FT                   SGISSWEGREACNDFSIGIELEGTDEQPYSDAQYEVLSGLSRTISRHYPAITAQRIVGH
FT                   CDIAPGRKTDPGDSFEWQRYRQMLNFK"
FT   gene            427102..427866
FT                   /gene="pdhR"
FT                   /locus_tag="ASA_0418"
FT   CDS_pept        427102..427866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhR"
FT                   /locus_tag="ASA_0418"
FT                   /product="pyruvate dehydrogenase complex repressor"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88597"
FT                   /db_xref="GOA:A4SI75"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI75"
FT                   /protein_id="ABO88597.1"
FT                   /translation="MPYLKITQPKLADAIVAELEQMILEGSLQPGQKLPPERELAIQFQ
FT                   VSRPSLREAIQRLEARGLLYRRQGGGTYVQNALSKGIADPLFELLSTHPEAQYDLLEFR
FT                   HALEGICAYYAALRGTDADFERIRNAQSAIEEAGQQGSLVTESAAVTQFYLAVAEASHN
FT                   VVLLHLLRAMGPMLEQNILRNNEILNRRPGVVAKIRRHRAHLIEAILSGAPERARAACH
FT                   EHLAFIEDTLLDMQREDSRIQRSMRRIRQQEN"
FT   gene            427946..430606
FT                   /gene="aceE"
FT                   /locus_tag="ASA_0419"
FT   CDS_pept        427946..430606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceE"
FT                   /locus_tag="ASA_0419"
FT                   /product="pyruvate dehydrogenase E1 component"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88598"
FT                   /db_xref="GOA:A4SI76"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI76"
FT                   /protein_id="ABO88598.1"
FT                   /translation="MSDILKNDVDPIETLEWLASLESLLREEGPQRAQFILEQLAEKAR
FT                   VSGVDVAAKANRDYINTIPSSDEPAYPGDLEMERRIRAIIRWNAMMIVLRASKKDLDLG
FT                   GHMSSFASSATIYEVCYNHFFRARSEKDGGDLVYFQGHISPGIYARAFAEGRLTEDQLD
FT                   NFRQEVDGKGIPSYPHPKLMPDFWQFPTVSMGLGPIAAIYQARFLKYLTDRGIKDCSEQ
FT                   TVYAFLGDGEMDEPEAKGALTVAVREKLDNLVFVVNCNLQRLDGPVVGNGKVINELEGL
FT                   FAGAGWDVTKVIWGRKWDELLKKDTSGKLIQLMNETVDGDYQTMKSRDGGYVREHFFNR
FT                   YPETAALVKDMTDEEIFALNRGGHDPRKLFAAFSKAAATKGKPTVILAKTIKGYGMGEA
FT                   AEGKNIAHQVKKMDLGSVRHLRDRFSLPVTDEQLENLPYLKIEEGTEEHKYLHARRAAL
FT                   KGYVPTRLRETTTKLDIPALETFGPLLGEQAREISTTMAFVRSLNVLLKDKSIGKRIVP
FT                   ILADEARTFGMEGLFRQIGIYSPHGQQYTPQDRDIVSYYKEDKQGQVLQDGINELGAMS
FT                   SWLAAATSYSTNDCPMIPFYIYYSMFGFQRVGDMAWAAGDQQARGFLLGATSGRTTLNG
FT                   EGLQHEDGHSHILANTIPNCISYDPSYAYEVAVIVQDGLRRMYGEKPENVFYYITTLNE
FT                   NYAMPAMPEGAEEGIRKGIYKLETVAGTKGKVQLLGCGSILGHVRTAAQILASEYGVGS
FT                   DVFSVTSFNELARDGQDVDRWNMLHPTAEARVPYIATVLGSEATIAATDYMKSFADQVR
FT                   AFVPTEHYRVLGTDGYGRSDSRANLRRHFEVNEFYVVVAALTELAKRGEIDKQVVADAI
FT                   AKYGIDADKVNPLYA"
FT   gene            430692..432584
FT                   /gene="aceF"
FT                   /locus_tag="ASA_0420"
FT   CDS_pept        430692..432584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceF"
FT                   /locus_tag="ASA_0420"
FT                   /product="pyruvate dehydrogenase E2 component"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88599"
FT                   /db_xref="GOA:A4SI77"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI77"
FT                   /protein_id="ABO88599.1"
FT                   /translation="MSKQIMVPDIGADEVEVTEIMVAVGDKVELDQSLIAVEGDKASME
FT                   VPAPAAGIVKEILIKVGDKVATGSQIMIFEAEGAAAPAPAQVAAPVAAAAPAAPVAAAR
FT                   KDVHVPDIGDDEVDVTEIMVAVGDMVEADQSIIAVEGDKASMEVPAPFAGRVVEIKVAA
FT                   GAKVATGSLVMVFEVAGAAPAAFAAPVETAASVAAAPVAAAAKEVNVPDIGGDEVEVTE
FT                   IMVAVGDKVEADQSLIAVEGDKASMEVPAPFAGIVKEIKVKAGDKVSTGSLIMVFEVAG
FT                   AAPAAAAPVAQAAAPVAAAPVAAAPAPVAQAAAASDFVANDAYVHAAPAVRRLAREFGI
FT                   NLAKVKASGRKGRIVKEDVQAYVKDAVKRAESAPAAGTGTGNGMSVLPWPKVDFSKFGP
FT                   VEELELTRIQKISGPALHRNWAMIPHVTQFDEADTTDLEAFRKEQNAMLEKQKSDVKIT
FT                   PLVFILKAAAKALEAHPRFCSALSEDGSKLIMKKYIHIGVAVDTPGGLVVPVVRDVNKK
FT                   GIYELSRDLAEISKKARAGKLTAADMQGGCFTISSLGGIGGTSFTPIVNAPEVAILGVS
FT                   KSEMKPKWNGKEFVPRLMLPLALSYDHRVIDGADGARFVTTLSGVLSDIRRLVL"
FT   gene            432742..434172
FT                   /gene="lpdA"
FT                   /locus_tag="ASA_0421"
FT   CDS_pept        432742..434172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpdA"
FT                   /locus_tag="ASA_0421"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88600"
FT                   /db_xref="GOA:A4SI78"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI78"
FT                   /protein_id="ABO88600.1"
FT                   /translation="MMSKEIKTQVVVLGAGPAGYSAAFRAADLGLDTIIVERYSTLGGV
FT                   CLNVGCIPSKALLHVAKVIEEAKALSEHGIIFGAPQTDIDKVRLWKEKVINQLTGGLAG
FT                   MAKMRKVQVVNGFGKFTGPNTLEVDGADGKTTVTFDNAIIAAGSRPVKLPFIPHDDPRV
FT                   WDSTDALELTSVPGKLLVIGGGIIGLEMGTVYSSLGSEIDVVEFADQLVPAADKDIVKI
FT                   YTKRVAKKFNIMLETKVTAVEARADGLYVSYEGKHAPAEPVRYDNVLVAVGRVPNGKLM
FT                   DAEKAGVAVTERGFIEVDKQLRTNVAHIHSIGDIVGQPMLAHKGVHEGHVAAEVIAGKK
FT                   HYFDPKVIPSIAYTEPEMAWVGLTEKEAKQQGLNFEVATFPWAASGRAIASDCSDGMTK
FT                   LIFDKESGRVIGGAIVGTNGGELLGEIGLAIEMGADAEDIALTIHAHPTLHESVGLAAE
FT                   VFEGSITDLPNAKAKKKK"
FT   gene            434302..435258
FT                   /locus_tag="ASA_0422"
FT   CDS_pept        434302..435258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0422"
FT                   /product="GGDEF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88601"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI79"
FT                   /protein_id="ABO88601.1"
FT                   /translation="MQTPATPDNERLRLDALRRMAILDTSAEERFERITRMARNMFDVP
FT                   ISLVSLVDEDRQWFKSCCGLPVPETPRDISFCGHAILGDDLFVVEDATRDLRFADNPLV
FT                   SGDPHIRFYAGSPLQIGEGYKLGTLCIIDRKPRLLDERQRDLLTDLAGMVERELAAIQL
FT                   ATMDELTGITNRRGFMLLAHKCLQLAHRQGRAATLLFLDLNRFKEINDRLGHDVGDDAL
FT                   RQMASLMCGVFRDADIFARLGGDEFAVLLPGTGPAEVPRVLARLDEALAGFNRESGKPY
FT                   RLSCSVGVGHYDALSPPALDQLLQQADKQMYDCKKGR"
FT   gene            complement(435255..435437)
FT                   /locus_tag="ASA_0423"
FT   CDS_pept        complement(435255..435437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0423"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88602"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI80"
FT                   /protein_id="ABO88602.1"
FT                   /translation="MSKLVVTMLLGSLLCACSSGPVRVHGADVSVDDTRIRVSDGSNGG
FT                   NGTFCPPGQAKKGRC"
FT   gene            complement(435573..436673)
FT                   /gene="hylB"
FT                   /locus_tag="ASA_0424"
FT   CDS_pept        complement(435573..436673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hylB"
FT                   /locus_tag="ASA_0424"
FT                   /product="hemolysin secretion protein HylB"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88603"
FT                   /db_xref="GOA:A4SI81"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI81"
FT                   /protein_id="ABO88603.1"
FT                   /translation="MLEGKLTLKLQLILAVTVPCLALLLVGGASLRSMGSIQQQSTELY
FT                   QNTATPMRAMAEVVSRIPRMRVGIDMMLLQDTSLKDERGVLSRVKDARDEDIPEMRQAM
FT                   QQAVTAQTDPAARADAQKLLSQFEGMERNELNPMLQALEKGDMEAARGIYRDRYTVTYG
FT                   TMRKDANTLLDGLIQQAQQRHQRGEQSYASGRMQMITIISGAILISLLVSVLILINLKR
FT                   RVGFLQQYIGYAAEHLALDSRAKLTGNDELAEITESFNHFVSKIHSAIEQVARNSHQLA
FT                   ATADEVASKAQLTQQNCTAQRDRTVQVATATEEQSSVVGELNRNVEDINQLTMETADIA
FT                   HQLTDASRSLQQLSGELDKLVGNFRL"
FT   gene            complement(436838..438734)
FT                   /pseudo
FT                   /locus_tag="ASA_0425"
FT                   /note="methyl-accepting chemotaxis protein; frameshift due
FT                   to 13 bp deletion"
FT   gene            438981..441251
FT                   /locus_tag="ASA_0426"
FT   CDS_pept        438981..441251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0426"
FT                   /product="patatin family outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88604"
FT                   /db_xref="GOA:A4SI82"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI82"
FT                   /protein_id="ABO88604.1"
FT                   /translation="MENHMRIFRRGWTHLFLILLAGLPLMAAAQSERPRIALVLSGGGA
FT                   KGSAHIGILKVLEEKRIPVDIIVGTSMGSYVAGMYAMGLSAEEVERTTLAIDWNKGYQD
FT                   KVGRDELSLRKKQQSEKYQLRTDIGVNGDAVQFPDGFFQGQSMASLLRHATSNLPAQKS
FT                   FDDLPIPYRAVATDMETVTPFVLEGGSLAKAMQASMSIPGALKPVEWEGHILADGGTVN
FT                   NMPVDVAKGMGADVVIAVDIGARLRTRESLKSGLAMIDQLTTYMTQVGTDKQRALLGPQ
FT                   DILLTPEFGNMGIADFSLMPEGIKQGEAVANRAATQLDALSLSPREYAVYRNQKLSRRA
FT                   ERSGQPAYYIDKVEILNKSRLSDETVRAMLKVKPDKIQTNESLEAGIRRLYALESFDRI
FT                   TYEVEERDGENVLVVDASEKNWGPGYLNFQFGFSDDFESSSNYNVGMSYTLTNLNEWGA
FT                   EWLTEASLGTAKHLKTDFYSPLEPSQTFYGEASFAYDKTLRSLFNPDPEDQSFNYLDTE
FT                   YSFFSTDLALGWNLQPWSRLSLGVDGKMGSIDVRNLNGVNSDAISWGPYVRFEHDTLDS
FT                   RYFPYEGVFWDIKGGYSHVRLDYHNDNEENERNEGVNYHLSMIKPWSWDRHSLNLILEG
FT                   GGSTSQEEVPLLVQDLGGLFRLSGFQHYQLSGRYSLFGGLRYIYRVVDNDFGALRAPLY
FT                   LGGSLEQGGVWDKGEDISIESSFTGGSVYVGIESFLGPIFLGYGIAEGGNNMFYLQLGT
FT                   TFE"
FT   gene            441480..444077
FT                   /gene="acnB"
FT                   /locus_tag="ASA_0427"
FT   CDS_pept        441480..444077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acnB"
FT                   /locus_tag="ASA_0427"
FT                   /product="aconitate hydratase 2"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88605"
FT                   /db_xref="GOA:A4SI83"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004406"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015929"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015933"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="InterPro:IPR036288"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI83"
FT                   /protein_id="ABO88605.1"
FT                   /translation="MLETYRKHVAERAAEGVVAKPLDAEQVAALVELIKNPPAGEEDFL
FT                   KELLSSRIPPGVDEAAYVKAGFLTAIAKGEAHSPILTAAQAVELLGTMQGGYNIQPLID
FT                   LLDHATLAPLAAKGLSHTLLMFDSFHDVEEKAKAGNAHAKQVMQSWADAEWFLSRPELA
FT                   EKITVTVFKVTGETNTDDLSPAPDAWSRPDIPLHALAMLKNARPGITPDNDGTVGPIKT
FT                   IDALKEKGFPLAYVGDVVGTGSSRKSATNSVLWFMGDDIPFVPNKRAGGVCLGGKIAPI
FT                   FFNTMEDAGALPIEVDVSKLEMGDVIDIYPFGGKICKHGTDQVLAQFELKTDVLIDEVR
FT                   AGGRIPLIIGRGLTDKAREALGLPFSTVFRRPVPVADTGKGYTLAQKMVGKACGVQGIR
FT                   PGTYCEPRMTTVGSQDTTGPMTRDELKDLACLGFSADLTMQSFCHTAAYPKPIDVQTHH
FT                   TLPDFIMNRGGVSLRPGDGVIHSWLNRMLLPDTVGTGGDSHTRFPIGISFPAGSGLVAF
FT                   AAATGVMPLDMPESVLVRFKGELQPGITLRDLVHAIPYAAIQKGLLTVEKAGKKNIFSG
FT                   RILEIEGLPTLKVEQAFELADASAERSAAGCTIKLDQAPITEYLKSNIVMLKWMLSEGY
FT                   GDPRTITRRIRGMEEWLAKPVLLEADKDAEYAEIIEIDLATIKEPILCAPNDPDDARLL
FT                   SDVAGSKIDEVFIGSCMTNIGHFRAAGKLLEKYQGELPTRMWIAPPTKMDKDQLTEEGY
FT                   YGIFGRVGARIEIPGCSLCMGNQARVAEGASVVSTSTRNFPNRLGKGANVYLASAELAA
FT                   VAAILGKIPTVAEYLQYAKTLDATAADTYRYLNFNEIASYTKKADAVILQQAV"
FT   gene            444410..445993
FT                   /locus_tag="ASA_0428"
FT   CDS_pept        444410..445993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0428"
FT                   /product="EAL domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88606"
FT                   /db_xref="GOA:A4SI84"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI84"
FT                   /protein_id="ABO88606.1"
FT                   /translation="MHFFYIDLSRRWLRLCCALMVFILPLLVGGWATHKSYMEELESGS
FT                   AAAAHKAMTLMENMLDHAERANRQVLPLVGAPCDEINFQLREQVALVPFVRSVNLVKEG
FT                   MLYCTSLFGSVREVDDASPYIARKLLLMRGNQVRANHPLLIVRSEQGRNAALSAIDGEY
FT                   LSVMLTLSHHAGNLFMRVGSTWFDEAGHYLDKAPDLHALARTELTSPHYPFSIHAGYVT
FT                   LAYWHSLWDHKSLILSLLCGLSLAFALLVWWLLGRPGSPVGELRRALRAKEFEPYLQPL
FT                   VTTSDTRLMGVEVLMRWQHPNSGLIRPDLFIPQAEESGLIVPMTTLIMKKVAQVLSREQ
FT                   ARLPDGFHISFNISAAHCRDLALLQECRTFLAQFAPGKIVLVLELTERELLVVDPNTLS
FT                   LFRQLDQMGVKLAIDDFGTGHSSLFYLQQFHVDYLKIDQSFIGRIGTESLSEHIVANVI
FT                   DLGARLGLLLIAEGVESELQAAYLRAKGVDYMQGYLFGRPMPLQHFCDDLPQGDALAGS
FT                   LPELADPHLG"
FT   gene            complement(446248..446997)
FT                   /locus_tag="ASA_0429"
FT   CDS_pept        complement(446248..446997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0429"
FT                   /product="short-chain dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88607"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI85"
FT                   /protein_id="ABO88607.1"
FT                   /translation="MLTVKSLSGQVAFVQGGSRGIGAAIVKRLARDGAAVAFTYVSSAS
FT                   KAEEIVATITAAGGKALAIRADSADAIAVQHAIRQTVTTFGRLDILVNNAGVLVWGDIE
FT                   ELTLDDLDRTLAVNIRSVFVACQEAAHHMGKGGRIINIGSTNADRIPMVGGSVYAMSKS
FT                   ALVGLTKGMARDLGPKGITVNNVQPGPVDTDMNPADGESAAQLKGMMALARYGKDEEIA
FT                   SFVAYLAGPEAGYITGASLTIDGGFSA"
FT   gene            447174..448097
FT                   /locus_tag="ASA_0430"
FT   CDS_pept        447174..448097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0430"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88608"
FT                   /db_xref="GOA:A4SI86"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI86"
FT                   /protein_id="ABO88608.1"
FT                   /translation="MALQDPFLSVRHFVAVAQSGSFTVAALTLGLTGSALSKSIVRLEA
FT                   RLGVKLLHRTTRRVSLTLEGEAYLASCLQAIRVLEETESSFASEKQSPSGRVRIDLPSA
FT                   FGRRHVLPILLDLAGSHPQLDLSVTFNERKVDLIEANIDLVVRIGALEDQADLVARRLG
FT                   EQKLVICGAPSYLALHRVPLTPKDLSQHDCIIDWRSGHRHSWLLRNGAGRTEAYDIPVR
FT                   YEMGDGEAVLAAALAGLGLVQVPTWLVNEQLDSGALVCVLHDQSGGEMPINVIWARSQH
FT                   MQLKLRVVVDALLLAAQKSGSGFRAR"
FT   gene            complement(448169..449011)
FT                   /locus_tag="ASA_0431"
FT   CDS_pept        complement(448169..449011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0431"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88609"
FT                   /db_xref="GOA:A4SI87"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI87"
FT                   /protein_id="ABO88609.1"
FT                   /translation="MAARTENFSRAADELHLTHGAISRAVRLLEEDLGIGLFERRQRRV
FT                   FLTEAGSRLHEAVKEGLGRIRETAQALRQQSKPQSLVISCEPTLLMRWLIPRWPAFQAL
FT                   HPELDVHLMAGGGALSFGSGIDLAIRRNDFHWPDDLYSQLLFEEQTGPVCQPGKVAQFF
FT                   EQGGELPALRPSAPRLHTKTRPAAWQSWQEQARQSTSDEAPTQTFEHFYFSLQAAVAGL
FT                   GVAIGPYRLVCDDIAAGLLAAPLGFIPDGTGYHLLAPAPPIPGSPHEKLANWLQSLSK"
FT   gene            449158..449775
FT                   /locus_tag="ASA_0432"
FT   CDS_pept        449158..449775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0432"
FT                   /product="lysine exporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88610"
FT                   /db_xref="GOA:A4SI88"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI88"
FT                   /protein_id="ABO88610.1"
FT                   /translation="MTELLAVVAITFFAVISPGPDFAMVSRNSLLLSRRTGVLTALGIA
FT                   AGVCVHVTYTLLGVGLLIQQSLWLFNLIKLAGAAYLIFLGIKMLRARPVTHEEMASQPT
FT                   LSSLGALRTGFLTNVLNPKTTIFIVSLFMQVVRPETPLGVQLGYGAFIVLAHGVWFSAV
FT                   ALFFSTASVRARLLAVRHWIDRVFGGLLVGFGMLLALTQQSR"
FT   gene            449995..451287
FT                   /locus_tag="ASA_0433"
FT   CDS_pept        449995..451287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0433"
FT                   /product="FAD-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88611"
FT                   /db_xref="GOA:A4SI89"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR010031"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI89"
FT                   /protein_id="ABO88611.1"
FT                   /translation="MWRPKNRDELQALLREYPERKLRLIGSGLSFEPIHSVYAEGSQAL
FT                   LVDLYHLRGQLAKTADTVTYQAGTPLDTIYADLIAMERMLPASPGVIGIQTLGGALSTG
FT                   THGQGLHQSALCDAVEAMTVMLASGDIIRVGRTDPRFGAFVMGMGMLGILLDVRLRTVP
FT                   NRIMRCTKFTTDYPFLLEHNERLNREHGFVKSWWFAWTGESHIWLVDPASEEEVARYRA
FT                   AGSEPLLLEGDIDARMNATIDATLQKMAKDTKDEALAGEHFETVRRFKDASDLVGNVYQ
FT                   ILCKGIPAPQINCEVAVPLHRMNEALETLQAWQQANPGVLHYPFILRCTGPSEAWLSAA
FT                   YDKSVCWVGFLVYLAADGTFVNGSMEQMRELQQLLVPLGGIPHFGKHLAMDLYDFPALL
FT                   PRWNDFLALKGELDPHGRFENRWLSDLFANR"
FT   gene            451359..452486
FT                   /locus_tag="ASA_0434"
FT   CDS_pept        451359..452486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0434"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88612"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI90"
FT                   /protein_id="ABO88612.1"
FT                   /translation="MTDMQDTRIPVTLLTGFLGSGKTTLLNHWVKQPELGECAVLINEF
FT                   GSVGLDHHLVQQVDEQVVLLDSGCICCSVQGSLVEALQGLFMRAIQRKIKPFKRLIIET
FT                   TGLADPAPVLFTLREEGFIAQRYRFDGTVTVVDAGHIEQQLAAQYEAVKQVALADLLVV
FT                   SKGDLVDGDQLERVEAQLAALNPAAPIERVTNGELSPAVLEKLGAYNEEAGRDVRQLLA
FT                   WLRTESPKQGLASPMQPKMKPLAAKVGTAAPTHFEHGNIESFSLRIGEPLKPSRLLAAI
FT                   DAVQAQYGDALLRLKGILQLEGESQPVVIHGVHGQLYPLQALGDWPEGKAQSRLVFIVK
FT                   SQDKAGIERLFLDTLKAPEPSLEEQLRAMLGQPDA"
FT   gene            452548..453936
FT                   /locus_tag="ASA_0435"
FT   CDS_pept        452548..453936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0435"
FT                   /product="drug resistance transporter, EmrB/QacA family"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88613"
FT                   /db_xref="GOA:A4SI91"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI91"
FT                   /protein_id="ABO88613.1"
FT                   /translation="MPDSTHMVTPAQRKWLPPLAAVGFFMQTLDGTILNTALPSMAETL
FT                   GESPLQMQSVIIAYMLTVALLIPASGWLADRFGTRRIYLAAILLFTLGSLACAAANTLP
FT                   MLVAARVLQGIGGALLMPVGRLAVLRVYSKHELLRVMSFVTIPGLVGPLIGPALGGWLV
FT                   EVASWHWVFLINLPVGILGFIASWHFMPDLRQGTAKFDWQGFVLFSAGMVLVSVGLQGL
FT                   GEHSISTGWALFALLFGLAAMASYWLYAANAEQPLFSLALFKTSTFAIGVWGNLFARLG
FT                   SGAMPFLTPLFLQLGLGFSPSKAGMTMIPTVLGAMLTKTLVNKLIPRIGYRRILIGNTL
FT                   ALGVMIASFALIDNLLPYGVLLGWLMVFGAINSLQFSAMNTLTLQDLSPEHASSGNGLL
FT                   SVVMQLSMSLGVAIAASLLGLFSAGSSALGGQWLAGFHLTYLCIGLMSMLAALIFAQLA
FT                   RDKG"
FT   gene            complement(453957..454445)
FT                   /locus_tag="ASA_0436"
FT   CDS_pept        complement(453957..454445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0436"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88614"
FT                   /db_xref="GOA:A4SI92"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI92"
FT                   /protein_id="ABO88614.1"
FT                   /translation="MPLDTIHDFNCQLLAPLPHQRYQHEPILDYATDERVRARFGWQAV
FT                   FSKTLFLKFKDGRFALLLTHQGGRLDNKAVKAALGAKPSICTAEEMQAEIGCLPGAVCP
FT                   FLPRADIPLLVDPQLMEHHAFTWTPGHPEQTFLLETAHLAQVLEQLPCLVSYLPAPSA"
FT   gene            complement(454570..455079)
FT                   /gene="folK"
FT                   /locus_tag="ASA_0437"
FT   CDS_pept        complement(454570..455079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="ASA_0437"
FT                   /product="7,
FT                   8-dihydro-6-hydroxymethylpterin-pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88615"
FT                   /db_xref="GOA:A4SI93"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI93"
FT                   /protein_id="ABO88615.1"
FT                   /translation="MTRIYISLGSNIEREHHIRAGLDALHAEFGELTVSRVFESEAVGF
FT                   AGRPFYNLVVGADTDMPLATLCQRLRAMEFAHGREPDAKKFAPRTLDLDLLLYGDLVCD
FT                   VPVALPRGEILTNAFVLWPLAELAPSLHHPVDGRTLDELWQGYDKASQRLNPIPFHWEA
FT                   RELQHH"
FT   gene            complement(455132..455503)
FT                   /gene="folB"
FT                   /locus_tag="ASA_0438"
FT   CDS_pept        complement(455132..455503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="ASA_0438"
FT                   /product="dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88616"
FT                   /db_xref="GOA:A4SI94"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI94"
FT                   /protein_id="ABO88616.1"
FT                   /translation="MDKVFIRGLEVLTTIGVYEWEKGIRQKLCFDLEMGFDNRPAAATD
FT                   DINLALDYATLSRKICDHAASKVVELVETMAEQVAMLVLADERVQWVKVTLTKPSAVPN
FT                   AAGVGVEILRHRTPAASAC"
FT   gene            455673..456335
FT                   /locus_tag="ASA_0439"
FT   CDS_pept        455673..456335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0439"
FT                   /product="conserved integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88617"
FT                   /db_xref="GOA:A4SI95"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SI95"
FT                   /protein_id="ABO88617.1"
FT                   /translation="MTALTILMIILAYLGGSLSSAVLVSRITGLPDPRDHGSHNPGATN
FT                   VLRLGGRVAALVVLLLDVLKGTAPVYLAWYLQIKPVYLGFIGVAACLGHMYPIFFHFRG
FT                   GKGVATALGTMMPIGFTMGGAVIGTWLVVLLVSGYSSLASIITVLLSPLFTYLIKPEYT
FT                   LPVSLLSCLILIRHHENIARLLKGEEPRVWGRQAQRRQEEVGEMDDVAQKRDERDKK"
FT   gene            456383..456458
FT                   /gene="trnF"
FT                   /locus_tag="ASA_0440"
FT   tRNA            456383..456458
FT                   /gene="trnF"
FT                   /locus_tag="ASA_0440"
FT                   /product="tRNA-Phe"
FT   gene            456510..456585
FT                   /gene="trnT"
FT                   /locus_tag="ASA_0441"
FT   tRNA            456510..456585
FT                   /gene="trnT"
FT                   /locus_tag="ASA_0441"
FT                   /product="tRNA-Thr"
FT   gene            456596..456671
FT                   /gene="trnF"
FT                   /locus_tag="ASA_0442"
FT   tRNA            456596..456671
FT                   /gene="trnF"
FT                   /locus_tag="ASA_0442"
FT                   /product="tRNA-Phe"
FT   gene            456680..456755
FT                   /gene="trnN"
FT                   /locus_tag="ASA_0443"
FT   tRNA            456680..456755
FT                   /gene="trnN"
FT                   /locus_tag="ASA_0443"
FT                   /product="tRNA-Asn"
FT   gene            complement(456930..457262)
FT                   /locus_tag="ASA_0444"
FT   CDS_pept        complement(456930..457262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0444"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88618"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI96"
FT                   /protein_id="ABO88618.1"
FT                   /translation="MNQLITYIKAIHRQPGQATITHQQSEHYSENDESGTLIQHQQTTY
FT                   WFANGVVICHQREQDQVPSEQLCAECWISYRVVTSHIPITPPRKLFHNPCQEAFWLKMQ
FT                   GITPAR"
FT   gene            457393..457908
FT                   /locus_tag="ASA_0445"
FT   CDS_pept        457393..457908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0445"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88619"
FT                   /db_xref="InterPro:IPR012550"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI97"
FT                   /protein_id="ABO88619.1"
FT                   /translation="MGIPQDKAELLLVIDTNFGKLLKALQAVPENRVQELAMEGHSKGT
FT                   SMSVANLVAYLIGWNELVIKWIERDAAGLPVDFPETGFKWNELGRLAQKFYRDYEGLAY
FT                   PALLARLMAARARIVELIVTRSDDELYGRPWYEQWTLGRMIQFNTASPYHNANGRLRKW
FT                   LKGNCIRV"
FT   gene            458601..459125
FT                   /locus_tag="ASA_0446"
FT   CDS_pept        458601..459125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0446"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88620"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI98"
FT                   /protein_id="ABO88620.1"
FT                   /translation="MDEFIQEGKYASHETLKGYAYSWQTLSLLMQEVITNGMYVPEFLP
FT                   DENQPVLLVVVKEATVLKAKSLHSEAPEVLISIASHTRESVRDDDNGYYADYWRLAAGT
FT                   IQLIDCAEDAVFWLPLPAVETWEPYHFSGYGTPFDALSAPLPVFQHLAFVLKPEQAQPD
FT                   LGTTIYLKSTI"
FT   gene            459145..459639
FT                   /locus_tag="ASA_0447"
FT   CDS_pept        459145..459639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0447"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88621"
FT                   /db_xref="UniProtKB/TrEMBL:A4SI99"
FT                   /protein_id="ABO88621.1"
FT                   /translation="MNSKTNKQAASQQTNTQPENKASDKPILSAKVILTSGVAMLLSPG
FT                   STTTVGYEIGHEPEQTELLIRLTGSSGGGLCSKEWFGLAQVVDLLNEQQSDKAFTSGLF
FT                   KVIWHFKGSSNNAGFLAAVLRHLELTKAAPEVRFGHLITGKHTEWFESLKAKLPKVSTT
FT                   N"
FT   gene            459739..460152
FT                   /locus_tag="ASA_0448"
FT   CDS_pept        459739..460152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0448"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88622"
FT                   /db_xref="InterPro:IPR021248"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIA0"
FT                   /protein_id="ABO88622.1"
FT                   /translation="MRISHDLQTLLEQAISSALEDFPDEIPDGTTPATLTLNYRDPDYS
FT                   ATTGGYHPVEIRLERWDDGWHLRYVTDFAYVGQGWCTELAKELDFDFSVGEYTHSLMGE
FT                   MSLAEVNEWFDVWQQSFCCYAQMDVFTLTVTPD"
FT   gene            460336..461562
FT                   /locus_tag="ASA_0449"
FT   CDS_pept        460336..461562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0449"
FT                   /product="phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88623"
FT                   /db_xref="GOA:A4SIA1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIA1"
FT                   /protein_id="ABO88623.1"
FT                   /translation="MSDLPSRFRFTQKAIEALPPNPANAKSTEAEYSDTQISGLKCLVG
FT                   KGEGNKKFLMRYLWHGRKRAIAIGRFPDVDLNTAREIATEYKRLLSQGIDPKQLKEDKR
FT                   QELTLYELFQLHYLPYAKHHKRSWQNDEQRFRDHLQPPMGSRLLSEINLEQGQALQTSL
FT                   MSQCKPATNNRITTLLKAILTWSVRMGYLEQHPLVYLKTLPENNQRTRFLDKAEIRRLF
FT                   MAADADENRYAGQYVKLLLLTGLRKDELRLAKWEHIDKVHQTLFIPHTKNGKSRILHMN
FT                   HMAMQVLQDTPVIAGNAYLFPGQKPGQPLNNVTKPFNRMLKRAQIEGQVCIHTCRHSVA
FT                   ALIVSSGGTLYDVQAQLGHSSSQSSQRYAHLHASRLRHTSAQVANCVEQALISPGVVKV
FT                   EPLALQRAG"
FT   mobile_element  462439..464837
FT                   /mobile_element_type="insertion sequence:ISAS4"
FT   gene            462548..464811
FT                   /pseudo
FT                   /locus_tag="ASA_0450"
FT                   /note="IS630-family transposase; interrupted by ISAS3"
FT   mobile_element  463356..464587
FT                   /mobile_element_type="insertion sequence:ISAS7"
FT   gene            463419..463712
FT                   /locus_tag="ASA_0451"
FT   CDS_pept        463419..463712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0451"
FT                   /product="IS3-family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88624"
FT                   /db_xref="GOA:A4SH98"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH98"
FT                   /protein_id="ABO88624.1"
FT                   /translation="MTRQRYPETFKIEAVKQITERGRPVADVARALGVSSHSLYAWLKQ
FT                   YGKPADQQHEESALQAEIRRLKAELRQVTEERNILKEAAAYFASESRKGTRS"
FT   gene            463841..464569
FT                   /locus_tag="ASA_0452"
FT   CDS_pept        463841..464569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0452"
FT                   /product="IS3-family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88625"
FT                   /db_xref="GOA:A4SH99"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A4SH99"
FT                   /protein_id="ABO88625.1"
FT                   /translation="MVKQSWLESGAVYGYRKIHRDLCDLGEACGKHRVAKLMRREGLRS
FT                   QTGYQRRKGHYGGKSPQAAPNTLARQFKVPAPNISWVTDITYIRTQEGWLYLAVVLDLF
FT                   SRQIIGWAMKPRMTAGLAVDALLMAVWRRKPTQPVLVHSDQGSQFTGGEWQDFLKAHNL
FT                   SCSMSRRGNCHDNAVAESFFQLLKRERIKRRIYSTRDEARSDVFDYIEMFYNPIRRHGS
FT                   NDGLSPVEFERQFICQQQSV"
FT   gene            464875..465306
FT                   /locus_tag="ASA_0453"
FT   CDS_pept        464875..465306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0453"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88626"
FT                   /db_xref="InterPro:IPR037883"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIA4"
FT                   /protein_id="ABO88626.1"
FT                   /translation="MTTNFFNLNERYSLDAYKPASTVDDIIALHNYFSGIDIPQEYIDF
FT                   ITQLTEAEILILDESYVRIWSAIGCIEMNSAYNIQKYIPGSIAIGDDEGGKVVFYANGK
FT                   EGFGLYKVGFGDLDINAAEWISPSLVSFLIDGIGADLFI"
FT   gene            465608..467164
FT                   /locus_tag="ASA_0454"
FT   CDS_pept        465608..467164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0454"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88627"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIA5"
FT                   /protein_id="ABO88627.1"
FT                   /translation="MTHRALWLALAVSMLAACTSTASLTDAELSQAAKQGDGRAQYELA
FT                   KRLANQPDYPNAMHWMQQAAEQSGPLAADQQIRANAAWQVGDWYQAGLGEPRNPALATQ
FT                   WWQRSARLGNINASYRLGLMCQEQHRGKLVSECLDWFEQAAKRDHADAQLVLAQWYSKQ
FT                   PGADTDAIKWLEKAAELGNRDAQYLLGERYAQGQGVAKRPDIALRWNDKAAAQQQPDAL
FT                   LLQAKQAAPADAFRAYQRAANAGSAEAELWLGMAYLAGEQVSADPALGRYWLELAAGHG
FT                   SHEAEYQLSLQQVDQEQQIHWLTRAADGGVTKAWFDLAELQNEQGALEQARASYAKAAQ
FT                   QGHTAAQYAYGEMLRLGQGGKEDYAQAIKQYRLAAQQGDRMAQYRMGTLREEGLGAPRN
FT                   RVHAYAWLSMAATEGMSEAVQARDELEAAMTKPEVKQAQKLSEHWFSKISSSVRKSLKE
FT                   TEGKAPQSDRFLHQCWVSAPDCSNYFKVSVQLVETRTIHSDLLMFMMGLGGKEVSALPL
FT                   V"
FT   gene            complement(467174..467671)
FT                   /locus_tag="ASA_0455"
FT   CDS_pept        complement(467174..467671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0455"
FT                   /product="transposase B"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88628"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIA6"
FT                   /protein_id="ABO88628.1"
FT                   /translation="MNQALGRSRGGFGSKIHLVTDGNGLPLGFCLSPGQSAEIRYATSA
FT                   LAMARIPTSSGRYRTRPAHLAADKAYSSRALRAELRRRRIKAVIPQRSDQQRHHKGRPL
FT                   VLDKARYRRRNVVERCFGWLKKFRRFSTRYEKLAGSFAAFIKLAFCLRYLRELLVDRKP
FT                   AF"
FT   gene            complement(467668..468027)
FT                   /locus_tag="ASA_0456"
FT   CDS_pept        complement(467668..468027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0456"
FT                   /product="probable transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88629"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIA7"
FT                   /protein_id="ABO88629.1"
FT                   /translation="MSRRYQLTDAQWGLIEPLFPYHRISGRPTREPRQVLDGILWILHT
FT                   GAPWRDLPERFGLWSSVYNTFRRWQSTGHIDAILEALQLHLNEAGLIDFDLWCIDGSNV
FT                   RASKDAAGARKKTLL"
FT   gene            468166..468233
FT                   /gene="trnL"
FT                   /locus_tag="ASA_0457"
FT   tRNA            468166..468233
FT                   /gene="trnL"
FT                   /locus_tag="ASA_0457"
FT                   /product="tRNA-Leu"
FT   gene            468522..469865
FT                   /locus_tag="ASA_0458"
FT   CDS_pept        468522..469865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0458"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88630"
FT                   /db_xref="GOA:A4SIA8"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIA8"
FT                   /protein_id="ABO88630.1"
FT                   /translation="MNATELWQLSPEQFNEWRRENDYPLIWDLLVASLPYFSDWMAEQK
FT                   IEKSVIFQIGIARFISSRSVLSLCVYMSDDKIRLYETASSALESLRKSGLVRSEMRFEP
FT                   YCMWLAGKHGKDEVKRVQSLLSVSENNKGEAQVLGKHRLLNIGGVELKSPIISGRLLDF
FT                   TCLDELSLDGAVNNSKVYLWHCSAKGVRVNGGVIGLDLFDSLLWDHRAWAKKRELALED
FT                   GVFQDFTIECEEIRFHSSRAVLKNFNVRAKNFDATMEHTNLDKVQVAYNENGRIDHSEA
FT                   SKLYRNAKRLFSSVGDTVDAGECYYHEKLHEMKSLASPRELFKERWLRSGPLRKGWLSL
FT                   LCYLKCGSKFVSFITWGFGERPIRSLLMSMVVILLATLTYFLAPASVTYHHLGRSLYFS
FT                   IVTFVTLGYGDISQTSSPLQLLSAIEAFSGMFLTGLFLAGFASKTKQY"
FT   gene            469921..470436
FT                   /locus_tag="ASA_0459"
FT   CDS_pept        469921..470436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0459"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88631"
FT                   /db_xref="InterPro:IPR012550"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIA9"
FT                   /protein_id="ABO88631.1"
FT                   /translation="MGIPSNKAELLLAIDTNFGKLLKALQAVPESLVQERVMEGHSKST
FT                   SMSVANLVAYLIGWNELAIKWIERDTAGLPVDFPETGFKWNELGRLAQKFYRDYEGLAY
FT                   PALLTRLMAAKARIVELIVTRSDDELYGRPWYEQWTLGRMIQFNTASPYHNANGRLRKW
FT                   LKGNCIRV"
FT   gene            470743..471915
FT                   /locus_tag="ASA_0460"
FT   CDS_pept        470743..471915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88632"
FT                   /db_xref="GOA:A4SIB0"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIB0"
FT                   /protein_id="ABO88632.1"
FT                   /translation="MENQAVKDSHVVQTSLRRWLEPVLVLAILGSLFGYLGSLMGLSAL
FT                   VNTLFNTAHQLLLNTVLFIMGITVLSGALSQLLSEFGVIRLLEVLLAPLMKPIFRLPGR
FT                   TALAALMTFFSDNPAVISLAKDSRFRKGFTPWQLVSLTNFGTAFGMGLIVVTFMATLQL
FT                   PSGESTASAALIGLLGALIGSVVSTRLMQRMIRPLVGETLIDDEVVSVGAKPGLSQEAA
FT                   PTWLRVLNALLDGGKSGVELGMAVIPGVLIISTFVMLLTFGPGDKGYTGEAFQGVALLP
FT                   VLAAKVGWLFEMLFGFTHAELVAFPVTSLGAVGAAMSLVPPFIGKGWITGNEVAVFTAM
FT                   GMCWSGFLSTHTAMLDALGYRHLTSRAIVAHTIGGLCAGVAAHQLYLLLG"
FT   gene            complement(472014..472706)
FT                   /locus_tag="ASA_0461"
FT   CDS_pept        complement(472014..472706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0461"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88633"
FT                   /db_xref="GOA:A4SIB1"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIB1"
FT                   /protein_id="ABO88633.1"
FT                   /translation="MPLFKPLITPEVTDMAPGFRALSITVQAAAIADPAVGTRALEQAS
FT                   LAMAREDAPWADAHLSAWADLFRKFGAKPQRTPCSAEALRKRVARDGSLPSIDPVVDLY
FT                   NAISIEYAIPVGGENLTTYEGMPRLVVADGSELFDTMKGGEVAHESPEPGEVVWRDDKG
FT                   VTCRRWNWRQGVRTRLSVESSMMWFILESLPEMPLEALQAAGNKLIEGIQQMMPGAVIE
FT                   QTVIGHVE"
FT   gene            complement(473041..474054)
FT                   /locus_tag="ASA_0462"
FT   CDS_pept        complement(473041..474054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0462"
FT                   /product="two-component system chemotzxis response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88634"
FT                   /db_xref="GOA:A4SIB2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024181"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIB2"
FT                   /protein_id="ABO88634.1"
FT                   /translation="MMSKNGEERKSILTESGTNELEIIEFHLKKHLPDGREKIAYYGIN
FT                   VAKVREVIRVPETTDYPNAQRHMVGVFSLRERLIPLVDLAGWLGIRTNPDNSNKVVIVT
FT                   DFNKMANGFLIDSVSRIHRVSWEDVESPSQFLEAGENDCVVAVVRRDGNLIMILDFEKI
FT                   IADINPELSMEKYDVTQDRKVIIDDRMMALRQAKSILVVDDSAFIRKMIETTLRTAGYN
FT                   VVTAKDGGEGLEMLTEFDRLSQEEKIPVSEFVSGIITDVEMPRMDGMHLLKRLRDTPAF
FT                   KTTPIIMFSSLMSDDNRQKALQLGANDTITKPELGRMVGMMDNLLLGIPIPKPGNL"
FT   gene            474263..474982
FT                   /locus_tag="ASA_0463"
FT   CDS_pept        474263..474982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0463"
FT                   /product="short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88635"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIB3"
FT                   /protein_id="ABO88635.1"
FT                   /translation="MAEAVVVIGAGGGIGQALVAHWLAAGANPVIAVSRQQAPVGFDDP
FT                   RLHWLPCDYSDQQMSHCVSHIAGLAPGLRHLVICNGVLHQGEIKPEKRLEALNVEAMTR
FT                   LYQTNALLPLRWINQLLSLFGTSPCTLAVLSARVGSIGDNRAGGWYGYRAAKAALNMLL
FT                   KCASIELARRAPGVKLLAFHPGTVDTQLSRPFHANVPAGSLQTPEQVAHHLVSLMDRLM
FT                   PDGELSYLDWQGKTIEW"
FT   gene            complement(474969..477035)
FT                   /locus_tag="ASA_0464"
FT   CDS_pept        complement(474969..477035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0464"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88636"
FT                   /db_xref="GOA:A4SIB4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR007807"
FT                   /db_xref="InterPro:IPR013562"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR024914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032672"
FT                   /db_xref="InterPro:IPR033442"
FT                   /db_xref="InterPro:IPR038321"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIB4"
FT                   /protein_id="ABO88636.1"
FT                   /translation="MSPAEVKALRQTLAHAGERRLIWLEGDEADCIVRAEALLGGVIYW
FT                   LGEGPACHGPVPAAKALQRLGQECDTLVFNAFSGFHPDAFGALAGTLRAGGLLLLLTPP
FT                   RELWPAWPDPDRIRLVAQPEEASRAGHGFIARLVRLLTGDPALSLLPPTSPQPWQPIGA
FT                   ERPLSDDQALALPAIQRVLHGHRRRPLVLSADRGRGKSSLLGLAAAGLLRQQPDLKIVV
FT                   TAPSQATVATLFAHAARALDTTQEQLVGLEFCSPDRLVHEALQPDLLLVDEAAAIPTPL
FT                   LEAMLARHSRIVFATTEHGYEGTGRGFHLRFKRVLDRQTPDWQEIHLAEPIRWSTRDPL
FT                   EPLVFRLLGLNTEVDAPQPPTNPSWRLIGQGTLAADEALLNQVFGLLVLAHYQTTPSDL
FT                   RSLLESPDLDIHLLEQAQSLLGVALVAREGNIAPELAEAIWAGRRRPRGHLLPQSLLAH
FT                   AGFKTAGGRSYARVMRIAIHPTLHRHGLGSRLLGQLEDYYREEGLDYLGSAFSASADLL
FT                   PFWRKAGLVTLRIGLQRDAASGNHAALLLKALKPEWQAELDLWRQRFVQQLPTLLAGEL
FT                   KELDPELVWQCVKGQELAVPELDEFEQDELDCFAHHHKPFELCQSTLQRWLTGNLPRLA
FT                   SLTPSECQLLIATIWQYADWSRLAARLQLAGKPAIIKALRALLARLLDAPTTR"
FT   gene            complement(477032..477346)
FT                   /locus_tag="ASA_0465"
FT   CDS_pept        complement(477032..477346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0465"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88637"
FT                   /db_xref="InterPro:IPR018772"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIB5"
FT                   /protein_id="ABO88637.1"
FT                   /translation="MLKKLFTALFGGQPAQVVDVTPTEYAGYLIYPEPMAEGGQYRLAG
FT                   RITKELDGVLQTHRFIRSDLFANPADAERFMVQKAHTFIDQTGDRMFEPRVKAGDSSAS
FT                   "
FT   gene            477485..477691
FT                   /gene="bfd"
FT                   /locus_tag="ASA_0466"
FT   CDS_pept        477485..477691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bfd"
FT                   /locus_tag="ASA_0466"
FT                   /product="bacterioferritin-associated ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88638"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIB6"
FT                   /protein_id="ABO88638.1"
FT                   /translation="MYVCLCRGITDTQIRKAVQAGKSEFRQLKQSLEVGAQCGKCVRMT
FT                   MEIIAAELDKAELETAPLYYEVA"
FT   gene            477837..478316
FT                   /gene="bfr"
FT                   /locus_tag="ASA_0467"
FT   CDS_pept        477837..478316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bfr"
FT                   /locus_tag="ASA_0467"
FT                   /product="bacterioferritin"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88639"
FT                   /db_xref="GOA:A4SIB7"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIB7"
FT                   /protein_id="ABO88639.1"
FT                   /translation="MKGDPKIIAHLNKVLANELIAINQYFLHARIYDDWGLKALGHKEY
FT                   HESIDEMKHADELVKRVLFLEGLPNLQDLGKLRIGETVEEMLRCDLSLEMDAIPDLKVA
FT                   IAYAESVQDYISRDLFQDILEDEEEHVDWLETQLDLIDRIGLENYQQSQLHHGSS"
FT   gene            478518..480623
FT                   /locus_tag="ASA_0468"
FT   CDS_pept        478518..480623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0468"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88640"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIB8"
FT                   /protein_id="ABO88640.1"
FT                   /translation="MHFLPNKLALACAIALSLAACNDNSSNAPADPAATKASLMQIMDE
FT                   AQRASQALDPYGFAIDAPRIAQRKALDGSLLTRLDAMDPSVLSERDRLFYDMIRWDLQI
FT                   NLAGYELPQSQIPIHHFRNRVVDLADEVGAAPASSKAARTISSGFDYFEQSSAERVAPG
FT                   DAAWRRDLDRTPAGTVVATRAKAVTAPLAWYQEHLTWLKAYDAYLAEVKHQFELGSAQG
FT                   NTLPNELVDRLLAQLDSKLDGEAISGAYLGWQQLPGEADEALRTDYKAVLDSINGRYLA
FT                   LRDYLDYQHGGAYAVRLGSGECDDGFCGMTNGRDWYRWLLKKHTTTEMTPEQVHALGLS
FT                   EVERIFGAMVKVCHTVGKCDSEEVAQSKQSGQIYDFFRYLNEPAFFYQNPLAVWSAGLN
FT                   PSNAAGAALSEPQQQALAEHERALREYNAFKSKAALVLPDFFDAERTIPKLDYEVVPVS
FT                   YEDAPYGGVAWYQDGNPQTGRKGQFFLNTYYPYGLQSWNISTLLAHEAAPGHHFQITIA
FT                   QELAAKDPDFPQYVANASYTAYAEGWALYTEYLADHDMGLYQGHGLYDPAVGDVKVEGS
FT                   SAFNNQLQYFGRLNEEMLRAMRLVVDTGIHWYGWSHDKAVNYMQENSALGAGDIGSEVP
FT                   RYMAYTGQATSYKAGQLALIRMRESAEQDLGSQFDLKAFHHHVLEYGMLPISVLEQKNR
FT                   QWIEQSK"
FT   gene            480712..481170
FT                   /gene="mgsA"
FT                   /locus_tag="ASA_0469"
FT   CDS_pept        480712..481170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgsA"
FT                   /locus_tag="ASA_0469"
FT                   /product="methylglyoxal synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88641"
FT                   /db_xref="GOA:A4SIB9"
FT                   /db_xref="InterPro:IPR004363"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR018148"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SIB9"
FT                   /protein_id="ABO88641.1"
FT                   /translation="MELIAREMAPHKRVALVAHDNMKTPLLNWVMRRKEELKLHHLYAT
FT                   GTTGTMLGKQAQLLITCLFSGPMGGDQQLGALIAEGKIDVLIFFWDPLNAVPHDPDVKA
FT                   LLRLAAVWNIPVATNEATADFIMDCPHMRQAFSVQIPDYAGYLKARTE"
FT   gene            complement(481243..481830)
FT                   /locus_tag="ASA_0470"
FT   CDS_pept        complement(481243..481830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0470"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88642"
FT                   /db_xref="GOA:A4SIC0"
FT                   /db_xref="InterPro:IPR025982"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIC0"
FT                   /protein_id="ABO88642.1"
FT                   /translation="MKRWIQHFYQLNRLNWLMVWLLLCCSIILLFPAGLMKGAVSQWAT
FT                   LHAAWLGVGMLIAISYFCSQAFLIAWEWACEEWQSRRQQDLLAQMIAFLDFNEKAVLRE
FT                   FVLQRKSVINLPITEPAVKNLMDAGVLTYAYGKPVREKEDENQIRALMIALPARPLLTY
FT                   KVLGFSRGKMSDEQVEQIMSARPKFAQKGFQR"
FT   misc_feature    482034..482162
FT                   /note="yybP-ykoY riboswitch"
FT   gene            482231..483217
FT                   /locus_tag="ASA_0471"
FT   CDS_pept        482231..483217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0471"
FT                   /product="Ca2+/Na+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88643"
FT                   /db_xref="GOA:A4SIC1"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIC1"
FT                   /protein_id="ABO88643.1"
FT                   /translation="MLITLLLFLLSAVTIYLACEYFVNGIEWTGHHFKFSQSATGSLLA
FT                   ALGTALPECIVTLTALLMGDAPAQQQIGIGAALGGPLVLSTIGYAAVGVTLLLCMSRAH
FT                   RVIDGEVQREIGRDQAWFVGIFLVAVALGMVVFTGKAWLAPLFVLVYLVYVRRELKQTD
FT                   SHEVELPEPLKLDPEAEIPALGKVLLQTLVALVVVALAAQLFVHQLESMGELFGLSPVL
FT                   AALLLSPVATEMPELMNVLIWVRQGKSRLALANISGAMMIQGTIPKAFCLLFTPWLLDS
FT                   TMMVSSLVTLLAVVLLWWGFSRAQMTAGRLAWVGLVYLGFCGWLVVG"
FT   gene            complement(483321..484379)
FT                   /gene="ansB"
FT                   /locus_tag="ASA_0472"
FT   CDS_pept        complement(483321..484379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ansB"
FT                   /locus_tag="ASA_0472"
FT                   /product="L-asparaginase II"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88644"
FT                   /db_xref="GOA:A4SIC2"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIC2"
FT                   /protein_id="ABO88644.1"
FT                   /translation="MTLPIRKTLLAAVVGLTLSPMAMALPQVHILATGGTIAGAGQSAT
FT                   QSNYEAGKVAIETLIAAVPEMKNVADVQGEQVVKIGSQDMNDEVWLKLAKRVNELLAKD
FT                   DVDGIVITHGTDTMEEAAYFLNLTVKSDKPVVLVGAMRPSTAMSADGPLNLYNAVVTAS
FT                   DPSSKGRGVMVAMNDTVLDARDVTKTNTTGVQTFAAPNFGPLGYIHNGKIDYQRSPARL
FT                   HTSKTPFDVSKLDKLPQVGIVYSYANATDLPAKAMVDANFDGIVSAGVGNGNLYHTLFD
FT                   TLAKASKDGIRVVRSARVPTGATTLDAEIDDAKYGFVAAGTLNPQKARILLMLSLTQSK
FT                   DPAQIQRWFQQF"
FT   gene            complement(484511..484705)
FT                   /locus_tag="ASA_0473"
FT   CDS_pept        complement(484511..484705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0473"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88645"
FT                   /db_xref="GOA:A4SIC3"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIC3"
FT                   /protein_id="ABO88645.1"
FT                   /translation="MTIELTISGMSCGGCAASLQKVLLAQSAVTQAQVDFASSKAVVES
FT                   ELSKAELIALIETKGFSAS"
FT   gene            complement(484768..485730)
FT                   /locus_tag="ASA_0474"
FT   CDS_pept        complement(484768..485730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0474"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88646"
FT                   /db_xref="GOA:A4SIC4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIC4"
FT                   /protein_id="ABO88646.1"
FT                   /translation="MANITDVSRLANVSKATVSRVLSGSRGVREESRLAVLQAAEQLNF
FT                   RPNATARSLATQATDCIGIILSPQLGNRLASMLPLLEGALAKAGKSMLVRFADEAQQQQ
FT                   LAVDELLGGRCDGVLVIGAKQSMNQDERLLQLDGVSDSSNFNLCYDLTFATESACRFLL
FT                   GKGHRQMVLMLDDKLSPAGKSAIQGYQQALQQQSLPYNSQLVIDGTDNQQALLGLLNRY
FT                   LPFTALVVQQDAQAADAMRLLREFNLNIPQDVSVISLEGSALADQLTPPLTCIEYPSER
FT                   LAQESVRVLQAQLTQSLRPADEQQKFHGRLMVRESVVAR"
FT   gene            complement(485863..487011)
FT                   /gene="rafY"
FT                   /locus_tag="ASA_0475"
FT   CDS_pept        complement(485863..487011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rafY"
FT                   /locus_tag="ASA_0475"
FT                   /product="glycoporin"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88647"
FT                   /db_xref="InterPro:IPR016963"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIC5"
FT                   /protein_id="ABO88647.1"
FT                   /translation="MIIMKLTNLSVQLLAILALSAPFMVSAVVETNTDFGRLSLGGDAE
FT                   INLNASNTTRGNVLGQTSETRTDRWDEDGRLLLNFVGVRELEDGRYGQIQIQPTIGTNG
FT                   GAGADDAYLGFGQRSNWGMKVGRFEAYDMFPLGQDIFVEHSGDSANDLYSDGNGYVYML
FT                   KEGRGRAGKGGQLLLNKEAGNWYLELSTLLGDRTNLFAGQQYHGYALTKAKDSVIVRPV
FT                   IAWKGENLKVALGAEGNAINDAIVTTDDVSVSDRMGYGLTTSWTQDALTVNVNAARMDA
FT                   EAETDTTLGANLLWHNAGLGYIYAINDISSANLGNASADFGKMVGKHTINTVYASYKIP
FT                   KVLDLNNFDIYLGAYWSQLNVDSNEEDNIDRYGGRVRFKYFF"
FT   gene            complement(487244..488173)
FT                   /locus_tag="ASA_0476"
FT   CDS_pept        complement(487244..488173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0476"
FT                   /product="ROK family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88648"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIC6"
FT                   /protein_id="ABO88648.1"
FT                   /translation="MLRLGLDIGGTKIEAQLLDSQGVSLLCKRIATPTTGYGDFLAAIT
FT                   DLVNEIRQELDGTFTIGIGLPGAISPQTGRIKNANCLFLNGQDLKGDLTRVLGQPVWLA
FT                   NDADCFTLSEAVDGAGDAGRLVFGIILGTGCGGGLVVNRQLIVGPNAITGEWGHNPLPG
FT                   YDPAQDGPSQPCYCGRHNCIERFISGTGFAGRFVERHGRSLSPRGIITAAAEGDHQALA
FT                   HYGHFIQALARSVASLINVLDPDVIVLGGGLSNIDLLYRDLPRALDPYLFSDGCITPIV
FT                   PARHGDSSGVRGAAWLPSCAEGIATWAI"
FT   gene            complement(488185..488496)
FT                   /gene="celC"
FT                   /locus_tag="ASA_0477"
FT   CDS_pept        complement(488185..488496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="celC"
FT                   /locus_tag="ASA_0477"
FT                   /product="PTS system, cellobiose-specific IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88649"
FT                   /db_xref="GOA:A4SIC7"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="InterPro:IPR036542"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIC7"
FT                   /protein_id="ABO88649.1"
FT                   /translation="MFDLEETVMGLIINAGMSRSLCFEALRQAKAGQFSEADDLLRQAG
FT                   EAANAAHAVQTKLIEADEGEGKIPVKLILVHAQDHLMTAMLAKELVTELIELHRKLAA"
FT   gene            complement(488569..489954)
FT                   /locus_tag="ASA_0478"
FT   CDS_pept        complement(488569..489954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0478"
FT                   /product="glycoside hydrolase, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88650"
FT                   /db_xref="GOA:A4SIC8"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIC8"
FT                   /protein_id="ABO88650.1"
FT                   /translation="MQYRFPETFWWGSASSAAQAEGASLQGGKAPTIWDHWFEQAPNRF
FT                   HQQIGPAQTSGFYEYFRDDVRLLRQLGHNSFRTSIAWARLIPAGRGEPNPEAVAFYDAM
FT                   LDELKAEGIEPFICLFHFDMPMSMQSLGGWESREVVAAYAEFAETCFRLFGHKVKHWFT
FT                   FNEPIVPVEGGYLYDFHYPNVVDFRRAATVAYHTMLAHAMAVQRYRALGQDGQIGIILN
FT                   LTPSYPRSQHPADLKAANIADLMFNRSFLDPAVKGEYPAELVSLLKEYDQLPACEAGDQ
FT                   ALLAAGKIDLLGINYYQPRRVKARSNAVNPASPFMPEWFFDHYEMPGRKMNPHRGWEIY
FT                   EQGIYDILVNLRDHYGNIPSYISENGMGVEGEAKFKGPDDQIQDDYRIGFIRDHLIWLH
FT                   KALEESCQCRGYHLWTFIDNWSWSNAYKNRYGFIELELESQTRRIKKSGQWFATAAREH
FT                   GFN"
FT   gene            complement(490008..491324)
FT                   /gene="celB"
FT                   /locus_tag="ASA_0479"
FT   CDS_pept        complement(490008..491324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="celB"
FT                   /locus_tag="ASA_0479"
FT                   /product="PTS system cellobiose-specific component IIC"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88651"
FT                   /db_xref="GOA:A4SIC9"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIC9"
FT                   /protein_id="ABO88651.1"
FT                   /translation="MNTLYERFVSTIENRVSPLAGRIGQQKYVQAIRDGFIAALPFMIV
FT                   GSFMLVFIFPPFSPQTQWGFARAWLDFSSTYQAQLLLPFQLSMGLMTLFISVGIGASLA
FT                   RQNGLDPVTTGLLCLMSFMLVAAPVKDGAISMQYFSGQGIFTALITAIYAAEVYAFLKR
FT                   NNITIKLPPQVPTGVARSFEVLIPVLVIILTLHPLNLLLENSTGMILPEAIMSLVAASD
FT                   SLPAMLLAVLVCQVLWFAGIHGALIVTGIMNPFWMANLANNQTAMAAGEALPHIFLQGF
FT                   WDHYLLIGGVGSTLPLAFLLLRSKAAHLRSIGKMGVVPGLFNINEPILFGAPIVMNPVF
FT                   FLPFILVPMINATLAWFALDFGLVERVVSLTPWTTPGPIGASWAANWAISPMVLSLLCM
FT                   CSAAAMYYPFLKAYERTLLKQEEQEKNEEAPTLAVATSR"
FT   gene            complement(491365..491760)
FT                   /gene="celA"
FT                   /locus_tag="ASA_0480"
FT   CDS_pept        complement(491365..491760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="celA"
FT                   /locus_tag="ASA_0480"
FT                   /product="PTS system cellobiose-specific IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88652"
FT                   /db_xref="GOA:A4SID0"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A4SID0"
FT                   /protein_id="ABO88652.1"
FT                   /translation="MFGRDTETGFQIKSIDPECAIRYERLENLEMKKIMLCCSSGMSTS
FT                   LLVKKMKEEADKRGVSAEIQAFGAAEFDLQMPHYQVVLLGPQVKYMQAELQQRAAAHCV
FT                   PVETINMMDYGMQRGDKVLDHALSLIR"
FT   gene            491935..493227
FT                   /locus_tag="ASA_0481"
FT   CDS_pept        491935..493227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0481"
FT                   /product="PTS system cellobiose-specific component IIC"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88653"
FT                   /db_xref="GOA:A4SID1"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:A4SID1"
FT                   /protein_id="ABO88653.1"
FT                   /translation="MNLQWMAMLVGMIEQRMVPFANWLTRSRHVLSLRDGFQLAMPFVI
FT                   VGSLLVPILFPPIAPDTPHAFGQWLHWLAHELHPFLFPVYSHTLGLVALIIAFGAASSL
FT                   AKAYEMPERLCGLGGCMAFLMLIDFRSLQPGVFGYLGGAGIFTALLMAFYSVEVTRFFY
FT                   RRGWYIHMPDEVPVMTRRGFQLIVPLLFTMLSLSLMRLWLQQQFGISLPDFMASLFRPL
FT                   IVGADTLPALLITLLIAHLLWFMGIHGALIVTGLLSPFWMAGVSANQAALMAGEPLPHI
FT                   FLQGFWDYYLLIGGIGTTLPLVFMAMRSRSHSIQSVGKLGFIPSLFNINEPLLFGFPII
FT                   MNPLFFLPFISVPLINAVLAWQLTQWGFLDRFIALLPWSIPSPLGAAWAANGSWSNGLM
FT                   SLVCILNSYVLYRPFFLAHEKMVLEQEHERA"
FT   gene            complement(493148..494188)
FT                   /locus_tag="ASA_0482"
FT   CDS_pept        complement(493148..494188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0482"
FT                   /product="predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88654"
FT                   /db_xref="GOA:A4SID2"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:A4SID2"
FT                   /protein_id="ABO88654.1"
FT                   /translation="MDLLASLHFSLSITGPICVVLLLGIWLKQLGLLPDSFVESASRLV
FT                   FQVTLPALLFLSMVRTDFSTMPSPWLILYGLLGTLTGFLILEALAARFIPERRQRGIFV
FT                   QGSFRGNMGIMGLAYVQNAYGPEGIGAAALLVGSVTVLYNILAVITLTRSLGGGKGIKP
FT                   ILNGIAKNPLIIAILSALPFGLLGIELPQLVITTGNYFANMTLPLALLCTGASLNLKAL
FT                   RGGAMLTGWATVNRLFCIPLLLVLGAWALGFSQQALGILFLISSTPTAAASYVMTRAMG
FT                   GRQRTGRQHHSHHHAGLAHHHQPGRRSDELPGVDGVIHLVRLFHVLAPAPSSRGPERRG
FT                   DRVHSC"
FT   gene            494329..495276
FT                   /gene="treR"
FT                   /locus_tag="ASA_0483"
FT   CDS_pept        494329..495276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treR"
FT                   /locus_tag="ASA_0483"
FT                   /product="trehalose operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88655"
FT                   /db_xref="GOA:A4SID3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR012771"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A4SID3"
FT                   /protein_id="ABO88655.1"
FT                   /translation="MDKKLTILDIARLSGVGKSTVSRVLNQDPKVKQATRERVEQVIAE
FT                   HGFVPSKSARAMRSQSQQVVGIIVSRLDSSSENQAVRGMLETLYQRGYDAVLMESKFSP
FT                   AKVQEHLAVLERRGVDGIILFAFNDLDYDAMAPLKDKLVLVAREYPGFSSVCFDDGGAV
FT                   RTMLAELAIRGLSDIAYLGVDTSDLTTGQRRLDAYLGYCAEQGLTARSALGDLSLQSGY
FT                   RLAADLLTPTTQALVCASDTLAIGAAKYLQEQGRSEVLVTGLGNNPMLSFLFPNALSLD
FT                   LGYKRAGEQAARQLLGQIEQGRCPLATIAPCHTL"
FT   gene            495468..496898
FT                   /gene="treB"
FT                   /locus_tag="ASA_0484"
FT   CDS_pept        495468..496898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:495999..496001,aa:Trp)
FT                   /gene="treB"
FT                   /locus_tag="ASA_0484"
FT                   /product="PTS system, trehalose-specific IIBC component"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88656"
FT                   /db_xref="GOA:A4SID4"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011296"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A4SID4"
FT                   /protein_id="ABO88656.1"
FT                   /translation="MSKINAQQLATLIDKIGGKENIATVSHCLTRLRFVLNDPAKADSK
FT                   AIETIPAVKGCFTNAGQFQVVIGNEVDDWYKALTEEIGVSGGSKDAAKLAARQNMNPLE
FT                   RGISHLAEIFVPLLPAIITGGLILGFRNVIGDIKMFDDGTHTLVEISQFWAQVHAFLWL
FT                   LGEAIFHFLPVGVCWSAVKKMGGSEILGIVLGITLVSPQLMNAYGIGQQTPEVWDFGLF
FT                   VIQKVGYQAQVIPALLAGVFLAWVETNLKRIIPAYLYLVIVPFISLLLAVIVAHAFIGP
FT                   FGRWIGDGVGFAAKAAMTGSFAPIGAALFGFLYAPLVITGIHHTTNAVDLQLMQSMGGT
FT                   PIWPLIALSNIAQASAVVGIILISRKENEREISVPAAISAYLGVTEPAMYGINLKYKFP
FT                   MLCAMVGSSCAALICGFAGVMANGIGVGGLPGILSIQPQYWAIYAIAMLVAIVVPLVLT
FT                   LLVYKRQQASGKLAQAIA"
FT   gene            496970..498631
FT                   /gene="treC"
FT                   /locus_tag="ASA_0485"
FT   CDS_pept        496970..498631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treC"
FT                   /locus_tag="ASA_0485"
FT                   /product="Trehalose-6-phosphate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88657"
FT                   /db_xref="GOA:A4SID5"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012769"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:A4SID5"
FT                   /protein_id="ABO88657.1"
FT                   /translation="MSQTPWWQSAVIYQIYPKSFQDSGARGTGDLKGIMARLDYLKTLG
FT                   VDALWLTPVYVSPQVDNGYDIADYYQIDPAYGTMADFEALLAAAHARDIRIVMDIVVNH
FT                   TSTEHAWFKSALGDKNSPYRDYYIWKDPVDGGVPNNWQSKFGGSAWELDAATGQYYLHL
FT                   FAREQADLNWENPAVRAEVKNIIHFWAGKGVDGFRLDVINLISKDQTFPNDDVGDGRRF
FT                   YTDGPRIHEFLQDVSRDVFAQVGAMTVGEMSSTSLEHCQRYGALDGSELSMVFNFHHLK
FT                   VDYPNGDKWTKAPFDFLELKRIFNHWQSGMHGKGWSALFWCNHDQPRIVSRFGDEGEHR
FT                   VAAAKMLASTLHGLQGTPYIYQGEEIGMTNPGYQSIDDYQDVESRNIFAIKQAEGMNKA
FT                   EILAILGAKSRDNSRTPMQWSTAPNAGFTQGTPWLRPAANYTEINAEAALADQGSVFWH
FT                   YRDLIALRKAHPIFTQGDYQEQLPGHQHIWAYTRSAKGQTLLVVSNFYGEPVAFDLPQD
FT                   LQEREGRLLLGNYPDSPAMPQSCMLRPYESLIWLVE"
FT   gene            498632..499246
FT                   /gene="maa"
FT                   /locus_tag="ASA_0486"
FT   CDS_pept        498632..499246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maa"
FT                   /locus_tag="ASA_0486"
FT                   /product="maltose O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88658"
FT                   /db_xref="GOA:A4SID6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="InterPro:IPR039369"
FT                   /db_xref="UniProtKB/TrEMBL:A4SID6"
FT                   /protein_id="ABO88658.1"
FT                   /translation="MVSEVMAKAMAPVHGTEWQKMVAGQPYDAGDPELKAARERCRFLY
FT                   HTFNTSWQEKPARDALLRELLGSRGNVCAINPPFFCDYGANIHVGENFYVNVNCTILDV
FT                   CEVHIGDNVLLAPGVQIYTAAHPVALVPRVAGVEFGKPVRIGNNVWVGGSTVICPGVTI
FT                   GDNSVIGAGSVVTRDIPANVVAVGNPCRVLRPMTAEELASI"
FT   gene            499621..499953
FT                   /locus_tag="ASA_0487"
FT   CDS_pept        499621..499953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0487"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88659"
FT                   /db_xref="UniProtKB/TrEMBL:A4SID7"
FT                   /protein_id="ABO88659.1"
FT                   /translation="MNMKKVIKMLAVAGLMTAGFAQASVPADFNAAPGVLFVNWHATAA
FT                   VDGKTNPMLEVRNESGDVVASVHANLMGTQQVRIPSRTQGNLTVSLGEQSSDYRIPFGI
FT                   GSGKQR"
FT   gene            complement(500045..501454)
FT                   /locus_tag="ASA_0488"
FT   CDS_pept        complement(500045..501454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0488"
FT                   /product="Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88660"
FT                   /db_xref="GOA:A4SID8"
FT                   /db_xref="InterPro:IPR004770"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:A4SID8"
FT                   /protein_id="ABO88660.1"
FT                   /translation="MQNQQNQIRLPGMLQVFGCLAIFLALAFSFTSVLDLPIQLALFIA
FT                   WFVIMGLGIKLGHDYKSLEQAAVDGVSKGMGAILILVSVGALVGTWIAGGIVPSIIYFG
FT                   LKVIHPSIFLLATLIICSLTSLATGTSWGSAATAGIAMMGIGHSLGVPAPLVAGAVLSG
FT                   VYFGDKLSPLSDSVVLASTMSNVDVVEHIKGMLPISLLSYIITAALFTVVGMQYSGNVS
FT                   LEQVNLVMEALDSQFNITPLAIVPVVLVLGLLANRKPAFPVISFGALLGLVWAIAFQDM
FT                   DPVKAMHSAYSPFPITSGIGFIDNILGRGGMESMLGSVAVIIFGLGFGGLLEKVGILEV
FT                   IANAFEKRINSVGSLTSHTIGTAFLANVFGSAMYVSLILTPKIMAKNYDRLGLARKNLS
FT                   RNAEFGGTLTCGMVPWSDNGIFMAGVLGVATLDYLPYMWLSFTCIIVTITLAYLGKAVN
FT                   RVLVIEAASSR"
FT   gene            501756..501965
FT                   /locus_tag="ASA_0489"
FT   CDS_pept        501756..501965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0489"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88661"
FT                   /db_xref="GOA:A4SID9"
FT                   /db_xref="UniProtKB/TrEMBL:A4SID9"
FT                   /protein_id="ABO88661.1"
FT                   /translation="MIWIVRVVLLVGLLAVLGWGQEKEYGIWSLGFVLAAWVMLEPRLR
FT                   PVLILLPVAGMTGIAALLWQQPWL"
FT   gene            complement(501960..502232)
FT                   /locus_tag="ASA_0490"
FT   CDS_pept        complement(501960..502232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88662"
FT                   /db_xref="InterPro:IPR019657"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIE0"
FT                   /protein_id="ABO88662.1"
FT                   /translation="MILDTDIHNFYEHLVLKEIEKQGLNQKLNSEQMADLCCLTLNQLP
FT                   SHYIRHDVDMIYFLTDAKRTEMENNVIASLKQAREKVKNAPPAQS"
FT   gene            complement(502342..502427)
FT                   /gene="trnL"
FT                   /locus_tag="ASA_0491"
FT   tRNA            complement(502342..502427)
FT                   /gene="trnL"
FT                   /locus_tag="ASA_0491"
FT                   /product="tRNA-Leu"
FT   gene            complement(502499..502584)
FT                   /gene="trnL"
FT                   /locus_tag="ASA_0492"
FT   tRNA            complement(502499..502584)
FT                   /gene="trnL"
FT                   /locus_tag="ASA_0492"
FT                   /product="tRNA-Leu"
FT   gene            complement(502629..502714)
FT                   /gene="trnL"
FT                   /locus_tag="ASA_0493"
FT   tRNA            complement(502629..502714)
FT                   /gene="trnL"
FT                   /locus_tag="ASA_0493"
FT                   /product="tRNA-Leu"
FT   gene            complement(502759..502843)
FT                   /gene="trnL"
FT                   /locus_tag="ASA_0494"
FT   tRNA            complement(502759..502843)
FT                   /gene="trnL"
FT                   /locus_tag="ASA_0494"
FT                   /product="tRNA-Leu"
FT   gene            complement(502897..502982)
FT                   /gene="trnL"
FT                   /locus_tag="ASA_0495"
FT   tRNA            complement(502897..502982)
FT                   /gene="trnL"
FT                   /locus_tag="ASA_0495"
FT                   /product="tRNA-Leu"
FT   gene            complement(503099..504559)
FT                   /gene="glgA"
FT                   /locus_tag="ASA_0496"
FT   CDS_pept        complement(503099..504559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgA"
FT                   /locus_tag="ASA_0496"
FT                   /product="glycogen synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88663"
FT                   /db_xref="GOA:A4SIE1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SIE1"
FT                   /protein_id="ABO88663.1"
FT                   /translation="MAINPLKILFVASEVEGLVKTGGLADVARALPLYLAQKGHDVRII
FT                   LPFYKTIKRRDEARLIASRWLPTHPGLPDIGYRIYQMELEGVCVYLLDCPQYFDRPQLY
FT                   AENNQAYGDNGERFAFFSAAALHACEQLDFAPEIVHCNDWHTGLLPLLLKTRHAHNPFF
FT                   QHTRSVISIHNAAFQGVFGREQFWAMPEIADYEQRISYDYGHVNLLKCGVLYADKINAV
FT                   SPNYASELLTHLGAHGMANIFQQRAADLRGILNGCDYKDWDPAFDDFLPATYDVDNLAG
FT                   KRVCKQTLQQEAGLPVTDLPIYGMVCRLTEQKGVHLLLPVLDKFLHHKVQVVIVGSGDP
FT                   SLAAQLQATAQRYPDKLAFLNTYDDRLAHLVEAGADFFLMPSLFEPCGLNQMYSLAYGT
FT                   LPLVRAVGGLKDTVVDWDAEPEHATGFCFNDPTANILLDAMRRSLLYYLQDPERFAQVQ
FT                   RNAMNTRFNWPDSVTQYEQMYQDALARQ"
FT   gene            complement(504549..505766)
FT                   /gene="glgC"
FT                   /locus_tag="ASA_0497"
FT   CDS_pept        complement(504549..505766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgC"
FT                   /locus_tag="ASA_0497"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88664"
FT                   /db_xref="GOA:A4SIE2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIE2"
FT                   /protein_id="ABO88664.1"
FT                   /translation="MAGILTMILAGGEGTRLQPLTTTRSKPSVPFGGSYRLIDFVLNNF
FT                   VNADFLRIYVLTQFKSQSLYLHMKKGWNIVGITDRFIDPIPAQMRMGKRWYDGTADAIY
FT                   QNLRFIEISDPEHVCIFGSDHIYKMDVSQMVTFHKQKAAALTVAALRMPIEEASAFGVI
FT                   EVDQEGRMIGFEEKPKHPKHIPGDPTQALVSMGNYIFETEALYRELKRDAAEENSSHDF
FT                   GKNIIPSMFPRAPVYVYDYSTNVIPGEKPTVYWRDVGTLDSYWQAHMDLVADDTPFSLY
FT                   NRKWPLHTHYPPLPPATFVDTDDCKVKIANSLISGGCFIQGSQIQRSILGFRCNIGPCS
FT                   HISKSVLLGDVKIGEGCSIRRAIIDKNVEIAPGTVIGENLDHDRERFTVSEGGIVVVPK
FT                   GARVGY"
FT   gene            complement(505916..506944)
FT                   /gene="rsmC"
FT                   /locus_tag="ASA_0498"
FT   CDS_pept        complement(505916..506944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmC"
FT                   /locus_tag="ASA_0498"
FT                   /product="ribosomal RNA small subunit methyltransferase C"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88665"
FT                   /db_xref="GOA:A4SIE3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR013675"
FT                   /db_xref="InterPro:IPR023543"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SIE3"
FT                   /protein_id="ABO88665.1"
FT                   /translation="MSSPISAVSQMLERNQALFVGKRLLVCGTLEDDYPRQLAELASSL
FT                   TVFTTDYCYYRSQQATLGDAILFDHQLGGAPRFDALLLLMPKAKAEAQYLLAMMTPLLE
FT                   AGADLFLAGENRGGINGADKLLAPYGNKPVKRDSARRCSLYHGELSKPVIPFELDAWFS
FT                   RYECKAGDTELTVLALPGVFSADELDPGSQMLLAAVPPMTGELLDFGCGAGVIGSVLAK
FT                   RNPGLEVKMVDISALALESSRRTLAINGLQGQVQASDVYSDITGKFDHIVSNPPFHAGL
FT                   KTFYAATETFLAKAPEYLSANGGLTIVANAFLRYQPILETHFKRTDIISSDAKFKVYLS
FT                   KV"
FT   gene            507224..508096
FT                   /gene="dapA"
FT                   /locus_tag="ASA_0499"
FT   CDS_pept        507224..508096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapA"
FT                   /locus_tag="ASA_0499"
FT                   /product="dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88666"
FT                   /db_xref="GOA:A4SIE4"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIE4"
FT                   /protein_id="ABO88666.1"
FT                   /translation="MFQGSIVALITPFRQGQLDEAALARLVEWHIEQGTHGIVPVGTTG
FT                   ESPTLTHDEHCRVVELVVKQVAGRVPVIAGAGSNNPVEAIEYTRHAEQAGADATLHVAG
FT                   YYNRPNQEGLYHHFKAVHDATSKPIIVYNIPPRAIVDVQPATLARLAELPRIAGVKDAT
FT                   GDLARPWTERQLIKKPFAWLSGEDATAVAYNIGGGQGCISVTANVAPRLVAEVQNLTLA
FT                   GKWQEARELQDKLIPLHQAMFAEPSPAGAKYAVSLLGFCSEECRLPVMPLSEATRERIR
FT                   SAMQALNLL"
FT   gene            508357..509820
FT                   /locus_tag="ASA_0500"
FT   CDS_pept        508357..509820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0500"
FT                   /product="GGDEF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88667"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIE5"
FT                   /protein_id="ABO88667.1"
FT                   /translation="MQRPLRPPNSPSSSSNMRSTRVSWWWSRQPRPPMSGKPSNRKRRA
FT                   CAPASPSSATRGWRPWSIWRPAAVSIASPDSIQLLMHYLAAELESRLLASQIDQERDQR
FT                   RHTQADLIRSQALQDSFLSMLQALHQVGVKLSRCDSEQQLLHDAVALARQDLQFDRIAI
FT                   FLVDAEFKTMHGTWGTNEAGELIDEHHFVSPIPEHPTVQEALRRKDYVLVLEDAPLYYE
FT                   KQEVGRGWNAMVSLWDGDMPIGWIAADNLLWRRPLKAYQSEIFKQYAAMLSQLLIRQRT
FT                   QAALEHFNRELELRVSERTMQLAETNRALEEANKRLSMLSLEDPLTGIANRRHWDLTMQ
FT                   REWEWARRHQSLLAVLMIDVDEFKPYNDHFGHAKGDLCLQQVASLLQEAERRRTNLVAR
FT                   YGGEEFVILLCGPQPGEAERLAEQIHQGLSELKIPHPASRVADFITVSIGFSYLVPSLD
FT                   GTWQSLTEQADQALYHAKSQGRACTLAYR"
FT   gene            509825..510928
FT                   /locus_tag="ASA_0501"
FT   CDS_pept        509825..510928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:510524..510526,aa:Trp)
FT                   /locus_tag="ASA_0501"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88668"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIE6"
FT                   /protein_id="ABO88668.1"
FT                   /translation="MLLRRYPIFNRRLALVAYGIDYQLADPAEWALLAAQCRLLAQGRQ
FT                   YLLPFSHEQLDEQRPLLFDPDTIPLVEASAERLPASFPVLTQWRDYRRRLAVHCAQREP
FT                   RWLNACRLLVFWMGEEGISQPTEHKRMALDIETWGDFLPLKEAGVDFFAGGFLARPELV
FT                   NQRAAQPDMKLVQEILQVICHEEFSFARVASLLEQDAWLPGQLLTYVNAPGFDHVSSIT
FT                   SVPRALSYLGEWEIRKFVLIYGLARVCYHMPEACTRMAIARGRFCELIAMTALGKDAAS
FT                   WAFLVGLVLDGSLLSAQLKAHLPKDVQRALEFHEGPLFHLFQLVKTYEQGDWPLLAQLA
FT                   PHYQLDPARLTPIYFQAQMWGQAFLAT"
FT   gene            510994..511584
FT                   /locus_tag="ASA_0502"
FT   CDS_pept        510994..511584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0502"
FT                   /product="predicted phosphatase/phosphohexomutase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88669"
FT                   /db_xref="GOA:A4SIE7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010976"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIE7"
FT                   /protein_id="ABO88669.1"
FT                   /translation="MTLSGFQGLVFDLDGTLVDSMPLHLAAWEHTSREFGFRFDADWFY
FT                   ELGGMPSRKIALLVAEQQQSALDPVVVTRCKTEHYVANLHKVAVFPAMLELVERYHGQI
FT                   PMGIGTGSPRINAEAVLRNTGLDRYFSVVVTADDVELHKPHPDTFLLVASRLGLEPTTC
FT                   LVFEDTGIGVQAGQAAGMQTCMVRDGKPVDLQY"
FT   gene            complement(511721..512080)
FT                   /locus_tag="ASA_0503"
FT   CDS_pept        complement(511721..512080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0503"
FT                   /product="putative Hfq family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88670"
FT                   /db_xref="GOA:A4SIE8"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIE8"
FT                   /protein_id="ABO88670.1"
FT                   /translation="MTTESPSYSTIEQAFSLGNGQDSALNWLRKNRSQVAIFLVSGIKL
FT                   EGTISGFDQYSVLLTDAHGNQQLVYKAKISTIAMHSGRPQVSIQRARKPRVSMAPRPHG
FT                   APSRYDDNQGGSSEQ"
FT   gene            512256..513539
FT                   /gene="pqiA"
FT                   /locus_tag="ASA_0504"
FT   CDS_pept        512256..513539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqiA"
FT                   /locus_tag="ASA_0504"
FT                   /product="paraquat-inducible protein A"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88671"
FT                   /db_xref="GOA:A4SIE9"
FT                   /db_xref="InterPro:IPR005219"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIE9"
FT                   /protein_id="ABO88671.1"
FT                   /translation="MHPVSNLHKPTYTHDATACEECDLLVPATVLAVGEKSSCPRCGHV
FT                   LSVHLPEQERRPISYGFAAIIMFVLSNSFTFMSFSAKGVGQEMTFLQCITTLVDQGYLF
FT                   LGAVLSLTLIGLPLVYVGSIMLVLWRVDKDLHSNSLRALGRLLCRIKPWLMVDVFLIGV
FT                   LISLVKLMGMADIKMGLSFWAFVGYTVLLIKTISSLDRMWLWQRLFGPTEPRELDADAD
FT                   AEASAMASGLVGCHICGALGEVGEHSCKRCGERLHSRKPGGINRTWALLFTSVILYVPA
FT                   NLYPIMDTVFLGDDSPSTIMGGVVLLWAMGSYPIAAVIFIASVVVPLVKILALLWLCYM
FT                   VQRGHGASPLGKLKLYRMTEFVGRWSMIDVFVVAILAGLIRLDNLMTVYPGPAAVAFAG
FT                   VVLITMVAAMSFDSRLIWDLQQGERERE"
FT   gene            513532..515178
FT                   /gene="pqiB"
FT                   /locus_tag="ASA_0505"
FT   CDS_pept        513532..515178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqiB"
FT                   /locus_tag="ASA_0505"
FT                   /product="paraquat-inducible protein B"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88672"
FT                   /db_xref="GOA:A4SIF0"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIF0"
FT                   /protein_id="ABO88672.1"
FT                   /translation="MSERKKRWKPGSDFLSSAAAIWMVPLLALFIGVWMLFQHWYSQGP
FT                   SFTLTVATAEGIVAGKTVIRSREVEVGRIEAVELSEDYSHAVLKARLTNAAAGMLKKDS
FT                   QFWVVKPRVGREGVSGLSTLLSGAYIELAPGRKGKPLDEYAMLDKPPLASQDAKGLRLS
FT                   LSSRDTRALGVGSPINYQGFTIGQVEEAKFLPEKSEMQYQIFINTPYDVLVSGNSRFWM
FT                   TPGFEVSMSSEGMKVKMDSLESLLDGGITMGLPPGWAPGEPVKQMDGFTLFQDEASVLA
FT                   GSLDQFIDYVFLFEDSVGGLHPGAAVEYRGIRVGTVISAPYLIDEKGVQMFQSRQIPVL
FT                   ARIEVQRLSHRYANAEKEQWRALFGKQFKEGLRATLKTSSLLTGGKVVDLNFYPDAPKY
FT                   QAIKLAGYQVFPTVQAGLDQIERKVNQILDKFVDMDTAKTLTQVNSTLATLDQTLKSIS
FT                   AVSSNLNKFTGQSSTQQLPASLNDSLKQLQSTLQEYDANSQTNQDLRQSVQSLNQLMRE
FT                   LQPLVHSLNEQPSSLIFDRARPRDPEPKRGQ"
FT   gene            515175..515747
FT                   /locus_tag="ASA_0506"
FT   CDS_pept        515175..515747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0506"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88673"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIF1"
FT                   /protein_id="ABO88673.1"
FT                   /translation="MMKKQIMTLALLGLLAGCSSAPTVLHYYSLDAEAQPAAAVTEQPQ
FT                   HQLVLRPVALSGQLDRVSLVYQLEGNELHFAEYHRWAGFLDAQLNQLTLSGLSNRLPGW
FT                   VVRQDGARKGPVLSISVERFQGRHDGRAVLSGRWRLLTEEGTVLRDVPFQQVRVLPADG
FT                   YGSLVSELGQGWQQLLDQIAAEVRKGA"
FT   gene            complement(515823..516854)
FT                   /gene="ompA"
FT                   /locus_tag="ASA_0507"
FT   CDS_pept        complement(515823..516854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompA"
FT                   /locus_tag="ASA_0507"
FT                   /product="outer membrane protein A"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88674"
FT                   /db_xref="GOA:A4SIF2"
FT                   /db_xref="InterPro:IPR000498"
FT                   /db_xref="InterPro:IPR002368"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIF2"
FT                   /protein_id="ABO88674.1"
FT                   /translation="MNKSLITLLVSGLLAANAHAAGQDNTWYGGAKLGWSNFYGVDENN
FT                   ITTLLDEDNDEVGAGAFAGYQINQNLGIELGYDYLGNYKYSGTRSGAAFNDKVEAQLAQ
FT                   LTLKLGFPVAENLDLYGRLGGGYGWASSDKLDNDGRFNFVGALGAEYAFNLDWAARLEY
FT                   QYSSPYGDREDTGLRMDNGLLAVAVVYRFGQVAPVVAAPAPTPAPEPVMVEKQFTLSSD
FT                   VLFDFNKATLKPEGGQALDTLYGEIEAARPTDGVATVIGYTDRIGSDAYNQRLSEQRAQ
FT                   TVADYLVGKGLPAGKVNVEGRGKGSPVTGDSCTSKSKHELIVCLAPDRRVEVKVEGVSE
FT                   VQQ"
FT   gene            517088..517822
FT                   /locus_tag="ASA_0508"
FT   CDS_pept        517088..517822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0508"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88675"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIF3"
FT                   /protein_id="ABO88675.1"
FT                   /translation="MNGKWIWLCWSLWLAPGWAVETLHVVTEDYAPYNYLEEAEIKGLG
FT                   TEVVEAMLEEAGFEYNLDIYPWARAISLARSRPNVLIYSISRFPEREDQFQWIGVIAKI
FT                   NFHVFALAKRDDIKPFSELSQARTWSIGTVRNDALEQYLMGRNFSNLQRNNNNEANMLK
FT                   LLMGRIDLWPVSQESANYYVRQAGYDPSTLKIVHDIEDFTGGELYVAASLETAPEVIKR
FT                   LQEALATIRQNGIYDGIVKRYR"
FT   gene            complement(517882..518889)
FT                   /gene="satA"
FT                   /locus_tag="ASA_0509"
FT   CDS_pept        complement(517882..518889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="satA"
FT                   /locus_tag="ASA_0509"
FT                   /product="glycerophospholipid-cholesterol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88676"
FT                   /db_xref="GOA:A4SIF4"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="InterPro:IPR008265"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIF4"
FT                   /protein_id="ABO88676.1"
FT                   /translation="MKKWFVCLLGLIALTVQAADTRPAFSRIVMFGDSLSDTGKMYSKM
FT                   RGYLPSSPPYYEGRFSNGPVWLEQLTKQFPGLTIANEAEGGATAVAYNKISWNPKYQVI
FT                   NNLDYEVTQFLQKDSFKPDDLVILWVGANDYLAYGWNTEQDAKRVRDAISDAANRMVLN
FT                   GAKQILLFNLPDLGQNPSARSQKVVEAVSHVSAYHNKLLLNLARQLAPTGMVKLFEIDK
FT                   QFAEMLRDPQNFGLSDVENPCYDGGYVWKPFATRSVSTDRQLSAFSPQERLAIAGNPLL
FT                   AQAVASPMARRSASPLNCEGKMFWDQVHPTTVVHAALSERAATFIETQYEFLAH"
FT   gene            519129..519509
FT                   /locus_tag="ASA_0510"
FT   CDS_pept        519129..519509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0510"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88677"
FT                   /db_xref="InterPro:IPR005220"
FT                   /db_xref="InterPro:IPR036700"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIF5"
FT                   /protein_id="ABO88677.1"
FT                   /translation="MNKASVIGLLTLMSISSFTMAAFTGPQEQNKVSVAQLKDLADDSW
FT                   ATLEGNLVKHLGGENYMFRDASGEVEVEVDQDVWRGTEVGPDDLIRIRGEVDHSWNKTE
FT                   VEVESLEKVGATPQSKGGFIAK"
FT   gene            complement(519578..520678)
FT                   /gene="mltC"
FT                   /locus_tag="ASA_0511"
FT   CDS_pept        complement(519578..520678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mltC"
FT                   /locus_tag="ASA_0511"
FT                   /product="membrane-bound lytic murein transglycosylase C"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88678"
FT                   /db_xref="GOA:A4SIF6"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR024570"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIF6"
FT                   /protein_id="ABO88678.1"
FT                   /translation="MGRIFWLLCTLLFLSACSSSPKPSGSEDDTLVNGKDIRGFEHMIS
FT                   ALSHNVNEIWGREALFAGKFDYVKYTDQYKSRAHIDFSSGHIMVETVSGLDPQAHLRRA
FT                   IIETLLTPDDPAEVDLYSDREILPGGEPFLYGQVLDNQGQPIRFDWRAERYADYLLSTA
FT                   MKKRTLGIRTIFFVDIPMVANHEDKRGYKYASIIRQASRKYGVAESLIYAVIKTESSFN
FT                   PYAVSHANAYGLMQVIPATAGRDVYVRVKGKNGQPTRDDLFNPAYNIDVGTAYLHLLQT
FT                   VYLADIQDPLSRRYAVISAYNGGAGGVLNTFSNDRKAAPGKINRLSPEVVYQILTEQHP
FT                   KAEARRYLYKVNQAEKGFKRTLARTG"
FT   gene            complement(520768..521040)
FT                   /locus_tag="ASA_0512"
FT   CDS_pept        complement(520768..521040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0512"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88679"
FT                   /db_xref="GOA:A4SIF7"
FT                   /db_xref="InterPro:IPR007457"
FT                   /db_xref="InterPro:IPR036766"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SIF7"
FT                   /protein_id="ABO88679.1"
FT                   /translation="MSRTVFCQRLKKEGPGLDFQLYPGELGKRIFDNISKEAWTEWQKK
FT                   QVMLINEKKLNMMNLEHRQLLEKEMVSYLFEAGEVAIDGYTPPSQ"
FT   gene            complement(521049..522110)
FT                   /gene="mutY"
FT                   /locus_tag="ASA_0513"
FT   CDS_pept        complement(521049..522110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="ASA_0513"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88680"
FT                   /db_xref="GOA:A4SIF8"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIF8"
FT                   /protein_id="ABO88680.1"
FT                   /translation="MNNSDNATFATRILDWYQVHGRKTLPWQQDKTPYRVWVSEIMLQQ
FT                   TQVATVIPYYQRFMARFPDVQALADAPIDEVLHHWTGLGYYARARNLHKAAQQIRDLHD
FT                   GLFPERLEEVMALPGIGRSTAGAVLSLSLGQPHAILDGNVKRVLTRWLALPGWPGQKQV
FT                   ENDLWELAIRLTPKLGVAHYNQAMMDMGATVCTRSKPACDRCPVQTDCQGLSQGKPTAY
FT                   PNSKPKKSIPARTGIMLLIRHGDELLLEKRPPQGIWGGLYCFPQVESPAEIDGLLQRLG
FT                   LSGHDYRELSGFRHTFSHFHLDIQPFLIEMDAPPAPQLMEADNRLWYNLRHPAEVGLAA
FT                   ATARLLAYPDLQP"
FT   gene            complement(522212..522892)
FT                   /gene="exeB"
FT                   /locus_tag="ASA_0514"
FT   CDS_pept        complement(522212..522892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exeB"
FT                   /locus_tag="ASA_0514"
FT                   /product="general secretion pathway protein B"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88681"
FT                   /db_xref="GOA:A4SIF9"
FT                   /db_xref="InterPro:IPR032389"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIF9"
FT                   /protein_id="ABO88681.1"
FT                   /translation="MSTLLKALRRADQPQFTSHIPAMGLPVTQEEEQNRRWIWWLLAPF
FT                   ALLMGAGANYGWHLLNNRPIEKTIEVKEVVTPPFVRIEPRPMITRPLPPPLPEPVVRPR
FT                   AVPENKTPAADSSQGLAERIMNALNNTPLMEEAVPQAQPEAQAMPISALPLELKQRIPA
FT                   LSYGSHVFSSNPAKRAVMLNGREFREGSEVASGVTLIAIAQDYIILQVAGQNASLKALQ
FT                   DWRG"
FT   gene            complement(522892..524535)
FT                   /gene="exeA"
FT                   /locus_tag="ASA_0515"
FT   CDS_pept        complement(522892..524535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exeA"
FT                   /locus_tag="ASA_0515"
FT                   /product="general secretion pathway protein A"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88682"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIG0"
FT                   /protein_id="ABO88682.1"
FT                   /translation="MYTQFFGLSEPPFSISPNPKYLYMSERHGEALAHLNYGLQDGGGF
FT                   VLLTGEVGTGKTTVSRCLLQQLPAKTEIAYILNPSLTERDLLAAICDEFQLSYDKDAGL
FT                   KLLFDLIRDHLLANLAAGKRSVVLVDEAQHLLPGVLEQLRLLTNLETDEKKLLQVVLIG
FT                   QPELQQMLRQPLLRQLAQRITARYHLLPLSHQDVDAYVRFRLQVAGCVQPIFTPKATQT
FT                   LHRLSGGIPRLINLICDRALIAAFARGSHKIVHGDISLAAYEVSGIRDEGTWQSGLMVA
FT                   LAGALLVATGWWGWQFFGFFPERPVIKVEVPVKVDDTPEQQEQLTRAINQALEPDSAMQ
FT                   NLYKVWGYQTELEEATCDNAPRAGLRCQEGDASLADLQPLQHPALISLTDETGGIYYAT
FT                   LVSLGPDKANLLIGNQSWQVDRQWLSDFWGGSYTLLWRMPKGGVALIGNNAGATQVQWL
FT                   DNALSRALQQPDRKVRRFDAELKNKLQQFQREQGLNPDGIAGSNTLLRLNVMAGEPMPR
FT                   LEDESKRTGTPAKLDAMDDESMVTLSEEAS"
FT   gene            524826..526067
FT                   /gene="cca"
FT                   /locus_tag="ASA_0516"
FT   CDS_pept        524826..526067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cca"
FT                   /locus_tag="ASA_0516"
FT                   /product="multifunctional CCA protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88683"
FT                   /db_xref="GOA:A4SIG1"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR012006"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SIG1"
FT                   /protein_id="ABO88683.1"
FT                   /translation="MQTYLVGGAVRDRLLGLPQGDRDHLVVGATVEQMLALGFSQVGRD
FT                   FPVFLHPKTQQEYALARTERKQGRGYTGFVCHASPEVTLEQDLLRRDLTINAIAEDEEG
FT                   RLHDPYGGIQDLEQRMLRHVSPAFAEDPLRILRVARFAARFHAQGFVVAPETLALMREM
FT                   TDAGELAHLTPERVWKELEKVLLGQTPQVFFEVLRECGALKALFPELDALFGVPAPAKW
FT                   HPEIDTGIHTLMVLAQACRLSPELAVRFAALCHDFGKGLTPPAFWPSHHGHGQKGLPLI
FT                   RDFCERFRVPNDCRDLALLVSDLHTHIHIAFELKPATLLKVFDKADAWRRPERFAQLLD
FT                   ACRADFHGRTGFEERVYAEPDYVAQALGAAQAVPVKDIVAAGFKGEAIREQLAKRRFDA
FT                   ISRVRDEWTFIDEE"
FT   gene            complement(526134..527399)
FT                   /gene="pitA"
FT                   /locus_tag="ASA_0517"
FT   CDS_pept        complement(526134..527399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pitA"
FT                   /locus_tag="ASA_0517"
FT                   /product="phosphate permease"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88684"
FT                   /db_xref="GOA:A4SIG2"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIG2"
FT                   /protein_id="ABO88684.1"
FT                   /translation="MDIIANYGTTLVLVAALFGFLMAWGIGANDVANAMGTSVGTKSLT
FT                   IRQAIIIAMIFEFAGAYLAGGEVTATIRNGIIDTNAFADTPDLLVLGMIASLLAAGSWL
FT                   ILASYFGWPVSTTHSIIGAIVGFAVVSIGPEAVQWNKFGGIVGSWIITPAISGIIAYFM
FT                   FISVQKLIFNTDDPLANAKRYVPFYMFLTALVICLVTIKKGLTHVGLHLSDGEGILLSI
FT                   IISIAVAFAGWLYIRGQKYNPQDDSKMHFANVEKVFGILMVITACAMAFAHGSNDVANA
FT                   IGPLSAVASIVASGGEIAGQSSIAWWILPLGGIGIVIGLATMGGKVMATVGTGITHLTP
FT                   SRGFAAQLATAATVVIASGTGLPISTTQTLVGAVMGVGLARGIAALNLGVLRNIVVSWI
FT                   ITLPAGAILSILIFYVLQVCFS"
FT   gene            complement(527425..528105)
FT                   /locus_tag="ASA_0518"
FT   CDS_pept        complement(527425..528105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0518"
FT                   /product="putative phosphate transport regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88685"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIG3"
FT                   /protein_id="ABO88685.1"
FT                   /translation="MPVNTILGLFAKSPIKPLQKHIVKVHVCCEQLIPFFDAVAEDRWE
FT                   DAEKIREHIAQLEKEADILKREIRLKLPRGLFLPVARTDLLELLTQQDKIANRAKDISG
FT                   RMLGRRMEFPAEMRAGFMAYLKRCIDATAQAEKAIGELDELLETGFKGREVEMVAEMIH
FT                   QLDLIEDDTDTMQIGLRQQLQAVEQKYNPIDVMFLYKILEWVGDLADQAERVGARLELM
FT                   LARS"
FT   gene            528275..529240
FT                   /pseudo
FT                   /locus_tag="ASA_0519"
FT                   /note="adenylate cyclase family; frameshift due to 1 bp
FT                   insertion"
FT   gene            complement(529339..529806)
FT                   /locus_tag="ASA_0520"
FT   CDS_pept        complement(529339..529806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0520"
FT                   /product="TonB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88686"
FT                   /db_xref="GOA:A4SIG4"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIG4"
FT                   /protein_id="ABO88686.1"
FT                   /translation="MKATLLLGALCVLTGCSHQTQSVHLTSLPLSNITDVNAQWTPLTR
FT                   VESRYPKEAILAEKMGCTSLEYVINEAGQAEQIRVLARSDEQFSEVAIETLQQWQWQAT
FT                   TANPDHSPIKSQTRFEFCIEHNGQPCDTSGLAQLCQGEDMVRSTGLVYTQV"
FT   gene            complement(529961..530884)
FT                   /gene="htrB"
FT                   /locus_tag="ASA_0521"
FT   CDS_pept        complement(529961..530884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htrB"
FT                   /locus_tag="ASA_0521"
FT                   /product="lipid A biosynthesis lauroyl acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88687"
FT                   /db_xref="GOA:A4SIG5"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR011920"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIG5"
FT                   /protein_id="ABO88687.1"
FT                   /translation="MAHEHAPRLEPHLFHPRYWGSWIGLSLLWLLVLLPWRSQMWLGRQ
FT                   LGTLARVLLKSRVKIARRNLELTMPELTKDEREKLLRQNFESVGCAIFEVGMAWFWPDW
FT                   RMRNLMKVEGEEHVIAAMEKGQGMLLLSCHFLTLELNARCFGLVRPGVGVYRPNTNPVL
FT                   EYAQYHGRCASNKYLVDRMDVKGMIKALRNGDALWYAPDHDYGSHASVFVPYFAVEQAA
FT                   TITGTATLARVKNTVTLPCYNIRTKEGYVLHIGAPLADYPSGDDVVDATRANKEIEAAV
FT                   RKAPEQYMWLHRRFKTRPSSDDISYY"
FT   gene            531181..532608
FT                   /gene="hldE"
FT                   /locus_tag="ASA_0522"
FT   CDS_pept        531181..532608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hldE"
FT                   /locus_tag="ASA_0522"
FT                   /product="ADP-heptose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88688"
FT                   /db_xref="GOA:A4SIG6"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023030"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SIG6"
FT                   /protein_id="ABO88688.1"
FT                   /translation="MKITLPEFGKARVLVVGDVMLDRYWHGPTGRISPEAPVPVVKVEH
FT                   IEERPGGAANVALNSAALGAHAVLLGLTGQDEAADALAGQMAGVKVACDFVRLADYPTI
FT                   TKLRVLSRNQQLLRLDFEEAFHDVDSTLLMNKVEQALPSSDVMILSDYGKGALNDVPGM
FT                   IQRARAAGIPVLVDPKGTEFEKYRGATLLTPNMSEFEAVVGKVKGEEDLVAKGLALVKR
FT                   FELEALLVTRSENGMTLIREGQPELHLPAQAHEVYDVTGAGDTVISTLATSLAAGMSLD
FT                   EACALANTAAGIVVGKLGTSTVSPVELANALYTEQETGFGVMSEAQLKIAVQAARLRGE
FT                   KVVMTNGCFDILHAGHVSYLANAGKLGDRLIVAVNTDGSVRRLKGPGRPVNSTDRRMAV
FT                   LAGLGAVDWVVPFAEDTPQRLIAEVLPDLLVKGGDYKPKDIAGYDEVTANGGEVRVLNF
FT                   EDGCSTSDIIKTIRERG"
FT   gene            complement(532777..534102)
FT                   /gene="tolC"
FT                   /locus_tag="ASA_0523"
FT   CDS_pept        complement(532777..534102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolC"
FT                   /locus_tag="ASA_0523"
FT                   /product="outer membrane protein TolC"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88689"
FT                   /db_xref="GOA:A4SIG7"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIG7"
FT                   /protein_id="ABO88689.1"
FT                   /translation="MKRTLLSAMVLLGVSAGAHAENLLDIYQQAQIKDTQLQESKAKRD
FT                   QAFEKINESRAALLPQINLGAGLNYLQNKGDTQTNSNATGSLSLDQSIYRRSNWVNLDL
FT                   TEKSATQSDVAYNLEIQNLMLRTAQAYFNVLKAMDTLEFVRANKAAVERQLEQTQQRFE
FT                   VGLTAITDVHEAEAERDQALADEINAENTLDNSYESLRELTGIDHRQLDVLNTERFSPQ
FT                   KTPFNSDKWLELALDKNLQLHSARIGKDIAKEQIDLAKTGHEPTLDLGAGLSSTYSDYK
FT                   DEIRNPESNSNQGNIGLNFKLPLYTGGATTSQVKQSQFNYVAASEQLERSFRSVQSTVR
FT                   SSYNNVNASIGSVRAYGQSVISADSALKATEAGYEVGTRTIVDVLDSTRKLYQAKQKLS
FT                   EARYNYILSILSLKQAAGTLEQKDLEEVNQGLIPAAQVKNKS"
FT   mobile_element  complement(534281..535444)
FT                   /mobile_element_type="insertion sequence:ISAS4"
FT   gene            complement(534304..535335)
FT                   /locus_tag="ASA_0524"
FT   CDS_pept        complement(534304..535335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0524"
FT                   /product="IS630-family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88690"
FT                   /db_xref="GOA:A4SHI5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:A4SHI5"
FT                   /protein_id="ABO88690.1"
FT                   /translation="MPILPPLPRPQLRRIHKIIHATRDKGHARRLMAILLLHEGRTVTD
FT                   VHHLTGAARSTIGRWLRWYRDEGIDALEALPAGRAPVLPIAKMVTLLVLLMQFSPQDFG
FT                   YQRSRWCTELLAIKINRLTGLNVAASTLRRWLPRMGIVWRRPVPTLRIKDPAYQEKMAN
FT                   IDAALARCNADNPVFYEDEVDIDLNPKLGADWMFRAQQKRVVTPGQNAKHYLAGVLHAG
FT                   NGRVLYVSGIKKNSSLFIAMLEKLRHHYRRAKTITLILDNYIIHKSKQTERWLKKNPKF
FT                   CLVFQPVYSPWVNHIERLWHKLHETITRNHQCRGMANLLARVKYFMDTVSPFPGNGYGT
FT                   AKV"
FT   gene            535569..536210
FT                   /gene="nudF"
FT                   /locus_tag="ASA_0525"
FT   CDS_pept        535569..536210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nudF"
FT                   /locus_tag="ASA_0525"
FT                   /product="ADP-ribose pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88691"
FT                   /db_xref="GOA:A4SIG9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004385"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIG9"
FT                   /protein_id="ABO88691.1"
FT                   /translation="MSQQALPQTRHYSADDVKIIEKSSGYNGFFKVNVYRLQHRLFAGG
FT                   WNEPIVRELFERGHAAALLPYDPVRDQIVLVEQFRIGAIETSSTPWLLELVAGIIDEGE
FT                   TAEVVVRREAVEEAGIEVGRCEHAISYLVSPGGSTERIEVYVGEVDASKAEGIHGLAEE
FT                   GEDIRVHVVSREQAYAWLKEGRIDNAASVIALQWLALNHGELRARWLAER"
FT   gene            536340..536765
FT                   /locus_tag="ASA_0526"
FT   CDS_pept        536340..536765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0526"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88692"
FT                   /db_xref="InterPro:IPR009659"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIH0"
FT                   /protein_id="ABO88692.1"
FT                   /translation="MKRYVPDLMSLQRSCEVNYMALMKLLPPGGTVGAERRYQVGNGLQ
FT                   FQLTVSEESRFTSQVILAQHNPELPSYLQARIEIRLYHDVRMAEVCAAQQISRLQPRYD
FT                   YPNKKMHQRDEKEQVNLFLADWLRFCLRHGTSLINIL"
FT   gene            536792..537610
FT                   /gene="icc"
FT                   /locus_tag="ASA_0527"
FT   CDS_pept        536792..537610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icc"
FT                   /locus_tag="ASA_0527"
FT                   /product="cyclic AMP phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88693"
FT                   /db_xref="GOA:A4SIH1"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIH1"
FT                   /protein_id="ABO88693.1"
FT                   /translation="METELPQAQDGSVRLLQITDTHLFASAEGRLLAVRTAESLAAVLE
FT                   QVQVNEHPFDLILATGDLSQDHSPESYQRFASMMAPLARPIYWLPGNHDDGPLMTEYLH
FT                   AAGISEAKQLVGEHWQVMLLDTQVRGKPHGVLGDHQLAALDSALRQHPERHALIALHHQ
FT                   AVPVGCAWLDQHNLKNADDLFAVLARHPQQKTILFGHVHQEFDEVHRGVRLIASPSTCI
FT                   QFKPLSDGFALDESGPGWRYLTLHPDGRVASQVWRLPVGQFVPDPDATGY"
FT   gene            537623..538210
FT                   /locus_tag="ASA_0528"
FT   CDS_pept        537623..538210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0528"
FT                   /product="predicted esterase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88694"
FT                   /db_xref="InterPro:IPR008886"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIH2"
FT                   /protein_id="ABO88694.1"
FT                   /translation="MKSVLLYLHGFNSSPGSAKAQQMAAWVAEYRPDIEVIIPAQPNTP
FT                   AAAWAAIEQIIEDVSARHGAHFKLGAVGSSLGGFMATRVAERYGCRAALINPAVRPHEL
FT                   LCDYLGPQTNPYTNECFELLPVHMDELKALAVPVTAPERLWILQQQEDEVLDYRKALTE
FT                   YQFARLSLECGGNHAFTGFERYPAQIIHFLGL"
FT   gene            538213..538836
FT                   /gene="mutT"
FT                   /locus_tag="ASA_0529"
FT   CDS_pept        538213..538836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT"
FT                   /locus_tag="ASA_0529"
FT                   /product="mutator MutT protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88695"
FT                   /db_xref="GOA:A4SIH3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIH3"
FT                   /protein_id="ABO88695.1"
FT                   /translation="MQPPLATFLEQVLATAQAGLTYSKDPFDIGRFEALRAATVALIAS
FT                   HSDLKPDTIAEWIDLDHGYPTPKLDVRALIVDKAGNILLVQERSDGCWTLPGGWCDVGD
FT                   SPADAVVREVVEETGLECRAVQLLALFDKLKHPHPPQLPHAHKAFFLCEVIGGQLLGET
FT                   GETQGAGYFPIDDLPELSRHRVVASQLRTLHAHLLQGRRDTLFD"
FT   gene            538874..539275
FT                   /locus_tag="ASA_0530"
FT   CDS_pept        538874..539275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0530"
FT                   /product="Glutathione-dependent formaldehyde-activating,
FT                   GFA"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88696"
FT                   /db_xref="GOA:A4SIH4"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIH4"
FT                   /protein_id="ABO88696.1"
FT                   /translation="MIKRIGKTRIEEKHRASCHCGAVVLELTLPDGVVDPRRCDCSLCR
FT                   RRGAIVASVPLSGIRILQGEAELRCYQFNTRTAKHYFCSVCGIYTHHQRRSNPAEYGYN
FT                   LACLEGVNPFELAEVPLRDGVNHPADRGK"
FT   gene            539504..541399
FT                   /gene="parE"
FT                   /locus_tag="ASA_0531"
FT   CDS_pept        539504..541399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parE"
FT                   /locus_tag="ASA_0531"
FT                   /product="DNA topoisomerase IV, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88697"
FT                   /db_xref="GOA:A4SIH5"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005737"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIH5"
FT                   /protein_id="ABO88697.1"
FT                   /translation="MSTQYNADAIEVLNGLEPVRRRPGMYTDTTRPNHLGQEVIDNSVD
FT                   EALAGHARTLEVTLFEDQSLEVIDDGRGMPVDIHPEEGVSGVELILCKLHAGGKFSNKN
FT                   YQFSGGLHGVGISVVNALSDRVEVTVRRDGQVYDIAFERGDKVQELTITGTCGRRNTGT
FT                   RVRFWPQASYFDSPRFSVTKLEHLLKAKAVLCPGLTIKFLDKNTGIKLEWCYEDGLKDY
FT                   LVDAVKQFTCLPEQPFVGAFSTEQSAVDWALCWLPEGGECLAESYVNLIPTPQGGTHVN
FT                   GLRQGLLDAMREFCEFRNLLPRGVKLTPEDIWDRCAYILSIKMQDPQFAGQTKERLSSR
FT                   QSSAFVSGVVKDSFSLFLNSNTELAEQIAEICISSAQRRLRAAKTVVRKKITQGPALPG
FT                   KLTDCNCADPMQGELFLVEGDSAGGSAKQARDREFQAIMPLRGKILNTWEVEAGQVLAS
FT                   QEVHDISVAIGLDPDSEDLSGLRYGKVCILADADSDGLHIATLLCALFVRHFRTLVNKG
FT                   HVYVAMPPLYRIDIGKEVYYALDEDEKNGVLQRVEAEKKKGKVMVTRFKGLGEMNPKQL
FT                   RETTMDPNTRRLVQLTMGELEEGDETLQLMDMLLAKKRAPDRREWLEEKGNLAII"
FT   gene            541484..543778
FT                   /gene="parC"
FT                   /locus_tag="ASA_0532"
FT   CDS_pept        541484..543778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parC"
FT                   /locus_tag="ASA_0532"
FT                   /product="topoisomerase IV subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88698"
FT                   /db_xref="GOA:A4SIH6"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005742"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIH6"
FT                   /protein_id="ABO88698.1"
FT                   /translation="MSDAIELSLDGVERQPMRTFTEQAYLNYSMYVIMDRALPHIGDGL
FT                   KPVQRRIIYAMSELGLSALSKHKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRY
FT                   PLVDGQGNWGAPDDPKSFAAMRYTEARLSRFSELLLSELGQGTVDWTPNFDGTMKEPVV
FT                   LPARLPHILLNGITGIAVGMATDIPPHNAREVAYACAELLDNPNAGLDALMAHIQGPDY
FT                   PTSAEIITPRDDIRKIYETGKGSIKQRAVWNEEDGDIVITALPHQASGAKIMEQIAAQM
FT                   VAKKLPMVTDLRDESDHENPTRLVIIPRSNRVDMEALMAHLFATTDLEKNYRVNLNILG
FT                   LDNRPQVKTLKMILSEWIIFRRETVRRRLQYRLDKVLARLHILEGLLVAYLNIDEVIEI
FT                   IRTEDEPGKVMVERFNISETQAEAILELKLRHLAKLEEFKLRAEQDELAIERDKLELLL
FT                   GSERRLNTLLKKELLADAEKYGDDRRTPLVERASAVALTEKELTPSEPVTVILSDKGWV
FT                   RAAKGHDVDVAGLSYKAGDGYLAHACGRSNQQAVFLSTLGRTYALEAHTLPSARSQGEP
FT                   LTGRFALGAGEEVRHLVMGNEGEPYLICSDAGYGFVCTYDDLIGKNKNGKALLTVPEGG
FT                   LVMAPQKIGSPETDLCMAISNEGRMLLFPLNTLPVLGKGKGNKLISIPSARVKAREEFM
FT                   VMAAIIPQGQYVTLFAGKRKLTLKPADLDYYRGERGRRGAKLPRGLQRVDRIEIEPAAG
FT                   PEPIAEENQEG"
FT   gene            complement(543881..544471)
FT                   /locus_tag="ASA_0533"
FT   CDS_pept        complement(543881..544471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0533"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88699"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIH7"
FT                   /protein_id="ABO88699.1"
FT                   /translation="MVDAVVRAIDNMEAKNTQQDVGLRSQINTFSSTQETGSIFTPRSS
FT                   NLSLPKSFTDLDKDRACREGFGYVTRYFENSLSEFKKRNSGVDYEFHQLDANAISCAIY
FT                   INGSRAGQCGIWRNNDRNYGGGEICYGQDGIARNSYNECLTITDNGQTLGFRPLMGGYT
FT                   MSSSRETLLTNEGMAEHLWDMFFNQIKQGRRLG"
FT   mobile_element  544478..545716
FT                   /mobile_element_type="insertion sequence:ISAS6"
FT   gene            544546..545708
FT                   /locus_tag="ASA_0534"
FT   CDS_pept        join(544546..544806,544806..545708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="ASA_0534"
FT                   /product="IS3-family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88700"
FT                   /db_xref="GOA:A4SIH8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIH8"
FT                   /protein_id="ABO88700.1"
FT                   /translation="MTRLRRSFTAEFKLEAASLVVDQGYSVPEASRSLDVGETVLRRWV
FT                   QQLQSERCGTTPISKALTPEQQKIQELEARINRLEREKDILKKGYCSLDGGRVHTYALI
FT                   DRLREQAPITLVCCAFDVPKSCFYDYLARKRTINRERMKQRSELRRLFKESRDSAGSRA
FT                   LMSMMRELGYQIGRFKVRNLMKEAGLASKQPGAHRYKVACSERPDIPNLLAREFDVPQP
FT                   NQVWCGDITYVWTSARWHYLAVVLDLHTRRVVGWAMSDKPDAELAIKALEMAYQQRGCP
FT                   SGVLFHSDQGSQYGSRAFRQRLWRYRMTQSMSRRGNCWDNAPMERLFRSLKSEWLPATG
FT                   YVSLREAKRDISYYLMDYYNWRRPHQHNDGIPPAEAEDRPNQVSGFS"
FT   gene            545821..546144
FT                   /locus_tag="ASA_0535"
FT   CDS_pept        545821..546144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0535"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88701"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIH9"
FT                   /protein_id="ABO88701.1"
FT                   /translation="MMKYVPILFCCWALYAQAETPEPVQEGTLANQQLIQDAMVGVAGW
FT                   VATKGCEVPERFVPVVLQPPKGEPGSRYWQERWTVEGCGKQYPVLIDFRETGVDSAMWT
FT                   IAH"
FT   gene            complement(546444..547226)
FT                   /locus_tag="ASA_0536"
FT   CDS_pept        complement(546444..547226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0536"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88702"
FT                   /db_xref="UniProtKB/TrEMBL:A4SII0"
FT                   /protein_id="ABO88702.1"
FT                   /translation="MSLKFADKYYNKYKMHLLEQAAHDVIGVVSLGLLELSQRDTAKAL
FT                   ALLQAPEGPIKPFQKGWSMLISVSAKQPGGNSLYGDVDARLLDKISSPPDVEEWQGWQE
FT                   YEKALVEHNKARLMSLIDQHFFACENDHPTMEDKLAEALLYRILCGNGSGAAKLKVKQD
FT                   LKRKLAREIELQEKWYDTDYLAAQLELLLAELPGELIAGLRQDLSKGFVPNLLHTLGFV
FT                   RQYQLLQQENAEPEKLDNFEMRAGLKHPLLGWPLYHDF"
FT   gene            complement(547361..548122)
FT                   /locus_tag="ASA_0537"
FT   CDS_pept        complement(547361..548122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0537"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88703"
FT                   /db_xref="UniProtKB/TrEMBL:A4SII1"
FT                   /protein_id="ABO88703.1"
FT                   /translation="MHSLIEITAIEIKELAVIEPKQASEKFELIAKTMSDDQLAEVIEQ
FT                   IDIVTLTQINGQHDMSFPSIISELMTPERIRDIVCQQPLYWEEAIKNNAEELQQHTFDF
FT                   LNYLIRTQDSDAKQAEILECIAEDPAGLFYLAIPFIEFYRGERFEDEEGFHDTLHAEEE
FT                   DLEEALSYSDRQQSENAHDYPLDDPRSLLMLIRELTPDVEKAIKALLRNEHSSWEGIIS
FT                   KFASELVMQAKDKNDASDEYAEVDDMFSFLD"
FT   gene            complement(548136..548663)
FT                   /locus_tag="ASA_0538"
FT   CDS_pept        complement(548136..548663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0538"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88704"
FT                   /db_xref="UniProtKB/TrEMBL:A4SII2"
FT                   /protein_id="ABO88704.1"
FT                   /translation="MQKKWDQARIKALMSDASENIESYRDQDDPKALEQFTGKMKTLLL
FT                   ADMSMLEFMPEYLPLALYGRVQFPAKAKPEWIKWLGSGVQPSWDEFKVSVAFNNADLPL
FT                   VKAVRAQSEDQLIEACAVLFQLDNPLPRGGRRADDDYELRDDDDDGENADADYNGDGDD
FT                   DGDQDMYDEVRF"
FT   gene            complement(548670..548954)
FT                   /locus_tag="ASA_0539"
FT   CDS_pept        complement(548670..548954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0539"
FT                   /product="DnaJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88705"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A4SII3"
FT                   /protein_id="ABO88705.1"
FT                   /translation="MNNYFRVLGVKSNASENDIKKAYRRLSNQYHPDKLLGASEEEREL
FT                   AAIKLHQVKQAYEVLSDPKQRAAFIKDFNNVIVTDPASAMQEMWDQFYP"
FT   gene            complement(549047..549286)
FT                   /locus_tag="ASA_0540"
FT   CDS_pept        complement(549047..549286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88706"
FT                   /db_xref="GOA:A4SII4"
FT                   /db_xref="UniProtKB/TrEMBL:A4SII4"
FT                   /protein_id="ABO88706.1"
FT                   /translation="MFVCCQRRGAELPLASRSCLFTAPLSSDTQRPACRAFFQPPSHIP
FT                   HPLLAKMAAIGAFLALATCLPYRLLFMAELACFR"
FT   gene            complement(549255..549731)
FT                   /locus_tag="ASA_0541"
FT   CDS_pept        complement(549255..549731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0541"
FT                   /product="DoxX family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88707"
FT                   /db_xref="GOA:A4SII5"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A4SII5"
FT                   /protein_id="ABO88707.1"
FT                   /translation="MTSIIARFLSTRSERYFLPLTLIRIAFGLFFFASGLNKLIQPDNQ
FT                   QAMLHTMIEAGLPYPAFMATFVAGNETLFGLLLVFGLLTRLSSLVLLVINIVALVTIGL
FT                   HQIPADVTGLEWYSWLLYLPESVYILLCILLVVQGCGPWGLDRHLVRLLPEAGR"
FT   gene            complement(549916..550440)
FT                   /gene="scsD"
FT                   /locus_tag="ASA_0542"
FT   CDS_pept        complement(549916..550440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scsD"
FT                   /locus_tag="ASA_0542"
FT                   /product="copper-sensitivity suppressor D protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88708"
FT                   /db_xref="GOA:A4SII6"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4SII6"
FT                   /protein_id="ABO88708.1"
FT                   /translation="MEAKPSLPHRLRRWGKEALWLLLFGVVISTALDFWRSPALPEGNP
FT                   LPTLTLQDGTTADLQAMSRDKPLLVYYWASWCAVCRFTTPTVEQLWQDGENVLTVALRS
FT                   GNTQQLSKGMGKKGLTFPTHNDERGDLAARWQVSVTPSFLIVKDGKVVSTTTGWSSGLG
FT                   LKLRLAWASLG"
FT   gene            complement(550443..551054)
FT                   /gene="scsC"
FT                   /locus_tag="ASA_0543"
FT   CDS_pept        complement(550443..551054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scsC"
FT                   /locus_tag="ASA_0543"
FT                   /product="copper-sensitivity suppressor C protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88709"
FT                   /db_xref="GOA:A4SII7"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4SII7"
FT                   /protein_id="ABO88709.1"
FT                   /translation="MANPKILDEVADAWEKQNAADQANQLGNFIKGNQDVLFNSATSPR
FT                   LGAKNPKLTLVSFTDYNCPFCKQFDPHLARLLKAYPNDVGLVIKLLPFKGQTSAKAAQY
FT                   SLTLWQQDPARFLALHDKLMSKQGMLTEADINKALAATGNAALKPEARATEELRNSLRI
FT                   GTLLGVQGTPATLIGNQLVSGAIPYEELEQIVKAELARKG"
FT   gene            complement(551171..553213)
FT                   /gene="scsB"
FT                   /locus_tag="ASA_0544"
FT   CDS_pept        complement(551171..553213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scsB"
FT                   /locus_tag="ASA_0544"
FT                   /product="copper-sensitivity suppressor B protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88710"
FT                   /db_xref="GOA:A4SII8"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4SII8"
FT                   /protein_id="ABO88710.1"
FT                   /translation="MSNIIKTALLMGGLLWQSMGLASDTGWLASPQNDHAKVRLQADTR
FT                   DPAQTRVLLSLELESGWKTYWQNPGEGGIAPEIFWDAPQATQQWHWPVPERFDVSGIST
FT                   QGYQKTVSLPITLAHSSSDALTGTLRLSTCSNVCILTDYPFTLALDGTTPEGFDFAYAQ
FT                   AMSKLPQTLPDTVILKAGYQQNQLQLTADNPQGWQDPQIFLQKLEGAEFGKPELEVQGN
FT                   TLIARIPVSDGWQGDAPDIRNQQLGFVLANGEQAWQSEFHIGDPLTLPSQGHSMLWLLG
FT                   AALLGGLILNLMPCVLPVLALKLGSVLQLETRERRPVRLQFLAASAGILVSFWALALMS
FT                   TLLRATQGAVSWGIQFQSVWFIGFMVVVTLLFCANLLGLFELRLPSNLNTRLATTGGNS
FT                   LGGHFLQGCFATLLATPCSAPFLGTAVAFALGAPLGQLWLIFTALGIGMSLPWLLIAAF
FT                   PRLALWLPKPGRWMRRLRILLGLMMLGSSLWLLSLLGNHIGQFWMLILMALMLAALLLA
FT                   VVWRHGIRGVTLGLALTCLVGGALLLGGAFTMEGKPQRDTVNWQPLSEQAIVDALAQNK
FT                   PVFVDVTADWCITCKANKFNVLLRDDVQKALSAPDVVALRGDWSRPSASIADFLRQRGS
FT                   VAIPFNQIYGPGLLGSEILSPLLDRPTLLGTLKQAAIAPSQGDTK"
FT   gene            complement(553264..553641)
FT                   /gene="scsA"
FT                   /locus_tag="ASA_0545"
FT   CDS_pept        complement(553264..553641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scsA"
FT                   /locus_tag="ASA_0545"
FT                   /product="copper-sensitivity suppressor A protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88711"
FT                   /db_xref="GOA:A4SII9"
FT                   /db_xref="UniProtKB/TrEMBL:A4SII9"
FT                   /protein_id="ABO88711.1"
FT                   /translation="MILRQRVATRLLLLVCILVLNCAAQPLARLAQLDQALSCQLLPVP
FT                   SSGAEADDAQTATPQPSSCQLNGKWLSAATLLCVEQIFFAIAFVIALLAPLSRRSPALP
FT                   PPRNISPPERRLHLTLCVWRE"
FT   gene            553818..554546
FT                   /gene="plsC"
FT                   /locus_tag="ASA_0546"
FT   CDS_pept        553818..554546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsC"
FT                   /locus_tag="ASA_0546"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88712"
FT                   /db_xref="GOA:A4SIJ0"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIJ0"
FT                   /protein_id="ABO88712.1"
FT                   /translation="MLKLARVLLLTLLLVFWFVFGLLLCLVRPRHPNNVFVFARMYHAV
FT                   CPLLGLKVKVTIPDEIKSLGPAVYVCNHQSNFDIFTVTGAVMPGVVAVGKKSLLWLPFF
FT                   GLIFWLSGNVLIDRSNRSRAIGTIGQVVDRIKNHGTSIWMFPEGTRSKGRGLLPFKAGA
FT                   FHTAVQAEVPVVPIVCSSYFGQVDLNRWDNGEVLVEVMAPLCSKEHGAAGIRDLSDTCR
FT                   AAMESKLVELDSKLGRHQAV"
FT   gene            554757..555389
FT                   /gene="pspA"
FT                   /locus_tag="ASA_0547"
FT   CDS_pept        554757..555389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pspA"
FT                   /locus_tag="ASA_0547"
FT                   /product="phage shock protein A"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88713"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="InterPro:IPR014319"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIJ1"
FT                   /protein_id="ABO88713.1"
FT                   /translation="MSVFSRLTDVINANLHSLLDKSEEPEKMLRLMIEEMEQVQVEMRT
FT                   QAARVIAEQKQLERHQQALQHQVLEWSAKAELAIQKGREDLARAALTEKLAEVKKCEQL
FT                   EQDKARVAEVLAQLTADSERLAAKLSEAREKQKMLTLREQTAHSRIRARAQVDNQRMHE
FT                   LMARFDGFQGRVDQLEAQMEAATLGQNPSLEAQFRELARLKGQKVEA"
FT   gene            555392..555598
FT                   /gene="pspC"
FT                   /locus_tag="ASA_0548"
FT   CDS_pept        555392..555598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pspC"
FT                   /locus_tag="ASA_0548"
FT                   /product="phage shock protein C"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88714"
FT                   /db_xref="GOA:A4SIJ2"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIJ2"
FT                   /protein_id="ABO88714.1"
FT                   /translation="MTPWPKDLAHRKLTGVCAGIANRLGLSRVTVRIVALIALILMPPL
FT                   TLAAYLLAVLIMPPRRELKRWLD"
FT   gene            555645..555863
FT                   /gene="pspG"
FT                   /locus_tag="ASA_0549"
FT   CDS_pept        555645..555863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pspG"
FT                   /locus_tag="ASA_0549"
FT                   /product="phage shock protein G"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88715"
FT                   /db_xref="GOA:A4SIJ3"
FT                   /db_xref="InterPro:IPR014318"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIJ3"
FT                   /protein_id="ABO88715.1"
FT                   /translation="MLEFIVLMLVLVAMALTGFTVLAMLVVSGVFVLFGALAGMFALII
FT                   KLAPWLLVLLVVCWFISNRRKQSNTYR"
FT   gene            complement(555860..556270)
FT                   /locus_tag="ASA_0550"
FT   CDS_pept        complement(555860..556270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0550"
FT                   /product="endo/excinuclease domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88716"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR022992"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SIJ4"
FT                   /protein_id="ABO88716.1"
FT                   /translation="MRKSTMDAEPTSSPPAGQWSIYLVRTAAGLLYTGISTDPIRRLRQ
FT                   HQSGKGSRALRGKGPLVLVWQQTVGNKGAALRLEYRLKQQSKAFKERLVQEPDRWADWS
FT                   QPWLTVVTPPLEAPQKRPLQAVAKEGSDNREG"
FT   gene            556282..557046
FT                   /locus_tag="ASA_0551"
FT   CDS_pept        556282..557046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0551"
FT                   /product="ABC-type transporter, periplasmic binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88717"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIJ5"
FT                   /protein_id="ABO88717.1"
FT                   /translation="MPNSRSAQGGAMRVWCWLWCLLSMSAHGETLRLYDYHQHPPFMTG
FT                   ETTGLSRDLVKYLNEKLGGEPRLELWLVNRARLALEMSDPGFDGLVSWVNPVWVGDPQR
FT                   EHYLWTFSMMRDTNELISSLAKPVTYRGPDSLKGLIFGGIEGYRYQGIDDAVARGDLVR
FT                   HDAKKVRTNFSLLIRGRIDVTLVPGSALAFFTHDAYEGKLFVSPFAQSSYTRHLLLPKS
FT                   RHELHTRLNDIAEQMGRDPKWLAILESYRSRP"
FT   gene            complement(557028..557924)
FT                   /gene="rarD"
FT                   /locus_tag="ASA_0552"
FT   CDS_pept        complement(557028..557924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rarD"
FT                   /locus_tag="ASA_0552"
FT                   /product="RarD protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88718"
FT                   /db_xref="GOA:A4SIJ6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIJ6"
FT                   /protein_id="ABO88718.1"
FT                   /translation="MKNWMGTGSAALSFALWGMLPLYYQFMPEVNMWELLSHRVLWSVV
FT                   LLAALFALFGYQVPWARLRSEPRQLGLILLAGPVMSISWCMFTWCLTTGQVLATSLAFF
FT                   MTPLFNIVFAVIFLKEKLTVQKHLAVALAGLAYMLLSYGQLPWFSLIMGANFTFYGLLK
FT                   KKVHYDAGVSLYLEALVQLPVALLIIGALTLNGMSQFMAGDWADRLLLMGSAPATLLPV
FT                   GLFCYGMMRTRMSTVGLLQYIEPSLAFLLAILWFGETADPVKSVGFAFVWAGLLVSLLP
FT                   LHRLRRGGNNDAQGLLR"
FT   gene            558027..558608
FT                   /locus_tag="ASA_0553"
FT   CDS_pept        558027..558608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0553"
FT                   /product="uracil-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88719"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIJ7"
FT                   /protein_id="ABO88719.1"
FT                   /translation="MNRLDTLFEQIRACRLCEAHLPLGPRPVIRGKESARLLIIGQAPG
FT                   TRVHASGIPWDDPSGDRLRHWLGVDKTTFYDESRIAIMPMGLCYPGKGKSGDLPPRPEC
FT                   APTWHDKVLMLLPNIELTLLIGQYSQQYYLGKAGKGSLTETVRQWADYCPAWLPLPHPS
FT                   PRNTFWLRKNPWFEQDVLPHLQQRVAPLLL"
FT   gene            complement(558610..559467)
FT                   /locus_tag="ASA_0554"
FT   CDS_pept        complement(558610..559467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0554"
FT                   /product="transporter, drug/metabolite exporter family"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88720"
FT                   /db_xref="GOA:A4SIJ8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIJ8"
FT                   /protein_id="ABO88720.1"
FT                   /translation="MNAVGIGILYLVLGNMVAVFSDALVKVLEPSQPVFQFVFFRQLSA
FT                   ALLLTPWLLWSWRRNPPVAIKWHLLRAHIWAVGVCLMVIALTRLPLATANAFFYAAPLM
FT                   MVPLAVWMAGEAISRQKVLTALIGFIGVLIVLRPTEVNWAALAALGVALSMALNNLLIK
FT                   RIPLKQPIAQTLFFTNVLSMPFILALALWEGGDWQWQMWWPAFGSSALIMVYAGLCVVA
FT                   YRKAEASKIASAEYTGLLMAVAIGVWLFDEQPGLPLLLGCLCIIIPLLAMARSKPKPLA
FT                   EPAA"
FT   gene            559559..560467
FT                   /locus_tag="ASA_0555"
FT   CDS_pept        559559..560467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0555"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88721"
FT                   /db_xref="GOA:A4SIJ9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIJ9"
FT                   /protein_id="ABO88721.1"
FT                   /translation="MKLPPLRAVQYFEAVARLLSFSRAALELNVSQSAVSHQIRLLEDF
FT                   LGERLLLRQGRLLSLTAQGEVYFEGIAAGLGQIAQSSEQLRGGGEMRVRLAVYSSFAVK
FT                   WLIPRLAGLRQLYPELDLSLEMVAEDPELSDRVADCFITVSPHGRGYCHDLIYRERLFP
FT                   VCSRRLLQQVEGEWPQAIWQLPLLSVQSIYKARGEDWQRWAKAGELVIPDEARMHHFSH
FT                   VLLAMEAAAWDQGVAFVNDYMLRPDDPQLVALPVHQLETGDAFYFTCKRSRAHEPAISR
FT                   LRQWLMMETRQSMALQTKAQP"
FT   gene            complement(560576..561355)
FT                   /gene="znuB"
FT                   /locus_tag="ASA_0556"
FT   CDS_pept        complement(560576..561355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="znuB"
FT                   /locus_tag="ASA_0556"
FT                   /product="ABC-type high affinity zinc transporter, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88722"
FT                   /db_xref="GOA:A4SIK0"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIK0"
FT                   /protein_id="ABO88722.1"
FT                   /translation="MDSFLLYALAAGLGIALLAGPLGSFVVWRKMAYFGDTLSHACLFG
FT                   IALGILLQVDLTLAVVVCCLAMAMLLVIMSRNQQVATDTLLGILAHSALSLGLVTLSFM
FT                   DNVRVDLMAYLFGDLLSVQPVDLLWIYGGGALVLLTLWRLWDPLLSMTISEELARVEGV
FT                   RVDVLRCVLMLLIGLVIAVAMKFVGALIITSLLIIPAATARRFSQTPEQMAGFAALIGC
FT                   LAVLGGLSLSWYQDTPAGPSVVVCATSMFILSQFKKA"
FT   gene            complement(561376..562140)
FT                   /gene="znuC"
FT                   /locus_tag="ASA_0557"
FT   CDS_pept        complement(561376..562140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="znuC"
FT                   /locus_tag="ASA_0557"
FT                   /product="ABC-type high-affinity zinc transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88723"
FT                   /db_xref="GOA:A4SIK1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017882"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIK1"
FT                   /protein_id="ABO88723.1"
FT                   /translation="MTQLVELKEVCLSFDGRSVLDKVSFTLNKGKITTLVGPNGAGKST
FT                   LSKLVLGLLTPDSGEINRSRDLRVGYVPQRLYLDPTLPLTVRRFLQLGKNGRLSIDEAL
FT                   DRVGAGDLLDNRMQKLSGGEMQRVLLARALLVKPELLVLDEPVQGVDITGQIELYALIS
FT                   QLAAELNCAVLMVSHDLHLVMASTHEVICLNRHVCCHGEPESVARHPEFARLFGRPEQE
FT                   VLAVYTHHHHCDGEHHHHEPQAPVIRLPSRNQ"
FT   gene            562139..563170
FT                   /gene="znuA"
FT                   /locus_tag="ASA_0558"
FT   CDS_pept        562139..563170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="znuA"
FT                   /locus_tag="ASA_0558"
FT                   /product="ABC-type high affinity zinc transporter,
FT                   periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88724"
FT                   /db_xref="GOA:A4SIK2"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR035520"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIK2"
FT                   /protein_id="ABO88724.1"
FT                   /translation="MTAPGFTACESYNITAVLVCYIITHSLPDEISMRILTLITALLAV
FT                   SLPVRALEVLTTIKPLGFIAAAITDGVSEPKVLLPTGASPHDFALRPSDIRSINGADLV
FT                   VWVGPELEGFMAKPLAKHPHVLTLTQVEGMPLFNYATQPSHDSHHHDADEHDHAAHDHA
FT                   DHDGHEGHHHEGVDPHIWLGPTQALVIASALSETLSAQDPANAERYRANLLTFKGKVDA
FT                   KDKLIAGQMKAVSQKGYFVFHEAYGYWERHYGMSSKGHFTVSPERRPGAKTLVDIRKAL
FT                   QEKQASCIYAEPQFSPAVIESVARNTGAKVLLLDEVGEQVPLGPDGYPQFMQQLADAFA
FT                   QCR"
FT   gene            563246..563920
FT                   /locus_tag="ASA_0559"
FT   CDS_pept        563246..563920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0559"
FT                   /product="conserved periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88725"
FT                   /db_xref="InterPro:IPR010319"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIK3"
FT                   /protein_id="ABO88725.1"
FT                   /translation="MKWLLIPTCTLALLCASVQASRLSEYIASPELRAKLQEVYGGRAI
FT                   QRAEAFSRLLSPRAGTTDQQKIELVNNYFNNLTYSEDPRLWGDEDYWANPLEFIGARGG
FT                   DCEDYSISKYYTLMELGVDEKKLRLAYVKAVKYNQFHMVTLYFPTPKSDPMLLDNINSR
FT                   ILPGSQRTDLIPVYSFDAKSIWIMKSRREGTLAGSADRLAQWTSMKTRFSSEQLRSPRR
FT                   QL"
FT   gene            complement(563915..564856)
FT                   /locus_tag="ASA_0560"
FT   CDS_pept        complement(563915..564856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0560"
FT                   /product="TRAP-type transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88726"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIK4"
FT                   /protein_id="ABO88726.1"
FT                   /translation="MNRTWSLLALLWPLPLLANPVTLATGGEQGIYHQVAREFCRLANK
FT                   SDPELQCKPQATSGSIENLRQLQAGQTSYALVQSDWLYQASKGLGPYVSQPQPELRALF
FT                   ATHAEPFTIVVRADGDITSLEQLKLAPIDMGLKSSGTRQTALALFDLLGAKEQDLDLKS
FT                   AGNLVDALCSKQIDAYGLVMGHPNRIVLDTAKRCAIRFLPIEGTLREQLIKGVKYYQRS
FT                   QVPARIYPGNLKATPTFAIAATLVTNAATPEADVYRLTRAMLTQQTNFNEQTYGYANLF
FT                   HKARNKTGPVLSIEQHPGAAKYFEELKTAGKL"
FT   gene            complement(564853..566151)
FT                   /locus_tag="ASA_0561"
FT   CDS_pept        complement(564853..566151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0561"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88727"
FT                   /db_xref="GOA:A4SIK5"
FT                   /db_xref="InterPro:IPR032244"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIK5"
FT                   /protein_id="ABO88727.1"
FT                   /translation="MSLAKLLNRIILILFVIGASLLFMLEVTTVRQSILDQMSANLETA
FT                   ITALGLVLQGTLLNDDKVLAETIVNAMFDGGFVSSVTLLDPDGQPLFQKVFHTAQQNVP
FT                   SWLPSVIDMPPVKIEQELTDGWRMLGTLTLEGHTGYAYQHLWNAISRTGLALLAGLLVF
FT                   TLVISWVCSRLLRPLEQINQQLVRIRKRQFSGSLESPWLQDLKELVISVNQLVSERKRD
FT                   LLQQRLKVTQLGKQQTVTAELPLQGLMDEEEGMQQQYFFSTQGKIRLYSRLVPTISPSQ
FT                   ESSPDEIQHLLELWLRNPAEGLQLPLSLLNHADWTQFAPLLAKARGKTLDWRWDLASFP
FT                   PLGEERLATLQEQGVEMAFSAIPKTNDTFNQLDPINPVFISCQPTQDPLYWNLVAQCLH
FT                   SSGYTLLAEASEIQDINTLRAWGIDGYASKEAS"
FT   gene            566487..567749
FT                   /locus_tag="ASA_0562"
FT   CDS_pept        566487..567749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0562"
FT                   /product="membrane-bound metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88728"
FT                   /db_xref="InterPro:IPR007340"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIK6"
FT                   /protein_id="ABO88728.1"
FT                   /translation="MLLLTAMTLSAVAILPAPGDILERPLRLELPIATHGTATNEDNTD
FT                   FNDIPDHELVEAATPEDDIPTDSTPQWQDYRVRNGENLTTIFNNLGLSTTTLYKVLDAD
FT                   SKNNLARLKPGQTIELLIDQDNILQQMKIRLNIKQTLVLERTDDTYSANMLNEEVEWQQ
FT                   KSYDGVINGSFYVSARNAGIPASHIQKIANLFQWRLNFAKDLKKGDKFRVLVRQETVEG
FT                   KSTGNTQLLGVEVFNQGKGVSAWLSEDGNYYDGQGNSLERGFRRYPTHSRYRVSSSFNP
FT                   NRRHPITGQVRPHEGTDFALPVGTPVLATGDGVVLKATSHPLAGTYVVIRHGRTLMTRY
FT                   LHLSKLLVKTGQKVKMGDKIALSGNTGRSTGAHLHYEVRINNRPVDAMKVKLPMAEPLS
FT                   GKAKRQFLAKVKSYRKEMEAG"
FT   gene            complement(567821..568765)
FT                   /locus_tag="ASA_0563"
FT   CDS_pept        complement(567821..568765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0563"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88729"
FT                   /db_xref="GOA:A4SIK7"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:3HG7"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIK7"
FT                   /protein_id="ABO88729.1"
FT                   /translation="MSQRTLLLLSQDNAHYERLLKAAHLPHLRILRADNQSDAEKLIGE
FT                   AHILMAEPARAKPLLAKANKLSWFQSTYAGVDVLLDARCRRDYQLTNVRGIFGPLMSEY
FT                   VFGHLLSLMRQLPLYREQQKQRLWQSHPYQGLKGRTLLILGTGSIGQHIAHTGKHFGMK
FT                   VLGISRSGRERAGFDQVYQLPALNKMLAQADVIVSVLPATRETHHLFTASRFEHCKPGA
FT                   ILFNVGRGNAINEGDLLTALRTGKLGMAVLDVFEQEPLPADSPLWGQPNLIITPHNSAY
FT                   SFPDDVAQIFVRNYIRFIDGQPLDGKIDFDKGY"
FT   gene            568928..569509
FT                   /locus_tag="ASA_0564"
FT   CDS_pept        568928..569509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0564"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88730"
FT                   /db_xref="InterPro:IPR007338"
FT                   /db_xref="InterPro:IPR023381"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIK8"
FT                   /protein_id="ABO88730.1"
FT                   /translation="MFGDKFYKRLAELQPWQQTVYTLALAERMYPNYALFAQASGFGDA
FT                   KAFRHALDQMWNYLTVKGSRVNLGAILEAFEVYIPEPSKFESYGAYPALDACVALGSAY
FT                   NSVICRVGEEAEDASHASVGTVAGFIEMLEERELTEEELYEHEYIEAELEFQVELLKRV
FT                   AHERDSDRILAIKVFAAQDGVSNIGISLDD"
FT   gene            complement(569588..570067)
FT                   /locus_tag="ASA_0565"
FT   CDS_pept        complement(569588..570067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0565"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88731"
FT                   /db_xref="GOA:A4SIK9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIK9"
FT                   /protein_id="ABO88731.1"
FT                   /translation="MEKHDEVLVALRQIIRAIDMHSKRLIKEAGLTSPQLLLLKGINEL
FT                   GQISMRQLADHTNMSQATATTIMDRLESRQLVQRIRSETDKRKVHATLTDAGRALLAQA
FT                   PTPLQERFIQRFQALEAWEQTLLLSSLQRISSMMNADAIDAAPVLSVRPLTEERA"
FT   gene            570230..570757
FT                   /locus_tag="ASA_0566"
FT   CDS_pept        570230..570757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0566"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88732"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIL0"
FT                   /protein_id="ABO88732.1"
FT                   /translation="MNDYLDIKSLVADLRVVRVRYELPDTSAFVRYQPAYEEDPNTLKV
FT                   HHYDGELPLSCSETGAFNLKELVNELRYAYVLVHLFPDESAMNFYLTGLDTGLAQLEFI
FT                   GGSYDFNRLWITSGISNLGVPMAIFLGKRHAVNGQPSVTLVDHRELAAGRMVYRAIGGA
FT                   GEHVGEDFFNND"
FT   gene            570767..572365
FT                   /locus_tag="ASA_0567"
FT   CDS_pept        570767..572365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0567"
FT                   /product="BCCT family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88733"
FT                   /db_xref="GOA:A4SIL1"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIL1"
FT                   /protein_id="ABO88733.1"
FT                   /translation="MRATKGLLKGLNPTMAMTALTVITLFLLFGVFVPETAAAWFTGAK
FT                   DQIIAGFKWYYILVVALFLFFAVYLMFSRFGSIRLGDDDQVPEFGYFAWFSMLFSAGMG
FT                   IGLVFWSIAEPMNHLQGNPFITEGMTPEAAQIAMRLTFFHWGLHPWAIYVIVGLSLAFF
FT                   SYRRKLPLAIRSVLYPILGERIYGFWGHAADVLAVFGTVFGVATSLGLGVSQMNTGLNQ
FT                   MFGMAVSQSNQLWLIGGISLIATLSAVSGVGRGVKLLSELNIWLSVFVLGLFLVLGPTT
FT                   YILNAYVQNIGDYLQNIVKLSFWTNTEANGTSAWQSSWTAFYWGWWIAWAPFVGMFIAR
FT                   ISKGRTIREFVLGVLLVPSLLGMFWLTVFGGTAMNLELFGGGGVVAAVNQDVTLALYQT
FT                   VELLHWDTFGWIAKAVLTLLICTYFITSSDSGTLVITTLLSIGDQDPPVLHRAIWGLGQ
FT                   GLVAAILLVSGGLAALQAASIIAALPFSVIMLAMCYSLVLGLKQESQHQFEYRQKLKRH
FT                   PGSVNLSLMDRIGPG"
FT   gene            complement(572446..575001)
FT                   /gene="mutS"
FT                   /locus_tag="ASA_0568"
FT   CDS_pept        complement(572446..575001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutS"
FT                   /locus_tag="ASA_0568"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88734"
FT                   /db_xref="GOA:A4SIL2"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SIL2"
FT                   /protein_id="ABO88734.1"
FT                   /translation="MINIENIQQHTPMMQQYLGLKAENPEILLFYRMGDFYELFYDDAR
FT                   KASQLLDISLTKRGQSAGNPIPMAGVPYHAIEGYLAKLIQLGESAAICEQVGDPATSKG
FT                   PVERKVIRIITPGTVSDEALLSERQDNLIAAVYHDGRRFGYGTMDIGSGRFFINQFDKE
FT                   ETLLAELQRTNPAELLYPESFAFLQHVEGRRGLRRRPEWEFELGTARKLLCQQFGTQDL
FT                   VGFGVDKSETALCAAGCLMQYVKDTQRTALPHIRSVRLEQPDHAVIMDAATRRNLELTQ
FT                   NLAGGYENTLAEVLDRTATPMGSRLLKRWIHQPIRDRVILKGRQSTIKELIEQNLYDEL
FT                   GALLRQVGDVERVLARLALRSARPRDLTRLRQAFAQLPELQRLLADNRHEAVQQLAERA
FT                   STFPELLSLLERAVMEVPPVLIRDGGVIRDGFNQELDELRDLANGATASLVRIEEREKA
FT                   LTGINTLKVGYNRVHGFYIEVSRANSHLVPAHYIRRQTLKNNERYIIDELKKYEDKVLT
FT                   AQAQALALEKRLYEELLDTLLPHLGDLQESASALAELDVLANLAERAETLDYRCPTLID
FT                   EDQILIEAGRHPVVEQVMSDPFIANPIRLERERRMLIITGPNMGGKSTYMRQTALIVLL
FT                   AHIGAFVPADSAHIGPIDRIFTRIGASDDLASGRSTFMVEMTETANILNNATARSLVLM
FT                   DEIGRGTSTYDGLSLAWACAEQLASKIGAYTLFATHYFELTRLPELMSGLANVHLDAVE
FT                   HGDTIAFMHAVQEGAASRSYGLQVAALAGVPKSVINQARHKLAELESATPLATGEVRPA
FT                   SIPLLPQSHPVVDELEAVRPDELTPRQALDLVYRLKQML"
FT   gene            575369..575737
FT                   /gene="arsR"
FT                   /locus_tag="ASA_0569"
FT   CDS_pept        575369..575737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsR"
FT                   /locus_tag="ASA_0569"
FT                   /product="arsenic operon regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88735"
FT                   /db_xref="GOA:A4SIL3"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIL3"
FT                   /protein_id="ABO88735.1"
FT                   /translation="MHKDVATRVFESLASGIRLDVWRLLVKAGLEGRVAGELAGELDIA
FT                   PNSLSFHLKALLHAGLVSVEQEGRFLRYRANIPLMLDLIGYLTEGCCAGHPEACGVMRA
FT                   ESGCSPHVLPEQPCCNKE"
FT   gene            575742..576185
FT                   /gene="arsD"
FT                   /locus_tag="ASA_0570"
FT   CDS_pept        575742..576185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsD"
FT                   /locus_tag="ASA_0570"
FT                   /product="arsenical resistance operon trans-acting
FT                   repressor ArsD"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88736"
FT                   /db_xref="GOA:A4SIL4"
FT                   /db_xref="InterPro:IPR010712"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIL4"
FT                   /protein_id="ABO88736.1"
FT                   /translation="MSVIQIFDPALCCASGVCGTEVEQRLVSFAADLAWAKGQGVAIER
FT                   FNLAQQPMVFAETAAVSAFLVHAGEEGLPLVLVEGQVVLTGRYPSRAELTRYAGLASPK
FT                   AAESGGATIDDAEANPPAAGPGKAGAIKGIVKGGCCSGSSGCC"
FT   gene            576261..578516
FT                   /gene="arsA"
FT                   /locus_tag="ASA_0571"
FT   CDS_pept        576261..578516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsA"
FT                   /locus_tag="ASA_0571"
FT                   /product="arsenical pump-driving ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88737"
FT                   /db_xref="GOA:A4SIL5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027541"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIL5"
FT                   /protein_id="ABO88737.1"
FT                   /translation="MSSFLSYSFLTDAPPFLFFTGKGGVGKTSLACASAVALCDSGKRV
FT                   LLVSTDPASNVGQVFDTQIGNKITAIAAVSGLSALEIDPQAAAQAYRERIVGPVRGKLP
FT                   DSVVRSIEEQLSGACTTEIAAFDEFTALLTDSKLVGEYDHIVFDTAPTGHTIRLLQLPG
FT                   AWSEFLEQGKGDASCLGPLAGLEKQRSQYAEAVAALSDAGKTRLVLVARAQASTLREVA
FT                   RTHDELAAIGLANQQLVINGIFPQSELADDPLASAVWQREQQAMAQMPGLLARLPQDRV
FT                   PLLATNLVGVDSLRQLLGAAPVNGRHEVERPAAESQDQQHPGLKQLVDELATDGHGLIM
FT                   LMGKGGVGKTTLAAAVAVELASRGLPVHLTTSDPAAHLGETLAGALPSLEVSRIDPHAE
FT                   TERYRAQVLATKGRALLEEDLRSPCTEEIAVFQAFSRIIREAGKRFVVMDTAPTGHTLL
FT                   LLDATGAYHREIARQMGGKGMHFTTPMMQLQDPKQTKVMIVTLPEPTPVQETANLQADL
FT                   RRAGIEPWAWVVNHMLAPASVTSPLLAQRAYRQQPHIDAVKGEHARRYAVMPLCRYAVM
FT                   PLCRCALAGRRAGGCQGAASAVSPCLQGGVTCIRASLLPRSNQQRHLPGLSPSFHPTPM
FT                   ESLDEYQCLLRSARQQKNELSRPQSHPLDLCRHGHGGRDWLSVPPGGSVERGHVGRHHQ
FT                   YPAGHRPYPDDVSAAGQGELRHHGRHDPRPSGDYPLTGDELAGRPHPDVRDSPDILA"
FT   gene            578176..579246
FT                   /gene="arsB"
FT                   /locus_tag="ASA_0572"
FT   CDS_pept        578176..579246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsB"
FT                   /locus_tag="ASA_0572"
FT                   /product="arsenical-resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88738"
FT                   /db_xref="GOA:A4SIL6"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIL6"
FT                   /protein_id="ABO88738.1"
FT                   /translation="MSTNACCDLPVSKKMSFLDRNLTLWIFVAMGMGVGIGYLFPQVAQ
FT                   WNEAMSVGTTNIPLAIGLILMMYPPLAKVNYGTMGAMTRDRQAITLSLVMNWLVGPILM
FT                   FVIALTFLHDYPDYMVGLILIGLARCIAMVLVWNDLGGGNKEYGAGLVALNSGFQILTY
FT                   SFMAWLFITVLPPLFGLQGFAVDITMLDIAQSVLIYLGIPFLAGFLSRKYLVKAKGEKW
FT                   YTERFIPAISPITLIALLATIVLMFSLKGEMIVELPMDVVRVAIPLVVYFVLMFFTSFL
FT                   VGKKLGIPYDKNASIAFTATGNNFELAIAVSIAVFGLNSDQAFAGVIGPLVEVPVLIAL
FT                   VNVALRMKRNYPNAEA"
FT   gene            579249..579680
FT                   /gene="arsC"
FT                   /locus_tag="ASA_0573"
FT   CDS_pept        579249..579680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsC"
FT                   /locus_tag="ASA_0573"
FT                   /product="arsenate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88739"
FT                   /db_xref="GOA:A4SIL7"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIL7"
FT                   /protein_id="ABO88739.1"
FT                   /translation="MHNNQITIYHNPACGTSRNTLELIRNSGVEPTVVHYLETPPSRET
FT                   LVALIGAMGMPVRDLLRKNVPPYEALELAENRFSDGDLIDAMLAHPILINRPIVVTPLG
FT                   TRLCRPSEVVLDILPSPQQGAFTKEDGEQVVDAAGNRIK"
FT   gene            complement(579870..580946)
FT                   /gene="arsO"
FT                   /locus_tag="ASA_0574"
FT   CDS_pept        complement(579870..580946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsO"
FT                   /locus_tag="ASA_0574"
FT                   /product="putative flavin-binding monooxygenase involved in
FT                   arsenic resistance"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88740"
FT                   /db_xref="GOA:A4SIL8"
FT                   /db_xref="InterPro:IPR000960"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIL8"
FT                   /protein_id="ABO88740.1"
FT                   /translation="MDQRLDVVVIGAGQAGLACGWHLKQQGLSFVILDAQARPGGNWRN
FT                   YYDSLELFSPAAYSSLPGMPFPGAPGHYPGRDEVVRYLEQYADLFQLPVRQGVQVTQVA
FT                   RADAGFQITAANGQGMLASAVIVASGAFSHPYLPDIPGLESFRGAQLHSADYRHAAPFR
FT                   GQNVVVIGAANSAVQIAYDLASVATVTLAAREAIRFAPQRILGADFHSWLKWTGLEKTR
FT                   WLNDQSTPVLDDGTYRKALKTGYFKQRPMFTQVTSSGIAWPNGQHEAVDSLVFATGFRP
FT                   NLPFLEGLPVMNERGQVMQRDGHAMHVPGLYFVGLPKQRNFASATLRGVGQDAGHLLPH
FT                   LLRYLNQPEMDRTSVYPE"
FT   gene            complement(581002..581349)
FT                   /gene="arsR"
FT                   /locus_tag="ASA_0575"
FT   CDS_pept        complement(581002..581349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsR"
FT                   /locus_tag="ASA_0575"
FT                   /product="transcriptional regulator, ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88741"
FT                   /db_xref="GOA:A4SIL9"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIL9"
FT                   /protein_id="ABO88741.1"
FT                   /translation="MRTYSHDMNTTLTQTQAIDAAIASLDGAFFKALCEPPRVAVLKRV
FT                   MQLGRADITEIAAELPQERSVVSRHLQVLLEAGIVRASKVGRQVFYEVDGPAIIQRLEA
FT                   ILHHTRMCCRG"
FT   gene            complement(581502..584135)
FT                   /gene="ppc"
FT                   /locus_tag="ASA_0576"
FT   CDS_pept        complement(581502..584135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppc"
FT                   /locus_tag="ASA_0576"
FT                   /product="phosphoenolpyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88742"
FT                   /db_xref="GOA:A4SIM0"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SIM0"
FT                   /protein_id="ABO88742.1"
FT                   /translation="MNEKYAALRANVGMLGQLLGKSIKDHQGQAFLDKIETIRQLAKSS
FT                   RKGNEADRERLLETLRTLSDDELLPVARAFSQFLNLANVAEQFHTISRRCEEQVCTPDP
FT                   LEQMFAKLKASNLSQEAIIQAVRELDIDLVLTAHPTEVTRRTLIHKHVQLNDCLEALEL
FT                   SDLLPRERDKILNRIEQLVNQAWHTNEIREQRPTPVDEAKWGFAVVENSLWPAIPEFMR
FT                   NLDERLQQHLGVRLPLDAAPVKFTSWMGGDRDGNPFVTAKVTAEVLELGRWMAVSLFYK
FT                   DIKELTSELSMSDCTDAVRERVGDHPEPYRALVRELREALRETQEYLTAKVQGQVSESR
FT                   DLITTTAQLREPLELCYHSMHACGMGNIADGMLLDVLRKLACFGIHLVKLDIRQDGERH
FT                   GQVFSELTRYLGMGDYAEWSEDDKQAFLLNELNSRRPLIPTDWEPSDETRETIDTCRVI
FT                   AQHDPDAFGIYIISMAGAPSDVLAVQLLLKEAGCKFRMPVAPLFETQEDLMAGTAVMER
FT                   LLSVDWYRGYIQGRQYVMIGYSDSAKDAGMMAAGWAQYAAMESLVALAEASNLRLTLFH
FT                   GRGGTVGRGGAPAHQAILSQPPGSLRGGLRVTEQGEMIRFKFGLPKVAIHSLNLYTSAV
FT                   LEGNLLPPPKPKESWRAVMEQLATVSCDHYRSIVRGHPDFVPYFRAATPEMELGKLPLG
FT                   SRPAKRKPNGGVESLRAIPWIFAWTQNRLMLPAWLGAHKGLEHAITDGQKSVLEEMSRQ
FT                   WPFFRTRLEMLEMVFLKADLWLAEYYDTRLVPQELWNLGKQLRQELADAIQIVLQLRPQ
FT                   GDLLDDQPWIKESINLRNPYTDPLNVLQVELLGRSRSHTETLHPELDQALMVTIAGIAA
FT                   GMRNTG"
FT   gene            complement(584348..585493)
FT                   /gene="argE"
FT                   /locus_tag="ASA_0577"
FT   CDS_pept        complement(584348..585493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argE"
FT                   /locus_tag="ASA_0577"
FT                   /product="acetylornithine deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88743"
FT                   /db_xref="GOA:A4SIM1"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIM1"
FT                   /protein_id="ABO88743.1"
FT                   /translation="MANLDFFALYKNIIAIPSISSTDPHWDQSNEAVIRLLADWFGQLG
FT                   FQCEVTALPELPGKFNLVATIGQGEGGLLLAGHTDTVPFDEGGWRKDPFKVTEEGNRLY
FT                   GLGTIDMKGFFAFIVEALKEIDLTKLTKPLRILATADEETTMAGARAIAAAAEIKPDYA
FT                   VIGEPTGLVPVVAHKGHMSEAIRITGKSGHSSDPANGVNALEIMHQAMGRVLRLQLRLE
FT                   ETYADYRFAVPQPTLNLRYIHGGDSPNRICGCCELHIDMRPTPQVGPDELMGMLKEALA
FT                   PIEVHQPGGLHLQHLHEPIPAYACADDSVLVREAEQASGHKAESVNYCTEAPFIQQLGC
FT                   QTIVMGPGHIAQAHQPDEYLDLSFVKPTTAVLQHLIRRFCL"
FT   gene            585772..586779
FT                   /gene="argC"
FT                   /locus_tag="ASA_0578"
FT   CDS_pept        585772..586779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argC"
FT                   /locus_tag="ASA_0578"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88744"
FT                   /db_xref="GOA:A4SIM2"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SIM2"
FT                   /protein_id="ABO88744.1"
FT                   /translation="MLNTVIVGASGYAGAELAALVQNHPQLKLFGLYVSAGSQDAHKRF
FT                   SSLHPQWVGALDQPLLPLDEDGMTRILTQADLVLLATAHEVSAELAPKFLAKGLPVFDL
FT                   SGAFRVKDQQFYSSFYGFTHENEQLLEQAAYGLAEWNSDAIAAAQLIAVPGCYPTASLC
FT                   ALKPLQQAGLIAEGWQPIINAVSGVSGAGRKAAINTSFCEVSLSPYGTFNHRHQPEISH
FT                   HLGKEVLFQPHLGNYVRGILATIYVQMADGVTPTQVDQAFLKAYEGKPLVRLTGQMPSI
FT                   RGVASTPYCDIAWQQQGNMLVVVSAIDNLLKGAASQAMQCINIKFGFDPATGLI"
FT   gene            586796..587575
FT                   /gene="argB"
FT                   /locus_tag="ASA_0579"
FT   CDS_pept        586796..587575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="ASA_0579"
FT                   /product="acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88745"
FT                   /db_xref="GOA:A4SIM3"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SIM3"
FT                   /protein_id="ABO88745.1"
FT                   /translation="MDKQTLVIKLGGALIENDEALTALFGTLKTFLDEQHRPLVLVHGG
FT                   GCLVDDLLKGLGLSSTKKNGLRVTPFEQIPFIAGALAGTANKQMMAKAIATGIPAVGLC
FT                   LADGGLCQVTQLDPDLGAVGDCQPGNPALVTGILAQGFLPVVSSIGITADGQLMNVNAD
FT                   QAATAIAEALGADLVMLSDVSGILDGKGKLVPQLNKATALDLMEKGVISDGMAVKVKAA
FT                   LHAAETLGKPVCVASWRYPDQLLKLLAGGAVGTQVTL"
FT   gene            587601..588512
FT                   /gene="argF"
FT                   /locus_tag="ASA_0580"
FT   CDS_pept        587601..588512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argF"
FT                   /locus_tag="ASA_0580"
FT                   /product="ornithine carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88746"
FT                   /db_xref="GOA:A4SIM4"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIM4"
FT                   /protein_id="ABO88746.1"
FT                   /translation="MQHLLKDSDLSKAQIEALIALGKAVKADPKKYSQALAGKSVVTLF
FT                   EKPSLHTRVTFDIGIAKLGGHSVYLDQQNGALGKRESVKDFAANLSRWCDAIVARVFDH
FT                   QTLVDLQAYGSVPVVNSLCNLYHPCQGLADFMTIAEHYDDLSKVKLAYLGDGNNVSHSL
FT                   LLLGATLGTDVTLICPKGYGPDTQIFLQAQALAADSGATIHISDDVGDIEGFDVVYTDT
FT                   WVSMGDNTPMEQVKDIFMPYQINQALLERTGIQHVLHCQPAHRELEITSDVMDGPASLI
FT                   MDEAENRMHIQNAVLLTLLGNK"
FT   gene            588567..589817
FT                   /gene="argG"
FT                   /locus_tag="ASA_0581"
FT   CDS_pept        588567..589817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="ASA_0581"
FT                   /product="argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88747"
FT                   /db_xref="GOA:A4SIM5"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SIM5"
FT                   /protein_id="ABO88747.1"
FT                   /translation="MERSKMSGINKIVLAYSGGLDTSAIIPWLKEHYDAEIIAFVADVG
FT                   QERDDLEGIEQKAIASGAVKCIVKDLREEFVKEYVYPTLKTGAVYEGTYLLGTSMARPI
FT                   IAKAMVEAALAEGADAISHGCTGKGNDQVRFEGAVAALAPQLKVIAPWRLWDMRSREDL
FT                   LAYLEARDIPCKATLKKIYSRDANAWHISTEGGELESTWNEPSEAVWQWTVSAEQAPNE
FT                   PEYVKLTVAKGEVVAVDDQPLSPHQILTTLNERAGKHGVGRIDITENRMVGMKSRGCYE
FT                   TPGGTVMVAALRAVEELVLDRPTRAWREKLGAEFSHLVYDGRWFTPLCKAIVASANAIA
FT                   EDLDGEVILKMYKGQVTAVQKKSPNSLYSEDFATFGADEVYDQSHAEGFIRLYTLASRI
FT                   RAMKEQHQAIGGDHTHG"
FT   gene            590011..591396
FT                   /gene="argH"
FT                   /locus_tag="ASA_0582"
FT   CDS_pept        590011..591396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="ASA_0582"
FT                   /product="argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88748"
FT                   /db_xref="GOA:A4SIM6"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SIM6"
FT                   /protein_id="ABO88748.1"
FT                   /translation="MALWGGRFSQGADSRFKQFNDSLRFDYRLAEQDIQGSMAWAKALV
FT                   KVGVLTADEQGKLQQAMEVLLASVQQDPHQILNSDAEDIHSWVESQLIAAVGDLGKKLH
FT                   TGRSRNDQVATDLKLWCKAQGELLLGSISALQAGLVASARANQAAVLPGYTHLQRAQPV
FT                   TFAHWALAYVEMLERDYSRLQDALKRLDTSPLGCGALAGTAYAIDREALALDMGFGGAT
FT                   RNSLDSVSDRDHVVELMHVASLSMTHLSRFAEDLIFYNTGEAGFVELSDAVTSGSSLMP
FT                   QKKNPDALELIRGKTGRVVGAQMGMLMSLKALPLAYNKDMQEDKEGLFDALDTWHDCLD
FT                   MAALVLIDLKVNVERTKAAAQGGYANATELADYLVAKGIPFREAHHIVGETVVYALEVK
FT                   KPLEDLSLPEFQRFSPVIGEDVYPNLELEATLAKRVAKGGVARELVDAALTAAEQWLAK
FT                   WAG"
FT   gene            complement(591522..592415)
FT                   /locus_tag="ASA_0583"
FT   CDS_pept        complement(591522..592415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0583"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88749"
FT                   /db_xref="GOA:A4SIM7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIM7"
FT                   /protein_id="ABO88749.1"
FT                   /translation="MQPLPLNLDLDALRSYVLGLDCGSFALAAQRLCRSTSAVSAQLKK
FT                   LEQQCGTELVMKRGRHLVPTASGERLLGYAKRLLELNDEAVLALKGELLQGEIRLGVQE
FT                   DFGESLLPAVLGPLCRQHPTLRMTTRIDRNAQLMKGIREGTLDMALAWQHPEERIDAHL
FT                   IDLVSLQWIAHSNWDPAPLLARGEPLPLVLFDAPCLMRSRALKALDDAGIPWRIAFTSQ
FT                   SLGGIWAALQAGLGITVRSAIDMPTSLSPLAYVLPSPGTLGVVLLGAGNGSGEAERQLQ
FT                   SLLTQAVQRAHATHQS"
FT   gene            592512..592838
FT                   /locus_tag="ASA_0584"
FT   CDS_pept        592512..592838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0584"
FT                   /product="carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88750"
FT                   /db_xref="GOA:A4SIM8"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIM8"
FT                   /protein_id="ABO88750.1"
FT                   /translation="MTHPVLDRDDLARAAPRLSQLAEETLFGDIWQRPALSARERSLIT
FT                   LAILASLGRVQQLPWHIAFAQQNGLTREQLEELFTHLAFYAGLPAAVTAVSYLPSREEP
FT                   HPCR"
FT   gene            592829..593221
FT                   /locus_tag="ASA_0585"
FT   CDS_pept        592829..593221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0585"
FT                   /product="probable tautomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88751"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR037479"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIM9"
FT                   /protein_id="ABO88751.1"
FT                   /translation="MPLTRITLREGMSDARLQQLSDLYHETLVEVFDVPREDKFQILEA
FT                   LPAKALVYHPHYQTGRRDGDFILFQILAGRPRSTEVKQRLYERLAERLHADMDIHPDNL
FT                   MVVIQLNGSEEWSFGRGLMFRQGVIL"
FT   gene            593218..593742
FT                   /locus_tag="ASA_0586"
FT   CDS_pept        593218..593742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0586"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88752"
FT                   /db_xref="InterPro:IPR032349"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIN0"
FT                   /protein_id="ABO88752.1"
FT                   /translation="MIAMHYRFTLPADYDMGLIEERIASNGTKLDGFPGLLFKAYLYGR
FT                   HDEAALPCRENRYAPFYVWQSVEAMHSFLVSEGFAALTRHFGWPHIETWHLLSAPQMEA
FT                   LDQARVAILRRTRIAPHCSLAELHTGAMLSGWDVSRWQWLEVDLLPSPPPTIPAGADAY
FT                   HIGYLAKGVPA"
FT   gene            593983..594624
FT                   /locus_tag="ASA_0587"
FT   CDS_pept        593983..594624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0587"
FT                   /product="negative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88753"
FT                   /db_xref="GOA:A4SIN1"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIN1"
FT                   /protein_id="ABO88753.1"
FT                   /translation="MYLPSHFETPDLASLHQLILAHPLGALITHGERGLDANHLPFELD
FT                   AGSGEQGVLRAHVARNNPLWQEASNGDEVLVIFKAADAYISPSWYPSKQVHHQQVPTWN
FT                   YSVVHAHGRICIHDDARFVRRLLANLTRTHEAIESAPWKMADAPREYIEAMVQAVVGIE
FT                   IEITGLVGKFKLSQNKAEADRQGAADSLQARGQVEIAESMLSPPQSLPQQ"
FT   gene            complement(594693..595148)
FT                   /locus_tag="ASA_0588"
FT   CDS_pept        complement(594693..595148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0588"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88754"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIN2"
FT                   /protein_id="ABO88754.1"
FT                   /translation="MISTLLPIASIALKLGSYLLSSNAKAQPEPEPVQEERLPPTVQSL
FT                   FQRLGVKDADSEQNRPAINQFMSELMQTLGQENNGQSLTEAIDTARNQLANGTQSTRLD
FT                   ALQSRLDTLKGTLGSSDLNLDQLLSAFKQTLPNGKGEGVGKLLNASA"
FT   gene            complement(595351..595563)
FT                   /locus_tag="ASA_0589"
FT   CDS_pept        complement(595351..595563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0589"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88755"
FT                   /db_xref="GOA:A4SIN3"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIN3"
FT                   /protein_id="ABO88755.1"
FT                   /translation="MTMWTGIVLIVFISMLFGYLTKRARYQLGDARITDRLGKQDVTIN
FT                   KLQERIANLEAIVIEEEKRRPFKDL"
FT   gene            complement(595729..596070)
FT                   /locus_tag="ASA_0590"
FT   CDS_pept        complement(595729..596070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0590"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88756"
FT                   /db_xref="GOA:A4SIN4"
FT                   /db_xref="InterPro:IPR010718"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIN4"
FT                   /protein_id="ABO88756.1"
FT                   /translation="MIWLALFPLLWTAWLGLVDANWWPLAIVTTMSLLTVLAYAHDKRQ
FT                   AIRGGWRIPESRLHLLELCGGWPGALVARHWLRHKTQKGSYRLVFWFIVLLHLTLWGLW
FT                   LGRPLWQGV"
FT   gene            complement(596067..596657)
FT                   /gene="maa"
FT                   /locus_tag="ASA_0591"
FT   CDS_pept        complement(596067..596657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maa"
FT                   /locus_tag="ASA_0591"
FT                   /product="maltose O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88757"
FT                   /db_xref="GOA:A4SIN5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIN5"
FT                   /protein_id="ABO88757.1"
FT                   /translation="MASDWDKILAGGALDSQSEEIANDRIRGQALLAQLNASSAGDHPL
FT                   RQRLCGELFGHCPASSWISTPFTCEFGRNIHIGEQTFFNFNVTILDVGEVHIGNHVLLA
FT                   PNVQIYTATHSMDYLERRNWTAYNKPVHIGDDCWIGGGAIICPGVTIGARSIIGAGAVV
FT                   TRDIPADSVAVGNPARVIRSLSPDAPRGWELAL"
FT   gene            complement(596737..597999)
FT                   /locus_tag="ASA_0592"
FT   CDS_pept        complement(596737..597999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0592"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88758"
FT                   /db_xref="GOA:A4SIN6"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="InterPro:IPR025105"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIN6"
FT                   /protein_id="ABO88758.1"
FT                   /translation="MWINADPVNGALVSLAIGLIIGLERGWQVRQLGDNQRIAGMRTYG
FT                   LIGLLGGVCALLLPTLGPWLPLLGLLAVVMGCGLSVWLAQRWQGEFGLTSSVAMLLTYL
FT                   LGLMSVLLSPSEAVACAVLAALLMGLKGKIQQGMLFLSETEFHATLRFLLISLVLLPVL
FT                   PNKEMGPLDAFNPFKIWLMVVVIAGISFCGHFAVRLLGTRAGLVLTSMLAGLASSTALT
FT                   LQFARLNKEQGGLERLLATGILLAGATMWVRLLVLVLLLHKELAMRLAAPLLLLAVIVY
FT                   GFAFWFWRQREALTDGPVQPRTSNPLDLATAIKFGLLLALIGFMATLLQSRVGDSGVYL
FT                   LALVSGITDVDAITLSLSQLSHKELGLEVAARGILLAGLVNSLVKGVLALGIGGRRLGL
FT                   MVLLPYLVSALLILPLIWPSA"
FT   gene            598208..599209
FT                   /gene="cysP"
FT                   /locus_tag="ASA_0593"
FT   CDS_pept        598208..599209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysP"
FT                   /locus_tag="ASA_0593"
FT                   /product="ABC-type sulfate transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88759"
FT                   /db_xref="GOA:A4SIN7"
FT                   /db_xref="InterPro:IPR000957"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIN7"
FT                   /protein_id="ABO88759.1"
FT                   /translation="MKLRMTALTLLSLLALGQANAAEIRLLNVSYDPTRELFQEYNGAF
FT                   AKEWKAKTGDDVVVGQSHGGSGKQARAVVDGLEADLVSLALAYDVNAVAKQGLIAADWQ
FT                   SRLANNASPYTSTIVFLVRKDNPKQIKDWGDLVRKDIAIVTPNPKTSGGARWNYLAAWG
FT                   YALKKSGSEEGAKQFVGDLYKNVKVLDSGARGATTSFIERGLGDVLLAWENEALLVLNQ
FT                   PGNRDKFELVVPSVSILAEPPVAVVDKVARKHGTEAVAKGYLEYLYSDEGQRIIAKYHY
FT                   RPSNPAIQKETAAQFPQLTLFTVKDLEGDWDKAQQKHFAQGGLFDQIYQPGG"
FT   gene            599224..599853
FT                   /locus_tag="ASA_0594"
FT   CDS_pept        599224..599853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0594"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88760"
FT                   /db_xref="GOA:A4SIN8"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIN8"
FT                   /protein_id="ABO88760.1"
FT                   /translation="MWHVHPALAPVPADRSTKMNKILLVPGLHNSGPDHWQSRWHQYFP
FT                   HWQRMVGLPWDKPDLTVWSAKLASKLRSRRGRAHLVAHSFGALAAITAARQQPDKVASL
FT                   FIVAPADPAHFGIVDEALAGSLKVSAQLIASRNDPWLSFERAEYWSRQWQVPLFDAGEV
FT                   SHINAQSGHGEWSQGLNLLGTLYRRAEMVVEPAPAVWERRAALSFR"
FT   gene            600104..600970
FT                   /gene="cysU"
FT                   /locus_tag="ASA_0595"
FT   CDS_pept        600104..600970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysU"
FT                   /locus_tag="ASA_0595"
FT                   /product="ABC-type sulfate transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88761"
FT                   /db_xref="GOA:A4SIN9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIN9"
FT                   /protein_id="ABO88761.1"
FT                   /translation="MFFITNGSVMRFGSYSVLPGFGPTLGFSLLYLGILVLLPLSALVL
FT                   FAVNNLTAGEFWQVIGSPRVLASFRLSFGAAFIAVLLNSLFGLILAWVLVRYRFPGRRL
FT                   VDALIDLPFAMPTAVSGIALCAIFAPNGWIGQWVAPLGIELAYNPIGVVIALTFIGLPF
FT                   VVRTLQPVLREAETEQEEAAASLGADRWQTFLRVLWPTLIPALLTGFALAFARGVGEYG
FT                   SVIFIAGNLPMVSEIAPLMIMSHLEEYDYAGASAIAVVMLLVSFILLLLINKLQAWSWA
FT                   RIGGTRV"
FT   gene            600967..601860
FT                   /gene="cysW"
FT                   /locus_tag="ASA_0596"
FT   CDS_pept        600967..601860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysW"
FT                   /locus_tag="ASA_0596"
FT                   /product="ABC-type sulfate transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88762"
FT                   /db_xref="GOA:A4SIP0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIP0"
FT                   /protein_id="ABO88762.1"
FT                   /translation="MSASNSTLDLVQGVAPAPLARHPSVTREPVWVKWLLIALGLGWFA
FT                   ALLLLPLATVFIQALSPGLTFFWHAISEPDALSALGLTALVTLCAVPLNLLFGLAAAWA
FT                   IARFRFPGRQLLITLIDLPFSVSPVIAGLMLVLLFGSRGWFGDWLSEHDIKVIFATPGI
FT                   ILATTFITVPFVVRELLPQMEARGPEEEETAIMLGASGLQMFWRVTLPGIRWSLMYGLL
FT                   LCTARAVGEFGAVSVVSGHIRGQTNTLPLHIEILYNEYQTGAAFAVASLLALFGIFTLL
FT                   GETLLARLRGQPDKPH"
FT   gene            601946..603013
FT                   /gene="cysA"
FT                   /locus_tag="ASA_0597"
FT   CDS_pept        601946..603013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysA"
FT                   /locus_tag="ASA_0597"
FT                   /product="ABC-type sulfate transporter, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88763"
FT                   /db_xref="GOA:A4SIP1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR014769"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR024765"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041193"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIP1"
FT                   /protein_id="ABO88763.1"
FT                   /translation="MSIQVQGLNKHFNQYAALADINLDFHDGELVALLGPSGCGKTTLL
FT                   RIIAGLEQADSGSVIIRGEHATDLDVRERNVGFVFQHYALFRHMTVFENVAFGLRVKPR
FT                   SERPTEAVIRARVKELLDLVQLSHVADRHPTQLSGGQRQRVALARALAVQPKVLLLDEP
FT                   FGALDAQVRKELRRWLRELHDELHVTSLFVTHDQEEALEVADRVVLMNAGRVEQIGTPA
FT                   EVYDQPASAFVHSFLGSVNLFRGRVAGQGLGIGEQWLGGPISSHLAEGSAAIAYVRPHE
FT                   LEIVPADASGGIRATITRLLPMGPRIRVELRGIGDTNGAHFEAELSKEAARAFAPGQGV
FT                   RLVARQAQLYPDYQI"
FT   gene            603199..604146
FT                   /locus_tag="ASA_0598"
FT   CDS_pept        603199..604146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0598"
FT                   /product="transcriptional regulator, LysR-family"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88764"
FT                   /db_xref="GOA:A4SIP2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037423"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIP2"
FT                   /protein_id="ABO88764.1"
FT                   /translation="MNFQQLRIIREAARRDYNLTEVANALFTSQSGVSRHIRELEEDLG
FT                   IELFIRYGKRLLGMTEPGKELLVIAERILNDANNIRKLASTFANRESGRLLVATTHTQA
FT                   RYALPRVVKAFREQFPQVQLELRQGSPEEIVRLVQTGEVDIGISSERLDKSEGVVAFPY
FT                   YRWHHNIVVPEQHPLTAERELTLAALAHWPIITYQAGLTGRARVDEAFAEAGITPQILL
FT                   TAQDSDVIKTYVELEMGVGILADMAFDTQRDRGLVQLDGSRLFAPHTAWIGLKQGQFQH
FT                   NFAWQFIQLCNPELALADIQARAMGGEPVIDYQI"
FT   gene            604357..605568
FT                   /gene="thrC"
FT                   /locus_tag="ASA_0599"
FT   CDS_pept        604357..605568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC"
FT                   /locus_tag="ASA_0599"
FT                   /product="threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88765"
FT                   /db_xref="GOA:A4SIP3"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIP3"
FT                   /protein_id="ABO88765.1"
FT                   /translation="MPYSYLSHLRCSKTGDIHDADQPQQLSQVGAPLLASYDLEALKKV
FT                   WHPAALLGRPATLWRYHELLPVRDPAQWVTLGEGLTPLLPLRALGKQVGIPDLWMKDES
FT                   IIPTGSFKARGAAVGISRARELGVTHFAMPTNGNAGAAWALYGARAGLRSTIVMPQEAP
FT                   AITRLETSLAGARLYLVDGLISDAGRQVAQAVVDQSLFDASTLKEPYRIEGKKTMGLEI
FT                   AEQLGWKLPDVIIYPTGGGVGLIGIYKALRELQELGWVKGDLPRLVAVQASGCAPIVQA
FT                   WQQGASESSFWPDSQTLAFGINVPKALGDFLVLDALYRTNGCAIAVDDRAIKAEIRQLA
FT                   SLEGSFVCPEGAAAFAAARQLRESGWIKGGEQVVVLNTGAGIKYPDAITVLPQRLRRDG
FT                   RIPA"
FT   gene            605565..606230
FT                   /locus_tag="ASA_0600"
FT   CDS_pept        605565..606230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0600"
FT                   /product="ABC-type glutamine/glutamate transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88766"
FT                   /db_xref="GOA:A4SIP4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIP4"
FT                   /protein_id="ABO88766.1"
FT                   /translation="MTFDWSFILGTLPAFGKAVWVTLQLGAMVIFTSLGVALLNVTLLS
FT                   LQKPLLAAFIRGYVELARNTPLLIQLFFLYFGLPALGLSPSGFATAVIAMTFLGGGYLT
FT                   EALRAGIQAVPTSQLEAGRAIGLSRWQLLRHVQLPQAWLASLPALFANFIFLLKETTVA
FT                   SAVAVPELLYTTKNYIALYYKTYEMLAVLTLMCVLIFLPLSLALRALERRLQHGQFGH"
FT   gene            606435..607097
FT                   /gene="glnP"
FT                   /locus_tag="ASA_0601"
FT   CDS_pept        606435..607097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnP"
FT                   /locus_tag="ASA_0601"
FT                   /product="ABC-type glutamine/glutamate transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88767"
FT                   /db_xref="GOA:A4SIP5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIP5"
FT                   /protein_id="ABO88767.1"
FT                   /translation="MASSVTELLGQALPLLAIGAGQTLAISLLAILFATLGGVAYGVLA
FT                   QQGGRLTLGLLRVYLELFRVVPVLVWLYLFFFGLPIFFGLDIPAFWCAVLVLALWGASE
FT                   VGEVVRGGLGSLARGQQEAGLALGLSTWQLYRHVLLPQALQRLTPPTINIYTRIIKTSS
FT                   LAVLIGVVEVIKVGQQIIERTYASVLIYGLLFLFFFLVCYPLSLASRRLEQKWGNAV"
FT   gene            607094..607855
FT                   /gene="glnQ"
FT                   /locus_tag="ASA_0602"
FT   CDS_pept        607094..607855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnQ"
FT                   /locus_tag="ASA_0602"
FT                   /product="ABC-type glutamine/glutamate transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88768"
FT                   /db_xref="GOA:A4SIP6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIP6"
FT                   /protein_id="ABO88768.1"
FT                   /translation="MTPLLELELVSKQFGQNRVLDGVSLAVNPGEVIVILGPSGCGKST
FT                   LLRTLNGLEPIQGGEIRFDGVLLDGATDWQRVRQRIGMVFQSYHLFPNLTVLENVLLGP
FT                   LQVQKRERQEALLQAEQLLTRIGLWEKRHAYPRELSGGQQQRIAIVRALCMNPQVMLFD
FT                   EVTAALDPEMVQEVLEVLRDLAGSGMTLLIVTHEMAFARAVADRIVFMDGGHILEQAAP
FT                   RVFFDNPRSPRARQFLAKFSYTDVIKRKESA"
FT   gene            607852..608688
FT                   /gene="glnH"
FT                   /locus_tag="ASA_0603"
FT   CDS_pept        607852..608688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnH"
FT                   /locus_tag="ASA_0603"
FT                   /product="ABC-type glutamine/glutamate transporter,
FT                   periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88769"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIP7"
FT                   /protein_id="ABO88769.1"
FT                   /translation="MKKITSVLFSALIGLGLASGAAQAADGSLDKIKARDKLIVGVFTD
FT                   KPPFGYVDEKGSYVGFDTDLGRRFAKDLLGDENKVEFVAVEPASRIPFLQSDKVDLILA
FT                   NMTVTPERREVVDFTNPNLRVAVQVLVPEGSPAKGLGDLADKTLIVTTGTTADIWLTRN
FT                   HPDWKVLKFEKNTESLQALAQGRGDAYAQDNLVLFSWAKENPGYRVLPEKLGAEDPIAP
FT                   AVKKGNIELRDWVNERLAKLGEEKYLLKLYDQYVRDKLSADTDPNDVIVEGGKWQG"
FT   gene            complement(609126..610583)
FT                   /locus_tag="ASA_0604"
FT   CDS_pept        complement(609126..610583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0604"
FT                   /product="chitin-binding protein, carbohydrate-binding
FT                   module family 33"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88770"
FT                   /db_xref="InterPro:IPR004302"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR041029"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIP8"
FT                   /protein_id="ABO88770.1"
FT                   /translation="MTAHIYRTEECMAAKIQLNHVAAALALLASGGVLAHGYISQPESR
FT                   NYLCNKGGNSQCGAVQWEPQSVEGPSGFPQSGPQDGQIASAGSSRWSELNAQTSDRWTR
FT                   REVQAGPFAISWTFTANHVTRNWRYYLTKQDWNPNQPLTRAAFDLTPFCVVDGNMVQPP
FT                   KQVTHNCNLPERTGYQLILGVWEVGDTSNSFYNLIDANFKGGSQPPLSWSQGGTIYPST
FT                   DLAAGDKARALVFDASGGRPDLQTELTITTTEQGQKNNWAHALASKINAEQSQIRAGQQ
FT                   NADNQFNPVYGQNPVYLKSGSTLERVEIQLEQLQPPVGNDISVSGLESEYLLDDGKVTL
FT                   DFTITAQGDLTVTNTLYDHGGVAKGQSAADIKDSSQSFTMPLTGLSAGHHQLVIEAKPK
FT                   AGGEALQQTLDLMLKDSAGGGNYQFTFPQGLTSYTDGTKVLQPKNGKVYQCKPFPYRGW
FT                   CSQWSASATQYEPGIGTNWQDAWIALN"
FT   gene            complement(610966..612663)
FT                   /locus_tag="ASA_0605"
FT   CDS_pept        complement(610966..612663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0605"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88771"
FT                   /db_xref="GOA:A4SIP9"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIP9"
FT                   /protein_id="ABO88771.1"
FT                   /translation="MFKLGDIAVSRKLMLLLSLALVGFIALLLISASALHRNLMSEREA
FT                   RLQAVLDLAMSRIQSLATTLPAAQAQAEAKAMLNSMRFDGDNYLFVLDETRHVVVHPVK
FT                   PELVGQQMGQSGTETAGDHWQRMVELGKGGQHGRLEYQWIGPSGDAAQKMSLVAGYQPW
FT                   GWILGSGVLLQDIQATIWSQYQLMGGATLLVILLMGLLGFAISRSIVNPLAEIKRAMQQ
FT                   VAAGDLVISIPVHGKDEMGVVAACTNQGLDAIRHALIEASQGARNVADAALRIASSAEE
FT                   TNQAVNSQRDQLSQLATAMNEMSATIADVAGHAENTARDTQEATSEAGLGNRDVHASVN
FT                   GIQALATEVEQATQQVNQLKEGVMQISEVTAVISAISEQTNLLALNAAIEAARAGEQGR
FT                   GFAVVADEVRQLASRTRQSTEEIQSTIAQLQQRAVTAASAMDASRKLAESSVSQSEKAG
FT                   QDLSLIVNHIQHVSDMAIQIATAAEQQSVVAEDMNRNVSGINDSAQEMSQSATYLAKES
FT                   ELLADLSRSLDERLSVFKLGTAIDQTLAQRLAPLHQQSHQAERPRARH"
FT   gene            612945..614795
FT                   /locus_tag="ASA_0606"
FT   CDS_pept        612945..614795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0606"
FT                   /product="oligoendopeptidase F"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88772"
FT                   /db_xref="GOA:A4SIQ0"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="InterPro:IPR033851"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIQ0"
FT                   /protein_id="ABO88772.1"
FT                   /translation="MHSIARNYLNQLNADYLQVHRRKEDLFWSTYMGTSDDQAGFTAAE
FT                   QAYKAFCANPARLPELREMLSRAEEADLKRGLGGWIAFFECNVIEDPAAAALMDELVAA
FT                   EAALFARRRELKLSLLDEQGQQVAGSLPAASTSLAASPNEAVRQSALAMFHTLEQWVVD
FT                   NGFLEVVAIRNRFARAMGYRDYFDYKVRKNEQMSPEQLFAVLDDFIARTEQRVQQSLAE
FT                   LKSAKGEAALQPHNLRYFVSGDVTRQLDPYVPFSRALKDWVESFRRLGIQYRDATLTLD
FT                   LLTWEGKYENGFCHGPVPSFWQEDKWVPAVVNFTSLANPVQVGSGWSGLNTLFHEGGHA
FT                   AHFANVTGNAPCFSQEFPPTSMAYAETQSMFCDSLLDDADWLKHYARNAAGEVIPDSLI
FT                   KAMIAARQPFRAFNERQIALVSYFERDLYAMEEIDRTPDAVLALARQWERKILGTESPR
FT                   PLLAIPHLLNQESACAYHGYLLALMAVEQTRAYFLQRDGYLTDNPRIGPDLAAHYWGPG
FT                   NGMTHDETLRSLTGEGFSAVPLAEVCNQSVADAWAQAQACMAAAQQRPPAGEGAPLNAR
FT                   IRVVHGSELIADNSESEARMLADFEGWIRRQSEVEPATQG"
FT   gene            complement(614864..617053)
FT                   /locus_tag="ASA_0607"
FT   CDS_pept        complement(614864..617053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0607"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88773"
FT                   /db_xref="InterPro:IPR021459"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIQ1"
FT                   /protein_id="ABO88773.1"
FT                   /translation="MKGLRIKAPVLGCLLISLLAAPLAAAPLILQGETLSYRIAPDTLA
FT                   ISVNKMPVSDGQPARQVDKLTRGEQEANWHWPAQDARVEVKLDGDDLLLTLASDTPRQL
FT                   AWYSLPKNQTHLSMAFGEGSRFSVRDSDWLGYVGDELAELNTHYDLKLPLWSQDAGKQT
FT                   YSWILQTPYDNQLNFTRKGGRLQLSARHEFSSFNQQAPMVVRLSVGDDWLAGARRYREW
FT                   LQAEGEWQSLADKFARIPAGRRLIGASHVYLWGDALLDRQDVKDWPGLRARLNQKPAWL
FT                   QAFSGEEREALAATAPEPWQQTLIMAGLNRLIASQLPLPAQQGPVSQSKVLALRQQWVR
FT                   GQLGDLLVAQTRWGQGLSLPVIEALQQAGLNKLWLGTPQWTAALQQSYAVTAAQRLGYL
FT                   VGSYDSYDTAILPGSNDSWLTAQIPPKIGKRCAIMEANGKPKPGFGGEGAYLNPGCTLP
FT                   FAKSRMSELAKASGINSLFLDVDGTAMASNDYNPAHQQGSQAMIAARNARMAWVGERLG
FT                   LVLGSEDGNALTSKPLMFAHGIQSWGFGWQDASMRKQAKSSYYLGKWWPDEAPQVFFQP
FT                   ARLKPRYLKTVFNPADRLPLYQAVFHDSVLNSHHWLLDNLKFPGIKEERALLGLLYNTP
FT                   PLVNLSRSTLESRLPELVRLSDQFAPLHEALWDKALVGFRWRDGVGRVQETRFSDGSRL
FT                   VANFSNSSIMLDGQKLPGKHLLVALKGKPVTLLTM"
FT   gene            617467..617778
FT                   /locus_tag="ASA_0608"
FT   CDS_pept        617467..617778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0608"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88774"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIQ2"
FT                   /protein_id="ABO88774.1"
FT                   /translation="MQHHNYPPCHSRCESGWESYRSLSPRRLSRILNTASAISVQPSAR
FT                   SRHIHDVCRLNRPCRWYQTWLESAPCVASSFLVVDTGTPALLQGGSLYFSLWKEVISS"
FT   gene            617788..618941
FT                   /pseudo
FT                   /locus_tag="ASA_0609"
FT                   /note="conserved hypothetical protein; frameshift due to 4
FT                   bp deletion"
FT   gene            619054..620274
FT                   /locus_tag="ASA_0610"
FT   CDS_pept        619054..620274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0610"
FT                   /product="glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88775"
FT                   /db_xref="GOA:A4SIQ3"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIQ3"
FT                   /protein_id="ABO88775.1"
FT                   /translation="MALTLTGILKWYARQVPQASDLPLSRRCPSVSCIITCYGEGDAIR
FT                   STILTLKEQLYRGHLEIIAVIDGANANAHTYQAALNCVREFQGCQTRTLVLLPKWQRGG
FT                   RVSTLNAGLSAATGEIVMNADGDTSFDNNMIDEIVACFDDPDMPAVGGALRVRNLHAGL
FT                   LTRMQGIEYMISMQGGKTGLSEWNLINNISGASGAFRRDFLRQIGGWDTHTAEDLDLTL
FT                   RIKHYLKRHPGLKIGFAPRAIGHTDAPPDLVTLAKQRLRWDGDLLFLYLRKHKLSLTPR
FT                   ILGWKTFLFTLVYGVAQNVVLPLLVMGYSWWLVFSYPGQFVTAMMLCLYLVYLFLTLVN
FT                   FLVFLLAISERPRADLGLLPWLCLYPVYTLLMRLWCAVALLNEIFRRSHEESSMAPWWV
FT                   LKRGNKF"
FT   gene            620274..621323
FT                   /locus_tag="ASA_0611"
FT   CDS_pept        620274..621323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0611"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88776"
FT                   /db_xref="GOA:A4SIQ4"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIQ4"
FT                   /protein_id="ABO88776.1"
FT                   /translation="MKVTFNTPKKQDATSEQGIRVLYAPARRMAFRARWYLILLLAFSP
FT                   VIILLWYLGQEWWLTQAPAIITTEPLLVVANGDGFIRNIYTAPGQSVSQGDVLMRFESP
FT                   TLNANIEARKARLKAIELNKQLAEQEIVRILDGQISIAERSSREQEGIYQEYANYRQQK
FT                   LVSSAEYASALLSWTQSRIALQQARVEKAQQGLQVREDHLTGPLASARHSLEQELTEME
FT                   AMSRQQQPLAPARGKVSDVLVQAGDWVFSGAPLALIAKREDPLVIAYVQPRYLSSMETG
FT                   HRAIVQLPSGERLAARVARPVELAGKLPAQLAAPFEGEKATLKVALSLDDKLPPNLQVE
FT                   GLPVTVLFD"
FT   gene            621890..624283
FT                   /locus_tag="ASA_0612"
FT   CDS_pept        621890..624283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0612"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88777"
FT                   /db_xref="GOA:A4SIQ5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR023870"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIQ5"
FT                   /protein_id="ABO88777.1"
FT                   /translation="MLRMNRIFWLLALLPLLALAGGVDRAREAWVIQGRAGELDAAAQG
FT                   LDALYRQTGDGKVLDDLIAVQLWRGDRKGALAACAPCEFSPIANSTLEGVARAARDEKR
FT                   YFEAISYYRVLQGRDPGNPTGWLGLFLTASDQGNRVLAHQAAGEYEARFGRDRAVLEAR
FT                   IYAARQAEDPMGEMLARQQWLALGPGNSEQVLALYRVAVSLGAGPAAADLMGQYPALFK
FT                   PVDRLWLDYYQAVNLLRISAQTEDPALARTSLTHTLALQDKILTRAPRDHVLYLSARRD
FT                   LVVTLVALGEFAQAERESAALQAEGPLPEYVQEARADALVGLGRVDEASLIYRQLATPQ
FT                   RAKDKTLLEKRFYAYSDAERYGAAQGLLAGWQEPPTRWDFTGNMRMPNDDYEKVLQLRT
FT                   LLLAWRGQAGMAEAQLEGWLKTAPANPWLWLQLGDIRRWRGHPDGAEQAYQQAVRWLPT
FT                   GRTRLAEQGLLHARLDQGQWQQTPQAVRALGNLTKDRRELQQRLALEQAPMLTTELTHG
FT                   RNEGGSVQASRDWSYDSRFYSARSDGGDRLFARRQGSFGEFDGQPERAAYSGLGAEVSF
FT                   YPLLLTLEGGMGSELNQKGYLWSRLDWRLGDHWTQGFAINLNSADTPLRALARGNYADQ
FT                   YQLDLGWRQDETREAGLRLERMDISDGNRRLTASGWLRQDLWRRDRWWFDTTLRAATSR
FT                   NEAVAVDYFNPLRDRNLELELAGRYRLPLDGRRALLQSLVIGGNQYWQQEYGGDPGWQL
FT                   SYRHDWVFSPALSLGYGLGRRQAVYDGNPEYGNFVFANLQWSFM"
FT   gene            624283..626284
FT                   /pseudo
FT                   /locus_tag="ASA_0613"
FT                   /note="polysaccharide deacetylase, carbohydrate esterase
FT                   family 4; frameshift due to 37 bp duplilcation CAZY family
FT                   CE4"
FT   gene            626281..627531
FT                   /locus_tag="ASA_0614"
FT   CDS_pept        626281..627531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0614"
FT                   /product="glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88778"
FT                   /db_xref="GOA:A4SIQ6"
FT                   /db_xref="InterPro:IPR023853"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIQ6"
FT                   /protein_id="ABO88778.1"
FT                   /translation="MSGFLSGIAIFTLAYPSMMAMVWICGGLYYYFQWEQRDIALARTG
FT                   LVLPRYPKVTLMVPCYNEGANVEETISHLLRQRYPDLEVLAINDGSKDDTGQRLDRLAA
FT                   QDARLTVLHQHNQGKAMALNNGLERAKGEILVGIDGDAVLDHDAVRWMVKHFIESPKVG
FT                   AVTGNPRVRTRSTIIGKIQTGEFSSIIGLIKRAQRIYGTVFTVSGVVVAFRKSAVEAVG
FT                   GWSTDMVTEDIDISWKLQLAGWLIHYQPQALCWVLMPETVRGLYKQRLRWAQGGAEVIL
FT                   RYGLQAMRWRNRHFWLLLLEYLSSVLWCYSMLLLALIWLIRPDLGELAEGQLFQWTGVI
FT                   MTAICLLQFGVSIFIDNHYDKTMARSFVWCIWYPLIYWLLNLVTVIVAVPKAILRRRGQ
FT                   LAVWESPDRGESFRDKK"
FT   gene            627470..628771
FT                   /locus_tag="ASA_0615"
FT   CDS_pept        627470..628771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0615"
FT                   /product="flavodoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88779"
FT                   /db_xref="GOA:A4SIQ7"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIQ7"
FT                   /protein_id="ABO88779.1"
FT                   /translation="MASLPYGKALTEESPSVTKNKFANEMIIRNGARCSWQYRLRDLLI
FT                   LLVTWIGWLLLALRLPRLEVWCGGLDRMLRLHRHSAMAATLALTSHWLLVEAPKWAVTA
FT                   GWLTRPARRGAGGGAGAGAGNGFSLHALGNTLGEWSFYLLIALVVVSLLSLVSYGRFRV
FT                   IHRLAPLIYLAGWVHGLCLLPQVGLLTPVGLGISLLGGAGAVAAVYSLLGLTGQRDRHQ
FT                   GRIVALRTLADSTREFTLQLATPLSHYRPGQFAFFEFDAKEGPHPFTLVRVSPDKRQLV
FT                   IAVRALGDHTRQLVEAARVDGPVTVTGPYGAFVCPARQGQSLWLGAGIGITPFVAWLEG
FT                   LVVRGERGEGITLIQCAPDLAGAVYHQRLAELCQRTGVRYRLHLDKEAGRLDLAGLAQG
FT                   KPGDVWFCGPERMADALTRLLPGGRLHRELFRFR"
FT   gene            complement(628754..630030)
FT                   /pseudo
FT                   /locus_tag="ASA_0616"
FT                   /note="putative Tricorn protease; frameshift due to 1900+
FT                   bp deletion"
FT   gene            630251..630772
FT                   /locus_tag="ASA_0617"
FT   CDS_pept        630251..630772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0617"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88780"
FT                   /db_xref="GOA:A4SIQ8"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIQ8"
FT                   /protein_id="ABO88780.1"
FT                   /translation="MVTRKALTRGLSRDGMRAVLLCLLGLWPALSFATLSADMIVVKKS
FT                   SYSLTLMKDGKEVKRYWIALGPAPKGHKQREGDQRTPEGRYILDYKKTNSNYYKAIHIN
FT                   YPNLDDIKTANEMGVNPGGMIMIHGQRNSIGNTRLQPSNWTNGCIAMLNHDLDEVWNAI
FT                   EPGTPIIIQP"
FT   gene            630909..631628
FT                   /locus_tag="ASA_0618"
FT   CDS_pept        630909..631628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0618"
FT                   /product="AzlC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88781"
FT                   /db_xref="GOA:A4SIQ9"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIQ9"
FT                   /protein_id="ABO88781.1"
FT                   /translation="MPSATSALPAGTESARALWWRATLDILPLSISVIPWGILCGALAL
FT                   QVGLSPLQAQCMSLLVYAGAAQLSATTLFGAGTPLLPIMGSTFVITSQHLLYGFTFRRD
FT                   VLPLSLRWRASLAFFLTDEMFAVALNDRERSGRFHPGYALIAGFVFYLFWNLATLLGIA
FT                   AGQYIDGLDKMGLDFAIAATFIAMTIPALKNLPMVAATLVSGGTALLTKPLLAEVYIII
FT                   SALAGMVVGYVLHRMRR"
FT   gene            631631..631963
FT                   /locus_tag="ASA_0619"
FT   CDS_pept        631631..631963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0619"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88782"
FT                   /db_xref="GOA:A4SIR0"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIR0"
FT                   /protein_id="ABO88782.1"
FT                   /translation="MSWLMIGLLALITFFNRFAFFSRLTRYQPGAEMGAFLSFSAQSVL
FT                   TAIWLPIVFSYEPGKGLDWDPDYLAATLLVTALTLLRLPTLLVGMGGFFLLRWQGGMAA
FT                   LLPWLG"
FT   gene            632080..633606
FT                   /locus_tag="ASA_0620"
FT   CDS_pept        632080..633606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88783"
FT                   /db_xref="InterPro:IPR016905"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIR1"
FT                   /protein_id="ABO88783.1"
FT                   /translation="MSFTETCQRIVRDPLLSPAQKNHALALAAENALPYPELPPAVAEA
FT                   LAQGFLCDMFEGHAPYKPRYVLPDYAKFLSQGSAWLELAPPKDFDEALDALRILYHHVP
FT                   SVTGMPVWLGRLDHLLLPFVGELDDEALHRKLKGFWIYLDRVLPDAFMHVNIGPDDNRL
FT                   CRLILRIDGELKQVAPNLTLFHDPAQTPDNLLMLAVQNIASCSKPHIANYPLHSNTFDQ
FT                   RGFGIVSCYNALPQAGGANTLVRLSLKRVAEQAHGIDDFMGCLLPHYCRLASQLIGARA
FT                   AFLHQESGFFDSFLVQEGLIDEDRFVPMFGIYGMAEAVNLLMDKENLPERYGHDEEANQ
FT                   LGYRISAQLSRHVSETPQVHAWGGRALLHSQGGLSVDRDVTPGVRIPYGQEPDPASHVL
FT                   ALAPHHGFYHSGISEILTLDPTIRQNPQALLQLCKGALAIGMREFTANVADSDLVRVTG
FT                   YMIRKSDVARFATEGSRLQTTCLGAEASELTAIRQRAPRVVGREATLCDY"
FT   gene            633756..634424
FT                   /locus_tag="ASA_0621"
FT   CDS_pept        633756..634424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0621"
FT                   /product="pyruvate formate lyase activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88784"
FT                   /db_xref="GOA:A4SIR2"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIR2"
FT                   /protein_id="ABO88784.1"
FT                   /translation="MRWQAALCTDCDRCIDGCPRHASPKTSQISVAEVLALLRRYGPLL
FT                   TGITVSGGEATTQLPFVIALFTAIRQAQDLSHLTCLLDSNGSLAETGWQRLLPVLDGAM
FT                   IDLKGWRDSVHHSLTGVGRERVLASLRLLASHGKLAELRLLHVPGRSDFLDADGKLETG
FT                   LASFLQNLGPVPIRLNGFRQHGVRGVATSWPEAGRDELTRLARAVSDRGLGPVSLPAII
FT                   "
FT   gene            634624..634947
FT                   /locus_tag="ASA_0622"
FT   CDS_pept        634624..634947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0622"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88785"
FT                   /db_xref="InterPro:IPR014949"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIR3"
FT                   /protein_id="ABO88785.1"
FT                   /translation="MSESNALYRVQFICHSERYEVYVREVSQGQLFGFIEIAHFVWDNH
FT                   TALIVDPSHEKLKSEFADVDRTMIPMHHVLRVDQVRKQGAARITELGNNIAPFPNPIYT
FT                   RKP"
FT   gene            complement(635059..635982)
FT                   /locus_tag="ASA_0623"
FT   CDS_pept        complement(635059..635982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0623"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88786"
FT                   /db_xref="GOA:A4SIR4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIR4"
FT                   /protein_id="ABO88786.1"
FT                   /translation="MDLIALSRLGGRHLVTLHLLLDSQSVTRTAERLCTTPSTVSKTLN
FT                   QLRDLLGDQLLYRQGNQLLLTPFAERLGPTLHRLLSELNNLTSQDGFDPQTWQGQLRFA
FT                   LRESSMVWPMGPILGQLMQEVPGLEPNVWNKDEQGLTALAAGKLDFVILPHDQSQPLPR
FT                   QPGLVWETLREDRLVCLLRADHPALDKPWDLDAYLSWRHIAIRDQELANPFFEQSLAQL
FT                   QVRRQIGATLPDFGSASALLRQSDLILTAIEGWALQSAALGLAIRPVPFDYGAVTHSLV
FT                   WYGPAGEEPALRWFRQRILTLARELG"
FT   gene            complement(636136..637332)
FT                   /gene="tyrB"
FT                   /locus_tag="ASA_0624"
FT   CDS_pept        complement(636136..637332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrB"
FT                   /locus_tag="ASA_0624"
FT                   /product="aromatic-amino-acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88787"
FT                   /db_xref="GOA:A4SIR5"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIR5"
FT                   /protein_id="ABO88787.1"
FT                   /translation="MFEHVDAYAGDPILTLVETFHKDTREQKVNLGIGLYYDEQGRIPL
FT                   LASVQQAEAQRAAAPAPRPYQPMEGAANYRTAVQHLLFGADHEAVKAGRIATIQTIGGS
FT                   GALKIGADLLKRYFPTSEVWVSNPTWDNHKAMFEGAGIQVHDYPYYDAATGGVQFDAMI
FT                   DCLSQLPAKSIVLLHPCCHNPTGVDLSSAQWDKVIALVVDKGLIPFMDIAYQGFGDGLE
FT                   EDAYAIRAMVAAGVSFFVSNSFSKNLSFYGERCGGLSVICKDAEEAGRVLGQMKATVRR
FT                   NYSSPPTHGGQITAAVMNDASLHALWVDEVSEMRIRIKAMRQKLFEVLSAKVPGRDFGY
FT                   FISQRGMFSYTGFTPEQVDRLREEFAVYLVRSGRMCVAGLNSRNVDYVADAMAAVLKG"
FT   gene            complement(637522..637797)
FT                   /locus_tag="ASA_0625"
FT   CDS_pept        complement(637522..637797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0625"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88788"
FT                   /db_xref="GOA:A4SIR6"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIR6"
FT                   /protein_id="ABO88788.1"
FT                   /translation="MSHTIHGKKKLLARVRRIKGQTGALESALEQEGDCAAILQQIAAI
FT                   RGAVNGLMLEVLEGHMREHLGAEEATPAERLEDLDQVVRVLRSYLK"
FT   gene            637869..638843
FT                   /gene="czcD"
FT                   /locus_tag="ASA_0626"
FT   CDS_pept        637869..638843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcD"
FT                   /locus_tag="ASA_0626"
FT                   /product="Co/Zn/Cd efflux system component"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88789"
FT                   /db_xref="GOA:A4SIR7"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIR7"
FT                   /protein_id="ABO88789.1"
FT                   /translation="MSFLVSSHCHQPVVHQGNPLAEQKTRWAVLLTVIMMVAEISGGWF
FT                   YNSMALLADGWHMSSHALALGLSVLAYRAARHFARDHRFSFGTWKIEVLGGFTSALLLV
FT                   GVAGLMLFESVFRLLDPSPIHYQQAIAIALVGLLVNLACAWLLKDDQGHHHGHSHGHHD
FT                   HNHDSHQGHDHSHHDHADHHGHQDLNLRAAYIHVLADAATSVLAILALVGGMLWGADWL
FT                   DPLMGIAGAVLVAVWAWGLLRDSGRVLLDAEMDTPLVAEIREVIADLPDAEIRDLHVWR
FT                   VGQEQYACVLSLLMATPIPAGQIRERLAIHEELVHVTIEIAQP"
FT   gene            complement(638913..639323)
FT                   /locus_tag="ASA_0627"
FT   CDS_pept        complement(638913..639323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0627"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88790"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIR8"
FT                   /protein_id="ABO88790.1"
FT                   /translation="MKRIEEQAKRLDQEYQGIAQLFDQFCQQAGGLAEQYHFFNWPDFE
FT                   DTPPLSRAFTLLGEPRELRLRCLPGERGTLSGLIQVRGEDGTVHASLGFRADGHLLLES
FT                   GHLLDNPPGLLLKLLLGAIWQHKPDDDHSQHH"
FT   gene            639591..643625
FT                   /gene="pulA"
FT                   /locus_tag="ASA_0628"
FT   CDS_pept        639591..643625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pulA"
FT                   /locus_tag="ASA_0628"
FT                   /product="pullulanase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88791"
FT                   /db_xref="GOA:A4SIR9"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR005323"
FT                   /db_xref="InterPro:IPR011839"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR024561"
FT                   /db_xref="InterPro:IPR040671"
FT                   /db_xref="InterPro:IPR041111"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIR9"
FT                   /protein_id="ABO88791.1"
FT                   /translation="MDMKKTKVALVTASLLALLSGCNDNSSSPSTPEPTDGPVARLPDV
FT                   QPPAEQLVAGPDQAVIALVDTQTSAARGIEGPFASHSLHLWNNDACNATAESGLNAGWD
FT                   DKANTPTAVDSFGPSWVVPLAKLEGCINFIARNGDLANLTGADMKVVFSDHPDRTVAIV
FT                   AGKSEVFDSRADAFTAAFGVAGASAHLIDGNTLIWQGGKDKPHVRLYYTESGTIKANAE
FT                   GVFDFPYLSLTATSLTAEQQAKYPHLKDAAAFALPSGKDLKPLLKGELVAIGTDADGIL
FT                   QGATLVQSAGALDALYAEEATKLAYGAIVEGGNVTFRLWAPTAKSVKLALFDEQHKALG
FT                   ERTMTQDDASGSWSVQGGSELVGKFYRYDIQVYHPLSRKLESYQVTDPYSLSLAMNSEF
FT                   SQVVDLDDPALKPEGWDSLKAPHSQQNPADITIYEAHVRDLTGNDESTKPEHRGKFLGL
FT                   TDSDSVPVKHLQSLAQSGVSHLHLLPVFDIATVNEDPAKVANLQDDFSKLCQVNAEVKD
FT                   SKFGGYCGGGQTIEAVLADLQGADSKESPQVQELSGYLRGVDSFNWGYDPYHYTAPEGS
FT                   YATDAEGSQRILEFREMVKAIKQNIGMNVVMDVVYNHTNEAGLGPKSVLDKIVPWYYQR
FT                   LNPETGSVENSTCCSNTAPEHAMFAKLMDDSLVTWARDYKIDAFRFDLMGHHPKDQVVQ
FT                   ALAAVKQVNPEMYFYGEGWNFGEVQDDKRFVQATQKHLAGTGIGSFSDRLRDAVRGGSP
FT                   FDGGDTIRKTQGFGNGALVDANEMDGVELATALHQSDLVRLGMAGNLKEFVLTDKDGMP
FT                   KKGSDIDYNGQPAGYAQDPTEIQNYVDKHDNQTLFDNLIYKAPEGADLVRMQGVSLATA
FT                   MLGQGIPFTHAGVELLRSKSMERDSYDSGDWYNRVDYTLADNNFDKGLPRKDKDGDNYP
FT                   LIEQVLGKHVKPSGADMATMVGFYQELAELRQSSRLLRLGSGAEVIKRVDFRNTGPDQV
FT                   PGLIVMTVDDGVNAGADLDPAIEGLVVMINATNQPQSIGDFRDGKDQPIDLSTLQLSPA
FT                   HHAGSSIADGALASGGQLTLGAWSAAVFVKPQAGAQGAGLPVSKKIDLSTVPPFGDTDV
FT                   FVRGFLNEWDPVNKMIFGGNFTYEFTTEVTTDQLGTTQVKIAGSEWDGPINYGKCSDTD
FT                   QLATGQVSVLCANGGDLPFNADKAGSYKFVFTAMNKDKPTLSVSFTEPVQSCKVLDTVA
FT                   GNPLGYNLFVKGELSGWAAQPQYQLSYKGMDGDLAIYQAAFNYMGTSEFKVANEDWSKE
FT                   YLLNGGGAVTAETGYSLGFSQAGSANNSITLPQGLWSVLVKVDPAGTKAGTAVIQECRA
FT                   K"
FT   gene            complement(643833..646256)
FT                   /gene="zntA"
FT                   /locus_tag="ASA_0629"
FT   CDS_pept        complement(643833..646256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zntA"
FT                   /locus_tag="ASA_0629"
FT                   /product="heavy metal transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88792"
FT                   /db_xref="GOA:A4SIS0"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIS0"
FT                   /protein_id="ABO88792.1"
FT                   /translation="MSKSCCSHQHTAATGKAVTSQVEHQHDSHCCDNVEQVSCCASKAP
FT                   HDHQDQGVSESPGDEEPPRGSCQSQGCCSPQPPHDHDHDHDHHEHDHHEQTTDTAEPLV
FT                   APEQDSRRHSWQVLGMDCPSCARKIETAVSRVAGVQQARVLFATEKLVVDLAPGLSPDP
FT                   VTAAVLAAGFRLKGATQPGDDNARRRSPQMALLAKYWQPLSLAGLMLLAALLPKEFGQP
FT                   LFTLATLWGLWPISRKAWALTRSGSPFAIETLMTVAALGALFLGETAEAAMVLLLFMLG
FT                   EHLEAYAAGRARAGVTALMALVPDKALRIRTRVDGDVREEVAADQLRPGDIIEIAPGAR
FT                   LPADARLLDALGAFDESALTGESIPVERRQGDKVPAGSLAADRVLRLEVVSEPGNNAID
FT                   RILHLIEEAETQRAPIERFIDRFSRWYTPAMMLVALLVVIVPPLAFGQSWDEWVYRGLA
FT                   LLLIGCPCALVISTPAAVTSALAAATRQEALIKGGAALERLAHIDTVAFDKTGTLTLGK
FT                   PQLTELVSLNDQPEDELLALAAAIEQGSHHPLARAVVAAAREQGLTLAAAQDLRALPGM
FT                   GVEGRVDGTLWQLLAPSRIDSLSNALNAQIATLEQQGKTVVVLGQPGAAPAALLALRDQ
FT                   IRPEAAAALAELKGLGLRSIMLTGDNPRAAEAIANELGMGWRASLLPEDKVEEIAKLAA
FT                   SQKVAMIGDGINDAPAMKRANIGIAMGGGTDVALETADAALTHNQLGGIAAMIRLSRAA
FT                   LANIHQNIALALGLKAIFLVTSLLGITGLWIAVLADTGATALVTANALRLLRKR"
FT   gene            646495..646995
FT                   /gene="tpx"
FT                   /locus_tag="ASA_0630"
FT   CDS_pept        646495..646995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpx"
FT                   /locus_tag="ASA_0630"
FT                   /product="peroxiredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88793"
FT                   /db_xref="GOA:A4SIS1"
FT                   /db_xref="InterPro:IPR002065"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR018219"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIS1"
FT                   /protein_id="ABO88793.1"
FT                   /translation="MSNSVTLQGNPVSVAGHFPVAGEQAKPFSLVAKDLSDVTLASFAG
FT                   QRKILNIFPSVDTPTCATSVRKFNEQASALENTVVLCISADLPFAQSRFCGAEGLDKVV
FT                   TLSTLRGAAFMQDYGVAFSSGPLVGLTARAIVVLDADNKVLHSEMVAEVADEPNYAAAL
FT                   AAL"
FT   gene            complement(647065..647922)
FT                   /locus_tag="ASA_0631"
FT   CDS_pept        complement(647065..647922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0631"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88794"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIS2"
FT                   /protein_id="ABO88794.1"
FT                   /translation="MAVYNGIIHLEGRQTMLRHIPMLLLSLLGIATIGLSQTSSTTSSP
FT                   PAQPVRVIKAHLGELPGLINADKTGPFVDLVHGIDALYPDMTIEITIYPIARAMAGVIN
FT                   GKADFSLPAIRNLHDADMLPYRFSTRSFGKVAHVIYSNTANPVSTDMAYGIEATQRDLL
FT                   IEAVPGELPFQVQRSMSIEQSLRKLSRGRIDAFIWAQEEADLMLRQLGLTNIQREFFGD
FT                   FEDVFIIQKGAAGNEMDAFLAQAIERLAASGKLEEIYSKIHRPYEHWQPHPEPLPATQP
FT                   VKTP"
FT   gene            648026..649246
FT                   /locus_tag="ASA_0632"
FT   CDS_pept        648026..649246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0632"
FT                   /product="ATP-dependent RNA helicase, DEAD box family"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88795"
FT                   /db_xref="GOA:A4SIS3"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIS3"
FT                   /protein_id="ABO88795.1"
FT                   /translation="MTFSELDLHPALLAALPATLHTPTRIQQLAIPVVLAGQDLLALAQ
FT                   TGSGKTLAFGLPLLQRLDPASSLVQGLVVVPTRELAMQVSAALQGMADALGLRILTLCG
FT                   GVAQERQQAELALGPQLLVATPGRLRDLLTQQVLGLDGLQQLVLDEADRLLEMGFWPDI
FT                   QWLMNEMPAERQTLLFSATLPAELNAFAHSLLTEPTRIEANPLNSLVNEIEERLYLVNK
FT                   SSKVPALISLLKEQAWPQVLVFISARDDADGVARKLARAGIPVAALHGEKEQAVREQAL
FT                   DDFKAGKVLVLVATDLMARGIHVEALPVVINLDLPASAPVYVHRIGRTARAGCEGLAIS
FT                   LVCHGESDILAAIRTLTGRELPLGELAGFPVTDLPASGEGKRPPRDKQANRRTANKRSV
FT                   KQFKGKV"
FT   gene            649337..650821
FT                   /locus_tag="ASA_0633"
FT   CDS_pept        649337..650821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0633"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88796"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIS4"
FT                   /protein_id="ABO88796.1"
FT                   /translation="MTSLLMGPLLGLEAEAQYSICFLAGPGCKGASIRINGTLLPASKQ
FT                   ADTPRGGLWRASWTASPAAEGTSVEYRILLDGEPARDLAGDDHWQFHLPGLAEPVRIGY
FT                   ASCNGFSDFKLLTSTPQPYVMWGRLAAEHAAHPFSLLLMGGDQVYADSLWTTVPSLKAW
FT                   NELDRTEKVKRKATRTMEEQLDRFYCDLYCKQWSRPEVARLLARVPSAMMWDDHDIFDG
FT                   WGSYPEDLQGCNVYRAIYAAASRYFRLFQLRSSANASLLDPVNLNHHSWLLTFRGYRIL
FT                   ALDNRATRTQAQVMSQSQWEQVNGALAACDAGHLLVMAGVPVVYRDFSFTEAALDATPW
FT                   EEELTDDLKDHWRAKDHQGERARLIMRLLDNAKSRRQKDSACKTLILSGDVHVGCLGVI
FT                   QDKREGVTNVHQLVSSGIVHPCPTQFQWMGILAMTNDNPEYLDENRLIRAELIKPFGAP
FT                   VYLRTRNFATLLMGSDHKLWANWHCENGLAASYPLA"
FT   gene            complement(650897..651688)
FT                   /locus_tag="ASA_0634"
FT   CDS_pept        complement(650897..651688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0634"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88797"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIS5"
FT                   /protein_id="ABO88797.1"
FT                   /translation="MKRRYGILALAVLSLLLLNLGWQNEPGSAPANAEVNQHGGSQPQQ
FT                   TPAAPMTTLIPRLTPAVSGGQSTKPPPSWREMPAELSQRLASEISDTDQPLSERLVNLI
FT                   ALESQWMSEGESLTRLQGRYAQALDQLADDSEQLALAERLAALTRLQDEWAADHPDLAA
FT                   DLFNPDARLLQARQLWGDEELETLARHFLPADRAEASVAFAGVRQQQLDQRGRYQQQLA
FT                   ELEQQLAASQGSMDPERWQQHREEVLGQFRRDFFAQAQDKP"
FT   gene            complement(651685..653001)
FT                   /locus_tag="ASA_0635"
FT   CDS_pept        complement(651685..653001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0635"
FT                   /product="putative phospholipase C precursor"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88798"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIS6"
FT                   /protein_id="ABO88798.1"
FT                   /translation="MHKPLSYAALLLVSQFPLQALADTDVYLTNNGPEPLQLAISQSGS
FT                   GQLQAGSQWIQHRTELGPWESAMVLSFNRYEGVKAGKSYLFETRVTTASGDTYRLNQLM
FT                   EGTWWNTTLQHGGDTPTVSSGWKSDRALHRTQGPQELAFAAKFTGRYDDLHYMLTPPQP
FT                   REQLEPSESKLKVASYNVWALPVIASSIGERLTLLPDYLKGYDALLLQEVFDGRREGFL
FT                   QALAKEYPYQTKVLDKPGVNIHDGGVVIVSRYPIVREAQLVYPQCTGTDCFADKGVMYA
FT                   EVIKGGKAWHLFATHTASFDTDEARQLRQIQFGQIRTLAASLKIPASDTVIYGGDFNVN
FT                   KRKFADDYASMLANLDAHEPGYGGYTEATFDPRINPYAGGPLSGGANVEYLDYLVVSRE
FT                   YGAASHNLNSVWIPRSSDGSLWPASNLSDHFPVKGEISR"
FT   gene            complement(653225..654784)
FT                   /locus_tag="ASA_0636"
FT   CDS_pept        complement(653225..654784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0636"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88799"
FT                   /db_xref="GOA:A4SIS7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIS7"
FT                   /protein_id="ABO88799.1"
FT                   /translation="MTTSQREGEIRFPDHLSLISTTDPTSHITYANQHFCEVAGYNAAE
FT                   MEGVPHNLVRHPDMPKAAFADMWQRLRQGKSWMGLVKNRAKSGSFYWVNAYVTPILNEQ
FT                   RQIIEYQSVRTRPSEQDIAWAEQLYARIRAGKALPWFSRLTLEPGQLTLLLSGTALLAL
FT                   LAALATGNPLWGAPGAAALLAQMIHGWRLQQRLNRLATTAGEEMGTPLCQVLYTKRRDT
FT                   LAALELALRMKRAELKAVVGRSADTNQQILQAAEDDRGNIQTIDTHLQQQRAQSEQLAA
FT                   AITQMSQSIRDVANSAHQANALVGEVQQVSAEGLQALATTQSSVNQLHEELDANHQVLA
FT                   QLTGDSQKISGILAVISQIADQTNLLSLNAAIEAARAGEQGRGFAVVADEIRALAQKTR
FT                   SSTGEIHEMIQALQQTTRQLADGMTQGAQTSERCQQHVSTTAEVLNQINRMLTQVTHTS
FT                   DEIAQAVGQQADVTSTLDHGIHQIHQLASHTADNSRQALDGITLLVERLHALSRLINQF
FT                   RH"
FT   gene            complement(655026..655856)
FT                   /locus_tag="ASA_0637"
FT   CDS_pept        complement(655026..655856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0637"
FT                   /product="CAAX amino terminal protease family"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88800"
FT                   /db_xref="GOA:A4SIS8"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIS8"
FT                   /protein_id="ABO88800.1"
FT                   /translation="MLPLPDSLIWGALALAVLLCLVRQRMPGLILLGVALLAALYLDHL
FT                   SPSTLLITLAGLLLAWRTPSLPQPWRGAALTLVLLWAIALMLHLIPGFNNLKVLDQAQA
FT                   GPASVPFNMYLNLDKPLVFFGLLLAWPALLGQGGAIRWRALALLLLPLAALLITAWQLG
FT                   ALKPEAGLPHWWWLFALNNLLFTCVAEEALFRGFIQQGVAARSRLWLGILVASLLFGAA
FT                   HLAGGPLLMLFAALAGACYGLAFHVSGRLSVAIVIHFLFNFAHLALFTYPLASR"
FT   gene            complement(656033..656332)
FT                   /locus_tag="ASA_0638"
FT   CDS_pept        complement(656033..656332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0638"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88801"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIS9"
FT                   /protein_id="ABO88801.1"
FT                   /translation="MSIYDFDGEQPEQPEDEQDQTKQAVPAKKKGKQVMNTQVNLSPRD
FT                   ASRLNGLHVEAITTLDDVSLPKNVIFKAGLIALGELEATKRADIIARVIAESGR"
FT   gene            complement(656383..656757)
FT                   /locus_tag="ASA_0639"
FT   CDS_pept        complement(656383..656757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0639"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88802"
FT                   /db_xref="InterPro:IPR008249"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIT0"
FT                   /protein_id="ABO88802.1"
FT                   /translation="MDYEFRRDPFGGYRARFSMGHEAIGQWLIDEVGKDEEKLDELFSI
FT                   IDQLSNRTRTEYQLHGGDYSLLLTHEEAEVKANVLNIEQDEDLDDLAYYDDEQLAMCGL
FT                   EDFAQVLGSWRAFIRNEDMG"
FT   gene            656966..658081
FT                   /gene="cdaR"
FT                   /locus_tag="ASA_0640"
FT   CDS_pept        656966..658081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdaR"
FT                   /locus_tag="ASA_0640"
FT                   /product="Sugar diacid utilization regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88803"
FT                   /db_xref="InterPro:IPR008599"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIT1"
FT                   /protein_id="ABO88803.1"
FT                   /translation="MQLNDTLARQIVSRAMKILSFSVNVMDEHGLIIASGNPERLHQRH
FT                   EGAVLALTENRVVEISEATAQQLKGVRPGINLPIAYQGELLGVIGISGDPDIVRAYAEL
FT                   VRMTAELILEQAALTEQLQWDKRHKEELVLQLIRGEGRVDQLQQAARFLELDLAQPRVV
FT                   AVLALEEADPARLRELVHLLENPERDNLVAINGLDEIVVLKPAQLSEGVWQSEQERSRI
FT                   KQLLARIPHFKVRIGVGDYFGGIDGLARSYQTARDTLRRGMRQAPRKQVYFFEDYRLPV
FT                   LLGSLADSWQADQLRAPLLRLAQEDTKGTLQKTLRQYFLQDCDLHPCAEALFIHPNTLR
FT                   YRLTRIEQITGLNFNKLDDKFLLYLGLNLDS"
FT   gene            658201..659232
FT                   /gene="gntT"
FT                   /locus_tag="ASA_0641"
FT   CDS_pept        658201..659232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntT"
FT                   /locus_tag="ASA_0641"
FT                   /product="H+/gluconate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88804"
FT                   /db_xref="GOA:A4SIT2"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="InterPro:IPR032813"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIT2"
FT                   /protein_id="ABO88804.1"
FT                   /translation="MIPVSALGALAALSIAIFLILKKVPPAYGMIVGALAGGLIGGADL
FT                   TQTVALMIGGAQGITTAVMRILAAGVLAGVLIESGAATTIAASDAFHLPLTSVMAAGII
FT                   PGLFGLVMAYWLAKRLNNKGSKVAADEVVSFSGSKLPGFGAAISAPLVAILLLALRPLA
FT                   GIVVDPLIALPLGGLVGALMMGKFSKVNQFAVSGLARMAPVAIMLLGTGTLAGIIANSG
FT                   LKDVLISGLTASGLPSYLLAPISGALMSLATASTTAGTVVASNVFSSTLIELGISSLAG
FT                   AAMIHAGATVFDHMPHGSFFHATGGSVHMGVGERLKLIPYETAVGLTIAAVSTLMFGVF
FT                   GLA"
FT   gene            659242..660375
FT                   /gene="glxK"
FT                   /locus_tag="ASA_0642"
FT   CDS_pept        659242..660375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glxK"
FT                   /locus_tag="ASA_0642"
FT                   /product="glycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88805"
FT                   /db_xref="GOA:A4SIT3"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIT3"
FT                   /protein_id="ABO88805.1"
FT                   /translation="MKIVIAPDSFKESLSAMAVADAIEAGFKQVLPEATYIKLPMADGG
FT                   EGTVQSLVDATGGRILPFYVTAPLGNQVQGFVGLLGDGERAVIEMAAASGLHLVPPELR
FT                   NPLHTSSFGTGELILAALDMGVKHLILGIGGSATNDGGAGMIQALGGKLLKRDGTPIAP
FT                   GGAGLADLATIDLSDLDSRLSRITIEVACDVDNPLCGPTGASAVFGPQKGANADMVAQL
FT                   DANLSRYADCIEQALGKQVREIPGAGAAGGMGAALVGLLGAELKPGIEIVIAALKLAEA
FT                   VADADLVITGEGRIDSQTIYGKTPIGVARCAKQFGKPVIGISGCLTDDYGVVHEHGLDA
FT                   VFAVVNRAMSLPEALATATTNLQLTARNVAALYMLRR"
FT   gene            660588..661151
FT                   /locus_tag="ASA_0643"
FT   CDS_pept        660588..661151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0643"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88806"
FT                   /db_xref="GOA:A4SIT4"
FT                   /db_xref="InterPro:IPR009915"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIT4"
FT                   /protein_id="ABO88806.1"
FT                   /translation="MILLTLGVLLFTLIHLYPCFAAAHRTRLRDRLGENRYKGLFSLLV
FT                   FVAFGLILAGWRSSSPMPLYFPPAWGPALVIGVMPVALILFFSGQGPNHLRRWLVHPQL
FT                   LGTLLWAGTHLAVNSEARSLVLFGGIGLWALVSIIWISVRDWQCHPRPAANWVGTGISV
FT                   GAGLAVTAILIFWGHGWLTGIPLR"
FT   gene            661219..661752
FT                   /locus_tag="ASA_0644"
FT   CDS_pept        661219..661752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0644"
FT                   /product="glutathione peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88807"
FT                   /db_xref="GOA:A4SIT5"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIT5"
FT                   /protein_id="ABO88807.1"
FT                   /translation="MKWFTLLLLLGVGTASAACPDYFNVEQRELNSTQRHNLCQLTEGK
FT                   VVLVVNTASYCGYRGQFGDLETLYQTYKDKGLIVLGFPSNDFWQESGDEDKTAAVCRRD
FT                   YGVTFPMFNRLAARGDDASPLYKGLAAAAGEAPGWNFHKYLIGRDGKLIASYGANQNPA
FT                   DDPLQKEVKRALGL"
FT   gene            661835..662770
FT                   /locus_tag="ASA_0645"
FT   CDS_pept        661835..662770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0645"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88808"
FT                   /db_xref="GOA:A4SIT6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIT6"
FT                   /protein_id="ABO88808.1"
FT                   /translation="MVIFDALVREQGISAAARRLGVSKSHISKQLAQLEAELGAQLVQR
FT                   TTRRFSLTELGQEYARHCRALMAVALEADSMVAERRGKVSGVLHLGVGQSFGRLHVIPR
FT                   LKAFQDRYPELELEVSLFDHRTNLVDEGLDLWITTYEDKPEALVGQRLADIHFVLVASP
FT                   DYLLSHGTPLHPKDLAQHNCITYQSRERRYHEWSFRQGKERQTVQVAGNYRVDLAEAVR
FT                   DAALAGLGIAYVANYLLDKELQSGQLIPLLPQWRPNQKMAVHAVYARREHLDPKIRLFI
FT                   DFLKESFGPNPYWELRLAPWLGGKLSGTEE"
FT   gene            662953..664149
FT                   /locus_tag="ASA_0646"
FT   CDS_pept        662953..664149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0646"
FT                   /product="nucleoside permease"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88809"
FT                   /db_xref="GOA:A4SIT7"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIT7"
FT                   /protein_id="ABO88809.1"
FT                   /translation="MIALLGILSILALAVLCSDNRRRIPLRTVGLALCLQVLFAGLVLW
FT                   LPAGQHVLNGVSESVSSVIGYGQEGIAFLFGDLAKFKLGFIFAFNVLPVIIFFSAVIAI
FT                   LYHIGLMPRVIALLGGGLQKLLGTGRAESLSATANIFVGMVEAPLVVKPYLSKMSDSQF
FT                   FAVMSCGLASVAGGTLVGYASIGVELKYLIAAAFMSAPAGLAMAKILVPPGIGEVDHHQ
FT                   DVEIPRATNVIEAAADGAMAGLNIAVAVGATLLAFVGVIAMLNGLLGWAGDLVGLELSF
FT                   QIILGLLFAPVSWLIGVPWDQAQAAGALIGTKIVINEFVAFIALVQDQTLNESSKAIVT
FT                   FALCGFANISSMAILIGGLGAMVPERKSFIARYGMRAILAGVLANLMSASLAGLFLAL"
FT   gene            complement(664471..664974)
FT                   /gene="ogt"
FT                   /locus_tag="ASA_0647"
FT   CDS_pept        complement(664471..664974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ogt"
FT                   /locus_tag="ASA_0647"
FT                   /product="Methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88810"
FT                   /db_xref="GOA:A4SIT8"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIT8"
FT                   /protein_id="ABO88810.1"
FT                   /translation="MREDEIQFLRQRPRPPAHRHRSGWLRHVEFMQGERPIMPTQQWRQ
FT                   DDLALAPYVEQFAAYFAGRLQRFDLPLAAKGTPFQQSVWRALCDIPYGKTVSYLEIAQS
FT                   IGNHKAVRAVGAANGRNPLSIIVPCHRVIGRSGELTGYAGGIPIKRWLLALEQQNASSF
FT                   ELTP"
FT   gene            complement(665008..665424)
FT                   /locus_tag="ASA_0648"
FT   CDS_pept        complement(665008..665424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0648"
FT                   /product="peptidyl-tRNA hydrolase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88811"
FT                   /db_xref="GOA:A4SIT9"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIT9"
FT                   /protein_id="ABO88811.1"
FT                   /translation="MLVISNSVTLPWHELQFQAMRAQGAGGQHVNKTDSAVWLRFDYRS
FT                   SPSLPPLYKEGLDKLSDSRVHDGFIQIRVETHRSQDMNRKEAMSRLVELLKKAAWRPKA
FT                   RHATKPTRSSQRKRIDAKKRKGDIKSARGKPVLE"
FT   gene            665626..665964
FT                   /locus_tag="ASA_0649"
FT   CDS_pept        665626..665964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0649"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88812"
FT                   /db_xref="GOA:A4SIU0"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIU0"
FT                   /protein_id="ABO88812.1"
FT                   /translation="MKLITAIIKPFKLDDVREAVASLGVEGLTVSEVKGFGRQKGHTEL
FT                   YRGAEYQVDFLPKVKLEIATADDNVEGVIEAICKAAYTGKIGDGKIFVYDLLQAVRIRT
FT                   GESDDEAL"
FT   gene            666213..667223
FT                   /gene="fbpA"
FT                   /locus_tag="ASA_0650"
FT   CDS_pept        666213..667223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbpA"
FT                   /locus_tag="ASA_0650"
FT                   /product="ABC-type iron(III) transporter, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88813"
FT                   /db_xref="GOA:A4SIU1"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIU1"
FT                   /protein_id="ABO88813.1"
FT                   /translation="MMKMKMLALAFSTLAAQGALAAGEVNVYSNRQDELIKPIIQQFEK
FT                   ESGIKVNVVFAKEGLNERLEREGKLSPADLMLTVDISRLTDLVDKGLVQPVDSKILQEN
FT                   IPSIYRDPENRWFALTTRVRAIYSSKERLGKLDTIRYEDLVKPEFKGKICTRSGKHEYN
FT                   VALVSSMIAHHGMADAKTWLEGVKANLARKPQGNDRDQVKAIKDGICDLSLGNSYYLGA
FT                   MLKDPAQKSWADAVYINFPNQADRGAHVNVSGVAMTKHAKNKEAAQKLMEFLAGDTAQH
FT                   MYADVNAEYPVKVGVEPSAMVKSWGSFKSDPMPVSEYAKHRKDALQLLDEVKFDL"
FT   gene            667263..668888
FT                   /gene="fbpB"
FT                   /locus_tag="ASA_0651"
FT   CDS_pept        667263..668888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbpB"
FT                   /locus_tag="ASA_0651"
FT                   /product="ABC-type iron(III) transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88814"
FT                   /db_xref="GOA:A4SIU2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIU2"
FT                   /protein_id="ABO88814.1"
FT                   /translation="MKNCGWIVSSWATALLLGLPVLALIFSAFSADGDLFRHLADTVLL
FT                   DYLANTLGLVVGVVLLSLLFGVPTAWLVAMCQVPGHRAMQWALMLPMAMPSYIVAYVYT
FT                   DLLDYSGPLQAGLRTLFEWSRPADYWFPAIRSLGGAAWVLALVLFPYVYLLARASFLEQ
FT                   SVSLIHSSRLLGCTPWQSFRRLSLPLARPAIMVAVSLVAMETLADFATVHFFAINTLTT
FT                   AVYDTWLGYGSLATAAKLSCMMLLAVVLLIALERRSRQRQQVFQKSMGHEQPLRYPLKG
FT                   MSRILAGLWCWGLVLAGFGLPFVILLDYGVRYFELSWTPEFVRFAGNSLLISALTALLA
FT                   MAIALLLGFFRRLDGGVKSLLPLRIAAMGYAMPGTVLAIGVLVPLTALDFGINDLAEWL
FT                   GGQGPGLLLTGTLTAIVFGYLVRFVAIAIGSVESSMGKISPSLDMAARSLGQGDGGMLR
FT                   RVHLPLVRRGLFAGAMLVFIESMKELPAALLLRPFNFDTLATHVYQFVSDEMLERGALG
FT                   AIVIVLVGLLPLIWVNRSLDSQGH"
FT   gene            668947..669996
FT                   /gene="fbpC"
FT                   /locus_tag="ASA_0652"
FT   CDS_pept        668947..669996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbpC"
FT                   /locus_tag="ASA_0652"
FT                   /product="ABC-type iron(III) transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88815"
FT                   /db_xref="GOA:A4SIU3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030287"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIU3"
FT                   /protein_id="ABO88815.1"
FT                   /translation="MRKSAVSCLQVENVSCRYNGRNVLEQLSLSVADNEIVCLLGASGC
FT                   GKTTLLKAIAGLLPLAEGEIRLGATLLDGPGVSVPPEARNIGMIFQDYALFPHLTVADN
FT                   VGFGLTRLDRPARQQQVEEALTLVKLQGLGDRYPHQLSGGQQQRVAIARALVCKPKLML
FT                   LDEPFSNIDTQVRMKLILEIRTLLKQQGIGAIFVSHSKEEAFAFADRLALFRAGHIEQV
FT                   GQPEQLYRRPQNRFVAEFLGGVNYLAAEVVDSHCVQTALGVICGSEPHGRNLGELLQLM
FT                   LRPQQLLLEAVVDGELTVLEQQFLGHHCRVLFECGGQRLEASIGEPLGGDRARVKVAPH
FT                   GLVLFEPVQ"
FT   gene            670085..670990
FT                   /locus_tag="ASA_0653"
FT   CDS_pept        670085..670990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0653"
FT                   /product="Dyp-type peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88816"
FT                   /db_xref="GOA:A4SIU4"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIU4"
FT                   /protein_id="ABO88816.1"
FT                   /translation="MKAQAGICAEPNLHALYLMFNRTGEATALVARLASVPALWEAVAA
FT                   DFPDAGFTGLVAVGADAWDDLYPVARPPQFRGFMTQSANGQQAPNTPFDLFVQLRADRV
FT                   DVLHHAGQRVMALLAGLVALVEEVRGFRNLDCRDLTGFVDGTENPQDEHRAEVALLEGG
FT                   EFAGGSYVHVQRWVHAMSDWEKLALKEQEDIIGRTKRDNIEYESADKPLTSHIKRVNLK
FT                   TPKGESMEILRQSMPWGTMTEQGLYFISCCRTPLHFNAMMASMYKGEGGHFDHLLRFTT
FT                   AVTGAAFFAPSEDFLVAQGQ"
FT   gene            complement(671094..671564)
FT                   /gene="argR"
FT                   /locus_tag="ASA_0654"
FT   CDS_pept        complement(671094..671564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argR"
FT                   /locus_tag="ASA_0654"
FT                   /product="arginine repressor"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88817"
FT                   /db_xref="GOA:A4SIU5"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SIU5"
FT                   /protein_id="ABO88817.1"
FT                   /translation="MKHNDKQEKLAKAFKALLKEERFGSQAEIVTALQEMGFENINQSK
FT                   VSRMLSRFGAVRTRNAKMEMVYCLPVELGVPTTSSPLKNLVLDVDHNGALVVIHTSPGA
FT                   AQLIARLLDSLGKAEGILGTIAGDDTIFITPTSDTDIEELYLSALELFEQTP"
FT   gene            671766..672506
FT                   /gene="artP"
FT                   /locus_tag="ASA_0655"
FT   CDS_pept        671766..672506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="artP"
FT                   /locus_tag="ASA_0655"
FT                   /product="ABC-type arginine transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88818"
FT                   /db_xref="GOA:A4SIU6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIU6"
FT                   /protein_id="ABO88818.1"
FT                   /translation="MGIELIGIAKSWHKVPVLQDVSFRTEPGETLVLLGPSGAGKSSLL
FT                   RMMNLLDTPDAGVLRIGESEFSFPSGLSAAEFNRQAQALRRKVGMVFQQYNLWPHLTVM
FT                   ENLIEAPVKLLGMSKAAAIEKGAYLLTQLQLADKRDAWPARLSGGQQQRVAIARTLMMD
FT                   PQVLLFDEPTAALDPEITKEVAEIIRNLGQTGITQVVVTHEVEFARKVASQVIYLEKGR
FT                   IIESGTAAIFQSPQTSRFAEFLMH"
FT   gene            672532..673269
FT                   /gene="artI"
FT                   /locus_tag="ASA_0656"
FT   CDS_pept        672532..673269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="artI"
FT                   /locus_tag="ASA_0656"
FT                   /product="ABC-type arginine transporter, periplasmic
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88819"
FT                   /db_xref="GOA:A4SIU7"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIU7"
FT                   /protein_id="ABO88819.1"
FT                   /translation="MKKSLLLVAAMGLLSTSVLAKEIKFATEATYAPFEYLDDKNEFQG
FT                   FDIDLARAICTQVKLECSFHNQAFDSLIPSLKFRRYDAAIAAMDVTPERAAQVDFSDIY
FT                   YENSAVFVAKKGTFKGPEDLVDKTVGVQNGSSHQSYLVDNWISKGLLTVPYASYQSAFL
FT                   DMMNGRTDGVFADTAVAADWLKQHKEYVVIGAPVTDAKYFGTGFGIAVAKGNLELLTQL
FT                   NKGLAEIKANGTYQKIFDKYFAQ"
FT   gene            673273..673923
FT                   /gene="artQ"
FT                   /locus_tag="ASA_0657"
FT   CDS_pept        673273..673923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="artQ"
FT                   /locus_tag="ASA_0657"
FT                   /product="ABC-type arginine transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88820"
FT                   /db_xref="GOA:A4SIU8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIU8"
FT                   /protein_id="ABO88820.1"
FT                   /translation="MLSLLLDAAWMTLGLVLASLVGGMVLALGLSAAELSKQPWLVWPV
FT                   ATLTTLIRGLPELLVVLFIYFGSTQVLFLITGEYVEFSPFACGVLALSLLFASYATQTL
FT                   RAALNAVPAGQRLAALALGLGKGHIFFRIVLPQAWRHALPGLGNQWLVLLKDTALVSLI
FT                   GVNEMMRQAQMASASTYEPFTWYAAAALIYLAISLVSEFGLKQAARYTRRYGG"
FT   gene            674182..674844
FT                   /gene="artM"
FT                   /locus_tag="ASA_0658"
FT   CDS_pept        674182..674844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="artM"
FT                   /locus_tag="ASA_0658"
FT                   /product="ABC-type arginine transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88821"
FT                   /db_xref="GOA:A4SIU9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIU9"
FT                   /protein_id="ABO88821.1"
FT                   /translation="MQDYFMTLLGGLAITLQLTALSLLLGVLMAAAMTWVLEQRIPVAT
FT                   QLVQLWVLIFTGTPLLIQIFLIYYGPGQFEWLKSGPLWPLLKQPWFCAVLALGFNTAAY
FT                   STRLFKGALDAIPSGEVEACRALGFSAGQTLWMKVRHAARRLVPAYSNEVILVLKGSSL
FT                   ASTITIMDVMGLAQRLNAQTYDTLAVFTVAGALYLTMNGLLTIGFRWCERRALAFQA"
FT   gene            675065..676000
FT                   /gene="mdh"
FT                   /locus_tag="ASA_0659"
FT   CDS_pept        675065..676000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdh"
FT                   /locus_tag="ASA_0659"
FT                   /product="malate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88822"
FT                   /db_xref="GOA:A4SIV0"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010097"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR023958"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SIV0"
FT                   /protein_id="ABO88822.1"
FT                   /translation="MKVAVLGAAGGIGQALALLLKNRLPAGSELSLYDIAPVTPGVAVD
FT                   LSHIPTDVKVKGFCGEDPSPALVGADVVLISAGVARKPGMDRSDLFNINPGIVKNLVEK
FT                   CAASCPKALIGIITNPVNTTVAIAAEVLKKAGVYDKRRLFGVTTLDVIRAETFVADAKG
FT                   LNVDKVRVNVIGGHSGVTILPLLSQIEGASFSAEEVAAMTKRIQNAGTEVVEAKAGGGS
FT                   ATLSMGQAACRFGLSLIKGLQGEANVIECAYVEGDGKHATFFAQPILLGKNGVETVLDY
FT                   GKLSAFEQEAMEGMLATLKADIQLGVEFVK"
FT   gene            676389..677042
FT                   /gene="motX"
FT                   /locus_tag="ASA_0660"
FT   CDS_pept        676389..677042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motX"
FT                   /locus_tag="ASA_0660"
FT                   /product="sodium-type flagellar motor component"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88823"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIV1"
FT                   /protein_id="ABO88823.1"
FT                   /translation="MAQPAATATASDGGLSPTSQPMTSTPTSGVDDSGNLQAVPLYRQD
FT                   ELLNWIEQGRHLQQVKQDRCQLTQDIEVRAEVMKVPAYQFLWGDMLAWGVCIKPNAELG
FT                   VKFMWEAANQGLAPALEQLGRYYWKGTLVQKDLLKAETLMREAASLGFQRAQVEWVEML
FT                   LQGLGSPLDYEEAYHWLHSTVIGDKALHQKATSLLNRLGNRMPANAIARAKAMR"
FT   gene            complement(677138..678331)
FT                   /gene="hmp"
FT                   /locus_tag="ASA_0661"
FT   CDS_pept        complement(677138..678331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmp"
FT                   /locus_tag="ASA_0661"
FT                   /product="flavohemoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88824"
FT                   /db_xref="GOA:A4SIV2"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIV2"
FT                   /protein_id="ABO88824.1"
FT                   /translation="MLDQATIAVIKSTIPLLESAGPALTQHFYQRMFSHNPELKDIFNL
FT                   AHQRSGGQPLALFNAVAAYAKNIDNLGALAGAVERIAHKHTGFMIQPEQYHIVGSHLLA
FT                   TLKELGGSEVTDEVLDAWGKAYGVLASIFIGRESEIYQEKASEIGGWQGPRPFIIKEKR
FT                   VESELITSFMLAPIDSKPVLHFKPGQYLSIQLNHPELEYQEIRQYSLSDAPNGRDYRIS
FT                   VKREPQGQVSNLLHDHLQVGDKVDLMPPTGDFFLQASASTPVVLLSAGVGLTPMLSMLN
FT                   QLLSTGHDADVCWLHACERGSLHAFKEDIQRKRQQHQKLQSRVWYREPSDQDQQGKDYD
FT                   FSGIMNLSEVSELLVPQAHYYFCGPLGFMRGIKTQLGAAGIPTEQLHYEVFGPHQDL"
FT   gene            678443..678916
FT                   /locus_tag="ASA_0662"
FT   CDS_pept        678443..678916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0662"
FT                   /product="transcriptional regulator, Rrf2 family"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88825"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIV3"
FT                   /protein_id="ABO88825.1"
FT                   /translation="MRLTSYTDFGLRALLYLATLPQGELSSVAKVSALYDVSRNHMVKV
FT                   VNQLVKLGYLQSQRGKNGGIRMACTPETVNIGQVIRALEGNLDGIDCNSPVCHIVSVCL
FT                   LKSALKEAMNAFLAVMDSYTLQDLLANRDELQKVFGELIPTLVLEPELDDENE"
FT   gene            complement(678948..680228)
FT                   /locus_tag="ASA_0663"
FT   CDS_pept        complement(678948..680228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0663"
FT                   /product="putative magnesium and cobalt efflux protein
FT                   CorB"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88826"
FT                   /db_xref="GOA:A4SIV4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIV4"
FT                   /protein_id="ABO88826.1"
FT                   /translation="MDSISTSTLLIVLVILILLSAFFSSSETGLMSINRYKLRHLAQTK
FT                   HKAARRVEQLLARPDRLLGLILIGNNLVNIFASAIATIVCIRLFGDLGVAIATFGLTLV
FT                   VLVFGEVTPKTLAAMFPERVAYPASWILKGLMVPLYPFVWLINGITSGLLKLLRVTPNK
FT                   NDALNTEELRTIVNEAGSLIPQRHQEMLLSILDLDKMTVEHIMVPRSEIYAIDINDDWK
FT                   SILRQLAHGAHTKILLYRDNIDDVVGFLHARDAQRLMARDQFNKSSLLREVDEIYFIPE
FT                   GTPLNVQLAKFQRNKERIGLIVDEYGDIQGLITLDDILEEIVGDFTTTITPTPSDEIHP
FT                   QPDGSFLVEGSASIRELNKEMNWQLPIDGPRTLNGAILEYLEEIPQPNISLRLAGYPIE
FT                   IMEVENNMVKMARIMPDLYRNVSGFED"
FT   gene            complement(680274..681065)
FT                   /locus_tag="ASA_0664"
FT   CDS_pept        complement(680274..681065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0664"
FT                   /product="ABC-type transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88827"
FT                   /db_xref="GOA:A4SIV5"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIV5"
FT                   /protein_id="ABO88827.1"
FT                   /translation="MIVISILALAFYLLAIVASLHLLLNAKQVGQAPLFACIGLALVAH
FT                   GASVASEVLVTHSGQNLSMLNVASLVSLIISCFMTCVTRRFNGWILLPVVYSFSALLLA
FT                   ASALIPGRYITHLEAHPQLLLHIGLALMAYSVLMIACLFALQLACLDRQLKSRKISQLP
FT                   SMPPLMTVEKRLFQLISAGLFLLTLSIASGLFFLEDMFAQGKSHKAILSILAWCVYVLL
FT                   LWGHHTRGWRGRRVITLSLVGSVILTLAYFGSRFVKEVLLS"
FT   gene            681364..682743
FT                   /gene="ffh"
FT                   /locus_tag="ASA_0665"
FT   CDS_pept        681364..682743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ffh"
FT                   /locus_tag="ASA_0665"
FT                   /product="signal recognition particle protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88828"
FT                   /db_xref="GOA:A4SIV6"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIV6"
FT                   /protein_id="ABO88828.1"
FT                   /translation="MFENLTERLSRTLRNVSGRGRLTEENIKDTLREVRMALLEADVAL
FT                   PVVRDFVARVKERAVGQEVAKSLSPGQAFIKIVHGELVSVMGEANEQLNLAAQPPVIIL
FT                   MAGLQGAGKTTTVGKLAKLLKERSKKKVLVVSADVYRPAAIKQLETLASDVGVDFFPSD
FT                   ASQKPVDIATAAIDQARKKFYDVVIVDTAGRLHVDSDMMDEIIHLHATIKPVETLFVVD
FT                   AMTGQDAANTAKAFNEALPLTGVILTKADGDARGGAALSVRHITGKPVKFIGMGEKTDA
FT                   LEPFHPDRLASRILGMGDVLSLIEEVERTVDKEKAAKLANKVKSGKGFDLEDFREQLAQ
FT                   MRNMGGMMGMLDKLPGMSGLPDNVKDQMDDKLTVRMEAIISSMTPKERAHPDLIKGSRK
FT                   RRIAAGSGMQVQDVNKLLKQFTEMQRMMKKMSGKGGMRKMMGQMKNMLPPGFGGGGRGP
FT                   F"
FT   gene            682923..683171
FT                   /gene="rpsP"
FT                   /locus_tag="ASA_0666"
FT   CDS_pept        682923..683171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="ASA_0666"
FT                   /product="Ribosomal protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88829"
FT                   /db_xref="GOA:A4SIV7"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SIV7"
FT                   /protein_id="ABO88829.1"
FT                   /translation="MVTIRLQRGGAKKRPFYQVVVSDSRCARDGRFIERVGFFNPVASG
FT                   SAETLNLDLARIEHWVATGAAVSDRVAKLIKDATKAA"
FT   gene            683196..683717
FT                   /gene="rimM"
FT                   /locus_tag="ASA_0667"
FT   CDS_pept        683196..683717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="ASA_0667"
FT                   /product="16S rRNA processing protein RimM"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88830"
FT                   /db_xref="GOA:A4SIV8"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SIV8"
FT                   /protein_id="ABO88830.1"
FT                   /translation="MEKPVVLGTLGTVYGIKGWLKVNSFTDVAEAIFDYNPWMINQNGV
FT                   WRELKVSAWKRHNKGLICKIDGIDLREDALALTNVEIGVPADLLPALPEGEFYWRDLIG
FT                   CSVSTTKGYDLGKVTELMETGSNDVLVVEANVKDAFGAKERLIPFLEEQVIKHIDLTAR
FT                   TIEVDWDPGF"
FT   gene            683752..684501
FT                   /gene="trmD"
FT                   /locus_tag="ASA_0668"
FT   CDS_pept        683752..684501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="ASA_0668"
FT                   /product="tRNA (guanine-N1)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88831"
FT                   /db_xref="GOA:A4SIV9"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SIV9"
FT                   /protein_id="ABO88831.1"
FT                   /translation="MWIGVISLFPEMFRAITEHGVTGRAVKSGLLQIECWNPREFTHDK
FT                   HRTVDDRPYGGGPGMLMMVQPLRDAIHAAKQAAGDGAKVIYLSPQGRKLTQAGVTELAT
FT                   NQKLILVAGRYEGIDERVIQTEVDEEWSIGDYVLSGGELPAMTLIDAVSRLVPGVLGDQ
FT                   ASAEQDSFTDGLLDHPHYTRPELLDGLAVPEALTSGNHEVIRRWRLKQSLGRTWQRRPE
FT                   LINNLALTDEQESLLAEYVREVRDSVK"
FT   gene            684534..684881
FT                   /gene="rplS"
FT                   /locus_tag="ASA_0669"
FT   CDS_pept        684534..684881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="ASA_0669"
FT                   /product="ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88832"
FT                   /db_xref="GOA:A4SIW0"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SIW0"
FT                   /protein_id="ABO88832.1"
FT                   /translation="MSKIIQQLEQEQLRTDIPAFAQGDTVRVQVRVKEGGKERLQAFEG
FT                   IVIAKRNRGLHSAFTVRKISNGEGVERVFQTHSPLIHSVELKRRGDVRRAKLYYLRNLS
FT                   GKAARIKEKLN"
FT   gene            complement(685010..685333)
FT                   /locus_tag="ASA_0670"
FT   CDS_pept        complement(685010..685333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0670"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88833"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIW1"
FT                   /protein_id="ABO88833.1"
FT                   /translation="MPINKQFLKSRPEVKVTFAVEKEAAGEAEQVLLLGEFSQWQPIEL
FT                   KRMKSGEFRTTLNLPTDGPSHFEYCYQLVKPNGETLYDNDWEADDYVPGPFGRDNSVVR
FT                   VNQ"
FT   gene            complement(685417..686091)
FT                   /gene="mutH"
FT                   /locus_tag="ASA_0671"
FT   CDS_pept        complement(685417..686091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutH"
FT                   /locus_tag="ASA_0671"
FT                   /product="DNA mismatch repair endonuclease MutH"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88834"
FT                   /db_xref="GOA:A4SIW2"
FT                   /db_xref="InterPro:IPR004230"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011337"
FT                   /db_xref="InterPro:IPR037057"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIW2"
FT                   /protein_id="ABO88834.1"
FT                   /translation="MPTNPQSEQELLARADAMAGFSLAQLASDAGIAVPRDLRRDKGWV
FT                   GQLIEWQLGASAGSKPEQDFPELGIELKTIPIDPYGKPLETTFVCVAPLIGVSGQRWEE
FT                   SNVRNKLSRVLWIPVEGSRDIPVGERRIGMPLMWSPSEEEDKLLRQDWEELMDMIVLGE
FT                   VEQISARHGQVMQLRPKAANNKALTRAIGRNGQPILTLPRGFYLKIGFTHGLLQRHFAL
FT                   PL"
FT   gene            complement(686119..686433)
FT                   /locus_tag="ASA_0672"
FT   CDS_pept        complement(686119..686433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0672"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88835"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIW3"
FT                   /protein_id="ABO88835.1"
FT                   /translation="MAHYLPCHRSKNRCSFTFFCNNTLTITTLRQLSKISVDNCVQQHE
FT                   QTLGQLFQLGILCREDLRYKDKLFKNHYDKSSPTKRPPLCSPLPGTVIKTAILIKDQTC
FT                   "
FT   gene            686825..687352
FT                   /gene="nudH"
FT                   /locus_tag="ASA_0673"
FT   CDS_pept        686825..687352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nudH"
FT                   /locus_tag="ASA_0673"
FT                   /product="(di)nucleoside polyphosphate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88836"
FT                   /db_xref="GOA:A4SIW4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SIW4"
FT                   /protein_id="ABO88836.1"
FT                   /translation="MIDGDGFRPNVGIVICNRDGQVLWAKRYGQHSWQFPQGGVDDGET
FT                   PEQAMYRELYEEIGLKPEDVTIMATSRNWLKYRLPKRLVRWDSSPVCIGQKQKWFLLQL
FT                   DPGRESRIQFGCHGHPEFDDWRWVSFWYPVRQVVSFKREVYRRVMTEFAPLAMPVPVVQ
FT                   VNRKDGRRNRSR"
FT   gene            687365..689644
FT                   /gene="ptsI"
FT                   /locus_tag="ASA_0674"
FT   CDS_pept        687365..689644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsI"
FT                   /locus_tag="ASA_0674"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88837"
FT                   /db_xref="GOA:A4SIW5"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIW5"
FT                   /protein_id="ABO88837.1"
FT                   /translation="MLTDLRRIVESMAEANTLELALQALVSQTRRAMTVDCCSVYVSEP
FT                   DMRRYRLAATDGLAESAVGKATLPFEQGIVGLVGQREELINLADAPSHPSFKFLPDVAE
FT                   EAFRSFLGAPIMHQRQVVGILVVQQKESRRFDEGEESFMVTLAAQLAARIAQAQAKGWL
FT                   QKTDWSKPLRGIAGASGIAMAKAWVWRPRKELSAITPRKDEEHAKQLERLNVAVEVVRH
FT                   DLESLALRFRESYSQDSVAIFDIYLHLLNDPGYIKPIRNKVSKEHWTAVSAVKLISDRL
FT                   IDQFKGMKDPYLQERSTDVKDIAQRLISRLVQNEPEHITVGEPVVLVADEVTATILAEV
FT                   PREFLTGVVSLKGGTNSHAAILARAMGVAAIMGVDLPLGDIGGRMLVVDGYSGDLFIEP
FT                   NQVILTEYRQLLNEERALDTLVRSVDNQPSETADGTPVSLLLNAGLSADTEISLNHLAD
FT                   GVGLYRTEIPFMLQDSFPSEWEQTARYRGILETYRNRPVCMRTLDVGGDKQLPYFPIVE
FT                   ENPFLGWRGIRLTLDHPELFLVQLKAMLRASEGLDNLAIMLPMISSVSEIRASRRLLDQ
FT                   AWREVSEEAASRDAVIRYPSLGVMIEVPSALYILPEMAPLIDFWSVGSNDLTQYLLAVD
FT                   RNNARVANIYDAFHPAVIRALQLLVDASHRYQKPVSVCGELAGDPVGVLLLLAMGYRRF
FT                   SMNTHNIARIKYVLRQSTLSELTALMADGLKHDNPHVLRGLFARYLEEHGLGGLLRAGH
FT                   KTKQTD"
FT   gene            689712..690539
FT                   /gene="lgt"
FT                   /locus_tag="ASA_0675"
FT   CDS_pept        689712..690539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="ASA_0675"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88838"
FT                   /db_xref="GOA:A4SIW6"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SIW6"
FT                   /protein_id="ABO88838.1"
FT                   /translation="MQHDGYWVFSQVDPVAFSLGPLSVRWYGLMYLFGFAFAMWLAGRR
FT                   ADTPNSGWTRNEVSDLLFYGFLGVILGGRVGYVLFYNFDMFLADPIYLFKIWTGGMSFH
FT                   GGLIGVITAMIWFAHKTKRHFFTVADFVAPLIPFGLGVGRIGNFLNGELWGRVTDVPWA
FT                   IIFPEAGPEPRHPSQLYQFALEGVVLFIILNLFWRKNPPRGAISGLFLFCYGLFRFLVE
FT                   FVRQPDSQLGLYFQEISMGQILSMPMIVAGALMVWAAYKRPQLFGNAGKEVKQ"
FT   gene            690536..691330
FT                   /gene="thyA"
FT                   /locus_tag="ASA_0676"
FT   CDS_pept        690536..691330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyA"
FT                   /locus_tag="ASA_0676"
FT                   /product="thymidylate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88839"
FT                   /db_xref="GOA:A4SIW7"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SIW7"
FT                   /protein_id="ABO88839.1"
FT                   /translation="MRVYLDLMQKILDEGTVKSDRTGTGTVSLFGHQMRFNLAQGFPLV
FT                   TTKKCHLRSIIHELLWFLNGDTNTAYLKEQGVSIWDEWADENGDLGPVYGAQWRSWPAA
FT                   DGAVIDQIQRAVDDIKHNPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQL
FT                   YQRSCDVFLGLPFNIASYALLTHMMAQQCDLEVGDFVWTGGDVHLYSNHMEQTALQLSR
FT                   EPRPLPQLAIKRKPDSIFDYRFEDFEILGYDPHPGIKAPVAI"
FT   gene            691559..692749
FT                   /gene="nhaA"
FT                   /locus_tag="ASA_0677"
FT   CDS_pept        691559..692749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaA"
FT                   /locus_tag="ASA_0677"
FT                   /product="Na+/H antiporter NhaA"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88840"
FT                   /db_xref="GOA:A4SIW8"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SIW8"
FT                   /protein_id="ABO88840.1"
FT                   /translation="MSDVFKKFLKLEAASGIILIMAAVLAMILANSGLASGYQAFLDTP
FT                   VQVRIAALDINKPLLLWINDGFMAIFFLLVGLEVKREMLEGALSSRVQATFPAIAAVGG
FT                   MLAPALIYTFFNYSDEAARAGWAIPAATDIAFALGVMALLGKRVPVSLKVFLLALAIMD
FT                   DLGVIIIIALFYTQQLSLEALAVGILATLTLLWMNRRGEDRIGLYMLVGLVLWVAVLKS
FT                   GVHATLAGVVVGFMIPLNGKRYASPLKHLEHALHPWSAYLILPLFAFANAGVSLDGIGL
FT                   SSLLSPVPMGIMLGLFVGKPLGVFTISWLSVKLGIAQLPSGVNFKQIFAVSILCGIGFT
FT                   MSMFIASLAFEHGGLDYGSYSRLGILVGSTLAAVVGYLALRMSLPNREADQSTEGL"
FT   gene            692746..693150
FT                   /locus_tag="ASA_0678"
FT   CDS_pept        692746..693150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0678"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88841"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIW9"
FT                   /protein_id="ABO88841.1"
FT                   /translation="MRKYGWLMILMSPAVWAGSLEDCKQDAVSASCSAYLNGVVDSALM
FT                   LGDKQAKAKFGETFAERALSSRAGEMVKQSNKRYCGERMPDKAHLKSTLQANFTANKVD
FT                   SISDMYDILAAELSCYRSPRTAGTPSDVTP"
FT   gene            693137..694069
FT                   /gene="nhaR"
FT                   /locus_tag="ASA_0679"
FT   CDS_pept        693137..694069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaR"
FT                   /locus_tag="ASA_0679"
FT                   /product="transcriptional activator protein NhaR"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88842"
FT                   /db_xref="GOA:A4SIX0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIX0"
FT                   /protein_id="ABO88842.1"
FT                   /translation="MSHLNYNHLYYFWMTQKKGSVTQAAEALFLTPQTVTGQIKLLEQR
FT                   LGGKLLMRKGRTLEATELGQLVFRYADKMFSLSYEMLDIVNYRKESQILFDVGIADALS
FT                   KRLASRVLLSVIPNDGSIHLRCFESTHELLLEQLSEHKLDMILSDCPVDSSQHAGLLSK
FT                   RLGGCGVSFFCKAPLPEKAFPACLEERKLLIPGRRTAMGRQLTQWFEQQGISPSILGEF
FT                   DDAALMKAFGFFNQGIFMAPTIYREEILEGEEVMLIGETQDLMEEYYVIFAERMIQHPA
FT                   VKRVCESDFSFLFAGQEDFATIQPATLSF"
FT   gene            694119..694421
FT                   /gene="hlyU"
FT                   /locus_tag="ASA_0680"
FT   CDS_pept        694119..694421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hlyU"
FT                   /locus_tag="ASA_0680"
FT                   /product="Transcription activator HlyU"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88843"
FT                   /db_xref="GOA:A4SIX1"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIX1"
FT                   /protein_id="ABO88843.1"
FT                   /translation="MQLEEMEANASRAVALLKALANERRLFILCQLLDRELSVGELNEV
FT                   LGLSQSALSQHLAVLRRDELVETRKEAQTVYYSLRSHEVREMIGLLHRLYCSADK"
FT   gene            complement(694471..694734)
FT                   /gene="rpsT"
FT                   /locus_tag="ASA_0681"
FT   CDS_pept        complement(694471..694734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="ASA_0681"
FT                   /product="ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88844"
FT                   /db_xref="GOA:A4SIX2"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SIX2"
FT                   /protein_id="ABO88844.1"
FT                   /translation="MANIKSAKKRAIQSEKRRQHNASRRSMTRTYLKKVIAAIASGDKA
FT                   AAVAAFATAQPIMDRMATKGLIHKNKAARHKSRLSAQIKAMA"
FT   gene            694953..696494
FT                   /gene="mviN"
FT                   /locus_tag="ASA_0682"
FT   CDS_pept        694953..696494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mviN"
FT                   /locus_tag="ASA_0682"
FT                   /product="integral membrane protein MviN"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88845"
FT                   /db_xref="GOA:A4SIX3"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIX3"
FT                   /protein_id="ABO88845.1"
FT                   /translation="MIVSGMTLVSRVMGLVRDVVIANLLGAGVAADVFFFANRIPNFLR
FT                   RLFAEGAFNQAFVPVMTEYKKNGDEREVRELLAAVAGTLGGIVTVVTLLGVLGSGVLTA
FT                   LFGWGWFWDWLHGGPAAEKFELASLMLKITFPYLWFITFTAMAGAILNTFGRFAVSSFT
FT                   PVFLNLTMIGAAWWIAPLLERPEIALAIGVFLGGLVQFLFQYPFLRQINMLVWPKWGWR
FT                   HPGVVKIRTLMIPALFGVSVSQINLLINTMLASFLATGAISYLYYSDRLLEFPLGLFAV
FT                   AISTVILPALAKKHVDADPADFSRTMDWGVRMVMLLGLAAMVGIAVLREPILRVLFMRG
FT                   EFGMHEVSMSSASLLASTTGLLSLMLIKVLAPGYYARQDTRTPVRIGVMSMIANMVCNL
FT                   IFIFPLGYVGLALSTACSGSLNAALLFKGLYQQGVYRPSRNTGLFCLKLLVATVLMGGV
FT                   LAYLSPDLAQWAAWSMGKASLQLTMLLCLGGGMYGVILLVLGIRPRHLKAGQQQD"
FT   gene            696634..697608
FT                   /gene="ribF"
FT                   /locus_tag="ASA_0683"
FT   CDS_pept        696634..697608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="ASA_0683"
FT                   /product="riboflavin kinase/FMN adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88846"
FT                   /db_xref="GOA:A4SIX4"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIX4"
FT                   /protein_id="ABO88846.1"
FT                   /translation="MELIRGIHNIKPRHRGCVLTIGNFDGVHQGHHAVLARLQEKAVQL
FT                   GLPACVMLFEPQPLELFAGSAAPARLSRLREKYEALKGMQIDRMLCVRFNHRFAEQSPN
FT                   SFIEQLLVEKLGVRYLVVGDDFRFGKGREGDFHLLEEAGHRFGFEVISTQSFQLERQRV
FT                   SSTLVREALKAGRMAEVEMMLGRPYTISGRVAHGDKLGRTIGFPTANLALKRQVIPVGG
FT                   VFAVEVLCSGKTFPGVANVGVRPTVNGTQARLEVHLFDFSGDLYGQQVKVLLRHKLREE
FT                   QKFASFIALKEQIERDALAARAWFGLPLLNLPSTLLEKKGTQD"
FT   gene            697608..700469
FT                   /gene="ileS"
FT                   /locus_tag="ASA_0684"
FT   CDS_pept        697608..700469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="ASA_0684"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88847"
FT                   /db_xref="GOA:A4SIX5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SIX5"
FT                   /protein_id="ABO88847.1"
FT                   /translation="MSDYKHTLNLPETEFPMRGDLAKREPNMLKRWYDQDLYGAIRRAK
FT                   AGKPSFILHDGPPYANGSIHIGHSVNKILKDVIIKSKGLSGFDSPYVPGWDCHGLPIEL
FT                   KVEGMVGKPGEKVSAAEFRAECRKYAKTQIEAQKTDFIRLGVLGDWEHPYLTMDFGTEA
FT                   NIIRSMAKIVENGHLHKGSKPVHWCTDCGSALAEAEVEYYDKNSPSIDVRFKAVDEATV
FT                   AAKFDCPEGHLGKGPISAVIWTTTPWTLPANRAIAMHADLDYALVQVEGEHPERLILAA
FT                   ELVKDVMDRAGIEKFHNLGYTKGVALELLRFNHPFYSFDVPVVLGDHVTLDAGTGAVHT
FT                   APGHGQEDFVVGQKYGLEVANPVGSNGVYLPDTELFAGQHVFKANAAVVEVLTERGALL
FT                   HHMVFNHSYPHCWRHKTPIIFRATPQWFISMEQKGLRQRALEEIERIEKDGITQHGQSG
FT                   WVPAWGKNRIQAMVENRPDWCISRQRTWGVPISLFVHKETQQLHPESVRLMHEVAKRVE
FT                   QSGIQAWWDLDKAELLGSDADMYDKVPDTLDVWFDSGSTHSSVVDARPEFNGHSADLYL
FT                   EGSDQHRGWFMSSLMIGVAMKDKAPYNQVLTHGFTVDGQGRKMSKSIGNVVSPQDVMNK
FT                   LGADILRLWVASTDYTGEMTVSDEILKRSADAYRRIRNTARFLLANLNGFNPATDMVAA
FT                   ADMVVVDRWAVGRAKAAQAEIVTAFEEYNFHGVTQKLMQFCSIEMGSFYLDVIKDRQYT
FT                   AKADSLARRSCQTALYHIAQAMVRWMAPIMSFTADEIWALLPGERSEFVFTEEWYDGLF
FT                   GLDAGEQMDDAFWAEILTVRGEVNKALEAARGEKRIGGSLQAELTLFAKPELAERLNAL
FT                   ADELRFVLLTSKAKVVTADTAPEGSVATERADLWLSVAQSAAAKCDRCWHHVEDVGTIA
FT                   GHEEICGRCATNVEGDGETRQFA"
FT   gene            700469..700981
FT                   /gene="lspA"
FT                   /locus_tag="ASA_0685"
FT   CDS_pept        700469..700981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="ASA_0685"
FT                   /product="lipoprotein signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88848"
FT                   /db_xref="GOA:A4SIX6"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIX6"
FT                   /protein_id="ABO88848.1"
FT                   /translation="MKMTHNAIHNKTGLRWLWLAVLAFVLDQASKLAVVKMLPFGYPGV
FT                   EITPFFNLVHVYNKGAAFSFLADQGGWQRWFFAVLAFAICGLLIHWLRKQSVTQRWSGI
FT                   AYSLIIGGALGNVFDRLVLGHVVDFLDFYWQRSHWPAFNLADSFIFIGAVMIVLEGFRS
FT                   EKKKEAP"
FT   gene            700978..701430
FT                   /gene="fkpB"
FT                   /locus_tag="ASA_0686"
FT   CDS_pept        700978..701430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fkpB"
FT                   /locus_tag="ASA_0686"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88849"
FT                   /db_xref="GOA:A4SIX7"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIX7"
FT                   /protein_id="ABO88849.1"
FT                   /translation="MSQQIAADSSVLFHFAIKLEDGSVADSTALQGKPARLRMGDGSLT
FT                   ASFEQCLLGLRTGESKSFTLTPEQAFGLSNPDNIYHLDRAKFGADVEPKIGTIILFDQP
FT                   NGSELPGIIRAVEGMSVTVDFNHPLAGHTVTFEVEILGVDDEEKVI"
FT   gene            701430..702365
FT                   /gene="lytB"
FT                   /locus_tag="ASA_0687"
FT   CDS_pept        701430..702365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lytB"
FT                   /locus_tag="ASA_0687"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88850"
FT                   /db_xref="GOA:A4SIX8"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SIX8"
FT                   /protein_id="ABO88850.1"
FT                   /translation="MDILLANPRGFCAGVDRAISIVESALEKFGAPIYVRHEVVHNRYV
FT                   VNKLKEAGAVFVEELDEVPDDSIVIFSAHGVAKTVREMAKSRALKVFDATCPLVTKVHM
FT                   EVHRASRKGSEAVLIGHAGHPEVIGTMGQYENREGGMYLVETPDDVARLKVKNPDDLCF
FT                   VTQTTLSVDETSDVIDALRKQFPKIQGPRKDDICYATQNRQDAVREMAGLVDVMLVVGS
FT                   RNSSNSNRLRELAEKVGSKAYLIDDASMIETVWLEGVKAIGVTAGASAPDVLVQNVIAR
FT                   LRELGGNMVVEHPGREENVVFEVPPELRII"
FT   gene            702476..702883
FT                   /gene="tppA"
FT                   /locus_tag="ASA_0688"
FT   CDS_pept        702476..702883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tppA"
FT                   /locus_tag="ASA_0688"
FT                   /product="type IV pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88851"
FT                   /db_xref="GOA:A2T196"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR031982"
FT                   /db_xref="UniProtKB/TrEMBL:A2T196"
FT                   /protein_id="ABO88851.1"
FT                   /translation="MIGFFRGFSLVELMIVVAIVAILGTIAYPSYQQYLLTSHRVDAKK
FT                   MLLDAANRQETYFMDFNQYTSSAADLNLSENSDAGHYHLVLSAAGNSFRLSATASGAQG
FT                   ADSDCVVFSIDQNGTRSALDSSDSTNNDCWD"
FT   gene            702884..703453
FT                   /gene="tppB"
FT                   /locus_tag="ASA_0689"
FT   CDS_pept        702884..703453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tppB"
FT                   /locus_tag="ASA_0689"
FT                   /product="type IV pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88852"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013362"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIY0"
FT                   /protein_id="ABO88852.1"
FT                   /translation="MMRRLTCLAGFSLLEVMIAAVVLSFGLLGLVAMQVQAKFSSYEAR
FT                   QRTIASWLANDMVERLKVNRGAWELQASNTWIVSGGTSSLPSCANENGTMSGCSNADLL
FT                   ALDLYYWRQSLLGSAASGAGTTLRNPTGCIIKGANNGLTVSIFWAGRESSHDGAAAGAV
FT                   DPAITASCGIAGLDLTRRQFVLTTTL"
FT   gene            703492..704436
FT                   /gene="tppC"
FT                   /locus_tag="ASA_0690"
FT   CDS_pept        703492..704436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tppC"
FT                   /locus_tag="ASA_0690"
FT                   /product="type IV pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88853"
FT                   /db_xref="GOA:A4SIY1"
FT                   /db_xref="InterPro:IPR032092"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIY1"
FT                   /protein_id="ABO88853.1"
FT                   /translation="MVIGVFLLGGVLAVFVASRSTTNESFDQSELLENGRIAMRLITQD
FT                   LRWAGFWGDFTGGALTVGDELTLSSGATVANDCLDERNEGSLPSSLFPVRPLWVAHIST
FT                   AGTMSGFACISSPTRVANTDVISIKRLIGNPVMGGLDANRFYMATNTQLAHLFRGNETA
FT                   PSETTMPMRQIWEYQHHVYYLSPNGSGGFELRKRMLTADGGSWLISGALVDGIERMVLL
FT                   FGVDTSNVPDGRIDKFSAIDAVTSQEWGEGRVIAVRVFLLVRSLQASSRYTNNNVYQLG
FT                   NVSVAGNGDGFRRLLLESTVVLRNPMMMAGGGQ"
FT   gene            704433..704870
FT                   /locus_tag="ASA_0691"
FT   CDS_pept        704433..704870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0691"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88854"
FT                   /db_xref="UniProtKB/TrEMBL:A2T199"
FT                   /protein_id="ABO88854.1"
FT                   /translation="MRHSRGVALIVALVILAPLTLIAVVLMQSGGMDLRASGAAAALQQ
FT                   AEHRVEGIIGGAMQQTGLATQIAQMPSVSTATSTVSGSMGNAIMQYRSETVCKRRFDAT
FT                   SKNVIPACRYVELEASQAYGKQGRPMTWIVGVEQPLLKKAE"
FT   gene            704882..708493
FT                   /gene="tapY1"
FT                   /locus_tag="ASA_0692"
FT   CDS_pept        704882..708493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tapY1"
FT                   /locus_tag="ASA_0692"
FT                   /product="type IV pilin biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88855"
FT                   /db_xref="InterPro:IPR008707"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A2T1A0"
FT                   /protein_id="ABO88855.1"
FT                   /translation="MLHHGKLWLMALCALSVPAVAGDAYSDDTELFIYDFSKAGDYRPK
FT                   VLVIFDNSGSMAETMELEREKYNPATVYPSLSRDPDTGNSRNYVYYSTDGSVPAINSNR
FT                   RFRDSINACASSKTPLGTVGYFQSQVWTYVYSSYRNGVPRQGDWETISGENEDDITIVD
FT                   CKQDIQNRTPANPFSGTLEVGSVSDGYPVDKTSNTRGEWYYTGNANDATSGSNTSVTLY
FT                   TANYIRWYYGPTGYAVESRLRIAKDAVKSVISSTPGVDFGLAIFNTNNSTSTNGGRVVR
FT                   RILSNDDMVGTITAEQNLLNTVEGLSATTNTPLCETLYEAYRFYGGQPVLYGKQGGTRD
FT                   KLAEDPEGTYTSPYDKCSNNGYVIYVTDGAPTSDTDADSAVKALMDSLSTDERAAYGST
FT                   VGYGSGSAKSYLAAMAGYMKNKDVNTSSPGKQTVTTFTVGFGDEAISGAGNLLAETARR
FT                   GGGQYYPAVSAEALTQALRSSLLAILRINTSLVSPAITTNNFDRTRSLNNIYYAMFEPD
FT                   TGPRWKGNLKKLTLSGDGYVADVNGLPAIKADGSILEQAQTYWSSERDGNLVAKGGVQA
FT                   MLAEKTNRNLYVVNSVASPKRLDVFNKANLVSIAGSADNLASYMQLASSTELDGQIDWT
FT                   KGLDVDDEDYDGSTTIRPYIVGDPLHSRPLVVNYGCAIPSGQSTCTPDLRILMGTNAGF
FT                   LHMFKDLGSTVDESWAMIPYELLPKQEALRLNAESADHLYGVDASPVALIKDANSNGVL
FT                   KASEGDFVWLFFGLRAGGSSYYALDITNPDAPSLKWVINSQTTGFSLLGETWSVPEVAY
FT                   VPWDASPSNKRLVMVFSGGYDANKSKVGIGSSDSKGMGLYMVDADSGALVFSATPGTGS
FT                   STNKQVTGMVDSMPGPVSTLDSDGDGRTDRIYAGDTGGNIWRLDMPSTSTSAWSVFKFA
FT                   SLGSDDVQANDRRFFTQPVVVRTINKQVTKTVISGEDYFSFKERPFDAVLIGSGDRNRP
FT                   SSESTVQNAYFMLRDYGVVAKNYNTGAPAPITMTDLYDVSVDPLAGVTATNDLLSLRAA
FT                   ITSKSGWKYWLAESGEKSMGAGVVLQGKLYFTSFLPQVQSFEECTIQSIGAMRQYMVDM
FT                   HYGTSFKYVVDQDGNETPQRYVEVNNKVADDLVIHAGDDSKIRIIGGAPGEEVILKDEG
FT                   EGVPERCTGEGECSEGADEAEMDMTPKKIYLYEDEPQ"
FT   gene            complement(708769..709266)
FT                   /gene="tppE"
FT                   /locus_tag="ASA_0693"
FT   CDS_pept        complement(708769..709266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tppE"
FT                   /locus_tag="ASA_0693"
FT                   /product="putative type IV pilus biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88856"
FT                   /db_xref="GOA:A2T1A2"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:A2T1A2"
FT                   /protein_id="ABO88856.1"
FT                   /translation="MKQAGFTLLELMIAIALAVILLGIGIPSLGNLLQDNRANYESERL
FT                   MKHLRFARNQAISDQQTVTACLVNTGNQCVTNSPSQLLVFTDSNSNARLDNGETELSRT
FT                   PVFSADTVLSSTRTRVLFATDGTSLGTNMTISICVSGEPTINLVIAASGRSSKTDTAVI
FT                   CP"
FT   gene            709413..711035
FT                   /gene="nadE"
FT                   /locus_tag="ASA_0694"
FT   CDS_pept        709413..711035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadE"
FT                   /locus_tag="ASA_0694"
FT                   /product="NH(3)-dependent NAD+ synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88857"
FT                   /db_xref="GOA:A4SIY5"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIY5"
FT                   /protein_id="ABO88857.1"
FT                   /translation="MAKALSLMLAQLNLTVGAIEDNCDKVLAAAVQAEQQGADLLVCSE
FT                   LALTGYPPEDLLLRSDLMIRVDAALARIATWQGRCAILVGHPWREGAALYNAASLYEQG
FT                   KLVARYFKQDLPNYGVFDEKRYFTAGTDTCVVPFRGHKLGLLICEDLWQPGPVLAAKAA
FT                   GAELLLTINASPYDQEKPWIRRELMTERCSQTGLPLVYLNQVCGQDELIFDGCSKVFNS
FT                   QGELTHKLAPFAEELALVHFADGQPVKEREPAAPLEPLAETYQALVLAVHDYITKNGFQ
FT                   GAVLGLSGGIDSALTLAIAADAIGADKVQAVMMPFRYTAQMSVEDAKEQAERMGVEFDI
FT                   ISIEPMFEGFMTQLAPLFAGTARDTTEENLQARCRGVLLMALSNKRRRIVLTTGNKSEM
FT                   AVGYATLYGDMAGGFDVLKDVPKTLVFKLCEYRNSVDYVIPQRVIDRPPSAELAPDQVD
FT                   QDSLPPYDILDAILKRYVEEDASVADMVAEGFEEVVVRKVIRLVDLNEYKRRQAAVGPR
FT                   ITARNFGKDRRYPITSGFGKQNW"
FT   gene            711045..711383
FT                   /gene="glnB"
FT                   /locus_tag="ASA_0695"
FT   CDS_pept        711045..711383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnB"
FT                   /locus_tag="ASA_0695"
FT                   /product="nitrogen regulatory protein PII"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88858"
FT                   /db_xref="GOA:A4SIY6"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIY6"
FT                   /protein_id="ABO88858.1"
FT                   /translation="MKKIEAIIKPFKLDDVREALAEIGINGMTVSEVKGFGRQKGHTEL
FT                   YRGAEYMVDFLPKVKVELVVQDEDLDACIEAIQNTARTGKIGDGKIFVCEVERVIRIRT
FT                   GEENEDAI"
FT   gene            711388..712038
FT                   /locus_tag="ASA_0696"
FT   CDS_pept        711388..712038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0696"
FT                   /product="glycoside hydroylase family 23"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88859"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIY7"
FT                   /protein_id="ABO88859.1"
FT                   /translation="MDVPRIDQENEETSLHMSWMRLFVAAGLLIGLTACSTRPPAQPEN
FT                   LCQIFREKPDWHKAALKMNEKWGTPVQVVMAMMYQESSFVHDAQPPMGYFLFIPTGRAS
FT                   SAYGYAQVKDETWDDYQRETGNSWSSRDDFADAIDFMGWYTNKAQRLNGTSKWDAYGQY
FT                   LNYHEGWGGYRRGSYRSKGWLMKTSRKVEARAQRYGAQYRQCKDQLSSGGWFW"
FT   gene            712057..712566
FT                   /gene="luxS"
FT                   /locus_tag="ASA_0697"
FT   CDS_pept        712057..712566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="luxS"
FT                   /locus_tag="ASA_0697"
FT                   /product="autoinducer-2 synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88860"
FT                   /db_xref="GOA:A4SIY8"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR037005"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SIY8"
FT                   /protein_id="ABO88860.1"
FT                   /translation="MPLLDSFTVDHTRMEAPAVRVAKTMQTPNKDTITVFDLRFCVPNQ
FT                   EILSERGIHTLEHLFAGFMRDHLNGNGVEIIDISPMGCRTGFYMSLIGAPDEARVGAAW
FT                   QAAMSDVLTVQEQAKIPELNEYQCGTFSMHSLEEAHEIARNVLARGIGVNHNDELALPE
FT                   EKLKSL"
FT   gene            complement(712629..713651)
FT                   /locus_tag="ASA_0698"
FT   CDS_pept        complement(712629..713651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0698"
FT                   /product="GGDEF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88861"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIY9"
FT                   /protein_id="ABO88861.1"
FT                   /translation="MSKDSFAQSAAYLKQAVPLMIKYQIPTTPDNYTLWYNYVSASMPE
FT                   LNQAIDQAIKLQGTCSLTTCERLYHQHLAAQDEQQMEAMKLSLAAMANELGHTMQDAIS
FT                   DTGMFQEMLDKSFDRLSLIDDEGLSLDDTMGILRDLVRESRDVRMSTMHFRNQLSNAEK
FT                   EIKELREALNETRKLANEDALTSLLNRRAFDLEIDGLIRSKQTFSLILSDIDRFKNFND
FT                   EYGHLLGDQVLRAFSKRLRETCKEGVTAYRLGGEEFALLVPMRNLALSRQMAESLRRAI
FT                   EKMSILDRKSGRRIDHITASFGVGEYNGQETGDALVERTDKLLYKAKELGRNRVMPLPS
FT                   "
FT   gene            713786..716179
FT                   /gene="rnr"
FT                   /locus_tag="ASA_0699"
FT   CDS_pept        713786..716179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnr"
FT                   /locus_tag="ASA_0699"
FT                   /product="ribonuclease R"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88862"
FT                   /db_xref="GOA:A4SIZ0"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR013668"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIZ0"
FT                   /protein_id="ABO88862.1"
FT                   /translation="MSQKDPFLQREAEKYENPIASREMLLELIKGHEKPMTREELAKAL
FT                   KLTDEEPLEALRRRLRAMERDGQLVFTRNQCYALPDRLNLVKGYVLGHKDGFGFLRPEG
FT                   GGPDLYLNNREMQRLMHGDYALVQPTEIDRKGRQEARLVRLLKSREADIVGRYFVENGV
FT                   GFVVPDDSRIGEDIIIPEGENKGARQSQVVVVRINQRANSRINAVGTVLDVLGENMAPG
FT                   MEIEIALRTHGIPHTWPEEVTKEVAGLGEQVPEKAKEGRIDLRALPLVTIDGEDARDFD
FT                   DAVFCEAKRGGGWRLWVAIADVSAYVKPGTALDAEAYQRGNSVYFPEFVVPMLPEVLSN
FT                   GLCSLNPQVDRLCMVCEMTISAAGRMSGYKFYEAVMNSHARMTYSKVAAILDGDPKLRQ
FT                   QYDPLVGHIEELNNLYKALKHARHQRGAVEFESEETRFIFNAQRKIDQIVPLVRNDAHK
FT                   IIEECMIQANVAAARYIEKNEAFALFRVHDRPGEERLTGFRDFLAELGLELKGGLEPEP
FT                   KDFAELAAKFEGRPDAELLSTMLLRSMRQAVYQADNIGHFGLALKSYAHFTSPIRRYPD
FT                   LILHRAIKYQAAKEQQPNLRHKWTPSGGYHYQLEEVDPMGEHCSMTERRADDATRDVAD
FT                   WLKCEYMLDHVGDEFDGVIASVTGFGFFVRLAEIHIDGLVHVSTLTNDYYQFDPLHMQL
FT                   IGENFRRRYRLGDKVRVKVMGVNLDDRKIDFVMVEEPLQATGKNAKEMARKQAEIKSEK
FT                   AKSAQRHEKRKEGKNIGKSDKGGRAKPSNRRPSKKAHDKAKSTK"
FT   gene            716176..716925
FT                   /gene="rlmB"
FT                   /locus_tag="ASA_0700"
FT   CDS_pept        716176..716925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlmB"
FT                   /locus_tag="ASA_0700"
FT                   /product="23S rRNA (guanosine-2'-O-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88863"
FT                   /db_xref="GOA:A4SIZ1"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR024915"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIZ1"
FT                   /protein_id="ABO88863.1"
FT                   /translation="MSTELIYGIHAVSALLERTPERFIEVWALKGRDDDRLHPLLAEME
FT                   SLGLKVQSVNRKTLDDKAEGNNHQGIMAKVIEAPKLAEHDLASLLDNLAEQKAQPFLLV
FT                   LDGVTDPHNLGACLRSADAAGVHAVIVPRDKASGLTSVVRKVACGAAEVVPLIQVTNLA
FT                   RSLRELKDRGVWIVGTAGEADHDVYQAKLTGPMALVMGAEGKGMRRLTREHCDELVSIP
FT                   MAGAVSSLNVSVATGVCLFEAVRQRRA"
FT   gene            716935..717501
FT                   /locus_tag="ASA_0701"
FT   CDS_pept        716935..717501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0701"
FT                   /product="transcription regulator, Crp family"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88864"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIZ2"
FT                   /protein_id="ABO88864.1"
FT                   /translation="MDRPPFSRDQVTNEQEAARLLSFARPLTLSPRTCLWHAGDKPDLL
FT                   VKVEQGLLRAKVVLVDGREYIKEFYWEGDEFIDFHHLLSGEPTRYSVEALEPCRLQLFN
FT                   LRDLRQLPCWSAWYHHLLAVQLRIKEEKELLLLTESPQARYQHFLHCFPVLDARVPDHQ
FT                   IAAYLGITPISLSRIRKRLKDLNKG"
FT   gene            717557..718006
FT                   /locus_tag="ASA_0702"
FT   CDS_pept        717557..718006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0702"
FT                   /product="acetyltransferase, gnat family"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88865"
FT                   /db_xref="GOA:A4SIZ3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIZ3"
FT                   /protein_id="ABO88865.1"
FT                   /translation="MNWSLKSFEQLDVNELYELLVLRSRVFVVEQTCVFLDLDGVDKRP
FT                   DVQHLLGWQDGVLVAYARLMAPGVAKASQVVIGRVVTSPEARGDGLGHRLMQQALVECE
FT                   QLWPGVSIYLGAQAHLQGFYGRHGFTAVGEPYLEDDIPHIGMTSS"
FT   gene            718224..719084
FT                   /locus_tag="ASA_0703"
FT   CDS_pept        718224..719084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0703"
FT                   /product="transporter, drug/metabolite exporter family"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88866"
FT                   /db_xref="GOA:A4SIZ4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIZ4"
FT                   /protein_id="ABO88866.1"
FT                   /translation="MELLRKRFALDLQTFAIITLVLGNLAQAFSDVLVKLIGPGFSPFQ
FT                   YMFLRQLLTLLVLLPFMLRVPRAAWGLGAWKWHLLRGHLCLLGGGGMMLALTQLPLATA
FT                   NAIFYVSPLLTLPLAAWLLKEKINSRVWLLGGMGLLGVVFVLKPGDFHLAGLGALVTAF
FT                   TLALFNVTGRKLPAGISVVATLFWANLLALPLTAGLAVNQWQPVDWHLLALIGGSGVMQ
FT                   LLYHASCIYAYRQVEANRIAATEYSGLMFVVLMGIWLFGEIPAWNLWVGVSFILLAIYW
FT                   QRRLR"
FT   gene            719222..720001
FT                   /locus_tag="ASA_0704"
FT   CDS_pept        719222..720001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0704"
FT                   /product="drug/metabolite transporter (DMT) superfamily
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88867"
FT                   /db_xref="GOA:A4SIZ5"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIZ5"
FT                   /protein_id="ABO88867.1"
FT                   /translation="MTPTIFAAILLAALLHALWNALAKRQAEGRVSVLLVSLCSGLFAA
FT                   PFLPLVGLPVPAEYPWLALSILLHCGYCLFLGRAYRLGEFGQIYPLARGSAPLVTLLFG
FT                   ALLLGEVPGVLAVAGALVLVSGVLLMAWRGGIKLASGALRAVLITALFTAAYTLSDGAG
FT                   ARSAGAPLRYTLWLFALTALMMPLLMRWQSRTAWRALDLAAWRTGALGGALSLLAYGRR
FT                   PSGWWRRCARAACCLPCCSPGAGWGRHWGGYDCAPPW"
FT   gene            complement(720082..720929)
FT                   /pseudo
FT                   /locus_tag="ASA_0705"
FT                   /note="Predicted metal-dependent hydrolase; frameshift due
FT                   to 1 bp deletion"
FT   gene            complement(721037..722260)
FT                   /gene="mntH"
FT                   /locus_tag="ASA_0706"
FT   CDS_pept        complement(721037..722260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mntH"
FT                   /locus_tag="ASA_0706"
FT                   /product="NRAMP family manganese transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88868"
FT                   /db_xref="GOA:A4SIZ6"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:A4SIZ6"
FT                   /protein_id="ABO88868.1"
FT                   /translation="MQSALTTAIPARKFKLTLLGPAFIAAIGYIDPGNFATNIQAGSTF
FT                   GYQLLWVVVWANLMAMLVQTLSAKLGIVTGKNLAEHIRDRLPKPAVWAYWVQAEIIAMA
FT                   TDLAEFIGAAVGFKLLLGVTLLEGAGITAVVTWGILMLQSRGQKPLEFVVGGLLLFVAA
FT                   AYIVELVFSRPHLPSLLEGALFPGLPNSEAVYLAAGVLGATVMPHVIYLHSALTQHTQD
FT                   QGTVPQRLHTTRVDVAIAMTIAGFVNLAMMAMAAAAFHSSGNQQVAELESAYQTLTPLL
FT                   GQAAATLFGLSLVASGISSTVVGTLAGQVVMQGFVRFTIPLWLRRAITMAPAFVVIAMG
FT                   LNTTEILVLSQVVLSFGIALALIPLLILTGDRALMGEYRNHPVTQAVGRLIVALVIGLN
FT                   AYLLVAMI"
FT   gene            722498..722887
FT                   /gene="rpsF"
FT                   /locus_tag="ASA_0707"
FT   CDS_pept        722498..722887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="ASA_0707"
FT                   /product="ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0707"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88869"
FT                   /db_xref="GOA:A4SIZ7"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SIZ7"
FT                   /protein_id="ABO88869.1"
FT                   /translation="MRHYEIVFMVHPDQSEQVPGMIERYTGAITTAGGTIHRMEDWGRR
FT                   QLAYPIDKLHKAHYVLMNVEAEQAVIDELETNFRFNDAVIRNMIMRTKHAVTEVSPMAK
FT                   AKEERFVRRDDERREDTVEAASSEE"
FT   gene            722918..723148
FT                   /gene="rpsR"
FT                   /locus_tag="ASA_0708"
FT   CDS_pept        722918..723148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="ASA_0708"
FT                   /product="ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88870"
FT                   /db_xref="GOA:A4SIZ8"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SIZ8"
FT                   /protein_id="ABO88870.1"
FT                   /translation="MARYFRRRKFCRFTAENVTEIDYKDIVTLKNYVTESGKIVPSRIT
FT                   GTRAKYQRQLARAIKRARYLALLPYTDLHNK"
FT   gene            723198..723644
FT                   /gene="rplI"
FT                   /locus_tag="ASA_0709"
FT   CDS_pept        723198..723644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="ASA_0709"
FT                   /product="ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88871"
FT                   /db_xref="GOA:A4SIZ9"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SIZ9"
FT                   /protein_id="ABO88871.1"
FT                   /translation="MQVILLDKIAKLGGLGDQVAVKAGYARNYLIPQGKAVMATKANIE
FT                   TFDARRAELEAKLAAGKAAAEERAAKLGELAAVVIASKAGDEGKLFGSIGTRDVADAIT
FT                   AAGVAVAKSEVRMGNVLRNTGEYEVVVQLHADVKATVQVQVVAL"
FT   gene            723744..724487
FT                   /gene="fnr"
FT                   /locus_tag="ASA_0710"
FT   CDS_pept        723744..724487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fnr"
FT                   /locus_tag="ASA_0710"
FT                   /product="ferredoxin--NADP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88872"
FT                   /db_xref="GOA:A4SJ00"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A4SJ00"
FT                   /protein_id="ABO88872.1"
FT                   /translation="MAAWVEGRVIERIEWTPTLFSLRVAAELAPYKAGQFTKLALAQGE
FT                   RRIQRAYSFVNPPSAPYHEFYLVEIPDGELTPSLGSLQEGDTLLVQSQATGFLILDEVP
FT                   SGRDLWLLSTGTAIGPFLSMLADGEAFERFENLVLVHGVRRGEELSYQGLIASFAEQHG
FT                   ARFHYVPFVSREGWSGAMAGRIPAAIADGRLQARVGLAFSPEQSQVLICGNPAMVKETQ
FT                   QTLLELGLAKNLRRAPGNISAENYW"
FT   gene            complement(724539..724901)
FT                   /locus_tag="ASA_0711"
FT   CDS_pept        complement(724539..724901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASA_0711"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASA_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ABO88873"
FT                   /db_xref="UniProtKB/TrEMBL:A4SJ01"
FT