(data stored in ACNUC7421 zone)

EMBL: CP000647

ID   CP000647; SV 1; circular; genomic DNA; STD; PRO; 5315120 BP.
XX
AC   CP000647;
XX
PR   Project:PRJNA31;
XX
DT   06-JUL-2007 (Rel. 92, Created)
DT   24-JUN-2016 (Rel. 129, Last updated, Version 10)
XX
DE   Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete genome.
XX
KW   .
XX
OS   Klebsiella pneumoniae subsp. pneumoniae MGH 78578
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Klebsiella.
XX
RN   [1]
RP   1-5315120
RX   DOI; 10.1038/35101614.
RX   PUBMED; 11677609.
RA   McClelland M., Sanderson K.E., Spieth J., Clifton S.W., Latreille P.,
RA   Courtney L., Porwollik S., Ali J., Dante M., Du F., Hou S., Layman D.,
RA   Leonard S., Nguyen C., Scott K., Holmes A., Grewal N., Mulvaney E.,
RA   Ryan E., Sun H., Florea L., Miller W., Stoneking T., Nhan M., Waterston R.,
RA   Wilson R.K.;
RT   "Complete genome sequence of Salmonella enterica serovar Typhimurium LT2";
RL   Nature 413(6858):852-856(2001).
XX
RN   [2]
RP   1-5315120
RG   The Klebsiella pneumonia Genome Sequencing Project
RA   McClelland M., Sanderson E.K., Spieth J., Clifton W.S., Latreille P.,
RA   Sabo A., Pepin K., Bhonagiri V., Porwollik S., Ali J., Wilson R.K.;
RT   ;
RL   Submitted (06-SEP-2006) to the INSDC.
RL   Genetics, Genome Sequencing Center, 4444 Forest Park Parkway, St. Louis, MO
RL   63108, USA
XX
DR   MD5; ba2c536ce9e72c87dff9a80054f9da1e.
DR   BioSample; SAMN02603941.
DR   EnsemblGenomes-Gn; EBG00001179770.
DR   EnsemblGenomes-Gn; EBG00001179771.
DR   EnsemblGenomes-Gn; EBG00001179772.
DR   EnsemblGenomes-Gn; EBG00001179773.
DR   EnsemblGenomes-Gn; EBG00001179774.
DR   EnsemblGenomes-Gn; EBG00001179775.
DR   EnsemblGenomes-Gn; EBG00001179776.
DR   EnsemblGenomes-Gn; EBG00001179777.
DR   EnsemblGenomes-Gn; EBG00001179778.
DR   EnsemblGenomes-Gn; EBG00001179779.
DR   EnsemblGenomes-Gn; EBG00001179780.
DR   EnsemblGenomes-Gn; EBG00001179781.
DR   EnsemblGenomes-Gn; EBG00001179782.
DR   EnsemblGenomes-Gn; EBG00001179783.
DR   EnsemblGenomes-Gn; EBG00001179784.
DR   EnsemblGenomes-Gn; EBG00001179785.
DR   EnsemblGenomes-Gn; EBG00001179786.
DR   EnsemblGenomes-Gn; EBG00001179787.
DR   EnsemblGenomes-Gn; EBG00001179788.
DR   EnsemblGenomes-Gn; EBG00001179789.
DR   EnsemblGenomes-Gn; EBG00001179790.
DR   EnsemblGenomes-Gn; EBG00001179791.
DR   EnsemblGenomes-Gn; EBG00001179792.
DR   EnsemblGenomes-Gn; EBG00001179793.
DR   EnsemblGenomes-Gn; EBG00001179794.
DR   EnsemblGenomes-Gn; EBG00001179795.
DR   EnsemblGenomes-Gn; EBG00001179796.
DR   EnsemblGenomes-Gn; EBG00001179797.
DR   EnsemblGenomes-Gn; EBG00001179798.
DR   EnsemblGenomes-Gn; EBG00001179799.
DR   EnsemblGenomes-Gn; EBG00001179800.
DR   EnsemblGenomes-Gn; EBG00001179801.
DR   EnsemblGenomes-Gn; EBG00001179802.
DR   EnsemblGenomes-Gn; EBG00001179803.
DR   EnsemblGenomes-Gn; EBG00001179804.
DR   EnsemblGenomes-Gn; EBG00001179805.
DR   EnsemblGenomes-Gn; EBG00001179806.
DR   EnsemblGenomes-Gn; EBG00001179807.
DR   EnsemblGenomes-Gn; EBG00001179808.
DR   EnsemblGenomes-Gn; EBG00001179809.
DR   EnsemblGenomes-Gn; EBG00001179810.
DR   EnsemblGenomes-Gn; EBG00001179811.
DR   EnsemblGenomes-Gn; EBG00001179812.
DR   EnsemblGenomes-Gn; EBG00001179813.
DR   EnsemblGenomes-Gn; EBG00001179814.
DR   EnsemblGenomes-Gn; EBG00001179815.
DR   EnsemblGenomes-Gn; EBG00001179816.
DR   EnsemblGenomes-Gn; EBG00001179817.
DR   EnsemblGenomes-Gn; EBG00001179818.
DR   EnsemblGenomes-Gn; EBG00001179819.
DR   EnsemblGenomes-Gn; EBG00001179820.
DR   EnsemblGenomes-Gn; EBG00001179821.
DR   EnsemblGenomes-Gn; EBG00001179822.
DR   EnsemblGenomes-Gn; EBG00001179823.
DR   EnsemblGenomes-Gn; EBG00001179824.
DR   EnsemblGenomes-Gn; EBG00001179825.
DR   EnsemblGenomes-Gn; EBG00001179826.
DR   EnsemblGenomes-Gn; EBG00001179827.
DR   EnsemblGenomes-Gn; EBG00001179828.
DR   EnsemblGenomes-Gn; EBG00001179829.
DR   EnsemblGenomes-Gn; EBG00001179830.
DR   EnsemblGenomes-Gn; EBG00001179831.
DR   EnsemblGenomes-Gn; EBG00001179832.
DR   EnsemblGenomes-Gn; EBG00001179833.
DR   EnsemblGenomes-Gn; EBG00001179834.
DR   EnsemblGenomes-Gn; EBG00001179835.
DR   EnsemblGenomes-Gn; EBG00001179836.
DR   EnsemblGenomes-Gn; EBG00001179837.
DR   EnsemblGenomes-Gn; EBG00001179838.
DR   EnsemblGenomes-Gn; EBG00001179839.
DR   EnsemblGenomes-Gn; EBG00001179840.
DR   EnsemblGenomes-Gn; EBG00001179841.
DR   EnsemblGenomes-Gn; EBG00001179842.
DR   EnsemblGenomes-Gn; EBG00001179843.
DR   EnsemblGenomes-Gn; EBG00001179844.
DR   EnsemblGenomes-Gn; EBG00001179845.
DR   EnsemblGenomes-Gn; EBG00001179846.
DR   EnsemblGenomes-Gn; EBG00001179847.
DR   EnsemblGenomes-Gn; EBG00001179848.
DR   EnsemblGenomes-Gn; EBG00001179849.
DR   EnsemblGenomes-Gn; EBG00001179850.
DR   EnsemblGenomes-Gn; EBG00001179851.
DR   EnsemblGenomes-Gn; EBG00001179852.
DR   EnsemblGenomes-Gn; EBG00001179853.
DR   EnsemblGenomes-Gn; EBG00001179854.
DR   EnsemblGenomes-Gn; EBG00001179855.
DR   EnsemblGenomes-Gn; EBG00001179856.
DR   EnsemblGenomes-Gn; EBG00001179857.
DR   EnsemblGenomes-Gn; EBG00001179858.
DR   EnsemblGenomes-Gn; EBG00001179859.
DR   EnsemblGenomes-Gn; EBG00001179860.
DR   EnsemblGenomes-Gn; EBG00001179861.
DR   EnsemblGenomes-Gn; EBG00001179862.
DR   EnsemblGenomes-Gn; EBG00001179863.
DR   EnsemblGenomes-Gn; EBG00001179864.
DR   EnsemblGenomes-Gn; EBG00001179865.
DR   EnsemblGenomes-Gn; EBG00001179866.
DR   EnsemblGenomes-Gn; EBG00001179867.
DR   EnsemblGenomes-Gn; EBG00001179868.
DR   EnsemblGenomes-Gn; EBG00001179869.
DR   EnsemblGenomes-Gn; EBG00001179870.
DR   EnsemblGenomes-Gn; EBG00001179871.
DR   EnsemblGenomes-Gn; EBG00001179872.
DR   EnsemblGenomes-Gn; EBG00001179873.
DR   EnsemblGenomes-Gn; EBG00001179874.
DR   EnsemblGenomes-Gn; EBG00001179875.
DR   EnsemblGenomes-Gn; EBG00001179876.
DR   EnsemblGenomes-Gn; EBG00001179877.
DR   EnsemblGenomes-Gn; EBG00001179878.
DR   EnsemblGenomes-Gn; EBG00001179879.
DR   EnsemblGenomes-Gn; EBG00001179880.
DR   EnsemblGenomes-Gn; EBG00001179881.
DR   EnsemblGenomes-Gn; EBG00001179882.
DR   EnsemblGenomes-Gn; EBG00001179883.
DR   EnsemblGenomes-Gn; EBG00001179884.
DR   EnsemblGenomes-Gn; EBG00001179885.
DR   EnsemblGenomes-Gn; EBG00001179886.
DR   EnsemblGenomes-Gn; EBG00001179887.
DR   EnsemblGenomes-Gn; EBG00001179888.
DR   EnsemblGenomes-Gn; EBG00001179889.
DR   EnsemblGenomes-Gn; EBG00001179890.
DR   EnsemblGenomes-Gn; EBG00001179891.
DR   EnsemblGenomes-Gn; EBG00001179892.
DR   EnsemblGenomes-Gn; EBG00001179893.
DR   EnsemblGenomes-Gn; EBG00001179894.
DR   EnsemblGenomes-Gn; EBG00001179895.
DR   EnsemblGenomes-Gn; EBG00001179896.
DR   EnsemblGenomes-Gn; EBG00001179897.
DR   EnsemblGenomes-Gn; EBG00001179898.
DR   EnsemblGenomes-Gn; EBG00001179899.
DR   EnsemblGenomes-Gn; EBG00001179900.
DR   EnsemblGenomes-Gn; EBG00001179901.
DR   EnsemblGenomes-Gn; EBG00001179902.
DR   EnsemblGenomes-Gn; EBG00001179903.
DR   EnsemblGenomes-Gn; EBG00001179904.
DR   EnsemblGenomes-Gn; EBG00001179905.
DR   EnsemblGenomes-Gn; EBG00001179906.
DR   EnsemblGenomes-Gn; EBG00001179907.
DR   EnsemblGenomes-Gn; EBG00001179908.
DR   EnsemblGenomes-Gn; EBG00001179909.
DR   EnsemblGenomes-Gn; EBG00001179910.
DR   EnsemblGenomes-Gn; EBG00001179911.
DR   EnsemblGenomes-Gn; EBG00001179912.
DR   EnsemblGenomes-Gn; EBG00001179913.
DR   EnsemblGenomes-Gn; EBG00001179914.
DR   EnsemblGenomes-Gn; EBG00001179915.
DR   EnsemblGenomes-Gn; EBG00001179916.
DR   EnsemblGenomes-Gn; EBG00001179917.
DR   EnsemblGenomes-Gn; EBG00001179918.
DR   EnsemblGenomes-Gn; EBG00001179919.
DR   EnsemblGenomes-Gn; EBG00001179920.
DR   EnsemblGenomes-Gn; EBG00001179921.
DR   EnsemblGenomes-Gn; EBG00001179922.
DR   EnsemblGenomes-Gn; EBG00001179923.
DR   EnsemblGenomes-Gn; EBG00001179924.
DR   EnsemblGenomes-Gn; EBG00001179925.
DR   EnsemblGenomes-Gn; EBG00001179926.
DR   EnsemblGenomes-Gn; EBG00001179927.
DR   EnsemblGenomes-Gn; EBG00001179928.
DR   EnsemblGenomes-Gn; EBG00001179929.
DR   EnsemblGenomes-Gn; EBG00001179930.
DR   EnsemblGenomes-Gn; EBG00001179931.
DR   EnsemblGenomes-Gn; EBG00001179932.
DR   EnsemblGenomes-Gn; EBG00001179933.
DR   EnsemblGenomes-Gn; EBG00001179934.
DR   EnsemblGenomes-Gn; EBG00001179935.
DR   EnsemblGenomes-Gn; EBG00001179936.
DR   EnsemblGenomes-Gn; EBG00001179937.
DR   EnsemblGenomes-Gn; EBG00001179938.
DR   EnsemblGenomes-Gn; EBG00001179939.
DR   EnsemblGenomes-Gn; EBG00001179940.
DR   EnsemblGenomes-Gn; EBG00001179941.
DR   EnsemblGenomes-Gn; EBG00001179942.
DR   EnsemblGenomes-Gn; EBG00001179943.
DR   EnsemblGenomes-Gn; EBG00001179944.
DR   EnsemblGenomes-Gn; EBG00001179945.
DR   EnsemblGenomes-Gn; EBG00001179946.
DR   EnsemblGenomes-Gn; EBG00001179947.
DR   EnsemblGenomes-Gn; EBG00001179948.
DR   EnsemblGenomes-Gn; EBG00001179949.
DR   EnsemblGenomes-Gn; EBG00001179950.
DR   EnsemblGenomes-Gn; EBG00001179951.
DR   EnsemblGenomes-Gn; EBG00001179952.
DR   EnsemblGenomes-Gn; EBG00001179953.
DR   EnsemblGenomes-Gn; EBG00001179954.
DR   EnsemblGenomes-Gn; EBG00001179955.
DR   EnsemblGenomes-Gn; EBG00001179956.
DR   EnsemblGenomes-Gn; EBG00001179957.
DR   EnsemblGenomes-Gn; EBG00001179958.
DR   EnsemblGenomes-Gn; KPN_00215.
DR   EnsemblGenomes-Gn; KPN_00216.
DR   EnsemblGenomes-Gn; KPN_00217.
DR   EnsemblGenomes-Gn; KPN_00218.
DR   EnsemblGenomes-Gn; KPN_00219.
DR   EnsemblGenomes-Gn; KPN_00220.
DR   EnsemblGenomes-Gn; KPN_00231.
DR   EnsemblGenomes-Gn; KPN_00279.
DR   EnsemblGenomes-Gn; KPN_00486.
DR   EnsemblGenomes-Gn; KPN_00688.
DR   EnsemblGenomes-Gn; KPN_00689.
DR   EnsemblGenomes-Gn; KPN_00690.
DR   EnsemblGenomes-Gn; KPN_00691.
DR   EnsemblGenomes-Gn; KPN_00692.
DR   EnsemblGenomes-Gn; KPN_00693.
DR   EnsemblGenomes-Gn; KPN_00694.
DR   EnsemblGenomes-Gn; KPN_00747.
DR   EnsemblGenomes-Gn; KPN_00748.
DR   EnsemblGenomes-Gn; KPN_00749.
DR   EnsemblGenomes-Gn; KPN_00750.
DR   EnsemblGenomes-Gn; KPN_00751.
DR   EnsemblGenomes-Gn; KPN_00752.
DR   EnsemblGenomes-Gn; KPN_00753.
DR   EnsemblGenomes-Gn; KPN_01008.
DR   EnsemblGenomes-Gn; KPN_01049.
DR   EnsemblGenomes-Gn; KPN_01055.
DR   EnsemblGenomes-Gn; KPN_02005.
DR   EnsemblGenomes-Gn; KPN_02006.
DR   EnsemblGenomes-Gn; KPN_02007.
DR   EnsemblGenomes-Gn; KPN_02207.
DR   EnsemblGenomes-Gn; KPN_02208.
DR   EnsemblGenomes-Gn; KPN_02407.
DR   EnsemblGenomes-Gn; KPN_02408.
DR   EnsemblGenomes-Gn; KPN_02409.
DR   EnsemblGenomes-Gn; KPN_02431.
DR   EnsemblGenomes-Gn; KPN_02433.
DR   EnsemblGenomes-Gn; KPN_02438.
DR   EnsemblGenomes-Gn; KPN_02446.
DR   EnsemblGenomes-Gn; KPN_02448.
DR   EnsemblGenomes-Gn; KPN_02626.
DR   EnsemblGenomes-Gn; KPN_02729.
DR   EnsemblGenomes-Gn; KPN_02746.
DR   EnsemblGenomes-Gn; KPN_02747.
DR   EnsemblGenomes-Gn; KPN_02751.
DR   EnsemblGenomes-Gn; KPN_02752.
DR   EnsemblGenomes-Gn; KPN_02753.
DR   EnsemblGenomes-Gn; KPN_02754.
DR   EnsemblGenomes-Gn; KPN_02911.
DR   EnsemblGenomes-Gn; KPN_02912.
DR   EnsemblGenomes-Gn; KPN_02913.
DR   EnsemblGenomes-Gn; KPN_02914.
DR   EnsemblGenomes-Gn; KPN_03023.
DR   EnsemblGenomes-Gn; KPN_03024.
DR   EnsemblGenomes-Gn; KPN_03025.
DR   EnsemblGenomes-Gn; KPN_03026.
DR   EnsemblGenomes-Gn; KPN_03027.
DR   EnsemblGenomes-Gn; KPN_03165.
DR   EnsemblGenomes-Gn; KPN_03166.
DR   EnsemblGenomes-Gn; KPN_03167.
DR   EnsemblGenomes-Gn; KPN_03315.
DR   EnsemblGenomes-Gn; KPN_03399.
DR   EnsemblGenomes-Gn; KPN_03476.
DR   EnsemblGenomes-Gn; KPN_03579.
DR   EnsemblGenomes-Gn; KPN_03584.
DR   EnsemblGenomes-Gn; KPN_03675.
DR   EnsemblGenomes-Gn; KPN_03676.
DR   EnsemblGenomes-Gn; KPN_03677.
DR   EnsemblGenomes-Gn; KPN_03678.
DR   EnsemblGenomes-Gn; KPN_03679.
DR   EnsemblGenomes-Gn; KPN_03902.
DR   EnsemblGenomes-Gn; KPN_04020.
DR   EnsemblGenomes-Gn; KPN_04161.
DR   EnsemblGenomes-Gn; KPN_04162.
DR   EnsemblGenomes-Gn; KPN_04163.
DR   EnsemblGenomes-Gn; KPN_04164.
DR   EnsemblGenomes-Gn; KPN_04257.
DR   EnsemblGenomes-Gn; KPN_04258.
DR   EnsemblGenomes-Gn; KPN_04259.
DR   EnsemblGenomes-Gn; KPN_04260.
DR   EnsemblGenomes-Gn; KPN_04261.
DR   EnsemblGenomes-Gn; KPN_04262.
DR   EnsemblGenomes-Gn; KPN_04263.
DR   EnsemblGenomes-Gn; KPN_04297.
DR   EnsemblGenomes-Gn; KPN_04298.
DR   EnsemblGenomes-Gn; KPN_04299.
DR   EnsemblGenomes-Gn; KPN_04300.
DR   EnsemblGenomes-Gn; KPN_04345.
DR   EnsemblGenomes-Gn; KPN_04346.
DR   EnsemblGenomes-Gn; KPN_04347.
DR   EnsemblGenomes-Gn; KPN_04348.
DR   EnsemblGenomes-Gn; KPN_04349.
DR   EnsemblGenomes-Gn; KPN_04353.
DR   EnsemblGenomes-Gn; KPN_04354.
DR   EnsemblGenomes-Gn; KPN_04355.
DR   EnsemblGenomes-Gn; KPN_04356.
DR   EnsemblGenomes-Gn; KPN_04389.
DR   EnsemblGenomes-Gn; KPN_04390.
DR   EnsemblGenomes-Gn; KPN_04391.
DR   EnsemblGenomes-Gn; KPN_04392.
DR   EnsemblGenomes-Gn; KPN_04523.
DR   EnsemblGenomes-Gn; KPN_04561.
DR   EnsemblGenomes-Gn; KPN_04562.
DR   EnsemblGenomes-Gn; KPN_04563.
DR   EnsemblGenomes-Gn; KPN_04686.
DR   EnsemblGenomes-Gn; KPN_04744.
DR   EnsemblGenomes-Gn; KPN_04745.
DR   EnsemblGenomes-Gn; KPN_04746.
DR   EnsemblGenomes-Gn; KPN_04747.
DR   EnsemblGenomes-Gn; KPN_04824.
DR   EnsemblGenomes-Gn; KPN_04825.
DR   EnsemblGenomes-Gn; KPN_04826.
DR   EnsemblGenomes-Tr; EBT00001758142.
DR   EnsemblGenomes-Tr; EBT00001758143.
DR   EnsemblGenomes-Tr; EBT00001758144.
DR   EnsemblGenomes-Tr; EBT00001758145.
DR   EnsemblGenomes-Tr; EBT00001758146.
DR   EnsemblGenomes-Tr; EBT00001758147.
DR   EnsemblGenomes-Tr; EBT00001758148.
DR   EnsemblGenomes-Tr; EBT00001758149.
DR   EnsemblGenomes-Tr; EBT00001758150.
DR   EnsemblGenomes-Tr; EBT00001758151.
DR   EnsemblGenomes-Tr; EBT00001758152.
DR   EnsemblGenomes-Tr; EBT00001758153.
DR   EnsemblGenomes-Tr; EBT00001758154.
DR   EnsemblGenomes-Tr; EBT00001758155.
DR   EnsemblGenomes-Tr; EBT00001758156.
DR   EnsemblGenomes-Tr; EBT00001758157.
DR   EnsemblGenomes-Tr; EBT00001758158.
DR   EnsemblGenomes-Tr; EBT00001758159.
DR   EnsemblGenomes-Tr; EBT00001758160.
DR   EnsemblGenomes-Tr; EBT00001758161.
DR   EnsemblGenomes-Tr; EBT00001758162.
DR   EnsemblGenomes-Tr; EBT00001758163.
DR   EnsemblGenomes-Tr; EBT00001758164.
DR   EnsemblGenomes-Tr; EBT00001758165.
DR   EnsemblGenomes-Tr; EBT00001758166.
DR   EnsemblGenomes-Tr; EBT00001758167.
DR   EnsemblGenomes-Tr; EBT00001758168.
DR   EnsemblGenomes-Tr; EBT00001758169.
DR   EnsemblGenomes-Tr; EBT00001758170.
DR   EnsemblGenomes-Tr; EBT00001758171.
DR   EnsemblGenomes-Tr; EBT00001758172.
DR   EnsemblGenomes-Tr; EBT00001758173.
DR   EnsemblGenomes-Tr; EBT00001758174.
DR   EnsemblGenomes-Tr; EBT00001758175.
DR   EnsemblGenomes-Tr; EBT00001758176.
DR   EnsemblGenomes-Tr; EBT00001758177.
DR   EnsemblGenomes-Tr; EBT00001758178.
DR   EnsemblGenomes-Tr; EBT00001758179.
DR   EnsemblGenomes-Tr; EBT00001758180.
DR   EnsemblGenomes-Tr; EBT00001758181.
DR   EnsemblGenomes-Tr; EBT00001758182.
DR   EnsemblGenomes-Tr; EBT00001758183.
DR   EnsemblGenomes-Tr; EBT00001758184.
DR   EnsemblGenomes-Tr; EBT00001758185.
DR   EnsemblGenomes-Tr; EBT00001758186.
DR   EnsemblGenomes-Tr; EBT00001758187.
DR   EnsemblGenomes-Tr; EBT00001758188.
DR   EnsemblGenomes-Tr; EBT00001758189.
DR   EnsemblGenomes-Tr; EBT00001758190.
DR   EnsemblGenomes-Tr; EBT00001758191.
DR   EnsemblGenomes-Tr; EBT00001758192.
DR   EnsemblGenomes-Tr; EBT00001758194.
DR   EnsemblGenomes-Tr; EBT00001758196.
DR   EnsemblGenomes-Tr; EBT00001758198.
DR   EnsemblGenomes-Tr; EBT00001758199.
DR   EnsemblGenomes-Tr; EBT00001758201.
DR   EnsemblGenomes-Tr; EBT00001758202.
DR   EnsemblGenomes-Tr; EBT00001758203.
DR   EnsemblGenomes-Tr; EBT00001758205.
DR   EnsemblGenomes-Tr; EBT00001758208.
DR   EnsemblGenomes-Tr; EBT00001758216.
DR   EnsemblGenomes-Tr; EBT00001758224.
DR   EnsemblGenomes-Tr; EBT00001758228.
DR   EnsemblGenomes-Tr; EBT00001758231.
DR   EnsemblGenomes-Tr; EBT00001758233.
DR   EnsemblGenomes-Tr; EBT00001758235.
DR   EnsemblGenomes-Tr; EBT00001758236.
DR   EnsemblGenomes-Tr; EBT00001758238.
DR   EnsemblGenomes-Tr; EBT00001758240.
DR   EnsemblGenomes-Tr; EBT00001758242.
DR   EnsemblGenomes-Tr; EBT00001758244.
DR   EnsemblGenomes-Tr; EBT00001758246.
DR   EnsemblGenomes-Tr; EBT00001758248.
DR   EnsemblGenomes-Tr; EBT00001758250.
DR   EnsemblGenomes-Tr; EBT00001758252.
DR   EnsemblGenomes-Tr; EBT00001758254.
DR   EnsemblGenomes-Tr; EBT00001758256.
DR   EnsemblGenomes-Tr; EBT00001758258.
DR   EnsemblGenomes-Tr; EBT00001758259.
DR   EnsemblGenomes-Tr; EBT00001758260.
DR   EnsemblGenomes-Tr; EBT00001758262.
DR   EnsemblGenomes-Tr; EBT00001758264.
DR   EnsemblGenomes-Tr; EBT00001758265.
DR   EnsemblGenomes-Tr; EBT00001758267.
DR   EnsemblGenomes-Tr; EBT00001758269.
DR   EnsemblGenomes-Tr; EBT00001758270.
DR   EnsemblGenomes-Tr; EBT00001758271.
DR   EnsemblGenomes-Tr; EBT00001758273.
DR   EnsemblGenomes-Tr; EBT00001758275.
DR   EnsemblGenomes-Tr; EBT00001758277.
DR   EnsemblGenomes-Tr; EBT00001758280.
DR   EnsemblGenomes-Tr; EBT00001758284.
DR   EnsemblGenomes-Tr; EBT00001758289.
DR   EnsemblGenomes-Tr; EBT00001758291.
DR   EnsemblGenomes-Tr; EBT00001758293.
DR   EnsemblGenomes-Tr; EBT00001758295.
DR   EnsemblGenomes-Tr; EBT00001758296.
DR   EnsemblGenomes-Tr; EBT00001758299.
DR   EnsemblGenomes-Tr; EBT00001758300.
DR   EnsemblGenomes-Tr; EBT00001758304.
DR   EnsemblGenomes-Tr; EBT00001758305.
DR   EnsemblGenomes-Tr; EBT00001758307.
DR   EnsemblGenomes-Tr; EBT00001758309.
DR   EnsemblGenomes-Tr; EBT00001758311.
DR   EnsemblGenomes-Tr; EBT00001758313.
DR   EnsemblGenomes-Tr; EBT00001758315.
DR   EnsemblGenomes-Tr; EBT00001758317.
DR   EnsemblGenomes-Tr; EBT00001758319.
DR   EnsemblGenomes-Tr; EBT00001758321.
DR   EnsemblGenomes-Tr; EBT00001758323.
DR   EnsemblGenomes-Tr; EBT00001758326.
DR   EnsemblGenomes-Tr; EBT00001758328.
DR   EnsemblGenomes-Tr; EBT00001758330.
DR   EnsemblGenomes-Tr; EBT00001758332.
DR   EnsemblGenomes-Tr; EBT00001758334.
DR   EnsemblGenomes-Tr; EBT00001758336.
DR   EnsemblGenomes-Tr; EBT00001758338.
DR   EnsemblGenomes-Tr; EBT00001758341.
DR   EnsemblGenomes-Tr; EBT00001758343.
DR   EnsemblGenomes-Tr; EBT00001758344.
DR   EnsemblGenomes-Tr; EBT00001758346.
DR   EnsemblGenomes-Tr; EBT00001758348.
DR   EnsemblGenomes-Tr; EBT00001758350.
DR   EnsemblGenomes-Tr; EBT00001758353.
DR   EnsemblGenomes-Tr; EBT00001758355.
DR   EnsemblGenomes-Tr; EBT00001758358.
DR   EnsemblGenomes-Tr; EBT00001758359.
DR   EnsemblGenomes-Tr; EBT00001758361.
DR   EnsemblGenomes-Tr; EBT00001758363.
DR   EnsemblGenomes-Tr; EBT00001758365.
DR   EnsemblGenomes-Tr; EBT00001758367.
DR   EnsemblGenomes-Tr; EBT00001758368.
DR   EnsemblGenomes-Tr; EBT00001758370.
DR   EnsemblGenomes-Tr; EBT00001758372.
DR   EnsemblGenomes-Tr; EBT00001758374.
DR   EnsemblGenomes-Tr; EBT00001758376.
DR   EnsemblGenomes-Tr; EBT00001758378.
DR   EnsemblGenomes-Tr; EBT00001758381.
DR   EnsemblGenomes-Tr; EBT00001758383.
DR   EnsemblGenomes-Tr; EBT00001758385.
DR   EnsemblGenomes-Tr; EBT00001758386.
DR   EnsemblGenomes-Tr; EBT00001758389.
DR   EnsemblGenomes-Tr; EBT00001758390.
DR   EnsemblGenomes-Tr; EBT00001758392.
DR   EnsemblGenomes-Tr; EBT00001758394.
DR   EnsemblGenomes-Tr; EBT00001758396.
DR   EnsemblGenomes-Tr; EBT00001758399.
DR   EnsemblGenomes-Tr; EBT00001758401.
DR   EnsemblGenomes-Tr; EBT00001758403.
DR   EnsemblGenomes-Tr; EBT00001758405.
DR   EnsemblGenomes-Tr; EBT00001758407.
DR   EnsemblGenomes-Tr; EBT00001758409.
DR   EnsemblGenomes-Tr; EBT00001758411.
DR   EnsemblGenomes-Tr; EBT00001758413.
DR   EnsemblGenomes-Tr; EBT00001758415.
DR   EnsemblGenomes-Tr; EBT00001758418.
DR   EnsemblGenomes-Tr; EBT00001758420.
DR   EnsemblGenomes-Tr; EBT00001758422.
DR   EnsemblGenomes-Tr; EBT00001758424.
DR   EnsemblGenomes-Tr; EBT00001758427.
DR   EnsemblGenomes-Tr; EBT00001758429.
DR   EnsemblGenomes-Tr; EBT00001758431.
DR   EnsemblGenomes-Tr; EBT00001758434.
DR   EnsemblGenomes-Tr; EBT00001758436.
DR   EnsemblGenomes-Tr; EBT00001758438.
DR   EnsemblGenomes-Tr; EBT00001758440.
DR   EnsemblGenomes-Tr; EBT00001758442.
DR   EnsemblGenomes-Tr; EBT00001758443.
DR   EnsemblGenomes-Tr; EBT00001758445.
DR   EnsemblGenomes-Tr; EBT00001758447.
DR   EnsemblGenomes-Tr; EBT00001758449.
DR   EnsemblGenomes-Tr; EBT00001758452.
DR   EnsemblGenomes-Tr; EBT00001758454.
DR   EnsemblGenomes-Tr; EBT00001758456.
DR   EnsemblGenomes-Tr; EBT00001758458.
DR   EnsemblGenomes-Tr; EBT00001758460.
DR   EnsemblGenomes-Tr; EBT00001758461.
DR   EnsemblGenomes-Tr; EBT00001758464.
DR   EnsemblGenomes-Tr; EBT00001758466.
DR   EnsemblGenomes-Tr; EBT00001758468.
DR   EnsemblGenomes-Tr; EBT00001758469.
DR   EnsemblGenomes-Tr; EBT00001758471.
DR   EnsemblGenomes-Tr; EBT00001758473.
DR   EnsemblGenomes-Tr; EBT00001758475.
DR   EnsemblGenomes-Tr; EBT00001758477.
DR   EnsemblGenomes-Tr; EBT00001758478.
DR   EnsemblGenomes-Tr; EBT00001758479.
DR   EnsemblGenomes-Tr; EBT00001758480.
DR   EnsemblGenomes-Tr; EBT00001758482.
DR   EnsemblGenomes-Tr; KPN_00215-1.
DR   EnsemblGenomes-Tr; KPN_00216-1.
DR   EnsemblGenomes-Tr; KPN_00217-1.
DR   EnsemblGenomes-Tr; KPN_00218-1.
DR   EnsemblGenomes-Tr; KPN_00219-1.
DR   EnsemblGenomes-Tr; KPN_00220-1.
DR   EnsemblGenomes-Tr; KPN_00231-1.
DR   EnsemblGenomes-Tr; KPN_00279-1.
DR   EnsemblGenomes-Tr; KPN_00486-1.
DR   EnsemblGenomes-Tr; KPN_00688-1.
DR   EnsemblGenomes-Tr; KPN_00689-1.
DR   EnsemblGenomes-Tr; KPN_00690-1.
DR   EnsemblGenomes-Tr; KPN_00691-1.
DR   EnsemblGenomes-Tr; KPN_00692-1.
DR   EnsemblGenomes-Tr; KPN_00693-1.
DR   EnsemblGenomes-Tr; KPN_00694-1.
DR   EnsemblGenomes-Tr; KPN_00747-1.
DR   EnsemblGenomes-Tr; KPN_00748-1.
DR   EnsemblGenomes-Tr; KPN_00749-1.
DR   EnsemblGenomes-Tr; KPN_00750-1.
DR   EnsemblGenomes-Tr; KPN_00751-1.
DR   EnsemblGenomes-Tr; KPN_00752-1.
DR   EnsemblGenomes-Tr; KPN_00753-1.
DR   EnsemblGenomes-Tr; KPN_01008-1.
DR   EnsemblGenomes-Tr; KPN_01049-1.
DR   EnsemblGenomes-Tr; KPN_01055-1.
DR   EnsemblGenomes-Tr; KPN_02005-1.
DR   EnsemblGenomes-Tr; KPN_02006-1.
DR   EnsemblGenomes-Tr; KPN_02007-1.
DR   EnsemblGenomes-Tr; KPN_02207-1.
DR   EnsemblGenomes-Tr; KPN_02208-1.
DR   EnsemblGenomes-Tr; KPN_02407-1.
DR   EnsemblGenomes-Tr; KPN_02408-1.
DR   EnsemblGenomes-Tr; KPN_02409-1.
DR   EnsemblGenomes-Tr; KPN_02431-1.
DR   EnsemblGenomes-Tr; KPN_02433-1.
DR   EnsemblGenomes-Tr; KPN_02438-1.
DR   EnsemblGenomes-Tr; KPN_02446-1.
DR   EnsemblGenomes-Tr; KPN_02448-1.
DR   EnsemblGenomes-Tr; KPN_02626-1.
DR   EnsemblGenomes-Tr; KPN_02729-1.
DR   EnsemblGenomes-Tr; KPN_02746-1.
DR   EnsemblGenomes-Tr; KPN_02747-1.
DR   EnsemblGenomes-Tr; KPN_02751-1.
DR   EnsemblGenomes-Tr; KPN_02752-1.
DR   EnsemblGenomes-Tr; KPN_02753-1.
DR   EnsemblGenomes-Tr; KPN_02754-1.
DR   EnsemblGenomes-Tr; KPN_02911-1.
DR   EnsemblGenomes-Tr; KPN_02912-1.
DR   EnsemblGenomes-Tr; KPN_02913-1.
DR   EnsemblGenomes-Tr; KPN_02914-1.
DR   EnsemblGenomes-Tr; KPN_03023-1.
DR   EnsemblGenomes-Tr; KPN_03024-1.
DR   EnsemblGenomes-Tr; KPN_03025-1.
DR   EnsemblGenomes-Tr; KPN_03026-1.
DR   EnsemblGenomes-Tr; KPN_03027-1.
DR   EnsemblGenomes-Tr; KPN_03165-1.
DR   EnsemblGenomes-Tr; KPN_03166-1.
DR   EnsemblGenomes-Tr; KPN_03167-1.
DR   EnsemblGenomes-Tr; KPN_03315-1.
DR   EnsemblGenomes-Tr; KPN_03399-1.
DR   EnsemblGenomes-Tr; KPN_03476-1.
DR   EnsemblGenomes-Tr; KPN_03579-1.
DR   EnsemblGenomes-Tr; KPN_03584-1.
DR   EnsemblGenomes-Tr; KPN_03675-1.
DR   EnsemblGenomes-Tr; KPN_03676-1.
DR   EnsemblGenomes-Tr; KPN_03677-1.
DR   EnsemblGenomes-Tr; KPN_03678-1.
DR   EnsemblGenomes-Tr; KPN_03679-1.
DR   EnsemblGenomes-Tr; KPN_03902-1.
DR   EnsemblGenomes-Tr; KPN_04020-1.
DR   EnsemblGenomes-Tr; KPN_04161-1.
DR   EnsemblGenomes-Tr; KPN_04162-1.
DR   EnsemblGenomes-Tr; KPN_04163-1.
DR   EnsemblGenomes-Tr; KPN_04164-1.
DR   EnsemblGenomes-Tr; KPN_04257-1.
DR   EnsemblGenomes-Tr; KPN_04258-1.
DR   EnsemblGenomes-Tr; KPN_04259-1.
DR   EnsemblGenomes-Tr; KPN_04260-1.
DR   EnsemblGenomes-Tr; KPN_04261-1.
DR   EnsemblGenomes-Tr; KPN_04262-1.
DR   EnsemblGenomes-Tr; KPN_04263-1.
DR   EnsemblGenomes-Tr; KPN_04297-1.
DR   EnsemblGenomes-Tr; KPN_04298-1.
DR   EnsemblGenomes-Tr; KPN_04299-1.
DR   EnsemblGenomes-Tr; KPN_04300-1.
DR   EnsemblGenomes-Tr; KPN_04345-1.
DR   EnsemblGenomes-Tr; KPN_04346-1.
DR   EnsemblGenomes-Tr; KPN_04347-1.
DR   EnsemblGenomes-Tr; KPN_04348-1.
DR   EnsemblGenomes-Tr; KPN_04349-1.
DR   EnsemblGenomes-Tr; KPN_04353-1.
DR   EnsemblGenomes-Tr; KPN_04354-1.
DR   EnsemblGenomes-Tr; KPN_04355-1.
DR   EnsemblGenomes-Tr; KPN_04356-1.
DR   EnsemblGenomes-Tr; KPN_04389-1.
DR   EnsemblGenomes-Tr; KPN_04390-1.
DR   EnsemblGenomes-Tr; KPN_04391-1.
DR   EnsemblGenomes-Tr; KPN_04392-1.
DR   EnsemblGenomes-Tr; KPN_04523-1.
DR   EnsemblGenomes-Tr; KPN_04561-1.
DR   EnsemblGenomes-Tr; KPN_04562-1.
DR   EnsemblGenomes-Tr; KPN_04563-1.
DR   EnsemblGenomes-Tr; KPN_04686-1.
DR   EnsemblGenomes-Tr; KPN_04744-1.
DR   EnsemblGenomes-Tr; KPN_04745-1.
DR   EnsemblGenomes-Tr; KPN_04746-1.
DR   EnsemblGenomes-Tr; KPN_04747-1.
DR   EnsemblGenomes-Tr; KPN_04824-1.
DR   EnsemblGenomes-Tr; KPN_04825-1.
DR   EnsemblGenomes-Tr; KPN_04826-1.
DR   EuropePMC; PMC2223576; 18055599.
DR   EuropePMC; PMC2546844; 18644883.
DR   EuropePMC; PMC2735749; 19682387.
DR   EuropePMC; PMC2772458; 19734331.
DR   EuropePMC; PMC2772557; 19703972.
DR   EuropePMC; PMC2786356; 19770275.
DR   EuropePMC; PMC2786449; 19786563.
DR   EuropePMC; PMC2849579; 20107095.
DR   EuropePMC; PMC2876394; 20350947.
DR   EuropePMC; PMC2876543; 20351136.
DR   EuropePMC; PMC2900259; 20576143.
DR   EuropePMC; PMC2935791; 19968874.
DR   EuropePMC; PMC3000955; 20959463.
DR   EuropePMC; PMC3017858; 20964857.
DR   EuropePMC; PMC3133326; 21571997.
DR   EuropePMC; PMC3161979; 21901098.
DR   EuropePMC; PMC3165464; 21708987.
DR   EuropePMC; PMC3256060; 21986829.
DR   EuropePMC; PMC3283321; 22152004.
DR   EuropePMC; PMC3347200; 22535926.
DR   EuropePMC; PMC3376583; 22737019.
DR   EuropePMC; PMC3377791; 22551038.
DR   EuropePMC; PMC3536570; 23194155.
DR   EuropePMC; PMC3553734; 23229477.
DR   EuropePMC; PMC3857182; 24349011.
DR   EuropePMC; PMC3868868; 24356844.
DR   EuropePMC; PMC3891705; 23250007.
DR   EuropePMC; PMC3904158; 24450656.
DR   EuropePMC; PMC3928365; 24558473.
DR   EuropePMC; PMC3948817; 24614534.
DR   EuropePMC; PMC3993218; 24590485.
DR   EuropePMC; PMC4187971; 25070096.
DR   EuropePMC; PMC4244539; 25505462.
DR   EuropePMC; PMC4249370; 25182636.
DR   EuropePMC; PMC4313302; 25275000.
DR   EuropePMC; PMC4348519; 25734903.
DR   EuropePMC; PMC4361152; 25886267.
DR   EuropePMC; PMC4385668; 21679283.
DR   EuropePMC; PMC4432112; 25801572.
DR   EuropePMC; PMC4462621; 26060277.
DR   EuropePMC; PMC4505419; 25971969.
DR   EuropePMC; PMC4510304; 26196384.
DR   EuropePMC; PMC4539999; 26301055.
DR   EuropePMC; PMC4551003; 26206847.
DR   EuropePMC; PMC4588269; 26420254.
DR   EuropePMC; PMC4939778; 27389261.
DR   EuropePMC; PMC5035412; 27510832.
DR   EuropePMC; PMC5049680; 27572646.
DR   EuropePMC; PMC5075120; 27620478.
DR   EuropePMC; PMC5119017; 27697759.
DR   EuropePMC; PMC5177892; 28004732.
DR   EuropePMC; PMC5278681; 27919898.
DR   EuropePMC; PMC5306282; 28261184.
DR   EuropePMC; PMC5328509; 28031204.
DR   EuropePMC; PMC5527587; 28533243.
DR   EuropePMC; PMC5532282; 28751669.
DR   EuropePMC; PMC5634883; 29017452.
DR   EuropePMC; PMC5664670; 28972552.
DR   EuropePMC; PMC5732189; 29321769.
DR   EuropePMC; PMC5786813; 29229634.
DR   EuropePMC; PMC5790149; 28375518.
DR   EuropePMC; PMC5890657; 27530752.
DR   EuropePMC; PMC5913063; 29692906.
DR   EuropePMC; PMC5955891; 29769695.
DR   EuropePMC; PMC5996243; 29951041.
DR   EuropePMC; PMC5998039; 29899556.
DR   EuropePMC; PMC6070572; 30068997.
DR   EuropePMC; PMC6345840; 30679463.
DR   EuropePMC; PMC6414703; 30862751.
DR   EuropePMC; PMC6417137; 30866820.
DR   EuropePMC; PMC6543805; 31179245.
DR   EuropePMC; PMC6650414; 31337792.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00014; DsrA.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00033; MicF.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00077; SraB.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00079; OmrA-B.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00084; CsrC.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00118; rydB.
DR   RFAM; RF00121; MicC.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00368; sroB.
DR   RFAM; RF00369; sroC.
DR   RFAM; RF00370; sroD.
DR   RFAM; RF00371; sroE.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00382; DnaX.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00534; SgrS.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01056; Mg_sensor.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01396; isrN.
DR   RFAM; RF01397; isrO.
DR   RFAM; RF01400; istR.
DR   RFAM; RF01408; sraL.
DR   RFAM; RF01517; iscRS.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01771; rnk_leader.
DR   RFAM; RF01794; sok.
DR   RFAM; RF01795; FourU.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01832; ROSE_2.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01988; SECIS_2.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02005; group-II-D1D4-6.
DR   RFAM; RF02029; sraA.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02051; STnc450.
DR   RFAM; RF02057; STnc40.
DR   RFAM; RF02064; STnc370.
DR   RFAM; RF02069; STnc70.
DR   RFAM; RF02074; STnc240.
DR   RFAM; RF02075; STnc230.
DR   RFAM; RF02076; STnc100.
DR   RFAM; RF02081; STnc550.
DR   RFAM; RF02084; STnc130.
DR   RFAM; RF02194; HPnc0260.
DR   SILVA-LSU; CP000647.
DR   SILVA-SSU; CP000647.
DR   StrainInfo; 118395; 0.
XX
CC   Coding sequences below are predicted from manually evaluated
CC   computer analysis, using similarity information and the program
CC   GeneMark (version 2.3); tRNA genes were determined using
CC   tRNAscan-SE-1.23; This sequence was finished as follows unless
CC   otherwise noted: all regions were double stranded, sequenced  with
CC   an alternate chemistries or covered by high quality data (i.e.,
CC   phred quality >=30); an attempt was made to resolve all sequencing
CC   problems, such as compressions and repeats; all regions were
CC   covered by sequence from more than one m13 subclone.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5315120
FT                   /organism="Klebsiella pneumoniae subsp. pneumoniae MGH
FT                   78578"
FT                   /sub_species="pneumoniae"
FT                   /strain="ATCC 700721; MGH 78578"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:272620"
FT   gene            190..258
FT                   /gene="thrL"
FT                   /locus_tag="KPN_00001"
FT   CDS_pept        190..258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrL"
FT                   /locus_tag="KPN_00001"
FT                   /product="thr operon leader peptide"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00001"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75462"
FT                   /db_xref="GOA:A6T4E1"
FT                   /db_xref="InterPro:IPR011720"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4E1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75462.1"
FT                   /translation="MNRIGMITTIITTTITTGNGAG"
FT   gene            340..2802
FT                   /gene="thrA"
FT                   /locus_tag="KPN_00002"
FT   CDS_pept        340..2802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrA"
FT                   /locus_tag="KPN_00002"
FT                   /product="bifunctional aspartokinase I/homeserine
FT                   dehydrogenase I"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00002"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75463"
FT                   /db_xref="GOA:A6T4E2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041743"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4E2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001048"
FT                   /inference="protein motif:Pfam:IPR001342"
FT                   /inference="protein motif:Pfam:IPR002912"
FT                   /inference="protein motif:Pfam:IPR005106"
FT                   /protein_id="ABR75463.1"
FT                   /translation="MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITN
FT                   HLVAMIEKTIGGQDALPNIADAERIFAELLQGLADAQPAFPLAQLKAFVEQEFAQIKHV
FT                   LHGISLLGQCPDSVNAALICRGEKLSIAIMAGLLEARGHKVSVINPVEKLLAVGHYLES
FT                   TVDIAESTRRIAASQIPADHMILMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADC
FT                   CEIWTDVDGVYTCDPRQVPDARLLKSMSYQEAMELSYFGAKVLHPRTIAPIAQFQIPCL
FT                   IKNTGNPQAPGTLIGASRDEDDLPVKGISNLNNMAMFNVSGPGMKGMVGMAARVFATMS
FT                   RAGISVVLITQSSSEYSISFCVPQSDCARAKRAMEDEFYLELKEGLLEPLAIMERLAII
FT                   SVVGDGMRTLRGISAKFFAALARANINIVAIAQGSSERSISVVVSNDDATTGVRVTHQM
FT                   LFNTDQVIEVFVIGVGGVGGALLEQIKRQQGWLKNKHIDLRVCGVANSQALLTSVHGLN
FT                   LENWSAELAEAKEPFNLGRLIRLVKEYHLLNPVIVDCTSSQAVADQYADFLREGFHVVT
FT                   PNKKANTFSLDYYHQLRHAASSSRRKFLYDTNVGAGLPVIENLQNLLNAGDELRHFSGI
FT                   LSGSLSFIFGKLDEGVSFSAATAMAREMGYTEPDPRDDLSGVDVARKLLILARETGREL
FT                   ELADIIVESALPPDFDASGDVETFMARLPSLDDGFASRVAKARDEGKVLRYVGNIEEDG
FT                   TCRVKIAAVDGNDPLFKVKNGENALAFYSHYYQPLPLVLRGYGAGNDVTAAGVFADLLR
FT                   TLSWKLGV"
FT   gene            2804..3733
FT                   /gene="thrB"
FT                   /locus_tag="KPN_00003"
FT   CDS_pept        2804..3733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="KPN_00003"
FT                   /product="homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00003"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75464"
FT                   /db_xref="GOA:A6T4E3"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4E3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR006204"
FT                   /protein_id="ABR75464.1"
FT                   /translation="MVKVYAPASSANMSVGFDVLGAAVTPVDGTLLGDNVTVEAAEQFS
FT                   LQNLGRFASKLPTAPQENIVYQCWESFCREIGKTVPVAMTLEKNMPIGSGLGSSACSVV
FT                   AALVAMNEFCGKPLNETRMLALMGEMEGRISGSIHYDNVAPCYLGGMQLMIEENGIISQ
FT                   QVPGFDEWLWVLAYPGIKVSTAEARAILPAQYRRQDCIAHGRHLAGFIHACYTRQPQLA
FT                   AKLMKDVIAEPYRTKLLPGFSEARQAAMEMGAQACGISGSGPTLFALCDKPDTAQRVAD
FT                   WLGAHYLQNQEGFVHICRLDTAGARVVG"
FT   gene            3737..5017
FT                   /gene="thrC"
FT                   /locus_tag="KPN_00004"
FT   CDS_pept        3737..5017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC"
FT                   /locus_tag="KPN_00004"
FT                   /product="threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00004"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75465"
FT                   /db_xref="GOA:A6T4E4"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4E4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001926"
FT                   /protein_id="ABR75465.1"
FT                   /translation="MKLYNLKDHNEQVSFAQAVTQGLGKHQGLFFPHDLPEFSLTEIDD
FT                   MLAQDFVTRSAKILCAFIGDEIPQDVLQQRVRAAFAFPAPVSKVQEDVGCLELFHGPTL
FT                   AFKDFGGRFMAQMLTHIAGDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKIS
FT                   PLQEKLFCTLGGNIETVAIDGDFDACQALVKQAFDDEELKATLGLNSANSINISRLLAQ
FT                   ICYYFEAAAQLPQEARNQLVISVPSGNFGDLTAGLLAKSLGLPIKRFIAATNANDTVPR
FT                   YLQGGEWAPKATQATLSNAMDVSQPNNWPRVEELFRRKIWRLSELGYAAVDDETTKAAM
FT                   RELKAIGYISEPHAAIAWRALRDQLQPGEYGLFLGTAHPAKFKESVEEILQETLPLPKE
FT                   LADRADLPLLSHNLPADFAALRKLMMG"
FT   gene            5354..5710
FT                   /locus_tag="KPN_00005"
FT   CDS_pept        5354..5710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00005"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75466"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4E5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75466.1"
FT                   /translation="MVVFALTGCSGTTIGGNEDKLTPAYLKQHLIVGKTTKAEVRQYFG
FT                   APDSGHTTVTASGKESWYYSVDKGINLVSLAGSMIPVTGASQAADAVDKSSQKDSNSLM
FT                   IFFDEKGVVENWVR"
FT   gene            complement(5779..6552)
FT                   /gene="yaaA"
FT                   /locus_tag="KPN_00006"
FT   CDS_pept        complement(5779..6552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaA"
FT                   /locus_tag="KPN_00006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00006"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75467"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4E6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR005583"
FT                   /protein_id="ABR75467.1"
FT                   /translation="MLILISPAKTLDYQSPLATTRYTQPELLEYSQQLIGIARKLSAPQ
FT                   IGKLMSISDKLADLNATRFHDWHPDFTPQNARQAILAFKGDVYTGLQAETLTEDDFDFA
FT                   QQHLRMLSGLYGVLRPLDLMQPYRLEMGIRLENPRGKDLYQFWGDTITEKLNQALRDQG
FT                   DDIVINLASDEYFKSVKTPKLQGQLIKPVFLDEKNGKFKVISFYAKKARGLMSRYIIEN
FT                   RLTQPEQLKAFNSEGYFFDADASEKGELVFKRHEQ"
FT   gene            complement(6630..8012)
FT                   /gene="yaaJ"
FT                   /locus_tag="KPN_00007"
FT   CDS_pept        complement(6630..8012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaJ"
FT                   /locus_tag="KPN_00007"
FT                   /product="inner membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00007"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75468"
FT                   /db_xref="GOA:A6T4E7"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4E7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001463"
FT                   /protein_id="ABR75468.1"
FT                   /translation="MIYLLLGAGIWFSWQTRGIQFRYVRKFGRSLKKSLHPQPGGLTSF
FT                   QALCTSLAARVGSGNLAGVTLAIAAGGPGAVFWMWVSALLGMASSFAECSLAQLYKERD
FT                   SRGQFRGGPAWYMARGLGMRWMGVLFSILLLLAYGFIFNTVQANSVAHALRYAFDLPAA
FT                   VSGGVLAVVVLLAILRGLRGVARLMQWIVPFMALLWIATSLLIGLWHITALPTIFATIF
FT                   RCAFGWQEAAAGAVGYTISQALTSGFQRGMFSNEAGMGSSPNAAAAAASWPPHPAAQGI
FT                   VQMIGVFIDTIVICTASAIIVMLAPRPDNEYTLNGIQDLQHAMSVLVGGWGAGFIALIV
FT                   LLFAFSSIVANYVYAENNLVFLRLDKPRYIWGLRILTVLMVLLGTMVSLPVVWQSADII
FT                   MALMAMTNLTAILLLSPTVRIIASDYLRQRRLGIQPTFDATRYPDIDQQLAPGAWNELP
FT                   RE"
FT   gene            8263..9216
FT                   /gene="talB"
FT                   /locus_tag="KPN_00008"
FT   CDS_pept        8263..9216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="talB"
FT                   /locus_tag="KPN_00008"
FT                   /product="transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00008"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75469"
FT                   /db_xref="GOA:A6T4E8"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4E8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001585"
FT                   /protein_id="ABR75469.1"
FT                   /translation="MTDKLTSLRQYTTVVADTGDIAAMKLYQPQDATTNPSLILGAAQI
FT                   PEYRKLIDDAVAWARSQSSDRAQQILDASDKLAVNIGLEILKLIPGRISTEVDARLSYD
FT                   TEASIAKAKRIIKLYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLFSFAQ
FT                   ARACAEAGVFLISPFVGRILDWYKANTDKKEYAPAEDPGVVSVSEIYEYYKQHGYETVV
FT                   MGASFRNVGEILELAGCDRLTIAPALLKELSESEGAVERKLVYTGEVKARPERITESEF
FT                   LWQHNQDPMAVDKLAEGIRKFAIDQEKLEKMIDELL"
FT   gene            9316..9903
FT                   /gene="mogA"
FT                   /locus_tag="KPN_00009"
FT   CDS_pept        9316..9903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mogA"
FT                   /locus_tag="KPN_00009"
FT                   /product="molybdenum cofactor biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00009"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75470"
FT                   /db_xref="GOA:A6T4E9"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4E9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001453"
FT                   /protein_id="ABR75470.1"
FT                   /translation="MNTLRIGLVSISDRASSGVYQDKGIPALEEWLARALTTPFELQTR
FT                   LIPDEQAIIEQTLCELVDEMGCHLVLTTGGTGPARRDVTPDATLAIADREMPGFGEQMR
FT                   QVSLHFVPTAILSRQVGVIRKQALILNLPGQPKAIQETLEGVKDADGNVLVHGIFASVP
FT                   YCVQLLEGPYVETDGRVVEAFRPKSARRETLS"
FT   gene            10023..11327
FT                   /gene="proP"
FT                   /locus_tag="KPN_00010"
FT   CDS_pept        10023..11327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proP"
FT                   /locus_tag="KPN_00010"
FT                   /product="low-affinity transport system; proline permease
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00010"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75471"
FT                   /db_xref="GOA:A6T4F0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4F0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR005828"
FT                   /protein_id="ABR75471.1"
FT                   /translation="MSYANRPLNRQDYKTLTLAALGGALEFYDFIIFVFFAAVVGELFF
FT                   PADIPEWLRQVQTFGIFAAGYLARPLGGIIMAHFGDLVGRKKMFTLSILLMALPTLAIG
FT                   LLPTYSSVGIIAPLLLLLMRILQGAAIGGEVPGAWVFVAEHVPEKRIGIACGTLTAGLT
FT                   VGILLGSVVATLINTSLTPQGIHDGGWRIPFLLGGVFGLIAMYLRRWLQETPIFLEMQQ
FT                   RKALAQELPVKAVALKHQKAVVISMLLTWLLSAGVVVVILMSPVWLQKHYGFAPAITLQ
FT                   ANSIATIMLCIGCLLAGLAADRFGASRTFIVGSLLLAVASWAFYHLAGASPQRLFLLYG
FT                   TVGLCVGVVGAVPYVMVRAFPAEVRFTGISFSYNLSYAIFGGLTPIAVTMLMGVSPMAP
FT                   AWYVLALSLMGLGLGIWLRQELTAPTGMPEGELQR"
FT   gene            complement(11390..11956)
FT                   /gene="yaaH"
FT                   /locus_tag="KPN_00011"
FT   CDS_pept        complement(11390..11956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaH"
FT                   /locus_tag="KPN_00011"
FT                   /product="putative regulator, integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00011"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75472"
FT                   /db_xref="GOA:A6T4F1"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4F1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000791"
FT                   /protein_id="ABR75472.1"
FT                   /translation="MGNTKLANPAPLGLMGFGMTTILLNLANSGLFAFDVAILAMGIFY
FT                   GGIAQIFAGLLEYKKGNTFGLTAFTSYGSFWLTLVAILLMPKMGLADAPNAHFLGMYLG
FT                   LWGVFTLFMFFGTLKAARMLQFVFLSLTVLFALLAIGHLADNEGIVKVAGWVGLVCGAS
FT                   AIYLAMGEVLNEQFGRTVLPIGEPR"
FT   gene            complement(12045..12794)
FT                   /gene="yaaW"
FT                   /locus_tag="KPN_00012"
FT   CDS_pept        complement(12045..12794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaW"
FT                   /locus_tag="KPN_00012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00012"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75473"
FT                   /db_xref="InterPro:IPR021150"
FT                   /db_xref="InterPro:IPR025217"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4F2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR005367"
FT                   /protein_id="ABR75473.1"
FT                   /translation="MHINYLEDDDLAFLPECSEAHLEAFTRILTHGENGKPRLSSTLLR
FT                   NETFLAMEGHPERYRRNWQLIAGELQHFGGDSIANTLRRHGKFYRAILLDVCKRLKAKV
FT                   DKQLSTPQIEQQLLAHFLQHSWNKLNAEQKAQFLAAVECRSHELDSLMAHLLRHRKLSE
FT                   GVTLLLDERLTAILRTHAAVSVIGHGLVRGAGLGGPLGAALNSVKAVSGSAYRVTIPAV
FT                   LHIACLRQMLQPPSDTAEIGEKYPARS"
FT   gene            complement(12822..13226)
FT                   /gene="yaaI"
FT                   /locus_tag="KPN_00013"
FT   CDS_pept        complement(12822..13226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaI"
FT                   /locus_tag="KPN_00013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00013"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75474"
FT                   /db_xref="InterPro:IPR020240"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4F3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75474.1"
FT                   /translation="MKSLYRLSVGLILGVSFITSAAANDHKILGVIAMPRNETNDLTLT
FT                   LPVCRVVKRIQLSADRGDVQLSGATVYFKASRGASHTLNVPAGIKEGSTTGWININSDN
FT                   DSKRCVKKIAFSGHTVHSSDMASLKIIGDD"
FT   gene            13612..15528
FT                   /gene="dnaK"
FT                   /locus_tag="KPN_00014"
FT   CDS_pept        13612..15528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="KPN_00014"
FT                   /product="molecular chaperone DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00014"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75475"
FT                   /db_xref="GOA:A6T4F4"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4F4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001023"
FT                   /protein_id="ABR75475.1"
FT                   /translation="MGKIIGIDLGTTNSCVAIMDGTTARVLENAEGDRTTPSIIAYTQD
FT                   GETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPYKIVAADNGDAWLD
FT                   VKGTKTAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGL
FT                   EVKRIINEPTAAALAYGLDKEVGNRTIAVYDLGGGTFDISIIEIDEVDGEKTFEVLATN
FT                   GDTHLGGEDFDTRLINYLVDEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDV
FT                   NLPYITADATGPKHMNIKVTRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDINDVILV
FT                   GGQTRMPMVQKKVAEFFGKEPRKDVNPDEAVAIGAAVQGGVLTGDVKDVLLLDVTPLSL
FT                   GIETMGGVMTALISKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRASDNKSLGQFN
FT                   LDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEEEIQKMVR
FT                   EAEANAESDRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALESSL
FT                   KGEDKADIEAKMQALAQASQKLMEIAQQQHAQQQAGSADAQASNAKDDDVVDAEFEEVK
FT                   DKK"
FT   gene            15616..16749
FT                   /gene="dnaJ"
FT                   /locus_tag="KPN_00015"
FT   CDS_pept        15616..16749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="KPN_00015"
FT                   /product="chaperone with DnaK; heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00015"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75476"
FT                   /db_xref="GOA:A6T4F5"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4F5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001305"
FT                   /inference="protein motif:Pfam:IPR001623"
FT                   /inference="protein motif:Pfam:IPR002939"
FT                   /protein_id="ABR75476.1"
FT                   /translation="MAKQDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQGDKEAEA
FT                   KFKEIKEAYEILTDAQKRAAYDQYGHAAFEQGGMGGGGGFGGGADFSDIFGDVFGDIFG
FT                   GGRGRQRAARGADLRYNMELTLEEAVRGVTKEIRIPTLEECDVCHGSGAKAGSKPQTCP
FT                   TCHGAGQVQMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVEKTKTLSVKIPAGVD
FT                   TGDRIRLAGEGEAGEHGAPAGDLYVQVQVKQHAIFEREGNNLYCEVPINFTMAALGGEI
FT                   EVPTLDGRVNLKIPGETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNEKQKQ
FT                   LLKELQESFGGPTGENNSPRSKSFFDGVKKFFDDLTR"
FT   gene            16915..18102
FT                   /gene="nhaA"
FT                   /locus_tag="KPN_00016"
FT   CDS_pept        16915..18102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaA"
FT                   /locus_tag="KPN_00016"
FT                   /product="Na+/H antiporter, pH dependent"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00016"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75477"
FT                   /db_xref="GOA:A6T4F6"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4F6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004670"
FT                   /protein_id="ABR75477.1"
FT                   /translation="MKVKVKHLQRFFSSDASGGIVLIIAAALAMVMANTSVTSGLYHSF
FT                   LETPVQLRVGALEINKNMLLWINDALMAVFFLLIGLEVKRELIQGSLASRRQAVFPVIA
FT                   ALGGMIVPALVYLAFNAQDPVAREGWAIPAATDIAFALGVLALLGSRVPTALKIFLMAL
FT                   AIIDDLGAIVIIALFYTHDLSMLSLGVAAAAIAVLMALNLSGVRRTGIYILVGAVLWTA
FT                   VLKSGVHATLAGVIVGFMIPLEEKHGKSPAKALEHVLHPWVAFMILPLFAFANAGVSLQ
FT                   GVTLAGLTSLLPLGIMAGLFIGKPLGISLFCWLALKLKWASLPEGTTCKQIMAVGILCG
FT                   IGFTMSIFIATLAFGSVDPALINWAKLGILIGSVLSAVVGYLILRQRVTDTRLAV"
FT   gene            18157..19053
FT                   /gene="nhaR"
FT                   /locus_tag="KPN_00017"
FT   CDS_pept        18157..19053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaR"
FT                   /locus_tag="KPN_00017"
FT                   /product="transcriptional activator of cation transport
FT                   (LysR family)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00017"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75478"
FT                   /db_xref="GOA:A6T4F7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4F7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000847"
FT                   /protein_id="ABR75478.1"
FT                   /translation="MSHINYNHLYYFWHVYKEGSVVGAAEALFLTPQTITGQIKALEER
FT                   LQGKLFKRKGRGLEPSELGELVFRYADRMFTLSQEMLDIVNYRKESNLLFDVGVADALS
FT                   KRLVSGVLDAAVVESEQIHLRCFESTHELLLEQLSQHKLDMIISDCPIDSTQQEGLFSV
FT                   KIGECSVSFWCMNPAPTKPFPACLEERRLLIPGRRSMLGRKLLNWINVQGLKVEILGEF
FT                   DDAALMKAFGAAHNAIFVAPTLYAHDFYHDESIVEIGRMDSVMEEYHAIFAERMIQHPA
FT                   VQRICNRDYSSLFTEPR"
FT   gene            complement(19173..19358)
FT                   /gene="rpsT"
FT                   /locus_tag="KPN_00018"
FT   CDS_pept        complement(19173..19358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="KPN_00018"
FT                   /product="30S ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00018"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75479"
FT                   /db_xref="GOA:A6T4F8"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4F8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002583"
FT                   /protein_id="ABR75479.1"
FT                   /translation="MMRTFIKKVYAAIEAGDKAAAQKAFNEMQPIVDRQAAKGLIHKNK
FT                   AARHKANLTAQINKLA"
FT   gene            19553..19755
FT                   /pseudo
FT                   /locus_tag="KPN_00019"
FT                   /note="Pseudogene compared to gi|16128018|ref|NP_414565.1|
FT                   orf, hypothetical protein [Escherichia coli K12]"
FT   gene            19766..20704
FT                   /gene="ribF"
FT                   /locus_tag="KPN_00020"
FT   CDS_pept        19766..20704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="KPN_00020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00020"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75480"
FT                   /db_xref="GOA:A6T4F9"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4F9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002606"
FT                   /protein_id="ABR75480.1"
FT                   /translation="MKLIRGIHNLSQAPHGCVLTIGNFDGVHRGHQALLQRLREEGRQR
FT                   GLPVVVMIFEPQPLELFAADKAPARLTRLREKLGYLAESGVDYVLCVRFDRRFAALTAQ
FT                   DFISELLVRRLGVQFLAVGDDFRFGAGRQGDFLLLQKAGAEYGFDVTSTQTFCEGGVRI
FT                   SSTAVRQALADDDLLLAETLLGHPFSISGRVVHGDELGRTIGFPTANLPLRRQVSPVKG
FT                   VYAVEVTGLGDKPIAGVANIGTRPTVAGVRQQLEVHLLDVVMDLYGRHINVILRKKIRN
FT                   EQRFASLDELKAQIARDELTARELFGLTSQA"
FT   gene            20796..23564
FT                   /gene="ileS"
FT                   /locus_tag="KPN_00021"
FT   CDS_pept        20796..23564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="KPN_00021"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00021"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75481"
FT                   /db_xref="GOA:A6T4G0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4G0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002300"
FT                   /inference="protein motif:Pfam:IPR010663"
FT                   /protein_id="ABR75481.1"
FT                   /translation="MRGDLAKREPGMLARWTDDDLYGIIRAAKKGKKTFILHDGPPYAN
FT                   GSIHIGHSVNKILKDIIVKSKGLTGYDSPYVPGWDCHGLPIELKVEQEYGKPGEKFTAA
FT                   EFRAKCREYAAEQIDGQRKDFIRLGVLGDWSHPYLTMDFKTEANIIRALGKIIGNGHLH
FT                   KGAKPVHWCVDCRSALAEAEVEYYDKTSPSIDVAFHAVDKAAVLAKFGVADVNGPVSLV
FT                   IWTTTPWTLPANRAISLSPEFDYALVQVDGQALILAKDLVESVMKRVGATDYTILAAVQ
FT                   GSELELMRFKHPFLDFDVPAILGDHVTLDAGTGAVHTAGGHGPDDYTISQKYGLEIANP
FT                   VGPDGAYLPGTWPSLDGINVFKANDIIVEMLRERGALLHVEKLQHSYPCCWRHKSPIIF
FT                   RATPQWFVSMDQKGLRAQSLKEIKGVQWIPDWGQARIESMVANRPDWCISRQRTWGVPM
FT                   SLFVHKETHELHPRTLELMEEVAKRVEVDGIQAWWDLDSRDILGDDADSYEKVPDTLDV
FT                   WFDSGSTHSSVVDVRPEFAGHAADMYLEGSDQHRGWFMSSLMISTAMKGKAPYRQVLTH
FT                   GFTVDGQGRKMSKSIGNTVSPQDVMNKLGADILRLWVASTDYTGEMAVSDEILKRAADS
FT                   YRRIRNTARFLLANLNGFDPVKDMVKPEEMVVLDRWAVGCAQAAQEDILKAYESYDFHE
FT                   VVQRLMRFCSIEMGSFYLDIIKDRQYTAKADSVARRSCQTALFHIVEALVRWMAPIMSF
FT                   TADEIWGYLPGEREKYVFTGEWYEGLFGLADDEAMNDDFWDELLKVRGEVNKVIEQARA
FT                   DKKVGGSLEAAVTLYADADLAAKLNALGDELRFVLLTSGANVADYASASADAQQSELLK
FT                   GLKVALSKAEGEKCPRCWHYTTDIGKVAEHAEICGRCVSNVAGDGEQRKFA"
FT   gene            23564..24064
FT                   /gene="lspA"
FT                   /locus_tag="KPN_00022"
FT   CDS_pept        23564..24064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="KPN_00022"
FT                   /product="signal peptidase II"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00022"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75482"
FT                   /db_xref="GOA:A6T4G1"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4G1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001872"
FT                   /protein_id="ABR75482.1"
FT                   /translation="MSKSICSTGLRWLWVVVAVLIIDLGSKFLILQNFALGETVPLFPS
FT                   LNLHYARNYGAAFSFLADSGGWQRWFFSGIAIGICVVLTVLMYRSKATQKLNNIAYALI
FT                   IGGALGNLFDRLWHGFVVDMIDFYVGDWHFATFNLADSAICIGAALIVLEGFLPKPTVK
FT                   EQA"
FT   gene            24180..24629
FT                   /gene="fkpB"
FT                   /locus_tag="KPN_00023"
FT   CDS_pept        24180..24629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fkpB"
FT                   /locus_tag="KPN_00023"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase
FT                   (rotamase)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00023"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75483"
FT                   /db_xref="GOA:A6T4G2"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4G2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001179"
FT                   /protein_id="ABR75483.1"
FT                   /translation="MSKSVQSNSAVLVHFTLKLDDGSTAESTRSNGKPALFRLGDTSLS
FT                   EGLEQQLLGLKEGEKKAFSLEPDAAFGVPSPDLIQYFSRREFIDAGEPEIGAIMLFTAM
FT                   DGSEMPGVIREVNGDSITVDFNHPLAGRTVHFDIEVLEIDPALEE"
FT   gene            24631..25581
FT                   /gene="ispH"
FT                   /locus_tag="KPN_00024"
FT   CDS_pept        24631..25581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispH"
FT                   /locus_tag="KPN_00024"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00024"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75484"
FT                   /db_xref="GOA:A6T4G3"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4G3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003451"
FT                   /protein_id="ABR75484.1"
FT                   /translation="MQILLANPRGFCAGVDRAISIVENALTLYGAPIYVRHEVVHNRYV
FT                   VDSLRKRGAIFIEQISEVPDGAILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHM
FT                   EVARASRRGEESILIGHAGHPEVEGTMGQYNNPQGGMYLVESPEDVLKLEVKNDARLSF
FT                   MTQTTLSVDDTSDVIDALRARFPKIVGPRKDDICYATTNRQEAVRALAEQADVVLVVGS
FT                   KNSSNSNRLAELAQRMGKAAYLIDDASDIQEAWVKDAACVGVTAGASAPDILVQNVITR
FT                   LQELGGGEAVPLEGREENIVFEVPKELRVDVREVE"
FT   gene            25648..26562
FT                   /gene="rihC"
FT                   /locus_tag="KPN_00025"
FT   CDS_pept        25648..26562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rihC"
FT                   /locus_tag="KPN_00025"
FT                   /product="nucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00025"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75485"
FT                   /db_xref="GOA:A6T4G4"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR022976"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4G4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001910"
FT                   /protein_id="ABR75485.1"
FT                   /translation="MRLPIILDTDPGIDDAAAIAAALFAPELDLQLMTTVAGNVSVEKT
FT                   TRNALQLLHFWNADVPLAQGASMPLVRPLRDAASVHGESGMEGYDFVEHQRQPLAKPAF
FT                   QAIRDALMHAAEPITLVAIGPLTNIALLLTQYPECVFNIRRLVIMGGSAGRGNFTPNAE
FT                   FNIAIDPEAAAKVFHSGLEIVMCGLDVTNRALLAADYLATLPTLNQTGKMLHALFSHYR
FT                   SGSMSSGLRMHDLCAIAWLARPELFTLQPCFVAVETQGTWTAGTTVVDIEGRLGQPANA
FT                   QVALDIDVEGFQRWAAEVIALAP"
FT   gene            complement(26578..26847)
FT                   /locus_tag="KPN_00026"
FT   CDS_pept        complement(26578..26847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00026"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75486"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4G5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75486.1"
FT                   /translation="MHPPAAYSQQGERHQQQPQRRKGYDNKTEDPVVRVNKGGQTPGGH
FT                   WRGGDQHIDKKKRPELLPAGASAKIKGLFPAAQIRLSIGHCFSP"
FT   gene            complement(26906..27835)
FT                   /gene="yeaT"
FT                   /locus_tag="KPN_00027"
FT   CDS_pept        complement(26906..27835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeaT"
FT                   /locus_tag="KPN_00027"
FT                   /product="putative transcriptional regulator (LysR family)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00027"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75487"
FT                   /db_xref="GOA:A6T4G6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4G6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000847"
FT                   /inference="protein motif:Pfam:IPR005119"
FT                   /protein_id="ABR75487.1"
FT                   /translation="MNLNLLPDLALFVQIVDQGSFSAVARQNGITPSAVSRSVSRLERE
FT                   MGCKLLQRTTRKLRLSDAGETIYQHAQQMLEAARQAMDSAGSRQTVAQGKLTLSVPKAV
FT                   GRFVIHPLMMAFFHRYPQVDVCLRLEDRPLDFIDDGIDLALRITDTPSPGLHGKPLMPI
FT                   RHVICATEAYLQQHGTPYTPQDLRSHSCISLGETPADARWKFRREGKTETVQTYGRYAA
FT                   NHTAVRLDAVRQHLGIGSLPLFTAREALANGDIVQVLPEWEFISSYSGDLWLLWAGDKH
FT                   MPARMRAMIDYLSETVPALNAGSTEPAK"
FT   gene            complement(28563..29276)
FT                   /locus_tag="KPN_00028"
FT   CDS_pept        complement(28563..29276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00028"
FT                   /product="putative transcription regulator sensor for
FT                   citrate"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00028"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75488"
FT                   /db_xref="GOA:A6T4G7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="InterPro:IPR028141"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4G7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001789"
FT                   /protein_id="ABR75488.1"
FT                   /translation="MNIMDSITTLIVEDEPMLAEILVDNIKQFPQFDVIGIADKLESAR
FT                   KQLRLYQPQLILLDNFLPDGKGIDLIRHAVSTHYKGRIIFITADNHMETISEALRLGVF
FT                   DYLIKPVHYQRLQHTLERFARYRSSLRSSEQASQLHVDALFNIQAREQTEPASAPLRGI
FT                   DESTFQRVLQLFADPTVVHTADSLARILGSSKTTARRYLEQGVKNDFLEAEISYGKVGR
FT                   PERIYHGKQTYPEQR"
FT   gene            complement(29260..30888)
FT                   /locus_tag="KPN_00029"
FT   CDS_pept        complement(29260..30888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00029"
FT                   /product="putative transcription regulator, histidine
FT                   kinase for citrate"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00029"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75489"
FT                   /db_xref="GOA:A6T4G8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4G8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003594"
FT                   /protein_id="ABR75489.1"
FT                   /translation="MYTRKITHWFARRSFQNRIFLLILFTSTIVMLAMSWYLTDITEER
FT                   LHYQVGQRALIQAMQISAMPELVEAVQKRDLARIKALIDPMRSFSDATYITVGDASGQR
FT                   LYHVNPDEIGKSMEGGDSDEALINAKSYVSVRKGSLGSSLRGKSPIQDATGKVIGIVSV
FT                   GYTIEQLENWLSLQISSLLIPMAIMLLLLLFCARRFSLHIKKQMLNMEPQQLSQLLIQQ
FT                   SVLFESVFEGLIAIDSDYKITAINQTARRLLNLSQPEPTLIGKRISSVISQEVFFYDAP
FT                   QTNKKDEIVTFNQIKVIASRMAVILNNEPQGWVISFRSKDDINTLSLQLSQVQQYADNL
FT                   RAVQHEHRNLISTIAGLLFLKRYNQALELIQQQSESHQKVIDFIARNFQDNHLAGLLIG
FT                   KYYRAKELGLELIFDPACFVDRLPTALSHNEWISIVGNLLDNAYNASLRQPQGSKQIEC
FT                   LINSDGQEVIIEIADQGCGIDEALRDRIFERGVTSSASKDHGIGLWLVRSYVEQAGGSI
FT                   VVENNIPFGTIFTLYIPLTRDEHHG"
FT   gene            complement(31060..32361)
FT                   /gene="dcoB"
FT                   /locus_tag="KPN_00030"
FT   CDS_pept        complement(31060..32361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcoB"
FT                   /locus_tag="KPN_00030"
FT                   /product="Oxalacetate decarboxylase: beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00030"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75490"
FT                   /db_xref="GOA:A6T4G9"
FT                   /db_xref="InterPro:IPR005661"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4G9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR005661"
FT                   /protein_id="ABR75490.1"
FT                   /translation="MESLNALIQGMGLMHLGAGQAIMLLVSLLLLWLAIAKKFEPLLLL
FT                   PIGFGGLLSNIPEAGLALTALESLLAHHDPAQLAVIAAKLHCAPDVHAIKEALALALPS
FT                   VQGQMESLAVDMGYSAGVLAIFYKVAIGSGIAPLVIFMGVGAMTDFGPLLANPRTLLLG
FT                   AAAQFGIFATVLGALTLNYFGIISFTLPQAAAIGIIGGADGPTAIYLSGKLAPELLGAI
FT                   AVAAYSYMALVPLIQPPIMKALTTDKERKIRMVQLRTVSKREKILFPAVLLLLVALLLP
FT                   DAAPLLGMFCFGNLMRESGVVERLSDTVQNALINIVTIFLGLSVGAKLVADKFLQPQTL
FT                   GILVLGVIAFCVGTAAGVLMAKLMNVFSRHKINPLIGSAGVSAVPMAARVSNKVGLEAD
FT                   GQNFLLMHAMGPNVAGVIGSAIAAGVMLKYVLAM"
FT   gene            complement(32377..34143)
FT                   /locus_tag="KPN_00031"
FT   CDS_pept        complement(32377..34143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00031"
FT                   /product="putative oxalacetate decarboxylase, subunit
FT                   alpha"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00031"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75491"
FT                   /db_xref="GOA:A6T4H0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005776"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4H0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000089"
FT                   /inference="protein motif:Pfam:IPR000891"
FT                   /inference="protein motif:Pfam:IPR003379"
FT                   /protein_id="ABR75491.1"
FT                   /translation="MTVAITDVVLRDAHQSLFATRLRLDDMLPVAAQLDDVGYRSLECW
FT                   GGATFDACIRFLGEDPWVRLRELKKAMPKTPLQMLLRGQNLLGYRHYADDVVERFVERA
FT                   VKNGMDVFRVFDAMNDPRNMQAALQAVRRHGAHAQGTLSYTTSPAHTLQTWLDLTEQLL
FT                   ETGVDSVAIKDMSGILTPHAAFELVSEIKKRYDVTLHLHCHATTGMAEMALLKAIEAGV
FT                   DGVDTAISSMSATYGHPATEALVATLAGTPYDTGLNIHRLESIAAYFREVRKKYHAFEG
FT                   QLKGTDSRILVAQVPGGMLTNLEGQLKQQSAAHRLDEVLAEIPRVREDLGFIPLVTPTS
FT                   QIVGTQAVLNVLGGERYKTIAKETAGILKGEYGHTPAPVNAALQARVLDGADAVTCRPA
FT                   DLLKPELAALEADVKRQAQEKGITLAENAIDDVLTVALFPQPGLKFLENRHNPAAFEPV
FT                   PQAEAAQPVAKAEKPAASGVYTVEVEGKAFVVKVSDGGDVSQLTAAAPASAPAAAAPAG
FT                   AGTPVTAPLAGTIWKVLASEGQTVAAGEVLLILEAMKMETEIRAAQAGTVRGIAVKAGD
FT                   AVAVGDTLMTLA"
FT   gene            complement(34159..34410)
FT                   /gene="dcoC"
FT                   /locus_tag="KPN_00032"
FT   CDS_pept        complement(34159..34410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcoC"
FT                   /locus_tag="KPN_00032"
FT                   /product="Oxalacetate decarboxylase: gamma chain"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00032"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75492"
FT                   /db_xref="GOA:A6T4H1"
FT                   /db_xref="InterPro:IPR005899"
FT                   /db_xref="InterPro:IPR023424"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4H1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR005899"
FT                   /protein_id="ABR75492.1"
FT                   /translation="MTDNAILLGEGFTLMFLGMGFVLVFLLLLIFAIRGMSLAVNRLFS
FT                   EPPAAPKPAPAAVAPADDFARLKPAIVAAIHHHRRLHP"
FT   gene            complement(34566..35897)
FT                   /locus_tag="KPN_00033"
FT   CDS_pept        complement(34566..35897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00033"
FT                   /product="putative citrate-sodium symport"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00033"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75493"
FT                   /db_xref="GOA:A6T4H2"
FT                   /db_xref="InterPro:IPR004679"
FT                   /db_xref="InterPro:IPR018025"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4H2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004679"
FT                   /protein_id="ABR75493.1"
FT                   /translation="MSQAPATEKKGVSDLLGFKIFGMPLPLYAFALITLLLSHFYNALP
FT                   TDIVGGFAIMFIIGAIFGEIGKRLPIFNKYIGGAPVMIFLVAAYFVYAGIFTQKEIDAI
FT                   SNVMDKSNFLNLFIAVLITGAILSVNRRLLLKSLLGYIPTILMGIVGASIFGIAIGLVF
FT                   GIPVDRIMMLYVLPIMGGGNGAGAVPLSEIYHSVTGRSREEYYSTAIAILTIANIFAIV
FT                   FAAVLDIIGKKHTWLSGEGELVRKASFKVEEDEKAGQITHRETAVGLVLSTTCFLLAYV
FT                   VAKKILPSIGGVAIHYFAWMVLIVAALNASGLCSPEIKAGAKRLSDFFSKQLLWVLMVG
FT                   VGVCYTDLQEIINAITFANVVIAAIIVIGAVLGAAIGGWLMGFFPIESAITAGLCMANR
FT                   GGSGDLEVLSACNRMNLISYAQISSRLGGGIVLVIASIVFGMMI"
FT   gene            36163..37191
FT                   /gene="citC2"
FT                   /locus_tag="KPN_00034"
FT   CDS_pept        36163..37191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citC2"
FT                   /locus_tag="KPN_00034"
FT                   /product="putative citrate lyase synthetase (citrate
FT                   (pro-3S)-lyase ligase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00034"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75494"
FT                   /db_xref="GOA:A6T4H3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005216"
FT                   /db_xref="InterPro:IPR013166"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4H3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000182"
FT                   /protein_id="ABR75494.1"
FT                   /translation="MTLILKRVQLLKDKPRREAIDRFLRQHQLSLEADCEMAIIAEYQQ
FT                   RLVGCGAIAGNVLKCIAIDPSLQGEGLSLKLLTELLTLAYELGRSELFLFTKPCNAALF
FT                   SGAGFWPIAQAGDRAVLMENSRERLTRYCRQLAMYRQPGRKIGAIVMNANPFTLGHRWL
FT                   VEQAASQCDWLHLFVVKEDASCFSYHDRFKLIEQGITGIDKVTLHPGSAYLISRATFPG
FT                   YFLKEQGVVDDCHSQIDLQLFRERLAPALQITHRFVGTEPLCPLTRNYNQRMKSLLEAP
FT                   GDAPPIEVVELARIEKNGGPVSASRVRELYRQRNWQAVAALVPPGTLSFLMQLAESEHQ
FT                   TA"
FT   gene            37222..37515
FT                   /gene="citD2"
FT                   /locus_tag="KPN_00035"
FT   CDS_pept        37222..37515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citD2"
FT                   /locus_tag="KPN_00035"
FT                   /product="putative citrate lyase acyl carrier protein
FT                   (gamma chain)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00035"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75495"
FT                   /db_xref="GOA:A6T4H4"
FT                   /db_xref="InterPro:IPR006495"
FT                   /db_xref="InterPro:IPR023439"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4H4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR006495"
FT                   /protein_id="ABR75495.1"
FT                   /translation="MEMKIDALAGTLESSDVMVRIGPAAQPGIQLEIDSIVKQQFGAAI
FT                   EQVVRETLAQLGVKQANVVVDDKGALECVLRARVQAAALRAAQQTQLQWSQL"
FT   gene            37512..38381
FT                   /gene="citE2"
FT                   /locus_tag="KPN_00036"
FT   CDS_pept        37512..38381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citE2"
FT                   /locus_tag="KPN_00036"
FT                   /product="putative citrate lyase beta chain (acyl lyase
FT                   subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00036"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75496"
FT                   /db_xref="GOA:A6T4H5"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR006475"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4H5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75496.1"
FT                   /translation="MKPRRSMLFIPGANAAMLSTSFVYGADAVMFDLEDAVSLREKDTA
FT                   RLLVYQALQHPLYQDIETVVRINPLNTPFGLADLEAVVRAGVDMVRLPKTDSKEDIHEL
FT                   EAHVERIERECGREVGSTKLMAAIESALGVVNAVEIARASPRLAAIALAAFDYVMDMGT
FT                   SRGDGTELFYARCAVLHAARVAGIAAYDVVWSDINNEEGFLAEANLAKNLGFNGKSLVN
FT                   PRQIELLHQVYAPTRKEVDHALEVIAAAEEAETRGLGVVSLNGKMIDGPIIDHARKVVA
FT                   LSASGIRD"
FT   gene            38410..39918
FT                   /gene="citF2"
FT                   /locus_tag="KPN_00037"
FT   CDS_pept        38410..39918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citF2"
FT                   /locus_tag="KPN_00037"
FT                   /product="putativ bifunctional citrate lyase alpha
FT                   chain/citrate-ACP transferase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00037"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75497"
FT                   /db_xref="GOA:A6T4H6"
FT                   /db_xref="InterPro:IPR006472"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4H6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR006472"
FT                   /protein_id="ABR75497.1"
FT                   /translation="MLNQQYVMPNGLTPYAGVTAKSPWLASESEKRQRKICDSLETAIR
FT                   RSGLQNGMTISFHHAFRGGDKVVNMVVAKLAEMGFRDLTLASSSLIDAHWPLIEHIKNG
FT                   VIRQIYTSGLRGKLGEEISAGLMENPVQIHSHGGRVQLIQSGELSIDVAFLGVPCCDEF
FT                   GNANGFSGKSRCGSLGYARVDAEHAKCVVLLTEEWVDYPNYPASIAQDQVDLIVQVDEV
FT                   GNPQKITAGAIRLTSNPRELLIARQAAKVVEHSGYFKEGFSLQTGTGGASLAVTRFLED
FT                   KMRRNGITASFGLGGITGTMVDLHEKGLIKTLLDTQSFDGDAARSLAQNPNHVEISTNQ
FT                   YASPGSKGASCERLNVVMLSALEIDIDFNVNVMTGSNGVLRGASGGHSDTAAGADLTII
FT                   TAPLVRGRIPCVVEKVLTRVTPGASVDVLVTDHGIAVNPARQDLIDNLRSAGIPLMTIE
FT                   ELQQRAELLTGKPQPIEFTDRVVAVVRYRDGSVIDVIRQVKNSD"
FT   gene            39937..40845
FT                   /gene="citG2"
FT                   /locus_tag="KPN_00038"
FT   CDS_pept        39937..40845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citG2"
FT                   /locus_tag="KPN_00038"
FT                   /product="putative modifier of citrate lyase protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00038"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75498"
FT                   /db_xref="GOA:A6T4H7"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="InterPro:IPR017551"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4H7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002736"
FT                   /protein_id="ABR75498.1"
FT                   /translation="MSDVLINPARVRRVKPLSAEEVVSAVERALLTEVRLTPKPGLVDI
FT                   RNAGAHWDMDLASFEASTAVVAPWMEKFFIMGHDTAAVAPEQVLMMLRPVGMACENDML
FT                   EATGGVNTHRGAIFAFGLLSAAAGRLVSKGEPIEQHRLCDQVARFCRGMVMQELSSAGG
FT                   ERLSKGEAHFLRYGLSGARGEAESGFLTVRTQAMPVFTRMMEETGDSNLALLQTLLHLM
FT                   AWNDDTNLVSRGGLAGLNFVQQEAQRLLWQGGVLADGGLEALRQFDDELIARHLSPGGS
FT                   ADLLAVTWFLSAFPAGALFPL"
FT   gene            41074..41895
FT                   /gene="dapB"
FT                   /locus_tag="KPN_00039"
FT   CDS_pept        41074..41895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="KPN_00039"
FT                   /product="dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00039"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75499"
FT                   /db_xref="GOA:A6T4H8"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4H8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000846"
FT                   /protein_id="ABR75499.1"
FT                   /translation="MHDAQIRVAIAGAGGRMGRQLIQAALQMEGVALGAALEREGSSLV
FT                   GSDAGELAGAGKAGVAVQSSLAAVKDDFDVLIDFTRPEGTLNHLAFCREHGKGMVIGTT
FT                   GFDDAGKQAIRDAAQDIAIVFAANFSVGVNVLLKLLEKAAKVMGDYTDIEIIEAHHRHK
FT                   VDAPSGTALAMGEAIAGALNKDLKDCAVYSREGYTGERVPGTIGFATVRAGDIVGEHTA
FT                   MFADIGERIEITHKASSRMTFANGAVRSALWLKGKKNGLFDMRDVLDLNSL"
FT   gene            42326..43501
FT                   /gene="carA"
FT                   /locus_tag="KPN_00040"
FT   CDS_pept        42326..43501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="KPN_00040"
FT                   /product="carbamoyl-phosphate synthase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00040"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75500"
FT                   /db_xref="GOA:A6T4H9"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4H9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000991"
FT                   /inference="protein motif:Pfam:IPR002474"
FT                   /protein_id="ABR75500.1"
FT                   /translation="MSGYSLEDVLIKSALLVLEDGTQFHGRAIGATGTAVGEVVFNTSM
FT                   TGYQEILTDPSYSRQIVTLTYPHIGNVGTNAADEESSQVHAQGLVIRDLPLIASNFRST
FT                   EDLSSYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIAGDSPDAQLALEKAKAFPGLN
FT                   GMDLAKEVTTAETYSWTQGSWTLAGDLPEAKAESELPFHVVAYDFGAKRNILRMLVDRG
FT                   CRLTVVPAKTSAADVLALNPDGIFLSNGPGDPAPCDYAIEAIEKFLETDIPVFGICLGH
FT                   QLLALASGAKTIKMKFGHHGGNHPVKDIDNNVVMITAQNHGFAVDEATLPANLRVTHKS
FT                   LFDGTLQGIHRTDKPAFSFQGHPEASPGPHDAAPLFDHFIELIELYRQSAK"
FT   gene            43661..46885
FT                   /gene="carB"
FT                   /locus_tag="KPN_00041"
FT   CDS_pept        43661..46885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="KPN_00041"
FT                   /product="carbamoyl-phosphate synthase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00041"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75501"
FT                   /db_xref="GOA:A6T4I0"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4I0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004362"
FT                   /inference="protein motif:Pfam:IPR005479"
FT                   /inference="protein motif:Pfam:IPR005481"
FT                   /protein_id="ABR75501.1"
FT                   /translation="MPKRTDIKSILILGAGPIVIGQACEFDYSGAQACKALREEGYRVI
FT                   LVNSNPATIMTDPEMADATYIEPIHWEVVRKIIEKERPDAVLPTMGGQTALNCALELER
FT                   QGVLAEFGVTMIGATADAIDKAEDRRRFDIAMKKIGLDTARSGIAHTMEEALAVAADVG
FT                   FPCIIRPSFTMGGTGGGIAYNREEFEEICERGLDLSPTNELLIDESLIGWKEYEMEVVR
FT                   DKNDNCIIVCSIENFDAMGIHTGDSITVAPAQTLTDKEYQIMRNASMAVLREIGVETGG
FT                   SNVQFAVNPKNGRLIVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLDELMNDIT
FT                   GGRTPASFEPSIDYVVTKIPRFNFEKFAGANDRLTTQMKSVGEVMAIGRTQQESLQKAL
FT                   RGLEVGATGFDPKVSLDDPEALTKIRRELKDAGAERIWYIADAFRAGLSVDGVFNLTNI
FT                   DRWFLVQIEELVRLEEKVAEVGINGLDADFLRTLKRKGFADARLAKLAGVREAEIRKLR
FT                   DQYDLHPVYKRVDTCAAEFATDTAYMYSTYEEECESNPSVDRDKIMVLGGGPNRIGQGI
FT                   EFDYCCVHASLALREDGYETIMVNCNPETVSTDYDTSDRLYFEPVTLEDVLEIVRIEKP
FT                   KGVIVQYGGQTPLKLARALEAAGVPVIGTSPDAIDRAEDRERFQHAVDRLKLKQPANAT
FT                   VTAIEQAVEKAKEIGYPLVVRPSYVLGGRAMEIVYDEQDLRRYFQTAVSVSNDAPVLLD
FT                   RFLDDAIEVDVDAICDGEMVLIGGIMEHIEQAGVHSGDSACSLPAYTLSKEIQDVMREQ
FT                   VQKLAFELQVRGLMNVQFAVKDNEVYLIEVNPRAARTVPFVSKATGVPLAKVAARVMAG
FT                   KTLAQQGVTKEIIPPYYSVKEVVLPFNKFPGVDPLLGPEMRSTGEVMGVGRTFAEAFAK
FT                   AQLGSNSTMKKQGRALLSVREGDKERVVDLAAKLLKFGFELDATHGTAIVLGEAGINPR
FT                   LVNKVHEGRPHIQDRIKNGEYTYIINTTAGRQAIEDSKLIRRSALQYKVHYDTTLNGGF
FT                   ATAMALNADATEKVISVQEMHAQITK"
FT   gene            47055..47288
FT                   /gene="ygdI"
FT                   /locus_tag="KPN_00042"
FT   CDS_pept        47055..47288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygdI"
FT                   /locus_tag="KPN_00042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00042"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75502"
FT                   /db_xref="InterPro:IPR010305"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4I1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR010305"
FT                   /protein_id="ABR75502.1"
FT                   /translation="MRNNILVASALAATAIMFVAGCSSNQSIKTTDGKTIVTSGKPQVD
FT                   DDTGLVSYKNAETGRVEQINRDQVKSMDELDN"
FT   gene            47477..47953
FT                   /gene="yabF"
FT                   /locus_tag="KPN_00043"
FT   CDS_pept        47477..47953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabF"
FT                   /locus_tag="KPN_00043"
FT                   /product="glutathione-regulated potassium-efflux system
FT                   ancillary protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00043"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75503"
FT                   /db_xref="GOA:A6T4I2"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023948"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4I2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003680"
FT                   /protein_id="ABR75503.1"
FT                   /translation="MLEQAGTLEGVEIRSLYQLYPDFNIDVAAEQAALARADLVIWQHP
FT                   MQWYSVPPLLKLWMDKVLSHGWAYGHNGIALRGKSLMWAVTTGGGESHFDIGSFPGFPV
FT                   LAQPLQATALYCGMKWLPPFAMHCTFICDDETLQAQARRYRQRLIDWQEAHQNG"
FT   gene            47946..49811
FT                   /gene="kefC"
FT                   /locus_tag="KPN_00044"
FT   CDS_pept        47946..49811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kefC"
FT                   /locus_tag="KPN_00044"
FT                   /product="glutathione-regulated potassium-efflux system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00044"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75504"
FT                   /db_xref="GOA:A6T4I3"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR023941"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4I3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003148"
FT                   /protein_id="ABR75504.1"
FT                   /translation="MDSHTLIQALIYLGAAALIVPIAVRLGLGSVLGYLIAGCIIGPWA
FT                   LRLVTDAEAILHFAEIGVVLMLFVIGLELDPQRLWKLRASVFGGGALQMVACGVLIGLF
FT                   CMLLGLRWQVAELIGMTLALSSTAIAMQAMNERNLTVSQMGRSAFAVLLFQDIAAIPLV
FT                   AMIPLLAASGGATSLMAFALSALKVAAALALVVVLGRYLTRPLLRFVARSGLREVFSAV
FT                   ALFLVFGFGLLLEEVGLSMAMGAFLAGVLLASSEYRHALESDIEPFKGLLLGLFFIGVG
FT                   MSIDFGTLVTHPLRIVILLVGFLAIKMLMLWLIARPLGVPRAQRRWFAVLLGQGSEFAF
FT                   VVFGAARMADVLDGEWAKALTLAVALSMAATPILLVLLTRLEKSSSGQARDADEIDEEQ
FT                   PRVIVAGFGRFGQIAGRLLLSSGVKMVILDHDPDHVDTLRKFDMKVFYGDATRVDLLES
FT                   AGAEKAEVLINAIDDPHVSLELVARVKEHFPHLQIISRARDVDHYIQLRQAGVEAPERE
FT                   TFEAALKSGRMTLEALGLGAYEARERADLFRRFNLQMVEEMVAMAENDAASRVAVFKRT
FT                   SDMLTGIINEDRHHLSLVQRHGWQGTEEGRHTGDIADEPENKPSA"
FT   gene            49985..50464
FT                   /gene="folA"
FT                   /locus_tag="KPN_00045"
FT   CDS_pept        49985..50464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="KPN_00045"
FT                   /product="dihydrofolate reductase type I, trimethoprim
FT                   resistance"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00045"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75505"
FT                   /db_xref="GOA:A6T4I4"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4I4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001796"
FT                   /protein_id="ABR75505.1"
FT                   /translation="MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVVMGRL
FT                   TWESIGRPLPGRKNIVISSKPGSDDRVQWVSSVEEAIAACGDVEEIMVIGGGRVYEQFL
FT                   PKAQKLYLTHIDAEVEGDTHFPDYDPDEWESVFSEFHDADAQNSHSYCFEILERR"
FT   gene            complement(50717..51565)
FT                   /gene="apaH"
FT                   /locus_tag="KPN_00046"
FT   CDS_pept        complement(50717..51565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaH"
FT                   /locus_tag="KPN_00046"
FT                   /product="diadenosinetetraphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00046"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75506"
FT                   /db_xref="GOA:A6T4I5"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4I5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004843"
FT                   /protein_id="ABR75506.1"
FT                   /translation="MSTYLIGDVHGCYDELIALLAQVEFDPRRDTLWLTGDLVARGPGS
FT                   LEVLRYVKSLGDSVRLVLGNHDLHLLAVFAGISRNKPKDRLKPLLEAPDADELLNWLRR
FT                   QPLLQVDEEKKLVMAHAGITPQWDLETAQQCARDVEAVLSSDSYPFFLDAMYGDMPNHW
FT                   SNELSGLARLRFISNAFTRMRYCFPNGQLDMYSKEAPEDAPAPLKPWFAIPGPVSNAYS
FT                   IAFGHWASLEGRGTPEGIYALDTGCCWGGELTCLRWEDKQYFTQPSNRQKSLDEGEAVA
FT                   S"
FT   gene            complement(51570..51929)
FT                   /gene="apaG"
FT                   /locus_tag="KPN_00047"
FT   CDS_pept        complement(51570..51929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaG"
FT                   /locus_tag="KPN_00047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00047"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75507"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4I6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR007474"
FT                   /protein_id="ABR75507.1"
FT                   /translation="MCVQVQSVYIESQSSPEEERYVFAYTVTIRNLGRSQVQLLGRYWL
FT                   ITNGHGRETEVQGEGVVGEQPYIPAGGEYQYTSGAVIETPLGTMQGHYEMIDIDGAPFR
FT                   IEIPVFRLAVPTLIH"
FT   gene            complement(51950..52771)
FT                   /gene="ksgA"
FT                   /locus_tag="KPN_00048"
FT   CDS_pept        complement(51950..52771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="KPN_00048"
FT                   /product="dimethyladenosine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00048"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75508"
FT                   /db_xref="GOA:A6T4I7"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4I7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001737"
FT                   /protein_id="ABR75508.1"
FT                   /translation="MNNRVHQGHLARKRFGQNFLNDQFVIDSIVSAINPQKGQAMVEIG
FT                   PGLAALTEPVGERLDQLTVIELDRDLAARLQTHPFLGPKLTIYQQDAMTMNFGELAEKM
FT                   GQPLRVFGNLPYNISTPLMFHLFSYTDAIADMHFMLQKEVVNRLVAGPNSKAYGRLSVM
FT                   AQYYCQVIPVLEVPPSAFTPPPKVDSAVVRLVPHSTMPYPVKEIRVLSRITTEAFNQRR
FT                   KTIRNSLGNLFSVEVLTELGIDPAMRAENISVAQYCLMANWLSDNLPTKES"
FT   gene            complement(52768..53757)
FT                   /gene="pdxA"
FT                   /locus_tag="KPN_00049"
FT   CDS_pept        complement(52768..53757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="KPN_00049"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00049"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75509"
FT                   /db_xref="GOA:A6T4I8"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4I8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR005255"
FT                   /protein_id="ABR75509.1"
FT                   /translation="MPETRKVVITPGEPAGIGPDLVVQLAQRDWPVELVICADGALLTD
FT                   RAKRLGLPLSLLPYDPAQPPVPQRAGTLTLLNVPLNVPAEPGVLNVQNGAYVVETLARA
FT                   CDGCLSGEFAALVTGPVHKGNINDAGIAFTGHTEFFEERAKASKVVMMLATEELRVALV
FT                   TTHLPLKAISEAITPELLREIITILDHDLRTKFGIAQPHVLVCGLNPHAGEGGHMGTEE
FT                   IDTIIPVLEEMRTKGMNLSGPLPADTLFQPKYLDHADAVLAMYHDQGLPVLKYQGFGRG
FT                   VNITLGLPFIRTSVDHGTALELAGQGKADVGSFITALNLAIKMIVNTQ"
FT   gene            complement(53763..55049)
FT                   /gene="surA"
FT                   /locus_tag="KPN_00050"
FT   CDS_pept        complement(53763..55049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surA"
FT                   /locus_tag="KPN_00050"
FT                   /product="peptidyl-prolyl cis-trans isomerase (PPIase)"
FT                   /note="involved in maturation of outer membrane proteins"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00050"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75510"
FT                   /db_xref="GOA:A6T4I9"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023034"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4I9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000297"
FT                   /protein_id="ABR75510.1"
FT                   /translation="MKNWKTLLLGIAMIANTSFAAPQVVDKVAAVVNNGVVLESDVDGL
FT                   MQSVKLNAGQAGQQLPDDATLRHQILERLIMDQIVLQMGQKMGVKISDDQLDQAIANIA
FT                   KQNNMTLDQMRSRLAYEGINYNTYRNQIRKEMLISEVRNNEVRRRITVLPQEVEALAKQ
FT                   IGDQNDASTELNLSHILIPLPENPTSDEVAAAQEQANSIVEQARNGANFGKLAITYSAD
FT                   QQALKGGQMGWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFHILKVNDLRGGTQNIS
FT                   VTEVHARHILLKPSPIMNDAQAQAKLEQIAAEIKSGKITFAQAAKTYSEDPGSANQGGD
FT                   LGWATPDIFDPAFRDALMRLNKGQTSGPVHSSFGWHLIELLDSRQVDRTDAAQKDRAYR
FT                   MLMNRKFSEEAATWMQEQRASAYVKILSN"
FT   gene            complement(55104..57452)
FT                   /gene="imp"
FT                   /locus_tag="KPN_00051"
FT   CDS_pept        complement(55104..57452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="imp"
FT                   /locus_tag="KPN_00051"
FT                   /product="organic solvent tolerance protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00051"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75511"
FT                   /db_xref="GOA:A6T4J0"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4J0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR007543"
FT                   /protein_id="ABR75511.1"
FT                   /translation="MKKRIPSLLATMIASALYSQQGLAADLATQCMLGVPSYDRPLVEG
FT                   RPGDLPVTINADHAKGNYPDNAVFTGNVDINQGNSRLRADEVQLHQQQAAGQAQPVRTV
FT                   DALGNVHYDDNQVILKGPKAWSNLNTKDTNVWQGDYQMVGRQGRGTADLMKQRGENRYT
FT                   ILENGSFTSCLPGSDTWSVVGSEVIHDREEQVAEIWNARFKLGSVPIFYSPYLQLPVGD
FT                   KRRSGFLIPNAKYSTKNGVEFSLPYYWNIAPNFDATITPHYMNKRGGVMWENEFRYLTQ
FT                   LGSGLTEFDYLPSDKVYEDDHSSDSNSRRWLFYWNHSGVIDQVWRLNADYTKVSDPDYF
FT                   NDFSSKYGSSTDGYATQKFSAGYVNQNFDATVSTKQFQVFDRESSNSYSAEPQLDVNYY
FT                   QNDVGPFDTHLYGQVAHFVNSNNNMPEATRVHFEPTINLPLSNGWGSLNTEAKLLATHY
FT                   QQSNLDKYNAANGTDYKESVSRVMPQFKVDGKMVFERDLQEGFTQTLEPRVQYLYVPYR
FT                   DQSEIGNYDSTLLQSDYTGLFRDRTYSGLDRIASANQVTTGLTSRVYDAAAVERFNISV
FT                   GQIYYFTESRTGDDNINWENNDTTGSLVWAGDTYWRIADEWGLRGGIQYDTRLDNVATG
FT                   NGTIEYRRDENRLVQLNYRYASPEYIQATLPSYSTAAQYKQGISQVGMTASWPIVDRWS
FT                   VVGAYYYDTNTRKAANQMLGVQYNSCCYAIRLGYERKVNGWNSNDNGGESKYDNTFGIN
FT                   IELRGLSSNYGLGTQQMLRSNILPYQSSL"
FT   gene            57696..58523
FT                   /gene="djlA"
FT                   /locus_tag="KPN_00052"
FT   CDS_pept        57696..58523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="djlA"
FT                   /locus_tag="KPN_00052"
FT                   /product="Dna-J like membrane chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00052"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75512"
FT                   /db_xref="GOA:A6T4J1"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR023749"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4J1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001623"
FT                   /protein_id="ABR75512.1"
FT                   /translation="MQYLGKVIGVAVALLMGGGFWGVVLGFLVGHMFDRARSRRLNLFA
FT                   NQQERQSLFFSTTFEVMGHLTKSKGRVTEADIHVANVLMDRMNLHGASRTAAQQAFRDG
FT                   KADNYPLREKMRQLRSVCFGRFDLIRMFLEIQLQAAFADGELHPNEREVLFVIADELGI
FT                   SRAQFDQFLRMMQGGAQFGGGSQQRSYGQHGGNAGWQQAQRGPTLEDACNVLGVKPTDD
FT                   AATVKRAYRKLMNEHHPDKLVAKGLPPEMMEMAKQKAQEIQKAWELIKEQRGF"
FT   gene            complement(58556..59254)
FT                   /locus_tag="KPN_00053"
FT   CDS_pept        complement(58556..59254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00053"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00053"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75513"
FT                   /db_xref="GOA:A6T4J2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="InterPro:IPR028141"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4J2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001789"
FT                   /protein_id="ABR75513.1"
FT                   /translation="MHHDLVDVLIIEDESELARLHAELVQKHPRLRLAGMAASLAQARQ
FT                   LLHATPPQLVLLDNYLPDGKGVTLMTDPALATSQCSVIFITAASDMETCSQAIRNGAFD
FT                   YILKPVSWKRLSQSLERFIQFYDQQREWKIVDQQNVDSLYQLQAKNYRVDSGSKGIEEK
FT                   TLALVQGLFSDREAHCFSVDEVVSAAGLSKTTARRYLEHGVETGFLEVEMLYGKIGHPR
FT                   RLYRRAKVKS"
FT   gene            complement(59244..60869)
FT                   /locus_tag="KPN_00054"
FT   CDS_pept        complement(59244..60869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00054"
FT                   /product="two-component sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00054"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75514"
FT                   /db_xref="GOA:A6T4J3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4J3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003594"
FT                   /protein_id="ABR75514.1"
FT                   /translation="MKLSFQYKLFISLVAFFSVLFIALGIYYYFDASRQLYQEMSARAK
FT                   IQAEEIALMPNLRQQVSRHDPQAIQAFMQQIAAHSDASFIVIGDRQGVHLFHSVHPEWV
FT                   GTRLVGGDNQAVLEGKSITTIRKGGLGVSLRSKTPIVDDAGRVIGIVSVGYLTSYLDSI
FT                   TLTKVINIFIAAVLLLIALFIFSWYFTRSIKKQIFSLEPREIGLLVRQQKAMMESIFEG
FT                   VIVIDRQRRIEVINHAARSLLGLSQPARQLRGQSIDSVISPQPFFASGDMLERDTHDEL
FT                   CRFNQLTVLASRVRIMLENTLQGWVITFRDRNEINALTAQLSQVKRYVDNLRIMRHEQL
FT                   NRMTTLSGLLHMGHYDEAIRYIQAQSEHAQELLDFISSHFHSPTLCGLLLGKATRAREK
FT                   GVALSFDPACRIDRPLPSLMESELISIIGNLLDNAIEATQRAELPHEPVEVLIQLNARE
FT                   LIIEVADRGVGIRPDIRERIFERGVTTKTRGDHGIGLYLIEHYVTQAGGTIEVADNAPR
FT                   GTIFTLFIPADAHACPQPEAHDAS"
FT   gene            61194..62558
FT                   /locus_tag="KPN_00055"
FT   CDS_pept        61194..62558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00055"
FT                   /product="citrate/acetate antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00055"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75515"
FT                   /db_xref="GOA:A6T4J4"
FT                   /db_xref="InterPro:IPR004679"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4J4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004679"
FT                   /protein_id="ABR75515.1"
FT                   /translation="MSTTDNAFSATLEPIDTPKTTLKQRWWHIMDNWKVGIVPLPLFLL
FT                   AGGLIALDCLGGKLPSDIVVMVATLAFFGFACGEFGKRLPVLGKLGAAAICATFIPSAL
FT                   VHYGLLPDVVIESTTKFYKSTNILYLYICCIIVGSIMSMNRTTLIQGFLKIFFPMLCGE
FT                   VVGMLVGIGVGTLLGMEPFQVFFFIVLPIMAGGVGEGAIPLSMGYAALMHMEQGVALGR
FT                   VLPMVMLGSLTAIVISGCLNQLGKRFPHLTGEGQLMPNRSHETRSLSESEGVSGKTDVG
FT                   TLASGALLAVLLYMMGMLGHKLIGLPAPVGMLFLAVLLKLANVVSPRLQEGSQMVYKFF
FT                   RTAVTYPILFAVGVAITPWQELVNAFTLTNLLVIVSTVSALVATGFLVGKKIGMHPIDV
FT                   AIVSCCQSGQGGTGDVAILTAGNRMSLMPFAQIATRIGGAINVSLGLLFLSHYLA"
FT   gene            62738..63277
FT                   /locus_tag="KPN_00056"
FT   CDS_pept        62738..63277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00056"
FT                   /product="phosphoribosyl-dephospho-CoA transferase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00056"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75516"
FT                   /db_xref="GOA:A6T4J5"
FT                   /db_xref="InterPro:IPR005551"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4J5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR005551"
FT                   /protein_id="ABR75516.1"
FT                   /translation="MSVDTPAQAGVSIDALLAAKEQRAARQADWLAHYQQPVISLTLVT
FT                   PGAVKDSIRYRNMMGVALQACDQLLWKHRWQTLDRQVLWLPTGPEALWCVAHPASEIKA
FT                   MCSTLEQSHPLGRLWDIDVICPQNGLVGRQSLGESQRRCLLCDEPAHACARSRRHDTDL
FT                   VVARVEQMIDAWFARD"
FT   gene            complement(63352..64011)
FT                   /gene="rluA"
FT                   /locus_tag="KPN_00057"
FT   CDS_pept        complement(63352..64011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluA"
FT                   /locus_tag="KPN_00057"
FT                   /product="23S rRNA pseudouridylate 746 synthase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00057"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75517"
FT                   /db_xref="GOA:A6T4J6"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4J6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR006145"
FT                   /protein_id="ABR75517.1"
FT                   /translation="MAMENYNPPQDPWLVILYQDEHIMVVNKPSGLLSVPGRLEEHKDS
FT                   VMTRIQRDFPQAESVHRLDMATSGVIVVALNKAAERELKRQFREREPKKQYVARVWGHP
FT                   QPAEGLVDLPLICDWPNRPMQKVCYETGKAAQTEYEVLEYAEDNTARVRLKPITGRSHQ
FT                   LRVHMLALGHPILGDRFYATPEALAMAPRLLLHAETLTITHPAYGNAMTFRAPIDF"
FT   gene            complement(64024..66930)
FT                   /gene="hepA"
FT                   /locus_tag="KPN_00058"
FT   CDS_pept        complement(64024..66930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hepA"
FT                   /locus_tag="KPN_00058"
FT                   /product="ATP-dependent helicase HepA"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00058"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75518"
FT                   /db_xref="GOA:A6T4J7"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022737"
FT                   /db_xref="InterPro:IPR023949"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="InterPro:IPR040765"
FT                   /db_xref="InterPro:IPR040766"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4J7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000330"
FT                   /inference="protein motif:Pfam:IPR001650"
FT                   /inference="protein motif:Pfam:IPR006935"
FT                   /protein_id="ABR75518.1"
FT                   /translation="MPFTLGQRWISDTESELGLGTVVALDARMVTLLFPAIGENRLYSR
FT                   NDSPITRVMFNPGDTITSHEGWQLHVDKVNEENGLLSYTGTRLDTQEANVTLREVLLDS
FT                   KLVFSKPQDRLFAGQIDRMDRFALRYRARKFQSEQYRMPWSGLRGQRTSLIPHQLHIAH
FT                   DVGRRHAPRVLLADEVGLGKTIEAGMILHQQLLSGAAERVLIVVPETLQHQWLVEMLRR
FT                   FNLRFSLFDDERYAEAQHDAYNPFETEQLVICSLDFVRRSKQRLEHLCDAEWDLMVVDE
FT                   AHHLVWSEEAPSREYQAIEQLAERVPGILLLTATPEQLGMESHFARLRLLDPNRFHDFE
FT                   QFVEEQQNYRPVADAVALLLAGNKLSDSELNTLGDLIGEQDIEPLLQAANSDREDAQAA
FT                   RQELISMLMDRHGTSRVLFRNTRNGVKGFPKRELHTIRLPLPTQYQTAIKVSGIMGARK
FT                   TAEERARDMLYPEQIYQEFEGDTGTWWNFDPRVEWLMGYLTSHRSQKVLVICAKAATAL
FT                   QLEQVLREREGIRAAVFHEGMSIIERDRAAAWFAEEDTGAQVLLCSEIGSEGRNFQFAS
FT                   NLVMFDLPFNPDLLEQRIGRLDRIGQAHDIQIHVPYLEKTAQSVLVRWYHEGLDAFEHT
FT                   CPTGRTVYDSVHDELINYLAAPESIDGFDDLIKSCRQQHDALKAQLEQGRDRLLEIHSN
FT                   GGEKAQALAESIEEQDDDTSLIAFSMNLFDIVGINQDDRGENLIVLTPSDHMLVPDFPG
FT                   LPEDGCTITFERDVALSREDAQFITWEHPLIRNGLDLILSGDTGSSTISLLKNKALPVG
FT                   TLLLELIYVVEAQAPKQLQLNRFLPATPVRMLLDKNGNNLAAQVEFESFNRQLSAVNRH
FT                   TGSKLVNAVQQDVHAILQQGEAQIAKAAQGLIDAARNEADEKLTAELSRLEALKAVNPN
FT                   IRDDELAAIESNRQQVMDALAQAGWRLDALRLIVVTHQ"
FT   gene            complement(67118..69475)
FT                   /gene="polB"
FT                   /locus_tag="KPN_00059"
FT   CDS_pept        complement(67118..69475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polB"
FT                   /locus_tag="KPN_00059"
FT                   /product="DNA polymerase II"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00059"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75519"
FT                   /db_xref="GOA:A6T4J8"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR042087"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4J8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR006133"
FT                   /inference="protein motif:Pfam:IPR006134"
FT                   /protein_id="ABR75519.1"
FT                   /translation="MTQPRAGFLLTRHWRDTPQGTELSFWLATDDGPLQVTLPPQESVA
FT                   FIPEAQRAQAERLLQGEKGLRFAPLALKDFHRQPIVGLYCRAHRQLMRLEKMLRDSGVT
FT                   VYEGDIRPPERYLMERFITAPVWVEGETRGSQLVNARMKPNPDYRPPLKWVSLDIETSR
FT                   HGELYCIGLEGCGQRVVYMLGPEPETPPDVDFELVFIASRPLLLEKLNAWFAEHDPDVL
FT                   IGWNVVQFDLRVLQKHAERYRIPLRLGRGNSELEWREHGFKNGVFFAQANGRLIIDGID
FT                   ALKSAFWNFSSFSLEAVARELLGEGKAIDNPWDRMDEIDRRFHEDKPALAIYNLQDCEL
FT                   VTRIFHKTEIMPFLLERATVNGLPADRHGGSVAAFSHLYFPRMHRLGYVAPNLGDVPPQ
FT                   ASPGGYVMDSRPGLYDSVLVLDYKSLYPSIIRTFLIDPVGLVEGLAQPDDQHSIEGFLG
FT                   ARFSRDKHCLPGIVSQIWHGRDEAKRQHNKPLSQALKIIMNAFYGVLGTSACRFFDPRL
FT                   ASSITMRGHAIMRQTKALIEAKGYDVIYGDTDSTFVWLKRPHSEAQAAKIGRELVSDVN
FT                   AWWAQELSKSQLTSALELEYETHFCRFLMPTIRGADTGSKKRYAGMIQEGDAQRMVFKG
FT                   LETVRTDWTPLAQQFQQELYLRIFRNQPYQDYVRETIARLMNGELDEQLVYRKRLRRPL
FT                   AEYQRNVPPHVRAARLADEHNLKLGRAQQYQQRGTIKYVWTTSGPEPVDYQQSPLDYDH
FT                   YLTKQLQPVAEGILPFVNDDFATIVTGQLGLF"
FT   gene            complement(69651..70346)
FT                   /gene="araD"
FT                   /locus_tag="KPN_00060"
FT   CDS_pept        complement(69651..70346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araD"
FT                   /locus_tag="KPN_00060"
FT                   /product="L-ribulose-5-phosphate 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00060"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75520"
FT                   /db_xref="GOA:A6T4J9"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR004661"
FT                   /db_xref="InterPro:IPR033748"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4J9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001303"
FT                   /protein_id="ABR75520.1"
FT                   /translation="MLEDLKRQVLEANLALPKHNLVTLTWGNVSAVDREKGVFVIKPSG
FT                   VDYRVMTADDMVVVSLESGEVVEGNKKPSSDTPTHRLLYQDFPTLGGIVHTHSRHATIW
FT                   AQAGQSIPATGTTHADYFYGPVPCTRLMTDAEINGDYEWETGNVIVETFRQQGIDPAQM
FT                   PGVLVHSHGPFAWGKNAEDAVHNAIVLEEIAYMGIFCRQLAPQLPAMQQTLLDKHYLRK
FT                   HGAKAYYGQ"
FT   gene            complement(70484..71986)
FT                   /gene="araA"
FT                   /locus_tag="KPN_00061"
FT   CDS_pept        complement(70484..71986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araA"
FT                   /locus_tag="KPN_00061"
FT                   /product="L-arabinose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00061"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75521"
FT                   /db_xref="GOA:A6T4K0"
FT                   /db_xref="InterPro:IPR003762"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR024664"
FT                   /db_xref="InterPro:IPR038583"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4K0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003762"
FT                   /protein_id="ABR75521.1"
FT                   /translation="MTIFDNYEVWFVIGSQHLYGPEALRQVTKHAEHVVNSLNAEAKLP
FT                   CKLVLKPLGTTPDEITHICRDANYDDKCAGLVVWLHTFSPAKMWINGLTILNKPLLQFH
FT                   TQYNAALPWDSIDMDFMNLNQTAHGGREFGFIGARMRQQHSVVTGHWQDKEAHQRIGGW
FT                   MRQAVSKQDTRHLKVCRFGDNMREVAVTDGDKVAAQIKFGFSVNTWAVGDLVQVVNSIS
FT                   DGDISALVDEYESSYRLTPAAQVHGDKRQNVLDAARIELGMKRFLEQGGFHAFTTTFED
FT                   LHGLKQLPGLAVQRLMQQGYGFAGEGDWKTAALLRIMKVMSTGLQGGTSFMEDYTYHFD
FT                   NGNDLVLGSHMLEVCPTIATAEKPILDVQPLGIGGKADPARLIFNTQTGPAIVASLIDL
FT                   GDRFRLLVNTIETVPTPHDLPKLPVANALWKAQPDLRTASEAWIIAGGAHHTVFSHALN
FT                   LDDMRQFAELHDIELTVIDNDTRLPSFKDALRWNEVYYGSKR"
FT   gene            complement(71997..73706)
FT                   /gene="araB"
FT                   /locus_tag="KPN_00062"
FT   CDS_pept        complement(71997..73706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araB"
FT                   /locus_tag="KPN_00062"
FT                   /product="ribulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00062"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75522"
FT                   /db_xref="GOA:A6T4K1"
FT                   /db_xref="InterPro:IPR005929"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4K1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000577"
FT                   /protein_id="ABR75522.1"
FT                   /translation="MAIAIGLDFGSDSVRALAVECASGAELATSVEWYPRWREGQYCDG
FT                   ANNRFRHHPRDYIESMEAALKSVLASLSAEQRADVVGIGVDSTGSTPAPVDAEGNVLAL
FT                   REEFADNPNAMFVLWKDHTAVEEAEAITRLCHQPGKEDYSRYIGGIYSSEWFWAKILHV
FT                   TREDSAVAQAAASWVELCDWVPALLSGTTRPQDLRRGRCSAGHKSLWHESWGGLPPASF
FT                   FDELDPIINQHLAWPLFTDTWTADVPVGTLSAEWAQRLGLSQSVAISGGAFDCHMGAVG
FT                   AGAQPNALVKVIGTSTCDILIADKESVGERTVKGICGQVDGSVVPHFIGMEAGQSAFGD
FT                   IYAWFGRILGWPLEQLAQQQPALREQIKASQKQLLPALTEAWANNPSLEHLPVVLDWFN
FT                   GRRTPNANQRLKGVITDLNLATDAPALFGGLIAATAFGARAIMECFTEQGIPVNNVMAL
FT                   GGIARKNQVIMQACCDVLNRPLQIVASDQCCALGAAIFAAVAAGVYDDIPAAQQRMASQ
FT                   VETTLQPRPAQAQRFEQLYQRYQQWSVSAEQHYLPSAAKAEKAPQSQAALTH"
FT   gene            74044..74889
FT                   /gene="araC"
FT                   /locus_tag="KPN_00063"
FT   CDS_pept        74044..74889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araC"
FT                   /locus_tag="KPN_00063"
FT                   /product="transcriptional regulator for ara operon"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00063"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75523"
FT                   /db_xref="GOA:A6T4K2"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4K2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000005"
FT                   /inference="protein motif:Pfam:IPR003313"
FT                   /protein_id="ABR75523.1"
FT                   /translation="MAETQNDPLLPGYSFNAHLVTGLTPIEAQGYLDFFIDRPLGMKGY
FT                   ILNLTIRGEGVINNHGEQFVCRPGDMLLFPPGEIHHYGRHPDASEWYHQWVYFRPRAYW
FT                   HEWLNWPTIFAQTGFFRPDEQWQARFGELFGQIVDAGQGAGRYSELLAINLLEQLLLRR
FT                   MEAINESLHPPLDNRVRDACQYISDHLADSHFDIASVAQHVCLSPSRLSHLFRQQLGVS
FT                   VLGWREDQRISQAKLLLSTTRMPIATVGRNVGFEDQLYFSRVFKKCTGASPSEFRAGCE
FT                   "
FT   gene            75018..75785
FT                   /gene="yabI"
FT                   /locus_tag="KPN_00064"
FT   CDS_pept        75018..75785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabI"
FT                   /locus_tag="KPN_00064"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00064"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75524"
FT                   /db_xref="GOA:A6T4K3"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4K3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000252"
FT                   /protein_id="ABR75524.1"
FT                   /translation="MQALLEHFITQSTVYSLLAVMLVAFLESLALVGLILPGTVMMAGL
FT                   GALIGGGEVNFWQAWLAGIVGCLLGDWISFWLGWRFKKPLHRWSFMKKNRALLEKTEHA
FT                   LHQHSMITILIGRFVGPTRPLVPMVAGMLDLPVAKFVLPNIIGCLLWPPLYFLPGILAG
FT                   AAIDIPADENSASFKWLLLGAALLAWLAGWLCWRLWRSAKTSGDRLTRWLPRGRLLWLS
FT                   PLMVALAATALTFVFRHPLMPVYLAILHKVIAR"
FT   gene            complement(75772..76473)
FT                   /gene="yabJ"
FT                   /locus_tag="KPN_00065"
FT   CDS_pept        complement(75772..76473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabJ"
FT                   /locus_tag="KPN_00065"
FT                   /product="putative ATP-binding component of a transport
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00065"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75525"
FT                   /db_xref="GOA:A6T4K4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005968"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4K4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003439"
FT                   /protein_id="ABR75525.1"
FT                   /translation="MLKLNDVTWLYQHLPMRFTLDVARGERIAVLGPSGAGKSTLLNLI
FT                   AGFLPPASGSLLINGEAHNATPPAQRPVSMLFQENNLFNHLTIRQNISLGIHPGLKLNR
FT                   EQQAQVTAIAGQMGIDALLERLPGELSGGQRQRAALARCLVRQQPVLLLDEPFSALDPA
FT                   LRQEILSLVADVCEQQQLTLLMVSHSVEDAARIAPRSMVVAEGRIVWDGATAELLSGHS
FT                   SASHLMGISAR"
FT   gene            complement(76457..78067)
FT                   /gene="thiP"
FT                   /locus_tag="KPN_00066"
FT   CDS_pept        complement(76457..78067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiP"
FT                   /locus_tag="KPN_00066"
FT                   /product="thiamin ABC transporter membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00066"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75526"
FT                   /db_xref="GOA:A6T4K5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005947"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4K5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000515"
FT                   /protein_id="ABR75526.1"
FT                   /translation="MATRRQPLNLRGLMPGLFAATLLCAVALAAFLALWFSAPGAGWQS
FT                   VFSDSYLWHVVRFSFWQASLSALISVGPAIFLARALYRRRFPGRTLLLRLCAMTLILPV
FT                   LVAVFGILSVYGRQGWLASLFHALGWQWEFSPYGLQGILLAHVFFNMPMATRLLLQALE
FT                   NIPGEQRQIAAQLGMRGYAFFRLVEWPWLRRHIPAVAALIFMLCFASFATVLSLGGGPK
FT                   ATTIELAIYQALSFDYDPARAAMLALIQMLCCLGLVLLSQRLSKAVAIGVSHVRGWRDP
FT                   DDRLHSRLSDGLLIGAALLLLLPPLLAVIVDGINRNMLDVLAQPALWQALSTSLRIAIA
FT                   AGLLSVTLTMMLLWSSRELRARQRPLAGQAMELSGMLILAMPGIVLATGFFLLLNNTIG
FT                   LPESADGIVIFTNALMAIPYALKVLENPMRDIAARYSMLCQSLGIEGFARLRVVELRAL
FT                   RRPLAQALAFACVLSIGDFGVVALFGNEAFRTLPFYLYQQIGAYRSQDGAVTALLLLLL
FT                   CFLLFTLIEKLPGRDAKTQ"
FT   gene            complement(78043..79026)
FT                   /gene="tbpA"
FT                   /locus_tag="KPN_00067"
FT   CDS_pept        complement(78043..79026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tbpA"
FT                   /locus_tag="KPN_00067"
FT                   /product="thiamin-binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00067"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75527"
FT                   /db_xref="GOA:A6T4K6"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="InterPro:IPR005967"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4K6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR006059"
FT                   /protein_id="ABR75527.1"
FT                   /translation="MLKKLLPLLALVAMPALAKPVLTVYTYDSFSADWGPGPAVKKAFE
FT                   AECGCELKFVALEDGVSLLNRLRMEGKNSKADVVLGLDNNLLEAAAQSKLFAKSNVPAS
FT                   AVSVPGGWDNDTFVPYDYGYFAFVYDKNKLANPPKSLKELVEGPQKWRVIYEDPRTSTP
FT                   GLGLLLWMQKVYGDQAPEAWQKLAAKTVTVTKGWSEAYGLFLKGESDLVLSYTTSPAYH
FT                   MIEEKKDNYAAANFAEGHYLQVEVAARTAASKQPELAEKFLKFMVSPGFQNAIPTGNWM
FT                   YPVTKVTLPAGFDTLVKPQTTLSFTPQQVASERQTWISAWQRAVSR"
FT   gene            complement(79316..80971)
FT                   /gene="yabN"
FT                   /locus_tag="KPN_00068"
FT   CDS_pept        complement(79316..80971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabN"
FT                   /locus_tag="KPN_00068"
FT                   /product="putative periplasmic binding protein of transport
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00068"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75528"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR025370"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4K7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000914"
FT                   /protein_id="ABR75528.1"
FT                   /translation="MSSGRLQQQFIRLWQCCDGKSQETTLNELAEMLSCSRRHMRTLLN
FT                   MMESRGWLTWEAEAGRGKRSRLTFLYTGLALQQQRAEDLLEQDRIDQLVQLVGDKAAVR
FT                   QMLVSHLGRSFRQGRHILRVLYYRPMKNLLPGSALRRSETHIARQIFSALTRVNEENGE
FT                   LEADIAHHWQQLTPTHWRFFLRPGIHFHHGRELEMADVIASLQRSNALPLYSHIERIES
FT                   PTAWTLDIHLRQPDRWLPWLLGQVPAMVLPQEWQTMNHFSSMPVGTGPYAVVRNNQNQL
FT                   KIHAFEDYFGYRALIDEVNVWVLPEISEEPNGGLTLQGNTESEKAVESRLEEGCYYLLF
FT                   DSRSPLGANDAVRRWLSYLFQPANLLYHAGEHYQGNWFPAYGLLPRWHHASNHACEKPA
FT                   GLETVTLTYYRDHVEHRVIGGIMRDLLAAHQVKLEIQELEYDAWHRGEVVSDIWLNSVN
FT                   FTLPIEFSLFAYLYEVPLIQRCIPIDWQADACRWRAGEFNPATWSQRLLAGQHIVPLIH
FT                   HWLMIQGQRSMRGVRMNTLGWFDFKSAWFAPPEP"
FT   gene            81059..81211
FT                   /locus_tag="KPN_00069"
FT   CDS_pept        81059..81211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00069"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75529"
FT                   /db_xref="GOA:A6T4K8"
FT                   /db_xref="InterPro:IPR031767"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4K8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75529.1"
FT                   /translation="MMRSTAKSFYQRYFSATQEASWLARLMAGRQQEILGELMQWGVTS
FT                   TTSDH"
FT   gene            81479..82663
FT                   /gene="setA"
FT                   /locus_tag="KPN_00070"
FT   CDS_pept        81479..82663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="setA"
FT                   /locus_tag="KPN_00070"
FT                   /product="Sugar efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00070"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75530"
FT                   /db_xref="GOA:A6T4K9"
FT                   /db_xref="InterPro:IPR004750"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4K9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75530.1"
FT                   /translation="MLWLMTMGRRLNGVYAAFMLVAFMMGVAGALQAPTLSLFLSREVG
FT                   AQPFWVGLFYTVNAIAGILVSLWLAKRSDSRGDRRRLIMFCCLMAVGNALLFAFNRHYL
FT                   TLITCGVMLASIANAAMPQLFALAREYADSSAREVVMFSSVMRAQLSLAWVIGPPLAFM
FT                   LALNYGFTTMFSIAAGIFVISLALIAIKLPSVPRVEQPSEEAAALAQAGGWQDKNVRML
FT                   FIASTLMWTCNTMYIIDMPLWISSDLGLPDSLAGILMGTAAGLEIPAMILAGYYVKRFG
FT                   KRKMMVAAVAAGVLFYAGLILFHGRAALLALQLFNAIFIGIIAGIGMLWFQDLMPGRAG
FT                   AATTLFTNSISTGVILAGVMQGALSQSYGHASVYWTIAAISLVTLFLTSKVKDI"
FT   gene            complement(82697..83905)
FT                   /locus_tag="KPN_00071"
FT   CDS_pept        complement(82697..83905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00071"
FT                   /product="Permeases of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00071"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75531"
FT                   /db_xref="GOA:A6T4L0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4L0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR005828"
FT                   /protein_id="ABR75531.1"
FT                   /translation="MINYLDRTILGIVAPQLSKEIHIDPAMMGIIFSAFAWTYALAQIP
FT                   GGMFLDRFGNKVTYALSIFFWSLFTLLQSFTLGLKSLLLLRLGLGVSEAPCFPANSRIV
FT                   STWFPQHERARATATYTVGEYIGLAAFSPLLFLILEHHGWRTLFFLTGGLGILFTLVWW
FT                   RFYHEPHESRTANQAELEYIGANGINNKIQNVPFNWRDARRLLGCRQILGASLGQFAGN
FT                   TTLVFFLTWFPSYLANERHLPWLHVGFFATWPFLAAAIGILFGGWISDRLLKRTGSVNI
FT                   SRKLPIISGLLLSSCIIAANWVSANSTVIIIMSVAFFGQGMVGLGWALISDIAPENMAG
FT                   LTGGIFNFCANMASIIAPLIIGVIISATGNFFYALIYVGLTALIGVIAYIFIIGDIKRI
FT                   ELK"
FT   gene            84239..85135
FT                   /locus_tag="KPN_00072"
FT   CDS_pept        84239..85135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00072"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00072"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75532"
FT                   /db_xref="GOA:A6T4L1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4L1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000847"
FT                   /inference="protein motif:Pfam:IPR005119"
FT                   /protein_id="ABR75532.1"
FT                   /translation="MNLKQLYYFKRLSETEHYTEAASSLCITQPSLSHAISELEKELGV
FT                   ALFARQGRNVKITQNGKRFLPYVEDALASLENGRMILQKNGAENKENIRIAFIYTMGEY
FT                   VVPQLINKYSLSPECHNVTFSFTQGTSLTLLQELKAGKVDLAICSYIADEPDIDFIPVI
FT                   QQELVVVTAKDHPLARLYEHEVDLVETIHYPYIYFSENSGLRPFIDNVFMQQKLMPEIA
FT                   CYVDEDTAMAGLVSIDYGIAIMPRITALSYYNVHILKIKNTIPPRYIYLATMKDKGLSP
FT                   ALESFKNVVIHDSQKIC"
FT   gene            complement(85173..85940)
FT                   /gene="aroD"
FT                   /locus_tag="KPN_00073"
FT   CDS_pept        complement(85173..85940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroD"
FT                   /locus_tag="KPN_00073"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00073"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75533"
FT                   /db_xref="GOA:A6T4L2"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018508"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4L2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001381"
FT                   /protein_id="ABR75533.1"
FT                   /translation="MDTYMTNAVTVKNITFQEGETLICVPLIGKTLDEILGNAHGLVDA
FT                   GADIIEWRVDHFAQVREMAQVMAALAEIRGALKALPLLFTFRSKKEGGETELSDEAYFA
FT                   LNREAARSGLVDVIDIELFNDEAQIRALVDDAHAAGVKVIMSNHDFHKTPAQEDIIYRL
FT                   RRMQDLGADLPKIAVMPQSPQDVLTLLAATLTMKEKYATRPLITMSMGKSGGVSRVTGR
FT                   LFGSAMTFGTVGQASAPGQIAIAKLREVMDILS"
FT   gene            complement(85959..87176)
FT                   /gene="ydiM"
FT                   /locus_tag="KPN_00074"
FT   CDS_pept        complement(85959..87176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydiM"
FT                   /locus_tag="KPN_00074"
FT                   /product="putative transport protein (MFS family)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00074"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75534"
FT                   /db_xref="GOA:A6T4L3"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4L3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75534.1"
FT                   /translation="MMKNKYIPTAAGLYLNYLIHGMGVLLITLNMAHLQEQWGTDKAGV
FT                   SIVISSLGIGKLATIVTGFLSDRFGRKPFIYLGILSYLIFFVGILLTKNIYLAYVFGIM
FT                   AGLANSFLDSGTYPALMESFPHSASRANVLIKAFVSAGQFLLPFIISFLIWANLWFGWS
FT                   FVIAAALFVLSGIYLLKMPFPDSQAAKKEEAPTAQAETAVRPQANKLDMVIFTLYGYIG
FT                   MATFYLVSQWLAQYGQFVVGLPYASAIKLLSIYTVGSLVCVFVTAAFVKEVFSSAIAMI
FT                   IYTGLSMISLLLVCLFPTPMMVTGFAFVIGFAAAGGVLQLGATIMAMSFPNGKGKATGI
FT                   FYTAGSIASFTIPLITAKLSQISIASIMWFDFLIAVIGFVIALYIGYRQLQARAAQKVS
FT                   RTAVTA"
FT   gene            complement(87184..88047)
FT                   /gene="aroE"
FT                   /locus_tag="KPN_00075"
FT   CDS_pept        complement(87184..88047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="KPN_00075"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00075"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75535"
FT                   /db_xref="GOA:A6T4L4"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4L4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR006151"
FT                   /protein_id="ABR75535.1"
FT                   /translation="MAERITGHTELIGLIATPIRHSMSPTMHNEAFAHLGLDYVYLAFE
FT                   VGNQELKDVVQGFRAMKLRGFNVSMPNKTEICQYLDKLSPAAQLVGAVNTVVNDDGVLT
FT                   GHITDGTGYMRALSEAGIDIIGKKMTVLGAGGAATALCVQAALDGVKAISIFNRRDKFF
FT                   ANAEETVAKIRHNTDCEIHLFDLDDHDKLRAEIDSSVILTNATGVGMKPFEGQMLLPDD
FT                   SFLRPDLIVSDVVYNPRKTHLLEVAEKKGCRTLNGLGMMLWQGARAFEIWTGKQMPVDY
FT                   IKSILF"
FT   gene            complement(88059..90092)
FT                   /gene="fadH"
FT                   /locus_tag="KPN_00076"
FT   CDS_pept        complement(88059..90092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadH"
FT                   /locus_tag="KPN_00076"
FT                   /product="2,4-dieonyl-CoA reductase, FMN-linked"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00076"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75536"
FT                   /db_xref="GOA:A6T4L5"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4L5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001155"
FT                   /inference="protein motif:Pfam:IPR001327"
FT                   /protein_id="ABR75536.1"
FT                   /translation="MSHYPHLFSPLTINGMTLKNRIIMPPMGTNMATLNGEVSQEQLEY
FT                   YELRAKGGTGLITIENICIDFPFASNGTTQLRIDNDQYIPRLFKLTETLHKHGACVSIQ
FT                   LNHAGASAYAYRLEGQTPLSSSTTPSKKHGNIPRPMTHEEIYHAVEKFGDAAERVRRAG
FT                   FDCVEIHAGHSYLISQFLSPLFNKRTDEFGGSVENRTRILSLIVDKVRACVGPRFPVSL
FT                   RISADDFLKGGNTLEDSLRILELCQEKVDIINVSAAQNDNLNLQIDQMSLEDGWKRYLS
FT                   RAVRDKFHKPTVIAGNIRTPQVAEDILASGDADLIAIGRGLIAEPEWVQKVQGGKERLM
FT                   RKCISCNIGCADHRIARSRPLRCSINPDIIHGDAYKMRRVNRDTNVVVIGAGTAGMEAA
FT                   CTAAEVGCHTWLLEAKNHVGGLASEISRLPEKKRIADFPQFMKNRIASLDNLMLQIGKR
FT                   ADVASVSALRPHLIVNATGSTPLLPPIEGLRENIDVENGKIFSITGMIDNLAKFTDIKG
FT                   KRIAVVGAGAVGLDVIEYFTARGAQAVLIEMQDAAGRDLDIITKNAMLTMLDEHQVEQH
FT                   MNTQLMAVAADHFQVKNTQQTFDIPFDYGFVCLGMRANRTGLDEIERWANANNVKIMNI
FT                   GDSVMARRIIDGVREGRNVLDALEDMGALGSREAQRIPFLTY"
FT   gene            complement(90488..91093)
FT                   /gene="leuD"
FT                   /locus_tag="KPN_00077"
FT   CDS_pept        complement(90488..91093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="KPN_00077"
FT                   /product="isopropylmalate isomerase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00077"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75537"
FT                   /db_xref="GOA:A6T4L6"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4L6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000573"
FT                   /protein_id="ABR75537.1"
FT                   /translation="MAEKFTQHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLFN
FT                   DWRFLDDKGQQPNPEFVLNYPEYQGASILLARENFGCGSSREHAPWALTDYGFKVVIAP
FT                   SFADIFYGNSFNNQLLPVTLSDEQVDELFKLVQANPGITFEVDLEAQVVKAGDKTYSFK
FT                   IDDFRRHCMLNGLDSIGLTLQHEAAISDYERKLPAFMN"
FT   gene            complement(91104..92504)
FT                   /gene="leuC"
FT                   /locus_tag="KPN_00078"
FT   CDS_pept        complement(91104..92504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="KPN_00078"
FT                   /product="isopropylmalate isomerase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00078"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75538"
FT                   /db_xref="GOA:A6T4L7"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4L7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001030"
FT                   /protein_id="ABR75538.1"
FT                   /translation="MAKTLYEKLFDAHVVYEAQNETPLLYIDRHLVHEVTSPQAFDGLR
FT                   AHGRQVRQPGKTFATMDHNVSTQTKDINASGEMARIQMQELIKNCKEFGVELYDLNHPY
FT                   QGIVHVMGPEQGVTLPGMTIVCGDSHTATHGAFGALAFGIGTSEVEHVLATQTLKQGRA
FT                   KTMKIEVQGKAAPGITAKDIVLAIIGKTGSAGGTGHVVEFCGEAIRDLSMEGRMTLCNM
FT                   AIEMGAKAGLVAPDETTFNYVRGRLHAPKGKDFDDAVAYWKTLKTDDGATFDTVVTLQA
FT                   AEIAPQVTWGTNPGQVISVTDNIPDPASFSDPVERASAEKALAYMGLKSGIPLTEVAID
FT                   KVFIGSCTNSRIEDLRAAAEIAKGRKVAPGVQALVVPGSGPVKAQAEAEGLDKIFIEAG
FT                   FEWRLPGCSMCLAMNNDRLNPGERCASTSNRNFEGRQGRGGRTHLVSPAMAAAAAVTGH
FT                   FADIRNLK"
FT   gene            complement(92507..93598)
FT                   /gene="leuB"
FT                   /locus_tag="KPN_00079"
FT   CDS_pept        complement(92507..93598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuB"
FT                   /locus_tag="KPN_00079"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00079"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75539"
FT                   /db_xref="GOA:A6T4L8"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4L8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001804"
FT                   /protein_id="ABR75539.1"
FT                   /translation="MSKNYHIAVLPGDGIGPEVMNQAMKVLEAVRQRFAMHITTSQYDV
FT                   GGAAIDRQGTPLPQATVAGCEQADAILFGSVGGPKWEHLPPAEQPERGALLPLRKHFKL
FT                   FSNLRPAKLYQGLEEFCPLRADIAANGFDILCVRELTGGIYFGQPKGREGSGQHEKAFD
FT                   TEVYHRFEIERIARIAFESARKRRHKVTSIDKANVLQSSILWREIVSEIGKEYPDVELA
FT                   HMYIDNATMQLIKDPSQFDVLLCSNLFGDILSDECAMITGSMGMLPSASLNEQGFGLYE
FT                   PAGGSAPDIAGKNIANPIAQILSLALLLRYSLDADEAATAIENAINRALEEGVRTGDLA
FT                   RGTAAVSTDEMGDIIARYVAEGV"
FT   gene            complement(93598..95169)
FT                   /gene="leuA"
FT                   /locus_tag="KPN_00080"
FT   CDS_pept        complement(93598..95169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="KPN_00080"
FT                   /product="2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00080"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75540"
FT                   /db_xref="GOA:A6T4L9"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4L9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000891"
FT                   /protein_id="ABR75540.1"
FT                   /translation="MSQQVIIFDTTLRDGEQALQASLSVKEKLQIALALERMGVDVMEV
FT                   GFPVSSPGDFESVQTIARTIKNSRVCALARCVEKDIDVAAESLKVAEAFRIHTFIATSP
FT                   MHIATKLRSTLDEVIERAIYMVKRARNYTDDVEFSCEDAGRTPIADLARVVEAAINAGA
FT                   TTINIPDTVGYTMPFEYANIISGLYDRVPNIDKAIISVHTHDDLGIAVGNALAAVHAGA
FT                   RQVEGAMNGIGERAGNCALEEVIMAIKVRKDIMNVHTNINHHEIWRTSQTVSQICNMPI
FT                   PANKAIVGTGAFAHSSGIHQDGVLKNRENYEIMTPESIGLNQVQLNLTSRSGRAAVKHR
FT                   MEEMGYQESDYNLDHLYDAFLKLADKKGQVFDYDLEALAFINKQQEEPEHFRLDYFNVQ
FT                   SGSSDIATASIKLVCGDEIKTEAANGNGPVDAIYQAINRVTDYNIELVKYGLSAKGHGK
FT                   DALGQVDIVVDYNGRRFHGVGLATDIVESSAKAMVHVLNNIWRAAEVEKELQRKAQNKE
FT                   NNKETV"
FT   gene            96049..96933
FT                   /gene="leuO"
FT                   /locus_tag="KPN_00081"
FT   CDS_pept        96049..96933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuO"
FT                   /locus_tag="KPN_00081"
FT                   /product="leucine transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00081"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75541"
FT                   /db_xref="GOA:A6T4M0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4M0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000847"
FT                   /inference="protein motif:Pfam:IPR005119"
FT                   /protein_id="ABR75541.1"
FT                   /translation="MVDLNLLTVFDAVMQEQNITRAAHTLGMSQPAVSNAVSRLKVMFN
FT                   DELFVRYGRGIQPTARAYQLFGSVRQALQLVQNELPGSGFEPLSSERVFHLCVCSPLDN
FT                   ILTSVIFNKVAEIAPNIHLVFKSALNQNTEHQLRYQETEFVIGYEEFRRPEFACVPLFK
FT                   DEMVLVASRNHPRISGPMMEADIYREEHAAVALDRYASFSLPWYDTADKQARIAYQGNA
FT                   MVSVLNVVSQTQMVAIAPRWLADEFADKLALQILPLPLKVNSRTCYLSWHEAAGRDKGH
FT                   QWMEELLVDICKR"
FT   gene            97328..99052
FT                   /gene="ilvI"
FT                   /locus_tag="KPN_00082"
FT   CDS_pept        97328..99052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvI"
FT                   /locus_tag="KPN_00082"
FT                   /product="acetolactate synthase III large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00082"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75542"
FT                   /db_xref="GOA:A6T4M1"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4M1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000399"
FT                   /protein_id="ABR75542.1"
FT                   /translation="MEMLSGAEMVVQSLVDQGVKQVFGYPGGAVLDIYDALHTLGGIDH
FT                   VLVRHEQAAVHMADGLARATGEVGVVLVTSGPGATNAITGIATAYMDSIPLVILSGQVA
FT                   TSLIGYDAFQECDMVGISRPVVKHSFLVKQTEDIPGVLKKAFWLAASGRPGPVVVDLPK
FT                   DILNPAKKLPYVWPDAVSMRSYNPTTSGHKGQIKRALQTLVAASKPVVYVGGGAINAHC
FT                   EPQLRELVEKLKLPVASSLMGLGAFPATHSQALGMLGMHGTYEANMTMHHSDVIFAVGV
FT                   RFDDRTTNNLAKYCPNATVLHIDIDPTSISKTVPADVPIVGDARLVLEQMLELLEQEEA
FT                   QQPLDDIRDWWQQIEQWRARHCLRYDDQSDKIKPQAVIETIWRLTQGDAYVTSDVGQHQ
FT                   MFAALYYPFDKPRRWINSGGLGTMGFGLPAALGVKMALPDEMVVCVTGDGSIQMNIQEL
FT                   STALQYELPVLVLNLNNRYLGMVKQWQDMLYSGRHSQSYMESLPDFVRLAEAYGHVGIR
FT                   ISEPQELETKLAEALEQVRQRRLVFVDVTVDGSEHVYPMQIRGGGMDEMWLSKTERT"
FT   gene            99055..99546
FT                   /gene="ilvH"
FT                   /locus_tag="KPN_00083"
FT   CDS_pept        99055..99546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvH"
FT                   /locus_tag="KPN_00083"
FT                   /product="acetolactate synthase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00083"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75543"
FT                   /db_xref="GOA:A6T4M2"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4M2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002912"
FT                   /protein_id="ABR75543.1"
FT                   /translation="MRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLSR
FT                   MTIQTVGDEKAIEQIEKQLHKLVDVLRVSELGQGAHVEREIMLVKVQASGYGREEVKRN
FT                   TEIFRGQIIDVTPSIYTVQLAGTSDKLDAFLASLRDVARIVEVARSGVVGLSRGDKIMR
FT                   "
FT   gene            99727..100731
FT                   /gene="fruR"
FT                   /locus_tag="KPN_00084"
FT   CDS_pept        99727..100731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruR"
FT                   /locus_tag="KPN_00084"
FT                   /product="transcriptional regulator of the control of
FT                   carbon and energy metabolism (GalR/LacI family)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00084"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75544"
FT                   /db_xref="GOA:A6T4M3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR012781"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4M3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000843"
FT                   /inference="protein motif:Pfam:IPR001761"
FT                   /protein_id="ABR75544.1"
FT                   /translation="MKLDEIARLAGVSRTTASYVINGKAKQYRVSDKTVEKVMAVVREH
FT                   NYHPNAVAAGLRAGRTRSIGLVIPDLENTSYTRIANYLERQARQRGYQLLIACSEDQPD
FT                   NEMRCIEHLLQRQVDAIIVSTSLPPEHPFYQRWANDPFPIVALDRALDREHFTSVVGAD
FT                   QDDAEMLAAELRTFPGETVLYLGALPELSVSFLREQGFRKAWQDDPREVHYLYANSYER
FT                   EAAAQLFEKWLETHPMPQALFTTSFPLLQGVMDVTLRREGKLPSELAIATFGDNELLDF
FT                   LQCPVLAVAQRHRDVAERVLEIVLASLDEPRKPKPGLSRIRRNLYRRGSLNRR"
FT   gene            101372..101830
FT                   /gene="yabB"
FT                   /locus_tag="KPN_00085"
FT   CDS_pept        101372..101830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabB"
FT                   /locus_tag="KPN_00085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00085"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75545"
FT                   /db_xref="GOA:A6T4M4"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4M4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003444"
FT                   /protein_id="ABR75545.1"
FT                   /translation="MFRGATLVNLDSKGRLAVPTRYREGLIENAAGQLVCTIDIHHPCL
FT                   LLYPLPEWEVIEQKLSRLSSMNPVERRVQRLLLGHASECQMDNAGRLLIAPVLRQHAGL
FT                   TKEVMLVGQFNKFELWDETTWYQRVKEDIDAEQSATGELSERLQDLSL"
FT   gene            101833..102774
FT                   /gene="mraW"
FT                   /locus_tag="KPN_00086"
FT   CDS_pept        101833..102774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="KPN_00086"
FT                   /product="S-adenosyl-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00086"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75546"
FT                   /db_xref="GOA:A6T4M5"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4M5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002903"
FT                   /protein_id="ABR75546.1"
FT                   /translation="MMENYKHTTVLLDEAVNGLNIRPDGIYIDGTFGRGGHSRLILSRL
FT                   GAEGRLLAIDRDPQAIAVAQTIDDPRFSIVHGPFSQLAEYVGERNLTGKIDGILLDLGV
FT                   SSPQLDDAERGFSFMRDGPLDMRMDPTRGQSAAEWLQTAEEDDIAWVIKTFGEERFGKR
FT                   IARAIVERNRIQPMTRTKELAEVIAAAMPVKDKHKHPATRTFQAVRIWVNSELEEIEQA
FT                   LKSSLSVLAPGGRLSIISFHSLEDRIVKRFMREQSRGPQVPAGIPMTEAQLKKLGGREL
FT                   RALGKLMPGEEEVAENPRARSSVLRIAERTNA"
FT   gene            102771..103136
FT                   /gene="ftsL"
FT                   /locus_tag="KPN_00087"
FT   CDS_pept        102771..103136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="KPN_00087"
FT                   /product="cell division protein; ingrowth of wall at
FT                   septum"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00087"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75547"
FT                   /db_xref="GOA:A6T4M6"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4M6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR007082"
FT                   /protein_id="ABR75547.1"
FT                   /translation="MIGRVTEALSKVKGSIGSNERHALPGVIGDDLLRFGKLPLCLFIC
FT                   IIITAITVVTTAHHTRLLTAQREQLVLERDALDIEWRNLILEENALGDHSRVERIATEK
FT                   LQMQHVDPSQENIVVQK"
FT   gene            103152..104918
FT                   /gene="ftsI"
FT                   /locus_tag="KPN_00088"
FT   CDS_pept        103152..104918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsI"
FT                   /locus_tag="KPN_00088"
FT                   /product="division-specific transpeptidase,
FT                   penicillin-binding protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00088"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75548"
FT                   /db_xref="GOA:A6T4M7"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4M7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001460"
FT                   /inference="protein motif:Pfam:IPR005311"
FT                   /protein_id="ABR75548.1"
FT                   /translation="MKAAPKTPKAKRQEEQANFISWRFALLCGCILLALAFLLGRVAWL
FT                   QVISPDMLVRQGDMRSLRVQEVSTARGMITDRSGRPLAVSVPVKAIWADPKELHDAGGV
FT                   TLDTRWKALADALNMPLDQLATRINTNPRMRFIYLARQVNPDMADYIKKLKLPGIHLRE
FT                   ESRRYYPSGEVTAHLIGFTNVDSQGIEGVEKSFDKWLTGQPGERIVRKDRYGRVIEDIS
FT                   STDSQAAHNLALSIDERLQALVYRELNNAVAFNKAESGSAVLVDVNTGEVLAMANSPSY
FT                   NPNNFAGTAKDTMRNRAITDVFEPGSTVKPMVVMTALQRGIVNENTVLNTVPYRINGHE
FT                   IKDVARYSELTLTGVLQKSSNVGVSKLALAMPSSALVDTYSRFGLGKATNLGLVGERSG
FT                   LYPQKQRWSDIERATFSFGYGLMVTPLQLARVYATIGSYGIYRPLSITKVDPPVPGERV
FT                   FPESLVRTVVHMMESVALPGGGGVKAAIKGYRIAIKTGTAKKVGPDGRYINKYIAYTAG
FT                   VAPASHPRFALVVVINDPQAGKYYGGAVSAPVFGAIMGGVLRTMNIEPDALATGEKSEF
FT                   VINQGEGTGGRS"
FT   gene            104905..106392
FT                   /gene="murE"
FT                   /locus_tag="KPN_00089"
FT   CDS_pept        104905..106392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="KPN_00089"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00089"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75549"
FT                   /db_xref="GOA:A6T4M8"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4M8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000713"
FT                   /inference="protein motif:Pfam:IPR004101"
FT                   /protein_id="ABR75549.1"
FT                   /translation="MADRNLRDLLAPWVPNAPERILREMTLDSRVAASGDLFIAVQGHQ
FT                   ADGRRYIPQAIAQGVAAIIAEAQGEAKDGEIREMHGVPVIYLSQLNERLSALAGRFYHQ
FT                   PSQQLRLVGVTGTNGKTTTTQLLAQWAKLLGETSAVMGTVGNGLLDKVVPTENTTGSAV
FT                   DVQHVLSSLVGQGATFGAMEVSSHGLVQHRVAALQFAASVFTNLSRDHLDYHGDMEHYE
FT                   AAKWLLYSTHHCGQAIVNADDEVGRRWLAKLPDAVAVSMEDHINPNCHGRWLKATAVNY
FT                   HDSGATIQFDSSWGKGEIESRLMGAFNVSNLLLALATLLALGYPLADLLKSAARLQPVC
FT                   GRMEVFSAPGKPAVVVDYAHTPDALEKALQAARLHCSGKLWCVFGCGGDRDKGKRPLMG
FT                   AIAEEFADIVVVTDDNPRTEEPRAIINDILAGMLDAGQAKVMEGRAEAVTNAVMQAKEN
FT                   DVVLVAGKGHEDYQIVGNRRLDYSDRVTVARLLGAVA"
FT   gene            106389..107747
FT                   /gene="murF"
FT                   /locus_tag="KPN_00090"
FT   CDS_pept        106389..107747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="KPN_00090"
FT                   /product="D-alanine:D-alanine-adding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00090"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75550"
FT                   /db_xref="GOA:A6T4M9"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4M9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000713"
FT                   /inference="protein motif:Pfam:IPR004101"
FT                   /protein_id="ABR75550.1"
FT                   /translation="MIRFTLSQLAAIAHGERQGSDVAIDEVTTDTRKVTAGCLFVALKG
FT                   ERFDAHDFAEQAKAAGAGALLVSRPLACDLPQVIVNDTRQAFGELAAWVRQQVPTRVVA
FT                   LTGSSGKTSVKEMTAAILSQCGNTLYTAGNLNNDIGVPMTLLRLTKEHQYAVIELGANH
FT                   QGEIAWTVSLTRPEAALVNNLAAAHLEGFGSLAGVAKAKGEIYTGLPENGIAILNADNN
FT                   DWLNWQAVIGDRKVWRFSPNAANSDFTATNVQITSHGTEFTLQTPTGNVDVLLPLPGRH
FT                   NIANALAATSLAMAVGADLAAVKAGLAQLQAVPGRLFPIRLTESQLLLDDSYNANVGSM
FT                   TAAVQVLSEMPGFRTMVVGDMAELGAESAACHREVGEAAKAAGLDCVLSVGALSADISR
FT                   ASGVGEHFNDKAAVVARLRELLAEHKIMTILVKGSRSAAMEEVVRALQETGTC"
FT   gene            107741..108823
FT                   /gene="mraY"
FT                   /locus_tag="KPN_00091"
FT   CDS_pept        107741..108823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="KPN_00091"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00091"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75551"
FT                   /db_xref="GOA:A6T4N0"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4N0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000715"
FT                   /protein_id="ABR75551.1"
FT                   /translation="MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMI
FT                   ARLQKLAFGQVVRNDGPESHFSKRGTPTMGGIMILTAITVSVLLWAYPSNPYVWCVLTV
FT                   LIGYGIIGFVDDYRKVVRKDTKGLIARWKYFWMSVIALGVAFALYLAGKDTPATELVVP
FT                   FFKDVMPQLGLFYILLAYFVIVGTGNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNM
FT                   NFANYLHIPYLRHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIA
FT                   VLLRQEFLLVIMGGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIV
FT                   RFWIISLMLVLIGLATLKVR"
FT   gene            108826..110142
FT                   /gene="murD"
FT                   /locus_tag="KPN_00092"
FT   CDS_pept        108826..110142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="KPN_00092"
FT                   /product="UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00092"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75552"
FT                   /db_xref="GOA:A6T4N1"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4N1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000713"
FT                   /inference="protein motif:Pfam:IPR004101"
FT                   /protein_id="ABR75552.1"
FT                   /translation="MADYQGKKVVIIGLGMTGLSCVDFFMARGVTPRVMDTRVAPPGLD
FT                   KLPESVECHVGGLNDTWLLAADLIVASPGIALAHPSLSAAADAGVEIVGDIELFCREAQ
FT                   APIIAITGSNGKSTVTTLVGEMAKAAGVNVGVGGNIGLPALMLLDTDRELYVLELSSFQ
FT                   LETTSSLQAVAATILNVTEDHMDRYPLGLQQYRAAKLRIYENAKTCVVNADDALTMPVR
FT                   GADERCISFGVDVGDYHLNRQQGETWLRVKGEKVLNVKEMPLTGQHNYSNALAALALAD
FT                   AAGLPRASSLKALTTFTGLAHRFQLVLDHNGVRWINDSKATNVGSTEAALNGLQLDGTL
FT                   YLLLGGDGKSADFTPLKRYLGGDRIRLYCFGRDGAELAELRPEVAVQTETMEQAMRQIA
FT                   PLVKAGDMVLLSPACASLDQFKNFEQRGEMFARLAKELG"
FT   gene            110142..111416
FT                   /gene="ftsW"
FT                   /locus_tag="KPN_00093"
FT   CDS_pept        110142..111416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="KPN_00093"
FT                   /product="cell division; membrane protein involved in shape
FT                   determination"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00093"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75553"
FT                   /db_xref="GOA:A6T4N2"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4N2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001182"
FT                   /protein_id="ABR75553.1"
FT                   /translation="MRFSLPRLRMPQLSLPRLRLPRLPGMFIFAWLFAALKGWVMGSRP
FT                   KDNDSLVMYDRMLLWLTFGLAAIGFIMVTSASMPVGQRLANDPFLFAKRDGLYIVLAFA
FT                   LAMITLRLPMDFWQRHSTAMLIASIVMLLIVLVVGSSVNGASRWIALGPLRIQPAEFTK
FT                   LSLFCYIANYLVRKADEVRNNLRGFLKPMGVIFVLAILLLAQPDLGTVVVLFVTTLAML
FT                   FLAGAKLWQFIAIIGMGISAVVLLILAEPYRIRRVTSFWNPWEDPFGSGYQLTQSLMAF
FT                   GRGEMWGQGLGNSVQKLEYLPEAHTDFIFAIIGEELGYIGVVLALLMVFFVAFRAMSIG
FT                   RKALEIDHRFSGFLACAIGIWFSFQALVNVGAAAGMLPTKGLTLPLISYGGSSLLIMST
FT                   AIMLLLRIDYETRLEKAQAFTRGVR"
FT   gene            111413..112483
FT                   /gene="murG"
FT                   /locus_tag="KPN_00094"
FT   CDS_pept        111413..112483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="KPN_00094"
FT                   /product="N-acetylglucosaminyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00094"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75554"
FT                   /db_xref="GOA:A6T4N3"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4N3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004276"
FT                   /inference="protein motif:Pfam:IPR007235"
FT                   /protein_id="ABR75554.1"
FT                   /translation="MSGQEKRLMVMAGGTGGHVFPGLAVAHHLMDQGWQVRWLGTADRM
FT                   EADLVPKNGIEIDFIRISGLRGKGIKAQLLAPVRIFNAWRQARAIMKRFQPDVVLGMGG
FT                   YVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLAKIAKKVMQAFPGAFPHADVVGNPVR
FT                   TDVLALPLPGQRLVGRQGPIRVLVVGGSQGARVLNQTMPQVAAKLGATVTIWHQSGKGG
FT                   QQTVQQAYAAAGQPQHKVTEFIDDMAAAYAWADVVVCRSGALTVSEIAAAGLPALFVPF
FT                   QHKDRQQYWNALPLEKAGAAKILEQPEFTVEAVASTLASWDRETLLDMAERARGASIPD
FT                   ATERVAEEVSAVALAR"
FT   gene            112531..114006
FT                   /gene="murC"
FT                   /locus_tag="KPN_00095"
FT   CDS_pept        112531..114006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="KPN_00095"
FT                   /product="UDP-N-acetylmuramate--L-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00095"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75555"
FT                   /db_xref="GOA:A6T4N4"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4N4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000713"
FT                   /inference="protein motif:Pfam:IPR004101"
FT                   /protein_id="ABR75555.1"
FT                   /translation="MNTQDLAKLRSIVPEMRRVRHIHFVGIGGAGMGGIAEVLANEGYQ
FT                   ISGSDLAPNPVTQQLSQLGATIYFNHRPENVRDASVVVVSSAISADNPEIVAAHEARIP
FT                   VIRRAEMLAELMRFRHGIAIAGTHGKTTTTAMVSSIYAEAGLDPTFVNGGLVKAAGVHA
FT                   RLGHSRYLIAEADESDASFLHLQPMVAIVTNIEADHMDTYHGDFENLKQTFINFLHNLP
FT                   FYGRAVMCVDDPVIRELLPRVGRQITTYGFSDDADVRVEDYRQVGAQGHFRLVRQDKAI
FT                   LQVTLNAPGRHNALNAAAAVAVATEEGIDDRAILRALESFQGTGRRFDFLGEFPLAEVN
FT                   GKPGSAMLIDDYGHHPTEVDATIKAARAGWPDKNLVMVFQPHRYTRTRDLYDDFANVLT
FT                   QVDALLMLDVYPAGEAPIPGADSRSLCRTIRGRGKVDPILVPDSTQAAEMLASVLTGND
FT                   LVLVQGAGNIGKIARHLAEIKLIPQKTEEERHG"
FT   gene            113999..114919
FT                   /gene="ddl"
FT                   /locus_tag="KPN_00096"
FT   CDS_pept        113999..114919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddl"
FT                   /locus_tag="KPN_00096"
FT                   /product="D-alanylalanine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00096"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75556"
FT                   /db_xref="GOA:A6T4N5"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4N5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR011095"
FT                   /inference="protein motif:Pfam:IPR011127"
FT                   /protein_id="ABR75556.1"
FT                   /translation="MADKIAVLFGGTSAEREVSLNSGAAVLAGLREGGVDAHPVDPRDV
FT                   DITQLKKQGFKKAFIALHGRGGEDGTLQGLLELIQLPYTGSGVMASAISMDKLRSKWLW
FT                   QGAGLPVAPWVALTRAQFTAGLSTDVEQQIAALGLPVIIKPSREGSSVGMSKVSESCDL
FT                   ASALALAFQHDDEVLVEKWLSGPEFTVAIVGEEILPSIRIQAAGTFYDYEAKYLSDETQ
FT                   YFCPGFEDPARESAIQNLVLKAWNVLGCKGWGRIDVMLDSDGQFYLLEANTSPGMTSHS
FT                   LVPMAARQAGMSFSQLVVRILDLAG"
FT   gene            114921..115751
FT                   /gene="ftsQ"
FT                   /locus_tag="KPN_00097"
FT   CDS_pept        114921..115751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="KPN_00097"
FT                   /product="cell division protein; ingrowth of wall at
FT                   septum"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00097"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75557"
FT                   /db_xref="GOA:A6T4N6"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4N6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR005548"
FT                   /protein_id="ABR75557.1"
FT                   /translation="MSQAALNTRNHEEEASSSRRSNGTRLAGIVFLLAVLFTVLVSGWM
FT                   VLGWMEDAQRLPLSKMVVTGERHYTRNDDIRQAILALGSPGTFMTQDVNIIQSQIERLP
FT                   WIKQASVRKQWPDELKIHLVEYVPIARWNDQHMVDAEGNAFSVPADRTSKQNLPMLYGP
FT                   EGSENEVLQGYRDMGQVLAKDKFTLKVAAMTARRSWQLTLNNDIKLNLGRGDTMKRLQR
FT                   FMELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWVPAPAEETNQQQNQAQAEQQ"
FT   gene            115748..117010
FT                   /gene="ftsA"
FT                   /locus_tag="KPN_00098"
FT   CDS_pept        115748..117010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="KPN_00098"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00098"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75558"
FT                   /db_xref="GOA:A6T4N7"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4N7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003494"
FT                   /protein_id="ABR75558.1"
FT                   /translation="MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMINIIGVGSCPSRG
FT                   MDKGGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEV
FT                   TQDDVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITC
FT                   HNDMAKNIVKAVERCGLKVDQLIFAGLAASYSVLTEDERELGVCVVDIGGGTMDIAVYT
FT                   GGALRHTKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDENVEVPSVG
FT                   GRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEQLRQQGVKHHLAAGIVLTGGAAQ
FT                   IEGLAACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLSGEAEVEK
FT                   RVTASVGSWIKRLNSWLRKEF"
FT   gene            117073..118224
FT                   /gene="ftsZ"
FT                   /locus_tag="KPN_00099"
FT   CDS_pept        117073..118224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="KPN_00099"
FT                   /product="cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00099"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75559"
FT                   /db_xref="GOA:A6T4N8"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4N8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003008"
FT                   /inference="protein motif:Pfam:IPR008280"
FT                   /protein_id="ABR75559.1"
FT                   /translation="MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTD
FT                   AQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDREALRAALDGADMVFIAAGM
FT                   GGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITI
FT                   PNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGY
FT                   AMMGSGVASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNT
FT                   IRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVMDRYQ
FT                   QHGMSPLTQEQKPAAKVVNDNTPQTAKEPDYLDIPAFLRKQAD"
FT   gene            118325..119242
FT                   /gene="lpxC"
FT                   /locus_tag="KPN_00100"
FT   CDS_pept        118325..119242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxC"
FT                   /locus_tag="KPN_00100"
FT                   /product="UDP-3-O-acyl N-acetylglucosamine deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00100"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75560"
FT                   /db_xref="GOA:A6T4N9"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4N9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004463"
FT                   /protein_id="ABR75560.1"
FT                   /translation="MIKQRTLKRIVQATGVGLHTGKKVTLTLRPAPANTGVIYRRTDLN
FT                   PPVDFPADAKSVRDTMLCTCLVNEHDVRISTVEHLNAALAGLGIDNIIVEVDAPEIPIM
FT                   DGSAAPFVYLLLDAGIDELNCAKKFVRIKETVRVEDGDKWAEFKPYNGFSLDFTIDFNH
FT                   PAIDASTQRYTLNFSADAFMRQISRARTFGFMRDIEYLQSRGLCLGGSFDCAIVVDDYR
FT                   VLNEDGLRFEDEFVRHKMLDAIGDLFMCGHNIIGAFTAYKSGHALNNKLLQAVLAKQEA
FT                   WEYVTFEDDAKLPMAFRAPSMVLA"
FT   gene            119634..120062
FT                   /gene="yacA"
FT                   /locus_tag="KPN_00101"
FT   CDS_pept        119634..120062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacA"
FT                   /locus_tag="KPN_00101"
FT                   /product="SecA regulator SecM"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00101"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75561"
FT                   /db_xref="GOA:A6T4P0"
FT                   /db_xref="InterPro:IPR009502"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4P0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR009502"
FT                   /protein_id="ABR75561.1"
FT                   /translation="MVAASLGLPALSNGHETAAPAKATASNHNPSKVNFSQLALLETNR
FT                   RPSFTVDYWHQHAIRTVIRHLSFAMAPQALPVAEETSPLQAQHLALLDTLSALLTQDST
FT                   PPVVIRQAGYIPSSYSAFRVSAWISQVAGIRAGPQRLS"
FT   gene            120125..122830
FT                   /gene="secA"
FT                   /locus_tag="KPN_00102"
FT   CDS_pept        120125..122830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="KPN_00102"
FT                   /product="translocase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00102"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75562"
FT                   /db_xref="GOA:A6T4P1"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4P1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004027"
FT                   /inference="protein motif:Pfam:IPR011115"
FT                   /inference="protein motif:Pfam:IPR011116"
FT                   /inference="protein motif:Pfam:IPR011130"
FT                   /protein_id="ABR75562.1"
FT                   /translation="MLIKMLTKVFGSRNDRTLRRMRKVVNIINGMEPAMEKLSDDELKA
FT                   KTAEFRARLEKGETLESLIPEAFAVVREASKRVFGMRHFDVQLLGGMVLNDRCIAEMRT
FT                   GEGKTLTATLPAYLNALTGKGVHVVTVNDYLAQRDAENNRPLFEFLGMTVGINMSGLPA
FT                   PAKREAYAADITYGTNNEYGFDYLRDNMAFSPEERVQRKLHYALVDEVDSILIDEARTP
FT                   LIISGPAEDSSEMYRKVNKIIPHLIRQEKEDSDTFTGEGHFSVDEKARQVNLTERGLVL
FT                   IEELLVQEGIMDEGESLYSPTNIMLMHHVTAALRAHALFTRDVDYIVKDGEVIIVDEHT
FT                   GRTMQGRRWSDGLHQAVEAKEGVEIQNENQTLASITFQNYFRLYEKLAGMTGTADTEAF
FT                   EFSSIYKLDTVVVPTNRPMIRKDMADLVYMTEAEKIQAIIEDIKTRTAAGQPVLVGTIS
FT                   IEKSEVVSRELTKAGIKHNVLNAKFHASEADIVAQAGYPSAVTIATNMAGRGTDIMLGG
FT                   SWQAEVAALENPTPEQIEKIKADWQVRHDAVLAAGGLHIIGTERHESRRIDNQLRGRAG
FT                   RQGDAGSSRFYLSMEDALMRIFASDRVSGMMRKLGMKPGEAIEHPWVTKAIANAQRKVE
FT                   SRNFDIRKQLLEYDDVANDQRRAIYTQRNELLDVSDVSETINSIREDVFKATIDAHIPP
FT                   QSLEEMWDIEGLQERLKNDFDLDLPIKEWLDKEPELHEETLRERILQSAVETYQRKEEV
FT                   VGAEMMRHFEKGVMLQTLDSLWKEHLAAMDYLRQGIHLRGYAQKDPKQEYKRESFSMFA
FT                   AMLESLKYEVISTLSKVQVRMPEEVEAMEQQRREEAERLAQMQQLSHQSDDEAAAQDLA
FT                   AQTGERKVGRNDPCPCGSGKKYKQCHGRLS"
FT   gene            122889..123281
FT                   /gene="mutT"
FT                   /locus_tag="KPN_00103"
FT   CDS_pept        122889..123281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT"
FT                   /locus_tag="KPN_00103"
FT                   /product="7,8-dihydro-8-oxoguanine-triphosphatase, prefers
FT                   dGTP"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00103"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75563"
FT                   /db_xref="GOA:A6T4P2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4P2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000086"
FT                   /protein_id="ABR75563.1"
FT                   /translation="MKKLQIAVGIIRNPQGEIFITQRAADAHMANKLEFPGGKIESDET
FT                   PEQALIRELQEEVGITVTTSSLFDKLEYQFPDRHITLWFFLVESWQGEPWGKEGQPGRW
FT                   MAGPTLDPAAFPPANEPVISKLIAQG"
FT   gene            complement(123334..123528)
FT                   /gene="yacG"
FT                   /locus_tag="KPN_00104"
FT   CDS_pept        complement(123334..123528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacG"
FT                   /locus_tag="KPN_00104"
FT                   /product="zinc-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00104"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75564"
FT                   /db_xref="GOA:A6T4P3"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4P3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR005584"
FT                   /protein_id="ABR75564.1"
FT                   /translation="MSEETIVNCPTCGKTVVWGEQSPFRPFCSKRCQLIDLGEWAAEEK
FT                   RIPSAGDLSDSDDWSEQQP"
FT   gene            complement(123538..124281)
FT                   /gene="yacF"
FT                   /locus_tag="KPN_00105"
FT   CDS_pept        complement(123538..124281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacF"
FT                   /locus_tag="KPN_00105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00105"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75565"
FT                   /db_xref="GOA:A6T4P4"
FT                   /db_xref="InterPro:IPR009777"
FT                   /db_xref="InterPro:IPR027462"
FT                   /db_xref="InterPro:IPR036268"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4P4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR009777"
FT                   /protein_id="ABR75565.1"
FT                   /translation="MHTPVLFEHPLNEKMRTWLRIEFLIQQMAFHPQIASHADALHFFR
FT                   NAGDLLDVLERGEVRTDLVKELERQQRKLQSWAEVPGVDQERINELRHQLKQSSSTLMA
FT                   APRIGQFLREDRLIALVRQRLSIPGGCCSFDLPTLHIWLHMPQAHRDEQVASWLASLDP
FT                   LVQSLSLILDLIRNSALFRKQTSLNGFYQDNGEDADLLRLRLDLAHQLYPQISGHKSRF
FT                   AIRFLALDSEYGIVPERFDFELACC"
FT   gene            complement(124281..124901)
FT                   /gene="coaE"
FT                   /locus_tag="KPN_00106"
FT   CDS_pept        complement(124281..124901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="KPN_00106"
FT                   /product="dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00106"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75566"
FT                   /db_xref="GOA:A6T4P5"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4P5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001977"
FT                   /protein_id="ABR75566.1"
FT                   /translation="MGYTVALTGGIGSGKSTVADAFAQLGVKVIDADVIARQVVEPGTP
FT                   ALQAIVGHFGPQMIAPDGTLNRRLLREKIFAHVEEKAWLNALLHPLIQQETRRQMQAAT
FT                   SPYLLWVVPLLVENRLSGQADRVLVVDVPKETQIERTMLRDKVSREHAEHILAAQATRQ
FT                   QRLAVADDVIENTGTPDAVASDVARLHEKYLTLASQAASQENS"
FT   gene            125245..126288
FT                   /gene="guaC"
FT                   /locus_tag="KPN_00107"
FT   CDS_pept        125245..126288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaC"
FT                   /locus_tag="KPN_00107"
FT                   /product="guanosine 5'-monophosphate oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00107"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75567"
FT                   /db_xref="GOA:A6T4P6"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005993"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4P6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001093"
FT                   /protein_id="ABR75567.1"
FT                   /translation="MRIEEDLKLGFKDVLIRPKRSTLKSRSDVELEREFTFKHSGLTWS
FT                   GVPIIAANMDTVGTFSMAKALATFGILTAVHKHYTAEEWLAFTQGASADVLKHVMVSTG
FT                   TSDADFEKTQQILSQNPQLNFVCIDVANGYSEHFVQFVAKAREAWPQKTIIAGNVVTGE
FT                   MCEELILSGADIVKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLGGQIISDGGC
FT                   TMPGDVAKAFGGGADFVMLGGMLAGHEESGGTIVEENGEKFMLFYGMSSESAMTRHVGG
FT                   VAKYRAAEGKTVKLPLRGPVENTARDILGGLRSACTYVGASRLKELTKRTTFIRVQEQE
FT                   NRVFNSL"
FT   gene            complement(126325..127530)
FT                   /gene="hofC"
FT                   /locus_tag="KPN_00108"
FT   CDS_pept        complement(126325..127530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hofC"
FT                   /locus_tag="KPN_00108"
FT                   /product="component in type IV pilin biogenesis,
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00108"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75568"
FT                   /db_xref="GOA:A6T4P7"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4P7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001992"
FT                   /protein_id="ABR75568.1"
FT                   /translation="MATKRLWRWRGIDVQGAPCQGMLWQTKRLEVLQHLQQQRVIPLAV
FT                   RRCAVKQSLWHPRYSCETIRQLATLLQAGLPLAEGLSLLAQQQSHAQWQALLEALGREL
FT                   AQGVAFSAALAQWPQAFPPLYLAMISTGELTGKLDICCLQLANQQQEQQRLASKVKKAL
FT                   RYPLIVLSLALLVVLGMLYFVLPEFTAIYQTFSTPLPLLTRMVVAAGDMLSRGWPLLLA
FT                   SLLSPLLLNQLIRRRSDWLLRRQRLLNALPLIGSLIGGQQLSLIFTILALTQSAGISFL
FT                   QGLQSVEESLSCPLWRQRLAQARALIVQGEPIWQALSRCGGFTPLCLQLIRTGESAGAL
FT                   DQMLENLAHHHRQQTYQRADSLAAHLEPMMLVITGSLVGILVVAMYLPVFHLGDAIGGV
FT                   GG"
FT   gene            complement(127520..128905)
FT                   /gene="hofB"
FT                   /locus_tag="KPN_00109"
FT   CDS_pept        complement(127520..128905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hofB"
FT                   /locus_tag="KPN_00109"
FT                   /product="putative integral membrane protein"
FT                   /note="involved in biogenesis of fimbriae (type IV pilin),
FT                   protein transport, DNA uptake"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00109"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75569"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4P8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001482"
FT                   /protein_id="ABR75569.1"
FT                   /translation="MKTEQLIPLCRRYHAMLLHSDEQTISIAVVNTPPAELMEALRFAT
FT                   QKRIDIECWSQEQMDKRLQAQEKQAQLAQNDGPENIAERVNQILEQALRQRASDIHIEP
FT                   TETHLRIRLRVDGVLHALPLLAPELAAPVIARLKVLASLDIAEHRLPQDGQFALNLAGR
FT                   PLSFRIATLPCRYGEKIVLRLLHQVDQALDLEALGLSSSQLAAFRQALNQPQGLLLVTG
FT                   PTGSGKTVTLYSALQARNREQVNICSVEDPLEIPIAGMNQTQINPRAGLTFHSVLRALL
FT                   RQDPDIVMVGEIRDAETAEIALKAAQTGHLVLSTLHTNSTSETLTRLQQMGIARWMISS
FT                   ALSLVIAQRLVRKLCPHCRRNAGSAADLPHSLWPRPLPRWQAAGCEHCYHGYYGRLALF
FT                   EVLPVTPGLRQGIVQGLNAIEIESLARAAGMMTLFESGCQAIEQGLTSLEEVVRVLGIP
FT                   HGD"
FT   gene            complement(128916..129347)
FT                   /gene="ppdD"
FT                   /locus_tag="KPN_00110"
FT   CDS_pept        complement(128916..129347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppdD"
FT                   /locus_tag="KPN_00110"
FT                   /product="prelipin peptidase dependent protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00110"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75570"
FT                   /db_xref="GOA:A6T4P9"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4P9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001082"
FT                   /protein_id="ABR75570.1"
FT                   /translation="MDKQRGFTLIELMVVIGIIAILSAIGIPAYQNYLRKAALTDLLQT
FT                   FVPYRTAIELCALDHGGLTPCDGGSNGIPSPTTTRYLSAMSVAKGVVTLTGQESLNGLG
FT                   VTLTPTWDNAEGVTGWQRVCTITGNSALQQACEDVFRVK"
FT   gene            complement(129529..130422)
FT                   /gene="nadC"
FT                   /locus_tag="KPN_00111"
FT   CDS_pept        complement(129529..130422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="KPN_00111"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00111"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75571"
FT                   /db_xref="GOA:A6T4Q0"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4Q0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002638"
FT                   /protein_id="ABR75571.1"
FT                   /translation="MSPRRYNPDRRRDVLLERINLDITDAVAHSLREDLGGEVDANNDI
FT                   SAQLLPQDARSHAVVITREDGVFCGKRWVEEVFIQLAGDDVNITWHVADGDAVKADQPL
FT                   FELEGPSRILLTGERTALNFVQTLSGVASVVRRYVDLLAGTKTQLLDTRKTLPGLRTAL
FT                   KYAVLCGGGANHRLGLFDAFLIKENHIIASGSIRQAVEKAFWLHPDVPVEVEVETLDEL
FT                   EQALKAGADIIMLDNFTTDLMREAVKITAGQAALEVSGNVTFDTIREFADTGVDYISVG
FT                   ALTKHVQALDLSMRFR"
FT   gene            130556..131119
FT                   /gene="ampD"
FT                   /locus_tag="KPN_00112"
FT   CDS_pept        130556..131119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampD"
FT                   /locus_tag="KPN_00112"
FT                   /product="N-acetyl-anhydromuramyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00112"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75572"
FT                   /db_xref="GOA:A6T4Q1"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4Q1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002502"
FT                   /protein_id="ABR75572.1"
FT                   /translation="MQLNKGWLVGARRVPSPHHDCRPDEETPSLLVVHNISLPPGEFGG
FT                   PWIDALFTGTLDPHAHPFFAEIAHLRVSAHCLIRRDGEIVQYVPFDKRAWHAGVSCYQG
FT                   RERCNDFSIGIELEGTDTLAYTDAQYRQLAAVTDLLIALYPAIAENIAGHSDIAPVRKT
FT                   DPGPAFDWIKYRALLSAPSEKETS"
FT   gene            131116..131970
FT                   /gene="ampE"
FT                   /locus_tag="KPN_00113"
FT   CDS_pept        131116..131970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampE"
FT                   /locus_tag="KPN_00113"
FT                   /product="putative transmembrane protein, putative
FT                   protease"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00113"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75573"
FT                   /db_xref="GOA:A6T4Q2"
FT                   /db_xref="InterPro:IPR031347"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4Q2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75573.1"
FT                   /translation="MTLFTTLLVLIAERLFKLGEHWQLDHRLEVAFRRIKHFSLPGTLL
FT                   MTLVAVAVVYIIQRLLQGQLFNIPLLVFWILLGLLCIGAGKVRLHYHAYLKAASRNDSR
FT                   ACDAMASELTLIHGVPPGCDEREYLSELQNALLWINYRYYLAPLFWFVVGGAWGPLTLI
FT                   AYSVLRAWQTWLARYQTPHHRLQSGIDGILHIVDWLPVRLVGVVYALVGHGEKALPAWF
FT                   ASLGDRHSSQYQVLTRLAQYSLAREPHVDKVATPKAAVSMAKKTSLVVVVIMALLTIYG
FT                   TLV"
FT   gene            complement(132206..133156)
FT                   /locus_tag="KPN_00114"
FT   CDS_pept        complement(132206..133156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00114"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00114"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75574"
FT                   /db_xref="GOA:A6T4Q3"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR016828"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4Q3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR006710"
FT                   /protein_id="ABR75574.1"
FT                   /translation="MNNWPNPFIEQRADPFILRHLSHYYFIASVPEYDRLEIRRAVTLE
FT                   GLRDAEPVVVWRAPQSGPMSQLIWAPELHEIDGKWYIYFAATHTHDLDARGMFQHRMFV
FT                   LECADSDPLTGRWQEKGQVVTPFDTFALDATTFTHQGKRWYLWAQKSPHIEGNSNLYLA
FT                   EMANPWTLKGEPVMLSKPEFDWECRGFKVNEGPAVLMHGDKLFISYSASATDENYCMGL
FT                   LWIDRQADPLQPANWHKAPQPVFRTSYENRQYGPGHNSFTQTPEGEDVLVYHARNYTEI
FT                   EGDPLYDPNRHTRLKLVSWREDGMPDFGIPPADTL"
FT   gene            complement(133156..134517)
FT                   /locus_tag="KPN_00115"
FT   CDS_pept        complement(133156..134517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00115"
FT                   /product="putative permease of the Na+:galactoside
FT                   symporter family"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00115"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75575"
FT                   /db_xref="GOA:A6T4Q4"
FT                   /db_xref="InterPro:IPR001927"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4Q4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75575.1"
FT                   /translation="MGDAGCNIIFGAIMLFVNYFYTDIFGLAPALVGVLLLSVRVIDAV
FT                   TDPIMGALADRTRSKYGRFRPWLLWIAFPYALFSVLMFTTPEWTYNSKVIYAFVTYFLL
FT                   SITYTAINIPYCSLGTVMTADPKERVACQSYRFVMVGIATLLLSLTLLPMADWFGGADK
FT                   AKGYQMAMTVLAFIGMCMFLFCFATVRERIRPAVQTNDELKKDLKDVWKNDQWVRILLL
FT                   TLCNVCPGFIRMAATMYYVTWVMGQSTHFATLFISLGVVGMMIGSMLAKVLTDRWCKLQ
FT                   VFFWTNIVLAVFSCAFYFFNPHATTLIMVLYFLLNILHQIPSPLHWSLMSDVDDYGEWK
FT                   TGKRITGISFSGNLFFLKVGLAVAGAMVGFLLSWYGYDAGAKAQSASALNGIVLLFSVI
FT                   PGVGYLITAGVVRLLKVDRTLMRQIQSDLEKRRSNYSELNEYQELKTSEHVRKA"
FT   gene            complement(134747..136117)
FT                   /gene="aroP"
FT                   /locus_tag="KPN_00116"
FT   CDS_pept        complement(134747..136117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroP"
FT                   /locus_tag="KPN_00116"
FT                   /product="aromatic amino acid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00116"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75576"
FT                   /db_xref="GOA:A6T4Q5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4Q5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004841"
FT                   /protein_id="ABR75576.1"
FT                   /translation="MEGQQHGDRLKRGLKNRHIQLIALGGAIGTGLFLGSASVIQSAGP
FT                   GIILGYAIAGFIAFLIMRQLGEMVVEEPVAGSFSHFAYKYWGGFAGFASGWNYWVLYVL
FT                   VAMAELTAVGKYIQFWWPEIPTWASAAVFFIAINAINLTNVKVFGEMEFWFAIIKVVAV
FT                   VAMILFGGWLLFSGNGGPQATVRNLWDQGGFLPHGFYGLVMMMAIIMFSFGGLELVGIT
FT                   AAEADNPEQSIPKATNQVIYRILIFYVGSLAVLLSLLPWTRVTADTSPFVLIFHELGDT
FT                   LVANALNVVVLTAALSVYNSCVYCNSRMLFGLAQQGNAPKALLSVDKRGVPVNTILVSA
FT                   LVTALCVLINYLAPESAFGLLMALVVSALVINWAMISLAHMKFRRAKKQQGVVTRFPAL
FT                   FYPLGNWLCLLFMAAVLVIMLMTPGMAISVWLIPVWIAVLGVGYLFKEKAAATIKAQ"
FT   gene            136761..137540
FT                   /gene="pdhR"
FT                   /locus_tag="KPN_00117"
FT   CDS_pept        136761..137540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhR"
FT                   /locus_tag="KPN_00117"
FT                   /product="transcriptional regulator of pyruvate
FT                   dehydrogenase complex"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00117"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75577"
FT                   /db_xref="GOA:A6T4Q6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4Q6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000524"
FT                   /protein_id="ABR75577.1"
FT                   /translation="MAYSKIRQPKLSDVIEQQLEFLILEGTLRPGEKLPPERELAKQFD
FT                   VSRPSLREAIQRLEAKGLLLRRQGGGTFVQSRLWQSFSDPLVELLSDHPESQFDLLETR
FT                   HALEGIAAYYAALRSNDEDRDRIRELHQAIERAQQSGDLDAESGAVVQYQIAVTEAAHN
FT                   VVLLHLLRCMEPMLAQNVRQNFELLYARREMLPLVSNHRTRIFEAIMAGEPEQAREASH
FT                   RHLAFIEEILLDRSREQSRRERSLRRLQQRKDENSGS"
FT   gene            137677..140340
FT                   /gene="aceE"
FT                   /locus_tag="KPN_00118"
FT   CDS_pept        137677..140340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceE"
FT                   /locus_tag="KPN_00118"
FT                   /product="pyruvate dehydrogenase (decarboxylase component)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00118"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75578"
FT                   /db_xref="GOA:A6T4Q7"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4Q7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR005474"
FT                   /protein_id="ABR75578.1"
FT                   /translation="MSERLHNDVDPIETRDWLQAIESVIREEGVERAQYLIDQLLSEAR
FT                   KGGVKVAAGASAGNYVNTIAVEDEPEYPGNLDLERRIRSAIRWNAIMTVLRASKKDLEL
FT                   GGHMASYQSSATFYEVCFNHFFRARTEKDGGDLVYFQGHISPGVYARAFLEGRLTEEQM
FT                   DNFRQEVHGKGLSSYPHPKLMPEFWQFPTVSMGLGPLGAIYQAKFLKYLEHRGLKDTSE
FT                   QTVYAFLGDGEMDEPESKGAITIATREKLDNLVFVINCNLQRLDGPVTGNGKIINELEG
FT                   IFGGAGWNVIKVIWGGRWDELLRKDTSGKLIQLMNETVDGDYQTFKSKDGAYVREHFFG
FT                   KYPETAALVADWTDEQIWALNRGGHDPKKVYAALKKAQETKGQPTVILAHTIKGYGMGD
FT                   TAEGKNIAHQVKKMNMDGVRYVRDRFNVPVADADLEKLPYVTFPEGSEEHTYLHAQRQK
FT                   LNGYLPTRQPKFTEKLELPTLADFSALLEEQNKEISTTIAFVRALNVMLKNKSIKDRLV
FT                   PIIADEARTFGMEGLFRQIGIYSPNGQQYTPQDREQVAYYKEDEKGQILQEGINELGAG
FT                   ASWLAAATSYSTNNLPMIPFYIYYSMFGFQRIGDLCWAAGDQQARGFLIGGTSGRTTLN
FT                   GEGLQHEDGHSHIQSLTIPNCISYDPAYAYEVAVIMHDGLVRMYGEAQENVYYYITTLN
FT                   ENYHMPAMPEGAEEGIRKGIYKLETIEGSKGKVQLLGSGSILRHVREAAQILAKDYGVG
FT                   SDVYSVTSFTELARDGQDCERWNMLHPLETPRVPYIAQVMNDAPAVASTDYMKLFAEQV
FT                   RTYVPADDYRVLGTDGFGRSDSRENLRHHFEVDASYVVVAALGELAKRGEIDKKVVADA
FT                   IAKFDIDAEKVNPRLA"
FT   gene            140355..142253
FT                   /gene="aceF"
FT                   /locus_tag="KPN_00119"
FT   CDS_pept        140355..142253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceF"
FT                   /locus_tag="KPN_00119"
FT                   /product="dihydrolipoamide acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00119"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75579"
FT                   /db_xref="GOA:A6T4Q8"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4Q8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000089"
FT                   /inference="protein motif:Pfam:IPR001078"
FT                   /inference="protein motif:Pfam:IPR004167"
FT                   /protein_id="ABR75579.1"
FT                   /translation="MAIEIKVPDIGADEVEITEILVKVGDKVEAEQSLITVEGDKASME
FT                   VPSPQAGVVKEIKVSVGDKTETGKLIMIFDSAEGAAAAAPAQEEKKEAAPAAAAPAAAA
FT                   AAKEVHVPDIGGDEVEVTEIMVKVGDTIAAEQSLITVEGDKASMEVPAPFAGTVKEIKI
FT                   NTGDKVSTGSLIMIFEVAGAAPAAAPAQAAAPAAAAPAAAAGVKDVNVPDIGGDEVEVT
FT                   EVMVKVGDKVAAEQSLITVEGDKASMEVPAPFAGTVKEIKISTGDKVKTGSLIMVFEVE
FT                   GAAPAAAPAQAAAPAPAAAPAQAAKPAAAPAAKAEGKSEFAENDAYVHATPLIRRLARE
FT                   FGVNLAKVKGTGRKGRILREDVQAYVKEAVKRAESAPAAAAGGGIPGMLPWPKVDFSKF
FT                   GEVEEVELGRIQKISGANLSRNWVMIPHVTHFDKTDITDLEAFRKQQNAEAEKRKLDVK
FT                   FTPVVFIMKAVAAALEQMPRFNSSLSEDGQRLTLKKYINIGVAVDTPNGLVVPVFKDVN
FT                   KKSITELSRELTTISKKARDGKLTAGEMQGGCFTISSIGGLGTTHFAPIVNAPEVAILG
FT                   VSKSAMEPVWNGKEFVPRLMLPISLSFDHRVIDGADGARFITIINNTLSDIRRLVM"
FT   gene            142460..143884
FT                   /gene="lpdA"
FT                   /locus_tag="KPN_00120"
FT   CDS_pept        142460..143884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpdA"
FT                   /locus_tag="KPN_00120"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00120"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75580"
FT                   /db_xref="GOA:A6T4Q9"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4Q9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001327"
FT                   /inference="protein motif:Pfam:IPR004099"
FT                   /protein_id="ABR75580.1"
FT                   /translation="MSTEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYSTLGGVC
FT                   LNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEPKTDIDKIRTWKEKVITQLTGGLAGM
FT                   AKGRKVKVVNGLGKFTGANTLEVEGENGKTVINFDNAIIAAGSRPIQLPFIPHEDPRVW
FT                   DSTDALELKSVPKRMLVMGGGIIGLEMGTVYHALGSEIDVVEMFDQVIPAADKDVVKVF
FT                   TKRISKKFNLMLETKVTAVEAKEDGIYVSMEGKKAPAEAQRYDAVLVAIGRVPNGKNLD
FT                   AGKAGVEVDDRGFIRVDKQMRTNVPHIFAIGDIVGQPMLAHKGVHEGHVAAEVISGLKH
FT                   YFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETATFPWAASGRAIASDCADGMTKL
FT                   IFDKETHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEV
FT                   FEGSITDLPNAKAKKK"
FT   gene            144049..144333
FT                   /locus_tag="KPN_00121"
FT   CDS_pept        144049..144333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00121"
FT                   /product="probable secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00121"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75581"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4R0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75581.1"
FT                   /translation="MKRFLTTALVAATFFTGVAYAADANIPWADNSGGTETTHIAAMGQ
FT                   DLNAQHQQVTKTNEGVWAANSGSISADEAALSSTKPAFAGDPSLMPHQG"
FT   gene            complement(144379..145149)
FT                   /locus_tag="KPN_00122"
FT   CDS_pept        complement(144379..145149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00122"
FT                   /product="probable secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00122"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75582"
FT                   /db_xref="InterPro:IPR021556"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4R1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75582.1"
FT                   /translation="MLSPLAVFAQQQFATPEQAATALAEAISQPNEAALSEVLGDNWQQ
FT                   FLPTDGIDPAAVDRFQRDWQVKHVIIQQGDKAWLDVGSEAWRLPVPIVKASEGWRFDMA
FT                   AGEEEILTRAIGRNELSAIAAMHAYVDAQQDYYHLNHRWAQKIISSEGKKDGLYWPTSP
FT                   GEAPSPLGPAFSPTVPGSGYHGYRFRIIAGRDDQSVALLAWPIAWGETGVMSFMIDQQD
FT                   RVYQANLGEESAAKAQEITRFTPDADAGWQVAEP"
FT   gene            complement(145197..146804)
FT                   /gene="yacH"
FT                   /locus_tag="KPN_00123"
FT   CDS_pept        complement(145197..146804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacH"
FT                   /locus_tag="KPN_00123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00123"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75583"
FT                   /db_xref="InterPro:IPR021728"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4R2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75583.1"
FT                   /translation="MSLPFKPHIIALLCSAGLLAAAGTLYVQSRTPATIAEPPAQQAPA
FT                   PAASTTQPVAATYTQAQIDQWVAPIALYPDSLLSQVLMASTYPDNVLQAVQWSQDNPAM
FT                   KGDAAVQAVASQPWDPSVKSLVAFPALLAMMGENPPWVENLGNAFLAQPHDVMDSVQRL
FT                   RAIAQQTGTLKSTPQQKVIVTPAAPVSASSSTAATATAHTAAPAPTQVIKIEPTNPQVV
FT                   YVPSYNPSTVYGTWPNSAYPPVYLPPPPGEQFTDSFVKGFGYSLGVATTWALFSSIDWD
FT                   DDDHHHHDDDYHHGDYSHNGDNININVNNFNHITGENLPGNHVNWQHNPAYRGHTPYPD
FT                   NTVAQRFHQTNVSGGLSATQHAPVDREAQRQAAMTQLQHNVPTATAGNLAANNTSRDAQ
FT                   RQAASAQLKQATQRSNYRGYDSTPTQQQRREAAKTQLKNPTPQQQQRREAARSHEQNRT
FT                   PQQQQRRQQFQSATPAQRQQTLSHLRANALSGNESRAPSWQAQQERGLQSRQFSGVNRE
FT                   LRDGTRERLSEHHELRRR"
FT   gene            147278..149833
FT                   /gene="acnB"
FT                   /locus_tag="KPN_00124"
FT   CDS_pept        147278..149833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acnB"
FT                   /locus_tag="KPN_00124"
FT                   /product="aconitate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00124"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75584"
FT                   /db_xref="GOA:A6T4R3"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004406"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015929"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015933"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="InterPro:IPR036288"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4R3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001030"
FT                   /inference="protein motif:Pfam:IPR004406"
FT                   /protein_id="ABR75584.1"
FT                   /translation="MGIVAKPLDATQMAALVELLKNPPAGEEEFLLDLLINRVPPGVDE
FT                   AAYVKAGFLAAIAKGEATSPLVTPEKAVELLGTMQGGYNIHPLIDALDDAKLAPIAAKA
FT                   LSHTLLMFDNFYDVEEKAKAGNEHAKQVMQSWADAEWFLNRPQLAEKITVTVFKVTGET
FT                   NTDDLSPAPDAWSRPDIPLHALAMLKNPREGIEPDQPGVVGPIKQIEALQQKGYPLAYV
FT                   GDVVGTGSSRKSATNSVLWFMGDDIPNVPNKRGGGLCLGGKIAPIFFNTMEDAGALPIE
FT                   VDVSNLNMGDVIDVYPFKGEVRNHETNELLASFELKTDVLIDEVRAGGRIPLIIGRGLT
FT                   TKAREALGLPHSDVFRQAKDVAESTRGFSLAQKMVGRACGVAGIRPGAYCEPKMTSVGS
FT                   QDTTGPMTRDELKDLACLGFSADLVMQSFCHTAAYPKPVDVTTHHTLPDFIMNRGGVSL
FT                   RPGDGVIHSWLNRMLLPDTVGTGGDSHTRFPIGISFPAGSGLVAFAAATGVMPLDMPES
FT                   VLVRFKGKMQPGITLRDLVHAIPLYAIKQGLLTVEKKGKKNIFSGRILEIEGLPDLKVE
FT                   QAFELTDASAERSAAGCTIKLNKEPIVEYLNSNIVLLKWMIAEGYGDRRTLERRIQGME
FT                   KWLADPQLLEADADAEYAAVIDIDLADIKEPILCAPNDPDDARLLSDVQGEKIDEVFIG
FT                   SCMTNIGHFRAAGKLLDSHKGQLPTRLWVAPPTRMDAAQLTEEGYYSVFGKSGARIEIP
FT                   GCSLCMGNQARVADGATVVSTSTRNFPNRLGTGANVYLASAELAAVASLLGKLPTPEEY
FT                   QTFVAQVDKTAEDTYRYLNFNQLDQYTEKADGVIFQTAV"
FT   gene            150020..150382
FT                   /gene="yacL"
FT                   /locus_tag="KPN_00125"
FT   CDS_pept        150020..150382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacL"
FT                   /locus_tag="KPN_00125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00125"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75585"
FT                   /db_xref="InterPro:IPR008249"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4R4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR008249"
FT                   /protein_id="ABR75585.1"
FT                   /translation="MDYEFLRDITGVVKVRMSMDHEAIGHWFNEEVKGNLALLDEVEQA
FT                   ARTVKGSERSWQRAGHEYTLWLDGEEVMIRANQLEFSGDEIEEGMSYYDEESLSLCGVE
FT                   DFLQVVAAYREFMQQR"
FT   gene            complement(150455..151240)
FT                   /gene="speD"
FT                   /locus_tag="KPN_00126"
FT   CDS_pept        complement(150455..151240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speD"
FT                   /locus_tag="KPN_00126"
FT                   /product="S-adenosylmethionine decarboxylase proenzyme"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00126"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75586"
FT                   /db_xref="GOA:A6T4R5"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR009165"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4R5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003826"
FT                   /protein_id="ABR75586.1"
FT                   /translation="MKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNANRL
FT                   TEILTETCSIIGANILNIARQDYEPQGASVTILVSEEPVDPKLIDQTEHPGPLPETVVA
FT                   HLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPLKALNYLIHQLESDIVTIDYR
FT                   VRGFTRDINGMKHFIDHEINSIQNFMSDDMKSLYDMVDVNVYQENIFHTKMLLKEFDLK
FT                   HYMFHTRPEELTAEERKVITDLLWKEMREIYYGRNIPAV"
FT   gene            complement(151274..152134)
FT                   /gene="speE"
FT                   /locus_tag="KPN_00127"
FT   CDS_pept        complement(151274..152134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speE"
FT                   /locus_tag="KPN_00127"
FT                   /product="spermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00127"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75587"
FT                   /db_xref="GOA:A6T4R6"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4R6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001045"
FT                   /protein_id="ABR75587.1"
FT                   /translation="MADNPLWHETLHDHFGQYFSVDNVLYHEKTDHQDLIIFDNRAFGR
FT                   VMALDGVVQTTERDEFIYHEMMTHVPLLAHGNAKHVLIIGGGDGAMLREVSRHRSIETI
FT                   TMVEIDAGVVSFCRQYLPNHNAGAYDDPRFTLVIDDGVNFVNQTTQTFDVIISDCTDPI
FT                   GPGESLFTSAFYEGCKRCLNPGGIFVAQNGVCFLQQDEAVGSHRKLSHYFRDVSFYQAA
FT                   IPTYYGGIMTFAWASDNEALRHLSSEIIQARFHKANLTCRYYNPAIHTAAFALPQYLHD
FT                   ALSAP"
FT   gene            complement(152284..154479)
FT                   /locus_tag="KPN_00128"
FT   CDS_pept        complement(152284..154479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00128"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00128"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75588"
FT                   /db_xref="GOA:A6T4R7"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4R7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001179"
FT                   /protein_id="ABR75588.1"
FT                   /translation="MNRAATLTLNAPLLMLVAALALSTPFTAGAAPAFLDYAQQQTQQS
FT                   QAQEKNDAASAKQTQESRQSADNKKTGTSTSQLQKRITSQQAAIAQKDKLIQQLKKQLA
FT                   ATPQTDTAGANEQAALNKRINELQVALSAATAEKEALIKKAGVVQNNNLQQSQAAARQQ
FT                   IQQLTTQIQQAEAENKRLSASFTTLNKDKHALMTQLAAAEKEKQAALEQVKALNADKQP
FT                   LTTRLAAAEKEKQAVLEQVKALNADKQSLTIRLAAAEKAQQAALDQAKALNADKQPLAT
FT                   RLAAAEKEKQAVLEQVKALNADKQSLTIRLAAAEKAQQAALDQAKALNADKQPLTTRLA
FT                   AAEKEKQAVLEQVKALNADKQSLTIRLAAAEKAQQAALDQAKALNADKQPLATRLAAAE
FT                   KEKQAVLEQVKALNADKQSLTIRLAAAEKTQQAALDQVKALNADKQSLSTRLAAADKAP
FT                   HGPANDAAAPKNEPPEMAAIVAAYRLQADKDNAQLRMKEDEIELLRTQLSVQSKTRSGE
FT                   SAAAKLSASGEQQAYAIGASMGSEALNVLTTRRTQGVTVDAGLVLQGIEDAFRGQLRLG
FT                   EQERNKALFDVSQQVYQNLNKIEQKNISAGKKYQQAFARKKDVVFKEGVYSRVDYPGKG
FT                   KISGNDLVTVVIKEMLTDGTVINDMEAKDQALTQKLDAYPPVFREPLKRLQNHGSVTLV
FT                   VPPEKAYGSKGLPPKIPPGATMVYSVRIVDSQPEPAK"
FT   gene            complement(154476..154886)
FT                   /locus_tag="KPN_00129"
FT   CDS_pept        complement(154476..154886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00129"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75589"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4R8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75589.1"
FT                   /translation="MNISLTLRVIPLAALLVAGCSNTSSRQPVKPIATPLTTQQQAEQE
FT                   RAASEQARIESCRQALDSLKEVNPQQATKLSNDFNALVRAASQYNSVREKVADPTRLGI
FT                   DSMYQFKSIKLCADIQKTLIDSLVQRGESKQP"
FT   gene            complement(155134..155460)
FT                   /gene="yacC"
FT                   /locus_tag="KPN_00130"
FT   CDS_pept        complement(155134..155460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacC"
FT                   /locus_tag="KPN_00130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00130"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75590"
FT                   /db_xref="InterPro:IPR019114"
FT                   /db_xref="InterPro:IPR038432"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4R9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75590.1"
FT                   /translation="MVLGSLLALSANSYALSESEAEDMADLTAVFVFLKNDCGYQNLPN
FT                   TQIRRALVFFAQQNQWDLSNYDSYNMKALGEDSYRDLSGINIPTAKKCKALARDSLSLL
FT                   AYVK"
FT   gene            155627..157225
FT                   /gene="cueO"
FT                   /locus_tag="KPN_00131"
FT   CDS_pept        155627..157225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cueO"
FT                   /locus_tag="KPN_00131"
FT                   /product="Probable periplasmic copper oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00131"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75591"
FT                   /db_xref="GOA:A6T4S0"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4S0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75591.1"
FT                   /translation="MQRRDFLKLTAAVGMASALPLWSRAVFAASRPALPIPSLLAADAR
FT                   NRIALRIQAGKTRFGALNATTWGYNGSLLGPALQLTQGKTVTVDITNQLAEETTLHWHG
FT                   LEVPGEVDGGPQGVIAPGATRTVSFTPTQRAATCWFHPHQHGSTGRQVAMGLAGLVLIE
FT                   DEESGRLLLPKQWGIDDVPVIVQDKKFTAAGEIDYQLDVMSAAVGWFGDTLLTNGALYP
FT                   EHAAPRGWLRLRLLNGCNARSLNFATSDKRPLYVVASDGGLLAEPVKVDELPVLMGERF
FT                   EVLVDTSDGKPFDLVTLPVSQMGMAIAPFDKPQPVLRVQPLVIPASGKLLDTLAALPAL
FT                   PSLTGLTQRQLQLSMDPMLDRMGMQALMEKYGDQAMAGMDHGMMGHGDMSDMGNMHHGD
FT                   MSMNHGSGMEHGMSSGKGFDFHNANRINGKAFDMNEPMFAAARGQYERWVISGKGDMML
FT                   HPFHIHGTQFRILSENGKPPAAHRRGWKDTVRVEGDVSEVLVKFDHPAPKEFAYMAHCH
FT                   LLEHEDTGMMLGFTV"
FT   gene            complement(157309..159663)
FT                   /gene="gcd"
FT                   /locus_tag="KPN_00132"
FT   CDS_pept        complement(157309..159663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcd"
FT                   /locus_tag="KPN_00132"
FT                   /product="glucose dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00132"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75592"
FT                   /db_xref="GOA:A6T4S1"
FT                   /db_xref="InterPro:IPR001479"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017511"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4S1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002372"
FT                   /protein_id="ABR75592.1"
FT                   /translation="MTLTALFAAFCGLYLLIGGAWLVVLGGSWYYPIAGLVMLGVTVML
FT                   FRGKRAALWLYAALLLATMIWGVWEVGFDFWALTPRSDILVFFGIWLILPFVWRRLPVP
FT                   SAGAVGALVVALLISGGMLTWAGFNDPQEVNGTLSADATPAAPISTVADGDWPAYGRNQ
FT                   EGQRFSPLKQINADNVKNLKEAWVFRTGDLKQPNDPGEITNEVTPIKVGDTLFLCTAHQ
FT                   RLFALDAATGKEKWHFDPQLNADPSFQHVTCRGVSYHEAKADNAPADVVADCPRRIILP
FT                   VNDGRLFAVNADNGKLCETFANKGILNLQTNMPVTTPGMYEPTSPPIITDKTIVIAGAV
FT                   TDNFSTREPSGVIRGFDVNTGKLLWAFDPGAKDPNAIPSDEHHFTLNSPNSWAPAAYDA
FT                   KLDLVYLPMGVTTPDIWGGNRTPEQERYASSIVALNATTGKLAWSYQTVHHDLWDMDMP
FT                   SQPTLADIEVNGKTVPVIYAPAKTGNIFVLDRRNGELVVPAPEKPVPQGAAKGDYVTKT
FT                   QPFSDLSFRPKKDLTGADMWGATMFDQLVCRVIFHQLRYEGIFTPPSEQGTLVFPGNLG
FT                   MFEWGGISVDPNRQVAIANPMALPFVSKLIPRGPGNPMEPPKDAKGSGTESGVQPQYGV
FT                   PYGVTLNPFLSPFGLPCKQPAWGYISALDLKTNEVVWKKRIGTPQDSLPFPMPVKLPFT
FT                   MGMPMLGGPISTAGNVLFIGATADNYLRAYNMSNGEKLWEARLPAGGQATPMTYEVNGK
FT                   QYVVISAGGHGSFGTKMGDYIVAYALPDDAK"
FT   gene            159892..160440
FT                   /gene="hpt"
FT                   /locus_tag="KPN_00133"
FT   CDS_pept        159892..160440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="KPN_00133"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00133"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75593"
FT                   /db_xref="GOA:A6T4S2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4S2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000836"
FT                   /protein_id="ABR75593.1"
FT                   /translation="MVSIMKHTVEVMIPESEIKARIAELGRQINEHYQNSGSEMVLVGL
FT                   LRGSFMFMADLCREVQVPHEVDFMTASSYGSGMSTTRDVKILKDLDEDIRGKDVLIVED
FT                   IIDSGNTLSKVREILSLREPKSLAICTLLDKPSRREVNVPVEYVGFAIPDEFVVGYGID
FT                   YAQRYRHLPYIGKVTLLDE"
FT   gene            complement(160500..161114)
FT                   /gene="yadF"
FT                   /locus_tag="KPN_00134"
FT   CDS_pept        complement(160500..161114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadF"
FT                   /locus_tag="KPN_00134"
FT                   /product="putative carbonic anhdrase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00134"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75594"
FT                   /db_xref="GOA:A6T4S3"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4S3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001765"
FT                   /protein_id="ABR75594.1"
FT                   /translation="MLVEEDPGFFEKLSQTQKPRFLWIGCSDSRVPAERLTGLEPGELF
FT                   VHRNVANLVIHTDLNCLSVVQYAVDVLEVEHIIICGHYGCGGVQAAVENPELGLIDNWL
FT                   LHIRDIWFKHSSLLGEMPEERRLDTLCELNVMEQVYNLGHSTIMQSAWKRGQKVTIHGW
FT                   AYGIHDGLLRDLDVTAVSRETLEQRYRHGISNLKIKHINHR"
FT   gene            161347..162273
FT                   /gene="yadG"
FT                   /locus_tag="KPN_00135"
FT   CDS_pept        161347..162273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadG"
FT                   /locus_tag="KPN_00135"
FT                   /product="putative ATP-binding component of a transport
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00135"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75595"
FT                   /db_xref="GOA:A6T4S4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4S4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003439"
FT                   /protein_id="ABR75595.1"
FT                   /translation="MTIALELKQLKKTYPGGVQALRGIDLQVEAGDFYALLGPNGAGKS
FT                   TTIGIISSLVNKTSGQVNVFGYDLEKDVVNAKRQLGLVPQEFNFNPFETVQQIVVNQAG
FT                   YYGVERKEALSRSEKYLKQLDLWEKRNERARMLSGGMKRRLMIARALMHEPKLLILDEP
FT                   TAGVDIELRRSMWGFLKDLNDRGTTIILTTHYLEEAEMLCRNIGIIQHGELVENTSMKA
FT                   LLSKLKSETFILDLAPKSPVPKLEGYQYQLVDTSTLEVEVLREQGINSVFAQLSAQGVQ
FT                   VLSMRNKANRLEELFVTLVHERKGESA"
FT   gene            162270..163040
FT                   /gene="yadH"
FT                   /locus_tag="KPN_00136"
FT   CDS_pept        162270..163040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadH"
FT                   /locus_tag="KPN_00136"
FT                   /product="putative transport protein (ABC superfamily,
FT                   membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00136"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75596"
FT                   /db_xref="GOA:A6T4S5"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4S5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000412"
FT                   /protein_id="ABR75596.1"
FT                   /translation="MMQLYWVALKSIWTKEIHRFMRIWVQTLVPPVITMTLYFVIFGNL
FT                   IGSRIGEMHGFTYMQFIVPGLIMMAVITNAYANVASSFFSAKFQRNIEELLVAPVPTHV
FT                   IIAGYVGGGVARGLCVGILVTAVSLFFVPFQVHSWLFVALTLLLTAVLFSLAGLLNAVF
FT                   AKTFDDISLIPTFVLTPLTYLGGVFYSLTLLPPFWQGLSHLNPIVYMISGFRFGFLGIN
FT                   DVPLATTFAVLVVFIVAFYLLCWSLIQRGRGLRS"
FT   gene            163163..163603
FT                   /gene="yadI"
FT                   /locus_tag="KPN_00137"
FT   CDS_pept        163163..163603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadI"
FT                   /locus_tag="KPN_00137"
FT                   /product="putative PTS enzyme II B component"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00137"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75597"
FT                   /db_xref="GOA:A6T4S6"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4S6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004701"
FT                   /protein_id="ABR75597.1"
FT                   /translation="MLGWVITCHDELAQEMLDRLEQKFGPLAQCRAVNYWRNLSSNMLS
FT                   RMMCDALHATDSGDGVIFLTDKTGAAPYRAAALMSHKHTHCEVISGVSYPLLERMYLLR
FT                   GTLSSVAFRQAIVSAGGPMVSSLWHQQQKNPPFRLRHDAWGN"
FT   gene            163662..164915
FT                   /gene="yadE"
FT                   /locus_tag="KPN_00138"
FT   CDS_pept        163662..164915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadE"
FT                   /locus_tag="KPN_00138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00138"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75598"
FT                   /db_xref="GOA:A6T4S7"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4S7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002509"
FT                   /protein_id="ABR75598.1"
FT                   /translation="MRMLARFLTLLLFLTSLSASASLLSQHGKAVRYMQTTEDAVIWAQ
FT                   VGNHVVSVGNVRAGQILAVVPTAADYYEFRFGFGTGFIDKGHLEPVQGKQRVEDRLGDL
FT                   NKPLSNQNLLTWKDTPLYDAPSVSSAPFGTLANNLRYPILSKLKDRLNQTWFQIRIGDR
FT                   LAWVSSLDAQEDHGIPVLTYHHILRDEENTRFRHTSTTTSVRAFTNQMTWLRDQGYTTL
FT                   TLYQLEGYVRNKINLPARAVAITFDDGLKSVNRYAYPVLKQYGFHATAFIISSRIKRHP
FT                   QKWDPKSLQFMSISELRQIQDVFDIQSHTHFLHRVDAGRRPILFSRNYHNILFDFARSR
FT                   RALSQFNPHVLYLSYPFGGYNATAVQAANDAGFHMAVTTVRGKVKPGDNPFLLKRLYIL
FT                   RTDSLETMSRLISNQPQG"
FT   gene            complement(164951..165331)
FT                   /gene="panD"
FT                   /locus_tag="KPN_00139"
FT   CDS_pept        complement(164951..165331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panD"
FT                   /locus_tag="KPN_00139"
FT                   /product="aspartate 1-decarboxylase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00139"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75599"
FT                   /db_xref="GOA:A6T4S8"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4S8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003190"
FT                   /protein_id="ABR75599.1"
FT                   /translation="MMRNMLQGKLHRVKVTQADLHYEGSCAIDQDFLDAAGILENETIH
FT                   LWNVTNGNRFSTYAIAAERGSRIISVNGAAAHCASVGDILIIASFVTMSDEEARSWQPN
FT                   IAYFEGDNEMKRQAKAIPVQVA"
FT   gene            complement(165424..166278)
FT                   /gene="panC"
FT                   /locus_tag="KPN_00140"
FT   CDS_pept        complement(165424..166278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="KPN_00140"
FT                   /product="pantoate--beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00140"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75600"
FT                   /db_xref="GOA:A6T4S9"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4S9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003721"
FT                   /protein_id="ABR75600.1"
FT                   /translation="MLIIESVLLLRQHIRRLRQEGKRIALVPTMGNLHDGHMKLVDEAK
FT                   ASADVVVVSIFVNPMQFDRVDDLARYPRTLQDDCEKLNKRHVDFVFAPTPAEVYPQGTE
FT                   GQTYVDVPGLSTMLEGASRPGHFRGVSTIVSKLFNLVQPDVACFGEKDFQQLALIRKMV
FT                   ADMGYDIEIIGVPIVRAKDGLALSSRNGYLTADQRKIAPGLYKVLSAVAEKLAAGDRQL
FT                   DEIIAIAEQELNEKGFRADDIQIRDADTLLELTDASQRAVILMAAWLGQARLIDNRIVT
FT                   LAQ"
FT   gene            complement(166290..167081)
FT                   /gene="panB"
FT                   /locus_tag="KPN_00141"
FT   CDS_pept        complement(166290..167081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panB"
FT                   /locus_tag="KPN_00141"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00141"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75601"
FT                   /db_xref="GOA:A6T4T0"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4T0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003700"
FT                   /protein_id="ABR75601.1"
FT                   /translation="MKPTTIALLQKCKQEKKRFATITAYDHSFAKLFADEGINVLLVGD
FT                   SLGMTVQGHDSTLPVTVEDIAYHTRAVRRGAPNSLLLADLPFMAYATPEQTFANAAIVM
FT                   RAGANMVKLEGGAWLADTVRMLAERAVPVCGHLGLTPQSVNVFGGYKVQGRGDAAQTLF
FT                   EDALALEAAGAQLLVLECVPVELAKRITDALTIPVIGIGAGNVTDGQILVMHDAFGITG
FT                   GHIPKFAKNFLAEAGDIRAAVRQYIAEVESGVYPGEEHSFH"
FT   gene            complement(167201..167680)
FT                   /gene="folK"
FT                   /locus_tag="KPN_00142"
FT   CDS_pept        complement(167201..167680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="KPN_00142"
FT                   /product="7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00142"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75602"
FT                   /db_xref="GOA:A6T4T1"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4T1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000550"
FT                   /protein_id="ABR75602.1"
FT                   /translation="MTLVYIALGSNLASPLEQVQAAIRALGEIPHSRVVAVSSFYRTPP
FT                   LGPQDQPDYLNAAVALETALPPETLLDHTQRIELQQGRVRKAERWGPRTLDLDIMLFGD
FT                   AVINSERLTVPHYDMKNRGFMLWPLFEIAPDLHFPDGLALRAVLDNLGAAKPASW"
FT   gene            complement(167677..169038)
FT                   /gene="pcnB"
FT                   /locus_tag="KPN_00143"
FT   CDS_pept        complement(167677..169038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcnB"
FT                   /locus_tag="KPN_00143"
FT                   /product="poly(A) polymerase I"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00143"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75603"
FT                   /db_xref="GOA:A6T4T2"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR010206"
FT                   /db_xref="InterPro:IPR025866"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4T2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002646"
FT                   /protein_id="ABR75603.1"
FT                   /translation="MLSREEREAEAAVEPTPMTVIPREQHAISRKDISENALKVMYRLN
FT                   KAGYESWLVGGGVRDLLLGKKPKDFDVTTNATPDQVRKLFRNCRLVGRRFRLAHVMFGP
FT                   EIIEVATFRGHHEGHTTDRVTSQRGQNGMLLRDNIFGSIEEDAQRRDFTINSLYYSVAD
FT                   FTVRDYVGGMKDLQDGVIRLIGNPETRYREDPVRMLRAVRFAAKLNMTISPETAEPLPR
FT                   LAALLHDVPPARLFEEVLKLLQAGYGYQTYMLLREYSLFQPLFPTITRYFTERGDSPME
FT                   RIISQVLKNTDTRIHNDMRVNPAFLFAVMFWYPLLETAQKIAQESGLAYYDAFALAMND
FT                   VLDEACRTLAIPKRITTLIRDIWQLQLRMSRRQGKRAWKLMEHPKFRAAYDLLELRAGA
FT                   ENNHELQRLTKWWGEFQVAAPPAQKDMLNDLGDDPAPRRRHRRPRKRAPRQGSA"
FT   gene            complement(169134..170015)
FT                   /gene="yadB"
FT                   /locus_tag="KPN_00144"
FT   CDS_pept        complement(169134..170015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadB"
FT                   /locus_tag="KPN_00144"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00144"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75604"
FT                   /db_xref="GOA:A6T4T3"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR022380"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4T3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000924"
FT                   /protein_id="ABR75604.1"
FT                   /translation="MTDSRYIGRFAPSPSGELHFGSLIAALGSYLQARANQGIWRVRIE
FT                   DIDPPREVPGAADTILRQLDHYGLHWDGDVLWQSQRHEAYREALTWLGEQGLSYYCTCT
FT                   RARIHAVGGIYDGHCRDLGLGAENAALRLRQTRPVLQFSDRLRGTLIANEPLAREDFII
FT                   HRRDGLFAYNLAVVVDDHFQGITEIVRGADLIEPTVRQISLYQHFGWQAPDYLHLPLAL
FT                   NGDGNKLSKQNHAPALPEGDPRPEIVRALRFLNQAIPEEWQALNIDDLLAQAVANWQPA
FT                   KIEHSQMAPAEL"
FT   gene            complement(170075..170530)
FT                   /gene="dksA"
FT                   /locus_tag="KPN_00145"
FT   CDS_pept        complement(170075..170530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dksA"
FT                   /locus_tag="KPN_00145"
FT                   /product="dnaK suppressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00145"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75605"
FT                   /db_xref="GOA:A6T4T4"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR020460"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4T4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000962"
FT                   /protein_id="ABR75605.1"
FT                   /translation="MQEGQNRKTSSLSILAIAGVEPYQEKPGEEYMNEAQLAHFKRILE
FT                   AWRNQLRDEVDRTVSHMQDEAANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKTLK
FT                   KVEDEDFGYCESCGVEIGIRRLEARPTADLCIDCKTLAEIREKQMAG"
FT   gene            complement(170693..171409)
FT                   /gene="sfsA"
FT                   /locus_tag="KPN_00146"
FT   CDS_pept        complement(170693..171409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfsA"
FT                   /locus_tag="KPN_00146"
FT                   /product="sugar fermentation stimulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00146"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75606"
FT                   /db_xref="GOA:A6T4T5"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4T5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR005224"
FT                   /protein_id="ABR75606.1"
FT                   /translation="MQFDPPLQPAILLKRYKRFLADVVTPDGRELTLHCPNTGAMTGCA
FT                   APGDTVWYSTSDNAKRKYAHTWELTETQQGAVICVNTLRANSLAKEAISAGIIPELSGY
FT                   NQLKSEVKYGEENSRIDIMLQADDRQNCYIEVKSVTLAEKEYGYFPDAVTTRGQKHLRE
FT                   LMAVAANGDRAVILFAVLHSAIDRFSPAHHIDARYAQLLTEAQDKGVEILAWKAELSTT
FT                   RMTLNKPIAVVLNPGK"
FT   gene            complement(171409..171945)
FT                   /gene="ligT"
FT                   /locus_tag="KPN_00147"
FT   CDS_pept        complement(171409..171945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligT"
FT                   /locus_tag="KPN_00147"
FT                   /product="2'-5' RNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00147"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75607"
FT                   /db_xref="GOA:A6T4T6"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR014051"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4T6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004175"
FT                   /protein_id="ABR75607.1"
FT                   /translation="MSEPKRLFFALELPSAVQKQIVQWRATHFPEDAGRPVAADNLHLT
FT                   LAFLGEVSAEKQRALAALAGRLRQPGFTLTLDDAGQWLRSRVVWLGTRQPPRGLLQLAS
FT                   MLRAQAARSGCYQSPQPFHPHITLWRDARQAVPIPAPGFRWTFPVNEFVLYESSFSRGR
FT                   TRYTALERYPFDKES"
FT   gene            172018..174447
FT                   /gene="hrpB"
FT                   /locus_tag="KPN_00148"
FT   CDS_pept        172018..174447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrpB"
FT                   /locus_tag="KPN_00148"
FT                   /product="helicase, ATP-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00148"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75608"
FT                   /db_xref="GOA:A6T4T7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4T7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001650"
FT                   /inference="protein motif:Pfam:IPR007502"
FT                   /inference="protein motif:Pfam:IPR011545"
FT                   /protein_id="ABR75608.1"
FT                   /translation="MSSLPVAAVLPELLSALQHAPQVLLNAPTGAGKSTWLPLQILAEG
FT                   NIAGRIILLEPRRLAARNVAQRLAELLGEKPGETVGFRMRAETCVGPQTRLEVVTEGIL
FT                   TRMIQRDPELTGVGLVILDEFHERSLQADLALALLLDVQQGLRDDLKLLIMSATLDNDR
FT                   LQRLLPEAPVVVSEGRAYPVERRFSPLSAHQRFDEAVAVAAAELLRHAQGSMLLFLPGV
FT                   GEIQRVQEQLTERVAEDVILCPLYGALPLSEQRKAILPAPAGKRKVVLATNIAETSLTI
FT                   EGIRLVVDSAQERVARFDPRTGLTRLVTQRISQASMTQRAGRAGRLSPGICLHLLGKEQ
FT                   AERAAAQSEPEILHSDLSALLLELLQWGCHDPAALAWLDQPPAVNLAAARRLLEALSAL
FT                   DGERLSAFGRKMAALGNEPRLAAMLAAAQTDDEAATAAKLAAILEEPPRGGLVDLGAVF
FT                   SRQQANWQQRAQQLMKRLARRGGQPDVGLMAGLLASAFADRIARRRGQEGRYQLANGMG
FT                   AMLDADDALGRHEWLIAPLLLQGSASPDARMLLALPVEIGELIAARPELAKSSDTVEWD
FT                   EAQGTLKAWRRTVIGQLVIKTQPLAKPSEAELHQAMLNGIREKGLGVLNWTPEAEQLRL
FT                   RLHCAAQWLPEEAWPAVDDASLLASLEAWLLPQMNGVHSLRALKALDLRQALQDWLPWP
FT                   LRQKLDRELPTHYTVPTGSRLAIRYHAENPPALAVRMQEMFGEATTPVIAEGRVPLVLE
FT                   LLSPAQRPLQITRDLSAFWQGSYREVQKEMKGRYPKHVWPDDPANAAPTRRSKKYS"
FT   gene            complement(174495..175295)
FT                   /gene="pulQ"
FT                   /locus_tag="KPN_00149"
FT   CDS_pept        complement(174495..175295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pulQ"
FT                   /locus_tag="KPN_00149"
FT                   /product="Pullulanase Q protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00149"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75609"
FT                   /db_xref="GOA:A6T4T8"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="InterPro:IPR014032"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4T8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000045"
FT                   /inference="protein motif:Pfam:IPR010627"
FT                   /protein_id="ABR75609.1"
FT                   /translation="MTTLAALSLHFPFVWYGFLLLFGLALGSFYNVVIYRLPRMLTQTA
FT                   DDERITLSTPGSSCPQCRQPIAWRDNIPLLSFLWLGRRARCCQAPIAWSYPLTELATGL
FT                   LFILAGALLAPGLPLAGGLVLLSFLLILARIDARTQLLPDRLTLPLLWAGLLFNLNEVY
FT                   IALPDAVAGAMAGYLALWSVYWLFRLLTGKEALGYGDFKLLAALGAWCGWQVLPQVLLL
FT                   ASASGLVWTLLQRLWTRQSLQQPLAFGPWLALAGGGIFLWQQMV"
FT   gene            complement(175292..176038)
FT                   /gene="pulN"
FT                   /locus_tag="KPN_00150"
FT   CDS_pept        complement(175292..176038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pulN"
FT                   /locus_tag="KPN_00150"
FT                   /product="Pullulanase N protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00150"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75610"
FT                   /db_xref="InterPro:IPR022792"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4T9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000645"
FT                   /protein_id="ABR75610.1"
FT                   /translation="MKANWIAGGLLLVLYLLWLTATAPARLLAPMLPPGVQVGQFSGSV
FT                   WRGAAQPVYWHGERLERLAWSLTLAGWQVSLSDPRGVMGQARLWGLRDLRLQEGRLTAP
FT                   ASLLSRWLMSTMPVKAAGEVTFSLTEGRFSDGRCRHIIAGGAQWRQARLHSPVGSLELA
FT                   QVNGTFRCTVDGAVALTLRQDSHQLSLSGQGTLSPDGRYLFRGTLQPRQGMPPLLALLV
FT                   TRPTANNAPGPTPWQLQGKWLPQEQK"
FT   gene            complement(176028..176513)
FT                   /gene="pulM"
FT                   /locus_tag="KPN_00151"
FT   CDS_pept        complement(176028..176513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pulM"
FT                   /locus_tag="KPN_00151"
FT                   /product="Pullulanase M protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00151"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75611"
FT                   /db_xref="GOA:A6T4U0"
FT                   /db_xref="InterPro:IPR007690"
FT                   /db_xref="InterPro:IPR023229"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4U0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR007690"
FT                   /protein_id="ABR75611.1"
FT                   /translation="MANLLIWWRQRTPSEQRLLLGLTGLLAACAFWYGLWQPWRAREAQ
FT                   WRQTLVKEQASLRWMTEQAPRLQQLSQQPAPAAKEALTALVMREAASHGLTVIRLQPQG
FT                   KRLQITLQHCAFQALIDWLDAPAMRGVNAISLSVTGQPSRPGWVTVNHLLLERDDEG"
FT   gene            complement(176506..177699)
FT                   /gene="pulL"
FT                   /locus_tag="KPN_00152"
FT   CDS_pept        complement(176506..177699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pulL"
FT                   /locus_tag="KPN_00152"
FT                   /product="Pullulanase L protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00152"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75612"
FT                   /db_xref="GOA:A6T4U1"
FT                   /db_xref="InterPro:IPR007812"
FT                   /db_xref="InterPro:IPR024230"
FT                   /db_xref="InterPro:IPR025691"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4U1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR007812"
FT                   /protein_id="ABR75612.1"
FT                   /translation="MNKINASPQAMLIVRLAAAQAPLHWQLFAPGEPHHEASGRWPTDD
FT                   ASPFPALAEQYPAWVLIPASDCAFHSLTLPAGLRKPPLQVAPFLLEEQLADDVEATHFA
FT                   LLHRQQAQCEIVAVQRQKMRDWLARCESLSLQPLALTPDVLALPWQPPAWSAVQVDEQW
FT                   LIRHQPWGGMAAENVWLTELLQSEAEEHVIDSYSPPPAAPGVWREQPAQTLLTLAARHP
FT                   AAQKLSLLQGEFAVRRRSAQASWRPARYAALALALLAGANSVLDHRDLARQAEAAQQAS
FT                   RAFYHRWFPTEKKVINPRLQMQQHLQTLTRQAQHAPLVDRLSALQNILSETPGIRLRAL
FT                   SWDAAGNRLQLDIAAVSSRALEQFTQRAQPRFRVRPGDMITKPDGIEGQLTLEENDG"
FT   gene            complement(177686..178639)
FT                   /gene="pulK"
FT                   /locus_tag="KPN_00153"
FT   CDS_pept        complement(177686..178639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pulK"
FT                   /locus_tag="KPN_00153"
FT                   /product="Pullulanase K protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00153"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75613"
FT                   /db_xref="GOA:A6T4U2"
FT                   /db_xref="InterPro:IPR005628"
FT                   /db_xref="InterPro:IPR038072"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4U2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR005628"
FT                   /protein_id="ABR75613.1"
FT                   /translation="MVLFILALMMILASAMTERTAVMYQHTAVTLDNLQARWYALAAEN
FT                   MAAALLQRDALDSPSQTNLAQTWAQEGRRFTLDDGEIRATIRDGHACFNLNAIDHRADE
FT                   AGDGTPYPTNVFVRLLALLGEPPLRASQIAAALGDWTDSDGQPRLNGAEDEVYMAQTPG
FT                   YLAANQPMQDVSELRLLAGMDAALYQRLLPFVCVQPDDALQVNVNTLRPSQAALLVALF
FT                   PGDLTLQEAQQLLHNRPRTGWSSVAAFLAQPTLQKTDTTLARPWLTVHSARFIAAFTVV
FT                   TGNLRFQLHSVLQQSGRTFTVVQRRYGLSMVVDEQD"
FT   gene            complement(178669..179253)
FT                   /gene="pulJ"
FT                   /locus_tag="KPN_00154"
FT   CDS_pept        complement(178669..179253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pulJ"
FT                   /locus_tag="KPN_00154"
FT                   /product="Pullulanase J protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00154"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75614"
FT                   /db_xref="GOA:A6T4U3"
FT                   /db_xref="InterPro:IPR010055"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4U3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75614.1"
FT                   /translation="MRGFTLIETLLALAILAVLSAAAVMVLQNVIRADGLTREKSQQIA
FT                   ALQRAFRQIADDVTHIIPRRARNSDTFFFAGRFQLQSDDWGLAFSRSGWPNPLGILPRS
FT                   EIQNVSYRLRQQRLERLSFDQQDPLTGSQPTVRVLLREVTAFRLRFYADGRWQETWDRP
FT                   QRLPQGLEITLTLANSGEITRLFLLTPGGGQ"
FT   gene            complement(179262..179627)
FT                   /gene="pulI"
FT                   /locus_tag="KPN_00155"
FT   CDS_pept        complement(179262..179627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pulI"
FT                   /locus_tag="KPN_00155"
FT                   /product="Pullulanase I protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00155"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75615"
FT                   /db_xref="GOA:A6T4U4"
FT                   /db_xref="InterPro:IPR003413"
FT                   /db_xref="InterPro:IPR010052"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4U4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003413"
FT                   /protein_id="ABR75615.1"
FT                   /translation="MKREAGMTLIEVMVALVIFALAGLAVMQSTLQQTRQLGRMEEKIL
FT                   ASWLADNQLVQLRLEKRWPALSWSETTVEAAGTRWFVRWQGVETALPQLRALDVEVRRQ
FT                   KSDPAPLATLRTWVTPP"
FT   gene            complement(179624..180139)
FT                   /gene="pulH"
FT                   /locus_tag="KPN_00156"
FT   CDS_pept        complement(179624..180139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pulH"
FT                   /locus_tag="KPN_00156"
FT                   /product="Pullulanase H protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00156"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75616"
FT                   /db_xref="GOA:A6T4U5"
FT                   /db_xref="InterPro:IPR002416"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4U5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75616.1"
FT                   /translation="MSQRGFTLLEMMLVLLLIGVSASMVLLAFPSARTQEATQILARFQ
FT                   TQLDFVRERGQQTGQLFGIIIHPERWQFMRLQPADDSAPAAADDRWGNAQWLPLQAGRV
FT                   TTAETLPRARLTLRFPDGQAWTPGEQPDVLIFPGGEVTPFQLRIDAATGINVDAQGDSQ
FT                   PLAAREQP"
FT   gene            complement(180139..180573)
FT                   /gene="pulG"
FT                   /locus_tag="KPN_00157"
FT   CDS_pept        complement(180139..180573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pulG"
FT                   /locus_tag="KPN_00157"
FT                   /product="Pullulanase G protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00157"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75617"
FT                   /db_xref="GOA:A6T4U6"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR010054"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013545"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4U6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75617.1"
FT                   /translation="MEKTMQRQRGFTLLEIMVVIVILGILASLVVPNLMGNKEKADRQK
FT                   VVSDLVALEGALDMYKLDNSRYPNTEQGLQALVTAPAAEPHARNYPEGGYIRRLPQDPW
FT                   GNEYQLLSPGQHGAIDVFSVGPDGMPDTNDDIGNWTLGKK"
FT   gene            complement(180582..181796)
FT                   /gene="pulF"
FT                   /locus_tag="KPN_00158"
FT   CDS_pept        complement(180582..181796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pulF"
FT                   /locus_tag="KPN_00158"
FT                   /product="Pullulanase F protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00158"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75618"
FT                   /db_xref="GOA:A6T4U7"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR011850"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4U7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001992"
FT                   /protein_id="ABR75618.1"
FT                   /translation="MALFRYQALDAQGKTRRGLQQADSARHARQLLRDKGWLALEVTTA
FT                   DPARRLWAGGSLTRRTSTGDLALLTRQLATLVAAGIPLEKALDAVAQQCEKPSLRTLMA
FT                   GVRSKVLEGHSLAEAMRGYPACFDGLFCAMVAAGETSGHLDGVLNRLADYTEQRQQLRA
FT                   RLLQAMIYPIVLTLVAISVIAILLSTVVPKVVEQFVHLKQALPFSTRLLMSLSDIVRSA
FT                   GPWLALLSLLALLALRYLLRQPARRLAWDRALLRLPVIGRVARSVNSARYARTLSILNA
FT                   SAVPLLLSMRISADVLSNAWARSQLAAASESVREGVSLHRALESTALFPPMMRYMIASG
FT                   EQSGELTAMLERAAENQDRELSAQIQMALSLFEPLLVVTMAGMVLFIVLAILQPILQLN
FT                   TLMSM"
FT   gene            complement(181798..183291)
FT                   /gene="pulE"
FT                   /locus_tag="KPN_00159"
FT   CDS_pept        complement(181798..183291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pulE"
FT                   /locus_tag="KPN_00159"
FT                   /product="Pullulanase E protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00159"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75619"
FT                   /db_xref="GOA:A6T4U8"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013369"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4U8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001482"
FT                   /protein_id="ABR75619.1"
FT                   /translation="MTPAAERRPLLPFAWARAHHLVLLSDGECCEALCRPDTAARALLE
FT                   ARRLADGPMRVSRLAPDAFEKVLVLSYQRDSAEAHRMMADIGNELDLYTLAEELPDTDD
FT                   LLDSEDDAPIIRLINAMLTEAIKEKASDIHIETYERHLQIRFRVDGVLREILRPQRRLA
FT                   ALLISRIKVMASLDIAEKRVPQDGRMALRIGGRAIDVRVSTLPSSHGERVVLRLLDKNS
FT                   VNLDLLTLGMPPALLDRVDALIARPHGIILVTGPTGSGKSTTLYAALSRLDARERNIMT
FT                   IEDPVEYELEGIGQTQVNAKVEMTFARGLRAILRQDPDVVLVGEIRDGETAQIAVQASL
FT                   TGHLVLSTLHTNSALGAISRLQDMGVEPFLLSTSLLAVMSQRLVRQLCPHCRQPWQADA
FT                   NTARQMAVPVGARLWQPKGCPECNFIGYRGRTGIHELLLIDDRVRAAIHRGENEITLIQ
FT                   QLGPAWQTLRHAGRDKALAGITSWEEVMRVTEQQTTESV"
FT   gene            complement(183288..185261)
FT                   /gene="pulD"
FT                   /locus_tag="KPN_00160"
FT   CDS_pept        complement(183288..185261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pulD"
FT                   /locus_tag="KPN_00160"
FT                   /product="Pullulanase D protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00160"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75620"
FT                   /db_xref="GOA:A6T4U9"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013356"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4U9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004846"
FT                   /inference="protein motif:Pfam:IPR005644"
FT                   /protein_id="ABR75620.1"
FT                   /translation="MKRLRKMLPALLILTPLLFSPAAAEEFSASFKGTDIQEFINTVSK
FT                   NLNKTVIIDPSVRGTITVRSYDMLNEEQYYQFFLSVLDVYGFAVINMNNGVLKVVRAKD
FT                   AKTSAVPVASAAAPGEGDEVVTRVVPLTNVAARDLAPLLRQLNDNAGAGSVVHYEPSNV
FT                   LLMTGRAAVIKRLLTIVERVDNAGDRSVVTVPLSWASAAEVVKLVTELNKDTSKSALPG
FT                   SMVANVVADERTNAVLVSGEPNSRQRIIAMIKQLDRQQAVQGNTKVIYLKYAKAADLVE
FT                   VLTGISSSLQSDKQSARPVAAIDKNIIIKAHGQTNALIVTAAPDVMNDLERVIAQLDIR
FT                   RPQVLVEAIIAEVQDADGLNLGIQWANKNAGMTQFTNSGLPISTAIAGANQYNKDGTIS
FT                   SSLASALGSFNGIAAGFYQGNWAMLLTALSSSTKNDILATPSIVTLDNMQATFNVGQEV
FT                   PVLTGSQTTSGDNIFNTVERKTVGIKLKVKPQINEGDAVLLEIEQEVSSVADSASSTSS
FT                   DLGATFNTRTVNNAVLVGSGETVVVGGLLDKTVTDTADKVPLLGDIPVIGALFRSDSKK
FT                   VSKRNLMLFIRPTIIRDRDEYRQASSGQYTAFNNAQTKQRGKESSEASLSNDLLHIYPQ
FT                   QETQAFRQVSAAIDAFNLGGRP"
FT   gene            complement(185271..185942)
FT                   /gene="pulC"
FT                   /locus_tag="KPN_00161"
FT   CDS_pept        complement(185271..185942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pulC"
FT                   /locus_tag="KPN_00161"
FT                   /product="Pullulanase C protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00161"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75621"
FT                   /db_xref="GOA:A6T4V0"
FT                   /db_xref="InterPro:IPR001639"
FT                   /db_xref="InterPro:IPR024961"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4V0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001478"
FT                   /protein_id="ABR75621.1"
FT                   /translation="MPPAADPELKNVRPAFTLFGLAVKNSPTPTDAASLNQVPVSSLKL
FT                   RLAGLLASSNPARSIAIIEKGNQQVSLSTGDPLPGYDARIAAILPDRIIVNYQGRKEAI
FT                   LLFNDSRAPSPPPTAAGNPPLVKRLREQPQNILTYLSISPVLSGDKLLGYRLNPGKDAS
FT                   LFRQSGLQANDLAIALNGIDLRDQEQAQQALQNLADMTEITLTVEREGQRHDIAFALGD
FT                   E"
FT   gene            185941..186237
FT                   /gene="pul"
FT                   /locus_tag="KPN_00162"
FT   CDS_pept        185941..186237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pul"
FT                   /locus_tag="KPN_00162"
FT                   /product="Pullulanase protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00162"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75622"
FT                   /db_xref="GOA:A6T4V1"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4V1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75622.1"
FT                   /translation="MVNGRAEISSGLTGNTTRQVNFASCGIAVINMMSVTICGNNLIIP
FT                   LFIFVNLITETGILIPLLIYFSARWRNTLPKQVGDYWLLNYLLPESGDKRGES"
FT   gene            186468..189728
FT                   /gene="pul"
FT                   /locus_tag="KPN_00163"
FT   CDS_pept        186468..189728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pul"
FT                   /locus_tag="KPN_00163"
FT                   /product="Pullulanase protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00163"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75623"
FT                   /db_xref="GOA:A6T4V2"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR005323"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011839"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR024561"
FT                   /db_xref="InterPro:IPR040671"
FT                   /db_xref="InterPro:IPR041111"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4V2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004193"
FT                   /inference="protein motif:Pfam:IPR005323"
FT                   /inference="protein motif:Pfam:IPR006047"
FT                   /protein_id="ABR75623.1"
FT                   /translation="MSGCDNSSSSSTSGSPGSPGNPGNPGTPGTPDPQDVVVRLPDVAV
FT                   PGEAVQASARQAVIHLVDIAGITSSTPADYATKNLYLWNNETCDALSAPVADWNDVSTT
FT                   PTGSDKYGPYWVIPLTNESGCINVIVRDGTNKLIDSDLRVSFSDFTDRTVSVIAGNSAV
FT                   YDSRADAFRAAFGVALADAHWVDKTTLLWPGGENKPIVRLYYSHSSKVAADSNGEFSDK
FT                   YVKLTPTTVSQQVSMRFPHLASYPAFKLPDDVNVDELLQGETVAIAAESDGILSSATQV
FT                   QTAGVLDDTYAAAAEALSYGAQLTDSGVTFRVWAPTAQQVELVIYSADKKVIASHPMTR
FT                   DSASGAWSWQGGSDLKGAFYRYAMTVYHPQSRKVEQYEVTDPYAHSLSTNSEYSQVVDL
FT                   NDSALKPEGWDGLTMPHAQKTKADLAKMTIHESHIRDLSAWDQTVPAELRGKYLALTAQ
FT                   ESNMVQHLKQLSASGVTHIELLPVFDLATVNEFSDKVADIQQPFSRLCEVNSAVKSSEF
FT                   AGYCDSGSTVEEVLTQLKQNDSKDNPQVQALNTLVAQTDSYNWGYDPFHYTVPEGSYAT
FT                   DPEGTARIKEFRTMIQAIKQDLGMNVIMDVVYNHTNAAGPTDRTSVLDKIVPWYYQRLN
FT                   ETTGSVESATCCSDSAPEHRMFAKLIADSLAVWTTDYKIDGFRFDLMGYHPKAQILSAW
FT                   ERIKALNPDIYFFGEGWDSNQSDRFEIASQINLKGTGIGTFSDRLRDAVRGGGPFDSGD
FT                   ALRQNQGVGSGAGVLPNELTTLSDDQARHLADLTRLGMAGNLADFVLIDKDGAVKRGSE
FT                   IDYNGAPGGYAADPTEVVNYVSKHDNQTLWDMISYKAAQEADLDTRVRMQAVSLATVML
FT                   GQGIAFDQQGSELLRSKSFTRDSYDSGDWFNRVDYSLQDNNYNVGMPRSSDDGSNYDII
FT                   ARVKDAVATPGETELKQMTAFYQELTALRKSSPLFTLGDGATVMKRVDFRNTGADQQTG
FT                   LLVMTIDDGMQAGASLDSRVDGIVVAINAAPESRTLQDFAGTSLQLSAIQQAAGDRSLA
FT                   SGVQVAADGSVTLPAWSVAVLELPQGESQGAGLPVSSK"
FT   gene            191543..194107
FT                   /gene="mrcB"
FT                   /locus_tag="KPN_00164"
FT   CDS_pept        191543..194107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcB"
FT                   /locus_tag="KPN_00164"
FT                   /product="penicillin-binding protein 1b"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00164"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75624"
FT                   /db_xref="GOA:A6T4V3"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR011813"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR028166"
FT                   /db_xref="InterPro:IPR032730"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4V3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001264"
FT                   /inference="protein motif:Pfam:IPR001460"
FT                   /protein_id="ABR75624.1"
FT                   /translation="MAGDDREPIGRKGRPSRPTKQKVTRRRVREEDYDDEYDDDDYEDE
FT                   KPVPRKAKGKGGKPRRKRSWLWLLVKLGIVFAVLIAAYGVYLDQKIRSRIDGKVWELPA
FT                   AVYGRMVNLEPDMQISKNEMVRLLNATQYRQVSAMTRPGEYTVQANSIEMIRRPFDFPD
FT                   SKEGQVRARLTFDGDHLETIENMDNNRQFGFFRLDPRLITMLQSPNGEQRLFVKRSGFP
FT                   DLLVDTLLATEDRHFYEHDGISLYSIGRAVLANLTAGRTVQGASTLTQQLVKNLFLSSE
FT                   RSYWRKANEAYMALIVDARYSKDRILELYMNEVYLGQSGDNEIRGFPLASLYYFGRPVE
FT                   ELSLDQQALLVGMVKGASVYNPWRNPKLALERRNLVLRLLQQQQVIDQELYDMLSARPL
FT                   GVQPRGGVISPQPAFMQMVRQELQAKLGDKVKDLSGVKIFTTFDSVAQDAAEKAASEGI
FT                   PVLKKQRKLADLETAMVVVDRFTGEVRAMVGGAEPQFAGYNRAMQARRSIGSLAKPATY
FT                   LTALSQPNQYRLNTWIADAPVTIRLSNGQTWSPQNDDRRFSGQVMLVDALTRSMNVPTV
FT                   NLGMALGLPAVVDTWTKLGAPKNQLNAVPSMLLGALNLTPIEVAQAFQTIASGGNRAPL
FT                   SALRSVIAEDGTVLYQSYPQAERAVPAQAAYMTLWTMQQVVQRGTGRQLGAKYPGLHLA
FT                   GKTGTTNNNVDTWFAGIDGSQVTITWVGRDNNQPTKLYGASGAMSIYQRYLANQTPTPL
FT                   VLTVPEDVVDMGVDSNGNFVCSGGMRSLPVWTTQPDALCRQGEMMQQQQLQQQEAKNPF
FT                   NQSGQQQQQQQQQQQQQQQQPPKQQEKSDGVAGWIKDMFGNN"
FT   gene            194342..196549
FT                   /gene="fhuA"
FT                   /locus_tag="KPN_00165"
FT   CDS_pept        194342..196549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuA"
FT                   /locus_tag="KPN_00165"
FT                   /product="outer membrane pore protein, receptor for
FT                   ferrichrome, colicin M, and phages T1, T5 and phi80"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00165"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75625"
FT                   /db_xref="GOA:A6T4V4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4V4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000531"
FT                   /protein_id="ABR75625.1"
FT                   /translation="MARPKTAQPNHSLRKVAAVVATAVSGMSVYAQAAEQPKQEETITV
FT                   VAAPAAQESAWGPAPTIAAKRSATATKTDTPIEKTPQSVSVVTRQEMEMRQPTTVKEAL
FT                   SYTPSVFSTRGSSTTYDVVTIRGFTTSTTVNTNQYLDGMKLQGNNYSEVSMDPYFLERV
FT                   EVMRGPTSVLYGNSNPGGIVSMVSKRPTTEPLKEVQFKMGTDNLWQTGFDFSDAIDDAG
FT                   VWSYRLTGLGRSQDAQQQMAKSTRYAVAPSFSWRPDDKTDFTFLSNFQNDPDAGYYGWL
FT                   PREGTVVPYYDANGKAHKLPTDFNEGESDNKISRRQKMVGYSFSHQFDDTFTVRQNLRY
FT                   ADVHTLYRSVYGNGYVAPGYMNRAYVRSDEHLNTFTVDTQLQSDFATGAVSHTLLTGVD
FT                   YSRMRNDVDADYGTADPISMSNPQYGNPNIQVTFPYAVLNRMEQTGLYAQDQMEWDKWV
FT                   MTLGGRYDYATTSTLTRATNSLAENHDQQFSWRGGINYLFDNGISPYFSYSESFEPVSG
FT                   SNSRGQPFDPSRGKQYEAGVKYVPKDMPVVVTAAVYQLTKDKNLTADPANQAFSIQTGE
FT                   IRSRGLELEAKAAVNANINVTAAYSYTDAEYTHDTVFNGKRPAEVPRNMASLWADYTFH
FT                   ETALSGLTIGAGARYIGSTVSYYKNDTSTGKKNDAFSVAGYALMDATVKYDLARFGLPG
FT                   SSVGVNVNNLFDREYVSSCYSEYACYWGAGRQVVATATFRF"
FT   gene            196595..197392
FT                   /gene="fhuC"
FT                   /locus_tag="KPN_00166"
FT   CDS_pept        196595..197392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuC"
FT                   /locus_tag="KPN_00166"
FT                   /product="ATP-binding component of hydroxymate-dependent
FT                   iron transport"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00166"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75626"
FT                   /db_xref="GOA:A6T4V5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4V5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003439"
FT                   /protein_id="ABR75626.1"
FT                   /translation="MQEQTPHAETTFALDRVTFRVPGRTLLHPLSLTFPTGKVTGLIGH
FT                   NGSGKSTLLKMLGRHQPPSAGEVLLDGQPLESWGSKAFARKVAYLPQQLPPAEGMTVRE
FT                   LVAIGRYPWHGALGRFGAADREKVEEAIALVGLKPLAHRLVDSLSGGERQRAWIAMLVA
FT                   QDSRCLLLDEPTSALDIAHQVDVLALVHRLSQQRGLTVIAVLHDINMAARYCDYLVALR
FT                   GGEMIAQGTPAELMRSDTLEQIYGIPMGILPHPAGAAPVSFVY"
FT   gene            197392..198282
FT                   /gene="fhuD"
FT                   /locus_tag="KPN_00167"
FT   CDS_pept        197392..198282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuD"
FT                   /locus_tag="KPN_00167"
FT                   /product="hydroxamate-dependent iron transport protein (ABC
FT                   superfamily, peri_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00167"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75627"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4V6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002491"
FT                   /protein_id="ABR75627.1"
FT                   /translation="MMNPTLITRRRLLIAMALSPLLWQMRGAQAADVDPQRVVALEWLP
FT                   AELLLALGVTPYGVADIPNYRLWVNEPALPDSVIDVGLRTEPNLELLTQMKPSFIVWSA
FT                   GYGPSPEKLARIAPGRGFTFSDGKRPLAMAQRSLLEMADLLGKTQQAKRHLAEFDALME
FT                   SLRPRFAGRGDRPLLMISLLDPRHVLVFGENCLFQEVLDRFGIKNAWHGEAAFWGSVSV
FT                   GIDRLAAFNEADVICFDHGNERDMAQLLATPLWQAMPFVRAGRFQRVPAVWFYGATLSA
FT                   MHFARVLADAQGSPA"
FT   gene            198279..200261
FT                   /gene="fhuB"
FT                   /locus_tag="KPN_00168"
FT   CDS_pept        198279..200261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuB"
FT                   /locus_tag="KPN_00168"
FT                   /product="hydroxamate-dependent iron transport protein (ABC
FT                   superfamily, membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00168"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75628"
FT                   /db_xref="GOA:A6T4V7"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4V7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000522"
FT                   /protein_id="ABR75628.1"
FT                   /translation="MNTRLSPLAIILLAGLLGVAFALSIVNLNVALPYAQWRQALWQPD
FT                   VDDIAQMLFHYSLLPRLAVALLVGAGLGLVGVLFQQVLRNPLAEPTTLGVATGAQLGIT
FT                   VTTLWAIPGVLASQFAALAGACLVGALVFGVSWGKRLSPVTLILAGLVVSLYCGALNQL
FT                   MVIFHHDQLQSMFLWSTGTLTQTDWSVAQRLWPQLLGGAILTLLLLRPLTLMGLDDGVA
FT                   RNLGLALSLARLGALTLAIVISALLVNAVGIIGFIGLFAPLLAKMLGARRLLARLLLAA
FT                   LIGALLLWLSDQVILWLSRVWREVSTGSVTALIGAPLLLWLLPRLRSISAPVMNGGDNV
FT                   QPERYHVQWFVLAGVALLLLAVSVALAFGRDAPGWLWAHGDLLEQLLPWRWPRVLSALF
FT                   AGVMLAVAGCIIQRLTGNPMASPEVLGISSGAAFGVVLMLFFVPGDAFGWLLPAGSLGA
FT                   AATLLIIMLAAGRGGFSPHRMLLAGMALSTAFTMLLMMLQASGDPRMAQILTWISGSTY
FT                   SATPERVVRSGAVMLALLALAPLCRRWLTILPLGGEAARAVGMALTSSRIVLLLLAACL
FT                   TAAATLTIGPLSFVGLMAPHIARMMGFRRTLPHMVISGLTGGLLLVFADWCGRMMMFPY
FT                   QIPAGLLSTFIGAPYFIYLLRKQSR"
FT   gene            complement(200398..201678)
FT                   /gene="hemL"
FT                   /locus_tag="KPN_00169"
FT   CDS_pept        complement(200398..201678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="KPN_00169"
FT                   /product="glutamate-1-semialdehyde aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00169"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75629"
FT                   /db_xref="GOA:A6T4V8"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4V8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR005814"
FT                   /protein_id="ABR75629.1"
FT                   /translation="MSKSENLYHAARELIPGGVNSPVRAFTGVGGTPLFIERADGAYLY
FT                   DVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAASRGLSFGAPTEMEVKMAALVTELVP
FT                   TMDMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLLVKAGSGALTLGQP
FT                   NSPGVPADFAKHTLTCTYNDLASVRAAFEQYPQEIACIIVEPVAGNMNCIPPQPEFLPG
FT                   LRALCDEFGALLIIDEVMTGFRVALAGAQAYYGVEPDLTCLGKIIGGGMPVGAFGGRRE
FT                   VMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGVHETLTELTNQLAQGLLDAAR
FT                   DAGIPLVVNNVGGMFGIFFTDAETVTCYQDVVKCDVERFKRFFHLMLEEGVYLAPSAFE
FT                   AGFMSVAHSEEDIDNTIDAARRVFAKL"
FT   gene            201859..203277
FT                   /gene="yadQ"
FT                   /locus_tag="KPN_00170"
FT   CDS_pept        201859..203277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadQ"
FT                   /locus_tag="KPN_00170"
FT                   /product="chloride channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00170"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75630"
FT                   /db_xref="GOA:A6T4V9"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="InterPro:IPR023861"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4V9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001807"
FT                   /protein_id="ABR75630.1"
FT                   /translation="MKAETPSFEAHQFVRVRRGDAVRRLIQRDKTPLAVLFMAAVVGTL
FT                   AGLVGVAFEKSVNWVQNQRIGALAQVADHWYLVWPLAFILSALLAMVGYFLVRRFAPEA
FT                   GGSGIPEIEGALEELRPVRWWRVLPVKFVGGMGTLGAGMVLGREGPMVQLGGNIGRMVL
FT                   DVFRMRSPEARHTLLATGAASGLSAAFNAPLAGILFIIEEMRPQFRYNLISIKAVFTGV
FT                   IMSSIVFRIFNGEAAIIEVGKLSNAPVNTLWLYLVLGMLFGCFGPLFNFLVLRTQDLFQ
FT                   RIHGGNIKKWVLIGGLIGGLCGLLGLMQPSAVGGGFNLIPIAAAGNFSVGLLLFIFIAR
FT                   VVTTLICFSSGAPGGIFAPMLALGTLLGTAFGMAAIPLFPAYHLDAGTFAIAGMGALLA
FT                   ASVRAPLTGIVLVLEMTDNYQLILPMIITCLGATLLAQFLGGKPLYSTILQRTLAKQEA
FT                   EQAAKAQQAPRENT"
FT   gene            203359..203703
FT                   /gene="yadR"
FT                   /locus_tag="KPN_00171"
FT   CDS_pept        203359..203703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadR"
FT                   /locus_tag="KPN_00171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00171"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75631"
FT                   /db_xref="GOA:A6T4W0"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4W0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000361"
FT                   /protein_id="ABR75631.1"
FT                   /translation="MSDDVALPLEFTEAAANKVKHLIADEDNPNLKLRVYITGGGCSGF
FT                   QYGFTFDDQVNEGDMTIEKQGVGLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKS
FT                   TCGCGSSFSV"
FT   gene            complement(203775..204398)
FT                   /gene="yadS"
FT                   /locus_tag="KPN_00172"
FT   CDS_pept        complement(203775..204398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadS"
FT                   /locus_tag="KPN_00172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00172"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75632"
FT                   /db_xref="GOA:A6T4W1"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4W1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR005115"
FT                   /protein_id="ABR75632.1"
FT                   /translation="MLVYWLDIIGTAVFAISGVLLAGKLRMDPFGVLVLGVVTAVGGGT
FT                   IRDMALANGPVFWVKDPTDLVVAMVTSMLTILLVRQPRRLPKWILPVLDAVGLAVFVGI
FT                   GVNKAFLAGSGPLVAVCMGVVTGVGGGIIRDVLAREIPMILRTEIYATACIVGGIVHAT
FT                   AHDTFHLPLENSAMMGMVVTLVIRLAAIRWHLKLPTFALDDNGR"
FT   gene            complement(204435..205235)
FT                   /gene="yadT"
FT                   /locus_tag="KPN_00173"
FT   CDS_pept        complement(204435..205235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadT"
FT                   /locus_tag="KPN_00173"
FT                   /product="vitamin B12-transporter protein BtuF"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00173"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75633"
FT                   /db_xref="GOA:A6T4W2"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR023544"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4W2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002491"
FT                   /protein_id="ABR75633.1"
FT                   /translation="MAKSLSFALAALLLLAPAWLLAAPRVITLSPANTELAFAAGITPV
FT                   GVSSYSDYPSQAKTIEQVASWQGMNLERIVALKPDVVLAWRGGNAERQVNQLQSLGIHV
FT                   LWVQTSTIEEIIATLRELAQWSPQPEKAQQAAQAMQQEYDALKARYANAPKKRVFLQFG
FT                   SAPLFTSGPGSIQDQVLRLCGGENIFATSRVPWPQVSREQVLARQPQAIVVTGDASRIA
FT                   EAQRFWQHQLTISLIALHSDWFERAGPRIILAAKQLCAALDQVK"
FT   gene            complement(205228..205926)
FT                   /gene="pfs"
FT                   /locus_tag="KPN_00174"
FT   CDS_pept        complement(205228..205926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfs"
FT                   /locus_tag="KPN_00174"
FT                   /product="5'-methylthioadenosine/S-adenosylhomocysteine
FT                   nucleosidase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00174"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75634"
FT                   /db_xref="GOA:A6T4W3"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="PDB:4G89"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4W3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000845"
FT                   /protein_id="ABR75634.1"
FT                   /translation="MKIGIIGAMEEEVTLLRDKIENRQTITIGGSEIYTGQLHGVDVAL
FT                   LKSGIGKVAAAMGATLLLERCQPDVIINTGSAGGLASTLKVGDIVVSDEARYHDADVTA
FT                   FGYEYGQLPGCPAGFKADEKLVAAAESCIKALDLNAVRGLIVSGDAFINGSVGLAKIRH
FT                   NFPQAIAVEMEATAIAHVCHNFKVPFVVVRAISDVADQQSHLSFEEFLAVAARQSTLMV
FT                   ENLVQNLARG"
FT   gene            206010..207524
FT                   /gene="dgt"
FT                   /locus_tag="KPN_00175"
FT   CDS_pept        206010..207524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgt"
FT                   /locus_tag="KPN_00175"
FT                   /product="deoxyguanosinetriphosphate triphosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00175"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75635"
FT                   /db_xref="GOA:A6T4W4"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR020779"
FT                   /db_xref="InterPro:IPR023293"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4W4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR006674"
FT                   /protein_id="ABR75635.1"
FT                   /translation="MAKIDFRNKINWRRRFRSPPRVETERDILRIFESDRGRIVNSPAI
FT                   RRLQQKTQVFPLERNAAVRTRLTHSLEVQQVGRYIAKEVLSRLKELRLLEEYGLEELTG
FT                   PFESVVEMACLMHDIGNPPFGHFGEAAINDWFRQRLAPGDALGQPLTDDRCEVQALRLH
FT                   DGETSLNALRRKVRQDLCSFEGNAQGIRLVHTLMRMNLTWAQVGCILKYTRPAWWSEET
FT                   PASHSYLMKKPGYYLAEEEYVARLRKELDLAPYNRFPLTWIMEAADDISYCVADLEDAV
FT                   EKRIFSAEQLYQHLYDAWGSHEKGSLFSQVVENAWEKSRANYLKQSAEDQFFMYLRVNT
FT                   LNKLVPYAARRFIDNLPAIFTGDFNHALLEDDSDCSQLLELYKNVAMKQVFSHPDVEQL
FT                   ELQGYRVISGLLDIYQPLLKLSLEDFSELVAQERVRRLPIASRLYQKLSTRHRLAYVEA
FT                   VNKLARTAPEFALMEYYYRCRLIQDYISGMTDLYAWDEYRRLMAVE"
FT   gene            207659..209092
FT                   /gene="degP"
FT                   /locus_tag="KPN_00176"
FT   CDS_pept        207659..209092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degP"
FT                   /locus_tag="KPN_00176"
FT                   /product="periplasmic serine protease Do, heat shock
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00176"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75636"
FT                   /db_xref="GOA:A6T4W5"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4W5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001254"
FT                   /inference="protein motif:Pfam:IPR001478"
FT                   /protein_id="ABR75636.1"
FT                   /translation="MKKTTLAMSALALSLGLALSPLSASAAETASSATNAQQMPSLAPM
FT                   LEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDNSPFCQDGSPFQSSPFCQGGGQGGQ
FT                   PDGGQQQKFMALGSGVIIDAAKGYVVTNNHVVDNATTIKVQLSDGRRFDAKVVGKDPRS
FT                   DIALIQIQEPKNLTAIKLADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNVE
FT                   NYENFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTE
FT                   QMVKYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVMPGSAAAKAGIKAGDVIT
FT                   SLNGKAISSFAALRAQVGTMPIGSKVELGLLRDGKPVTVTVELQQSNQTQVDSSTIFNG
FT                   IEGAEMSNKGQDKGVVVNNVKAGTPAAQIGLKKGDVIVGANQQPVKNIADLRKIFDAKP
FT                   SVLALNIQRGDASIYLLLQ"
FT   gene            209206..210417
FT                   /gene="cdaR"
FT                   /locus_tag="KPN_00177"
FT   CDS_pept        209206..210417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdaR"
FT                   /locus_tag="KPN_00177"
FT                   /product="regulator of D-galactarate, D-glucarate and
FT                   D-glycerate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00177"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75637"
FT                   /db_xref="InterPro:IPR008599"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4W6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR008599"
FT                   /protein_id="ABR75637.1"
FT                   /translation="MQRDDDSFMLVPSKGEDYMAGWHLDTKMAQDIVARTMRIIDTNIN
FT                   VMDARGRIIGSGDRERIGELHEGALLVLSQGRVVDIDDAVARHLHGVRQGINLPLRLEG
FT                   EIVGVIGLTGEPESLRKYGELVCMTAEMMLEQSRLMHLLAQDSRLREELVMNLIQAEEH
FT                   TPALNEWAQRLGIDLNQPRVVAMIEVDSGQLGVDSAMAELQQLQNALTTPDRNNLVAIV
FT                   SLTEMVVLKPALNSFGRWDADDHVRRVEQLIARMKENGQLRFRVALGNFFTGPGSIARS
FT                   YRTARTTMMVGKQRMPESRSYFYQDLMLPVLLDSLRGGWQANELARPLARLKAMDNNGL
FT                   LRRTLQAWFRHNVQPLATSKALFIHRNTLEYRLNRISELTGLDLGSFDDRLLLYIALQL
FT                   DEQR"
FT   gene            complement(210536..210922)
FT                   /gene="yaeH"
FT                   /locus_tag="KPN_00178"
FT   CDS_pept        complement(210536..210922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeH"
FT                   /locus_tag="KPN_00178"
FT                   /product="putative structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00178"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75638"
FT                   /db_xref="InterPro:IPR020911"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4W7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75638.1"
FT                   /translation="MYDNLKSLGITNPDEIDRYSLRQEANNDILKIYFQKDKGEFFAKS
FT                   VKFKYPRQRKTVVADGVGQGYKEVQEISPNLRYVIDELDQICQRDRTEIDLKRKILDDL
FT                   RHLESVVTNKISEIEADLEKLTRK"
FT   gene            complement(211030..211854)
FT                   /gene="dapD"
FT                   /locus_tag="KPN_00179"
FT   CDS_pept        complement(211030..211854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapD"
FT                   /locus_tag="KPN_00179"
FT                   /product="2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00179"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75639"
FT                   /db_xref="GOA:A6T4W8"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4W8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001451"
FT                   /protein_id="ABR75639.1"
FT                   /translation="MQQLQNVIESAFERRADITPANVDTVTREAVNQVIALLDSGALRV
FT                   AEKIDGQWVTHQWLKKAVLLSFRINDNQVIDGAESRYFDKVPMKFADYDEARFQKEGFR
FT                   VVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVG
FT                   IGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTKIYDRETGEV
FT                   FYGRVPAGSVVVSGNLPSKDGKYSLYCAVIVKKVDAKTRGKVGINELLRTID"
FT   gene            complement(211885..214548)
FT                   /gene="glnD"
FT                   /locus_tag="KPN_00180"
FT   CDS_pept        complement(211885..214548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnD"
FT                   /locus_tag="KPN_00180"
FT                   /product="PII uridylyl-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00180"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75640"
FT                   /db_xref="GOA:A6T4W9"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4W9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002912"
FT                   /inference="protein motif:Pfam:IPR002934"
FT                   /inference="protein motif:Pfam:IPR006674"
FT                   /protein_id="ABR75640.1"
FT                   /translation="MSNSLPDTASPLLPVPPEHPVSWPQGDLNCAAIKAHIDTFQHWLG
FT                   EAFDSGIVAEQLIAARTEFIDQLLQRLWIACGFESVSDLALVAVGGYGRGELHPLSDVD
FT                   LLILSRKKLPDDQAQKVGELLTLLWDVKLEVGHSVRTLEECLLEGLSDLTVATNLIESR
FT                   LLIGDVALFLELQKHIFSDGFWPSEKFFAAKVEEQNVRHQRYHGTSYNLEPDVKSSPGG
FT                   LRDIHTLQWVARRHFGATSMDEMVGFGFLTEAERNELNECLHQLWRIRFALHLELTRYD
FT                   NRLLFDRQLSVARRLGYEGDGNQPIEHMMKDFFRVTRRVSELNQMLLQLFEEAILALTE
FT                   DEKPRPIDDDFQLRGTLIDLRDDTLFIREPQAILRMFYIMVRNSTITGIYSTTLRHLRH
FT                   ARRHLTQPLCYIPEARTLFLSMLRHQGAVSRGLLPMHRHSVLWAYMPQWSHIVGQMQFD
FT                   LFHAYTVDEHTVRVMLKLESFAKEETRSRHPLCVELWPRLTHPELILIAALFHDIAKGR
FT                   GGDHSILGAQDVLKFAELHGLNSRETQLVAWLVRHHLLMSVTAQRRDIQDPEVIKQFAE
FT                   EVQTENRLRYLVCLTVADICATNETLWNSWKQSLLRELYFATEKQLRRGMQSTPDMRER
FT                   VRHHQLQALALLRMDNINEEALHQIWNRCRANYFVRHTPTQLAWHARNLLSHDLNKPMI
FT                   LLSSQATRGGTEIFIWSPDRPYLFAAVCGELDRRNLSVHDAQIFTTRDGMAMDTFIVLE
FT                   PDGSPLSADRHEAIRQGLEQTITQRSWQPPAPRRQAAKLRHFSVDTEVNFLPTHTDRKS
FT                   FLELIALDQPGLLARVGQVFADLGISLHGARITTIGERVEDLFIIATADRRALNNELQQ
FT                   EVQQRLTAALNPNDKG"
FT   gene            complement(214606..215400)
FT                   /gene="map"
FT                   /locus_tag="KPN_00181"
FT   CDS_pept        complement(214606..215400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="KPN_00181"
FT                   /product="methionine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00181"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75641"
FT                   /db_xref="GOA:A6T4X0"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4X0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000994"
FT                   /protein_id="ABR75641.1"
FT                   /translation="MAISIKTSEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRIC
FT                   NDYIVNEQKAISACLGYHGYPKSVCISVNEVVCHGIPDDGKLLKDGDIVNIDVTVIKDD
FT                   FHGDTSKMFIVGKPTILGERLCRITQESLYLALRMVKPGINLRAIGAAIQKFVEAEGFS
FT                   VVREYCGHGIGRGFHEEPQVLHYDSPETNVVLKPGMTFTIEPMVNAGKKEIRSMKDGWT
FT                   VKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE"
FT   gene            215738..216448
FT                   /gene="rpsB"
FT                   /locus_tag="KPN_00182"
FT   CDS_pept        215738..216448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="KPN_00182"
FT                   /product="30S ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00182"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75642"
FT                   /db_xref="GOA:A6T4X1"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4X1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001865"
FT                   /protein_id="ABR75642.1"
FT                   /translation="MRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEKTVPMF
FT                   NEALAELNKIAARKGKILFVGTKRAASEAVKDAALSCDQFFVNHRWLGGMLTNWKTVRQ
FT                   SIKRLKDLETQSQDGTFDKLTKKEALMRTRELDKLENSLGGIKDMGGLPDALFVIDADH
FT                   EHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIPGNDDAIRAVSLYLGAVAATVREGRSQ
FT                   DLASQAEESFVEAE"
FT   gene            216568..217419
FT                   /gene="tsf"
FT                   /locus_tag="KPN_00183"
FT   CDS_pept        216568..217419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="KPN_00183"
FT                   /product="elongation factor Ts"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00183"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75643"
FT                   /db_xref="GOA:A6T4X2"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4X2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000449"
FT                   /inference="protein motif:Pfam:IPR001816"
FT                   /protein_id="ABR75643.1"
FT                   /translation="MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRKSG
FT                   AIKAAKKAGNVAADGVIKTKIEGNYGYILEVNCQTDFVAKDGGFQAFADKVLDAAVAGK
FT                   ISDVEVLKAQFEEERVALVAKIGENINIRRIAVLEGDVLGSYQHGARIGVLVAAKGADE
FT                   ELVKQLAMHVAASKPEFVKPEDVSAEVVEKEYQVQLDIAMQSGKPKEIAEKMVEGRMKK
FT                   FTGEVSLTGQPFVMEPSKSVGQLLKEHNADVTGFIRFEVGEGIEKVETDFAAEVAAMSK
FT                   QS"
FT   gene            217570..218295
FT                   /gene="pyrH"
FT                   /locus_tag="KPN_00184"
FT   CDS_pept        217570..218295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="KPN_00184"
FT                   /product="uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00184"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75644"
FT                   /db_xref="GOA:A6T4X3"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4X3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001048"
FT                   /protein_id="ABR75644.1"
FT                   /translation="MATNAKPVYKRILLKLSGEALQGSEGFGIDASILDRMAQEIKELV
FT                   ELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARL
FT                   MSAIPLNGVCDNYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEADVVLK
FT                   ATKVDGVFTADPAKDPSATMYDQLTYSEVLEKELKVMDLAAFTLARDHKLPIRVFNMNK
FT                   PGALRRVVMGEKEGTLITE"
FT   gene            218482..219003
FT                   /gene="frr"
FT                   /locus_tag="KPN_00185"
FT   CDS_pept        218482..219003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="KPN_00185"
FT                   /product="ribosome releasing factor"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00185"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75645"
FT                   /db_xref="GOA:A6T4X4"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4X4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002661"
FT                   /protein_id="ABR75645.1"
FT                   /translation="MEKCVEAFKNQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASV
FT                   TVEDSRTLKINVFDRSMSAAVEKAIMASDLGLNPSSAGSDIRVPLPPLTEERRKDLTKI
FT                   VRGEAEQARVAVRNVRRDANDKVKALLKEKEISEDDDRRSQDDVQKMTDAAIKKVDAAL
FT                   ADKEAELMQF"
FT   gene            219232..220434
FT                   /gene="ispC"
FT                   /locus_tag="KPN_00186"
FT   CDS_pept        219232..220434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispC"
FT                   /locus_tag="KPN_00186"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00186"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75646"
FT                   /db_xref="GOA:A6T4X5"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4X5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003821"
FT                   /protein_id="ABR75646.1"
FT                   /translation="MKQLTVLGSTGSIGCSTLDVVRHNPGRFSVAALVAGKNVDRMVEQ
FT                   CLEFTPRYAVMDDAQSAERLRTRLHEHGSRTEVLSGQQAAAEVAALDEVDQVMAAIVGA
FT                   AGLVPTLAAIRAGKTVLLANKESLVTCGRLFMEAVQQSGARLLPVDSEHNAIFQSMPET
FT                   IQQHLGYADLAQNGVSSILLTGSGGPFRETAVAELAAMTPDQACRHPNWSMGRKISVDS
FT                   ATMMNKGLEYIEARWLFNASAQQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIA
FT                   HTMGWPQRLNSGVKPLDFCQLSNLSFSAPDYTRYPCLKLAMDAFDVGQAATTTLNAANE
FT                   ESVAAFLHGDIRFTDIAAVNLAVLDKMDLQEPQSIDDVLVIDAEARAIAHQQLQRLVAQ
FT                   A"
FT   gene            220654..221430
FT                   /gene="uppS"
FT                   /locus_tag="KPN_00187"
FT   CDS_pept        220654..221430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppS"
FT                   /locus_tag="KPN_00187"
FT                   /product="undecaprenyl pyrophosphate synthetase
FT                   (di-trans,poly-cis-decaprenylcistransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00187"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75647"
FT                   /db_xref="GOA:A6T4X6"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4X6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001441"
FT                   /protein_id="ABR75647.1"
FT                   /translation="MDLKRVMLSANQTVSEISPTHGCRHVAIIMDGNGRWAKRQGKIRA
FT                   FGHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMELFVWALDSEVKS
FT                   LHRHNVRLRIIGDTTRFNARLQERIRKAEALTANNTGLTLNIAANYGGRWDITQGVRLL
FT                   AKQVQDGTLLPEQITEDMLSQQVCMHELAPVDLVIRTGGEHRISNFLIWQIAYAELYFT
FT                   DVLWPDFAEQDFEGALHAFVNRERRFGGTEPGGSHA"
FT   gene            221518..222300
FT                   /gene="cdsA"
FT                   /locus_tag="KPN_00188"
FT   CDS_pept        221518..222300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="KPN_00188"
FT                   /product="CDP-diglyceride synthase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00188"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75648"
FT                   /db_xref="GOA:A6T4X7"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4X7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000374"
FT                   /protein_id="ABR75648.1"
FT                   /translation="MGFAIVTLVVCMLAAWEWGQLSGFTSTSQRVWLAVLCGLLLAAML
FT                   FLLPEYHYDVHQPMVEGSLWASFAWWIVALLLVLSYPASAAFWRHSKVLRLIFGILTIV
FT                   PFFWGMLALRAWHYADNHYSGALWLLYVMILVWGADSGAYMFGKMFGKHKLAPKVSPGK
FT                   TWQGFFGGLLTAAVISWAYGVWAHLDVTPTVLLVCSVVAALASVLGDLTESMFKREAGI
FT                   KDSGHLIPGHGGILDRIDSLTAAVPVFACLLLLVFRTI"
FT   gene            222297..223664
FT                   /gene="yaeL"
FT                   /locus_tag="KPN_00189"
FT   CDS_pept        222297..223664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeL"
FT                   /locus_tag="KPN_00189"
FT                   /product="membrane-associated protease"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00189"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75649"
FT                   /db_xref="GOA:A6T4X8"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4X8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001478"
FT                   /inference="protein motif:Pfam:IPR008915"
FT                   /protein_id="ABR75649.1"
FT                   /translation="MTEGYMLSVLWNLAAFIIALGVLITVHEFGHFWVARRCGIRVERF
FT                   SIGFGKALWRRMDKQGTEFVIALIPLGGYVKMLDERVEAVAPEMRHYAFNNKTVGQRAA
FT                   VIAAGPIANFIFAIFAYWLVFIIGVPGVRPVVGEITPNSVAAQAQIAKGTELKAIDGIE
FT                   TPDWDAVRLQLVAKIGNPQTIVTVAPFGTNQRQDKIVDLRHWSFEPDKQDPVTSLGIQP
FT                   RSAQIDTVLAEVQAGSAAQKAGLQAGDRIVKVDGQPLTQWMTFVNLVRDNPGKALALEI
FT                   ERQGSALPLTLTPDAKTVKGKAEGFAGVVPKVIPLPEEYKTVRQYGPFAAIAEATDKTW
FT                   QLMSLTVRMLGKLITGDVKLNNLSGPISIAQGAGMSAEFGLIYYLMFLALISVNLGIIN
FT                   LFPLPVLDGGHLLFLAIEKLKGGPVSERVQDFSYRIGSILLVLLMGLALFNDFSRL"
FT   gene            223696..226125
FT                   /gene="yaeT"
FT                   /locus_tag="KPN_00190"
FT   CDS_pept        223696..226125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeT"
FT                   /locus_tag="KPN_00190"
FT                   /product="putative outer membrane antigen"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00190"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75650"
FT                   /db_xref="GOA:A6T4X9"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4X9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000184"
FT                   /inference="protein motif:Pfam:IPR010827"
FT                   /protein_id="ABR75650.1"
FT                   /translation="MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLS
FT                   MPVRPGDTVTDDDISNTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKS
FT                   VKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRV
FT                   DLKLVFQEGVSAKIQQINIVGNHAFSTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGD
FT                   LETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYITVNITEGDQYKFSGVQVTGNLAGHS
FT                   AEIEALTKVEPGELYNGAKVTRMENDIKKLLGRYGYAYPRVQSQPEINDSDKTVKLHVN
FT                   VDAGNRYYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKDRLNRLGFFETVD
FT                   TDTQRVPGSPDQVDVVYKVKERNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGI
FT                   NGTKNDYQTYTELSVTNPYFTVDGVSLGGRVFYNDFDANDADLSDYTNKSYGTDITLGF
FT                   PVNEYNTLRAGVGYVHNSLSNMQPQVAMWRYLNSMGQYPDNTNDRNSFSANDFTFNYGW
FT                   TYNKLDRGFFPTEGSRVNLNGKVTIPGSDNEYYKATLDTATYVPIDNDHQWVVLGRTRF
FT                   GYGDGIGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAVYFPASSRHDDDDSYDNECKST
FT                   ESAPCKSDDAVGGNAMAVASLELITPTPFISDKYANSVRTSVFWDMGTVWDTHWDSSAY
FT                   AGYPDYSDPSNIRMSAGIAVQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFNIGKTW"
FT   gene            226286..226732
FT                   /gene="hlpA"
FT                   /locus_tag="KPN_00191"
FT   CDS_pept        226286..226732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hlpA"
FT                   /locus_tag="KPN_00191"
FT                   /product="periplasmic molecular chaperone for outer
FT                   membrane proteins"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00191"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75651"
FT                   /db_xref="GOA:A6T4Y0"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4Y0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR005632"
FT                   /protein_id="ABR75651.1"
FT                   /translation="MVTSAQAADKIALVNMNSLFQQVAQKTGVSNTLENEFKGRASELQ
FT                   RMEGDLQSKMQRLQSMKPGAERTKLEKDVMAQRQTFSQKAQAFEQDRARRSNEERGKLV
FT                   TRIQTAVQSVAKDQSIDLVVDANAVAYNSSDVKDITADVLKQVK"
FT   gene            226736..227761
FT                   /gene="lpxD"
FT                   /locus_tag="KPN_00192"
FT   CDS_pept        226736..227761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxD"
FT                   /locus_tag="KPN_00192"
FT                   /product="UDP-3-O-(3-hydroxymyristoyl)-glucosamine
FT                   n-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00192"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75652"
FT                   /db_xref="GOA:A6T4Y1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4Y1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001451"
FT                   /protein_id="ABR75652.1"
FT                   /translation="MPSIRLADLAQQLDAELHGDGDIVITGVASMQSAKTGQITFMVNP
FT                   KYREHLAACQASAVVMTQDDLPFAHSAALVVRNPYLTYARMAQILDTTPQPAQDIAPSA
FT                   VIDPSAKLGSNVAIGANAVIESGVVLGDNVVIGAGCFVGKNTKIGAGSRLWANVTVYHE
FT                   IEIGENCLIQSSTVIGADGFGYANDRGNWVKIPQLGRVIIGDRVEIGACTTIDRGALDD
FT                   TVIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICD
FT                   KVTVTGMGMVMRPISEPGVYSSGIPLQPNKAWRKTAALVMNIDEMSKRLKAIERKVNQQ
FT                   D"
FT   gene            227867..228322
FT                   /gene="fabZ"
FT                   /locus_tag="KPN_00193"
FT   CDS_pept        227867..228322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="KPN_00193"
FT                   /product="(3R)-hydroxymyristoyl ACP dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00193"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75653"
FT                   /db_xref="GOA:A6T4Y2"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4Y2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR006683"
FT                   /protein_id="ABR75653.1"
FT                   /translation="MTTDTHTLHIEEILELLPHRYPFLLVDRVLDFEEGRFLRAVKNVS
FT                   VNEPFFQGHFPGKPILPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRP
FT                   VVPGDQMIMEVTFEKTRRGLTRFKGVALVDGKVVCEATMMCARSREA"
FT   gene            228326..229114
FT                   /gene="lpxA"
FT                   /locus_tag="KPN_00194"
FT   CDS_pept        228326..229114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxA"
FT                   /locus_tag="KPN_00194"
FT                   /product="UDP-N-acetylglucosamine acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00194"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75654"
FT                   /db_xref="GOA:A6T4Y3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4Y3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001451"
FT                   /protein_id="ABR75654.1"
FT                   /translation="MIDKTAFVHPTAIVEEGAVIGANVHIGPFCIVGANVEIGEGSVLK
FT                   SHVVVNGHTKIGRDNEIYQFASIGEVNQDLKYAGEPTRVEIGDRNRIRESVTIHRGTVQ
FT                   GGGLTKVGNDNLLMINAHVAHDCTLGDRCILANNATLAGHVSLDDYVIIGGMTAVHQFC
FT                   VIGSHVMVGGCSGVAQDVPPFVIAQGNHATPFGVNIEGLKRRGFSREAITAIRNAYKLL
FT                   YRSGKTLEEAKPEIAELAAQHPEVQPFVDFFARSTRGLIR"
FT   gene            229114..230265
FT                   /gene="lpxB"
FT                   /locus_tag="KPN_00195"
FT   CDS_pept        229114..230265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxB"
FT                   /locus_tag="KPN_00195"
FT                   /product="lipid-A-disaccharide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00195"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75655"
FT                   /db_xref="GOA:A6T4Y4"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4Y4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003835"
FT                   /protein_id="ABR75655.1"
FT                   /translation="MAEQRPLTIALVAGETSGDILGAGLIRALKARIPNARFVGVAGPL
FT                   MQAEGCEAWYEMEELAVMGIVEVLGRLRRLLHIRADLTRRFGELRPDVFVGIDAPDFNI
FT                   TLEGNLKKQGIKTIHYVSPSVWAWRQKRVFKIGRSTDLVLAFLPFEKAFYDKFNVPCRF
FT                   IGHTMADAMPLDPDKGAARDRLGIPHSVRCLALLPGSRGAEVEMLSADFLKTAQLLRAT
FT                   YPDLQVVVPLVNAKRREQFERIKAETAPDMIVHMLDGQARDAMIASDAALLASGTAALE
FT                   CMLAKCPMVVGYRMKPFTFWLAKRLVKTDYVSLPNLLAGRELVKELLQDECEPQALAAA
FT                   LQPLLADGKTSHEMHETFRALHQQIRCNADEQAADAVLELAKQ"
FT   gene            230262..230861
FT                   /gene="rnhB"
FT                   /locus_tag="KPN_00196"
FT   CDS_pept        230262..230861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="KPN_00196"
FT                   /product="ribonuclease HII"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00196"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75656"
FT                   /db_xref="GOA:A6T4Y5"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4Y5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001352"
FT                   /protein_id="ABR75656.1"
FT                   /translation="MMEFVYPHTHLVAGVDEVGRGPLVGAVVTAAVILDPAKPIVGLND
FT                   SKKLSEKRRLALFDEIKEKALCWSLGRAEPHEIDELNILHATMLAMQRAVAGLSIVPEF
FT                   VLIDGNRCPSLPMPSQAVVKGDSRVAEISAASILAKVTRDAEMATLDLAFPHYGFAQHK
FT                   GYPTAVHLQKLQEHGATEHHRRSFGPVKRALGLASN"
FT   gene            230879..234361
FT                   /gene="dnaE"
FT                   /locus_tag="KPN_00197"
FT   CDS_pept        230879..234361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaE"
FT                   /locus_tag="KPN_00197"
FT                   /product="DNA polymerase III subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00197"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75657"
FT                   /db_xref="GOA:A6T4Y6"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4Y6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003141"
FT                   /inference="protein motif:Pfam:IPR004013"
FT                   /inference="protein motif:Pfam:IPR004365"
FT                   /protein_id="ABR75657.1"
FT                   /translation="MAEPRFVHLRVHSDYSMIDGLAKTGPLVKKAASLGMPALAITDFT
FT                   NLCGLVKFYGTGHGAGIKPIVGADFHVQCDLLGDEFTELTVLAANNTGYQNLTLLISRA
FT                   YQRGYGALGPWIDRDWLVEHQEGLILLSGGRKGDVGVSLIRGNMPLVEQCVAFYEEHFP
FT                   DRYFLELIRTGRQDEEAYLHAAVALAEARGLPVVATNDVRFLDTSDFDAHEIRVAIHDG
FT                   FTLDDPKRPRNYSPQQYMRSEEEMCELFADIPEALANSVEIAKRCNVTVRLGEYFLPQF
FT                   PTGDMTTEDFLVMKSKEGLEERLEFLFPDPAVRAEKRPEYDQRLDIELQVINQMGFPGY
FT                   FLIVMEFIQWSKDNGVPVGPGRGSGAGSLVAYALKITDLDPLEFDLLFERFLNPERVSM
FT                   PDFDVDFCMEKRDQVIEHVADMYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPYGFVDR
FT                   ISKLVPPDPGMTLAKAFEAEPQLPEIYEADEEVKALIDMARKLEGVTRNAGKHAGGVVI
FT                   APTKITDFAPLYCDEQGLHPVTQFDKNDVEYAGLVKFDFLGLRTLTIINWALEMINKRR
FT                   EKNGEGPLDIAAIPLDDKKSFDMLQRSETTAVFQLESRGMKDLIKRLQPDCFEDMIALV
FT                   ALFRPGPLQSGMVDNFIDRKHGREEISYPDVQWQHESLKPVLEPTYGIILYQEQVMQIA
FT                   QVLSGYTLGGADMLRRAMGKKKPEEMAKQRSIFEDGAKKNGIDGELAMKIFDLVEKFAG
FT                   YGFNKSHSAAYALVSYQTLWLKAHYPAEFMAAVMTADMDNTEKVVGLVDECWRMGLKIL
FT                   PPDINSGLYHFHVNDDGEIVYGIGAIKGVGEGPIEAIIEARNNGGYFRELFDLCARTDI
FT                   KKLNRRVLEKLIMSGAFDRLGPHRAALMNSLGDALKAADQHAKAEAIGQADMFGVLAEE
FT                   PEQIEQSYASCQPWPEQVVLDGERETLGLYLTGHPINQYLKEIERYVGGVRLKDMHPTE
FT                   RGKVTTAAGLVIAARVMVTKRGNRIGICTLDDRSGRLEVMLFTDALDKYQQLLEKDRIL
FT                   IVSGQVSFDDFSGGLKMTAREVMDIDEAREKYARGLAISLTDRQIDDQLLNRLRQSLEP
FT                   HRSGTIPVHLYYQRADARARLRFGATWRVSPSDRLLNDLRGLIGSEQVELEFD"
FT   gene            234374..235333
FT                   /gene="accA"
FT                   /locus_tag="KPN_00198"
FT   CDS_pept        234374..235333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="KPN_00198"
FT                   /product="acetyl-CoA carboxylase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00198"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75658"
FT                   /db_xref="GOA:A6T4Y7"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4Y7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001095"
FT                   /protein_id="ABR75658.1"
FT                   /translation="MSLNFLDFEQPIAELEAKIDSLTAVSRQDEKLDINIDEEVHRLRE
FT                   KSVELTRKIFADLGAWQVAQLARHPRRPYTLDYVRLAFDEFDELAGDRAFADDKAIVGG
FT                   IARLDGRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMEMAERFKMPIITFIDT
FT                   PGAYPGVGAEERGQSEAIARNLREMSRLSVPVICTVIGEGGSGGALAIGVGDKVNMLQY
FT                   STYSVISPEGCASILWKSADKAPLAAEAMGIIAPRLKELKLIDSIVPEPLGGAHRNPEA
FT                   MAASLKAQLLADLADLDLLSEEELLNRRYQRLMSYGYA"
FT   gene            235411..237600
FT                   /gene="ldcC"
FT                   /locus_tag="KPN_00199"
FT   CDS_pept        235411..237600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ldcC"
FT                   /locus_tag="KPN_00199"
FT                   /product="lysine decarboxylase 2, constitutive"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00199"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75659"
FT                   /db_xref="GOA:A6T4Y8"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4Y8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000310"
FT                   /inference="protein motif:Pfam:IPR005308"
FT                   /inference="protein motif:Pfam:IPR008286"
FT                   /protein_id="ABR75659.1"
FT                   /translation="MMLDLGEYQEESVNIIAIMGPHGVYHKDEPIKELEAALQRQGFQT
FT                   IWPQNSADLLQFIEHNPRICGVIFDWDEYSVDLCSDINQLNEYLPLYAFINAHSTMDVS
FT                   SQDLRMTLWFFEYALGLSEEIATRIGQYTREYLENITPPFTRALFNYVQEGKYTFCTPG
FT                   HMGGSAYQKSPVGCLFYDFFGGNTLKADVSISVTELGSLLDHTGPHLEAEEYIARAFGA
FT                   EQSYMVTNGTSTSNKIVGMYSAPAGSTLLIDRNCHKSLAHLLMMSDVVPLWLKPTRNAL
FT                   GILGGIPRREFTRDSIQQKVRDTGGAQWPVHAVITNSTYDGLLYNTTWLKETLDVPSIH
FT                   FDSAWVPYTHFHPIYQGKSGMSGERIPGKVIFETQSTHKMLAALSQASLIHIKGNYDEE
FT                   TFNEAFMMHTSTSPSYPIVASIETAAAMLRGNSGKRLIQRSIERALDFRKEVQRLREES
FT                   DGWFFDIWQPEAVDKAECWPVAPGEDWHGFKDADADHMYLDPVKVTILTPGMDEQGNMD
FT                   EEGIPAALVAKFLDERGVVVEKTGPYNLLFLFSIGIDKTRAMGLLRGLTEFKRAYDLNL
FT                   RVKNMLPDLYAEDPDFYRNMRIQDLAQGIHRLIRQHQLPQLMLSAFDVLPEMKMTPHHA
FT                   WQRQIKGEVETIELENLVGRISANMILPYPPGVPLLMPGEMITEESRAVLDFLLMLCSI
FT                   GRHYPGFETDIHGAKRDEDGVYRVRVLKNDERLAR"
FT   gene            237647..238036
FT                   /gene="yaeR"
FT                   /locus_tag="KPN_00200"
FT   CDS_pept        237647..238036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeR"
FT                   /locus_tag="KPN_00200"
FT                   /product="putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00200"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75660"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037478"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4Y9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004360"
FT                   /protein_id="ABR75660.1"
FT                   /translation="MLGLKRVHHIAIIATDYARSKAFYCDILGFTLQSEFYRAERDSWK
FT                   GDLALNGEYVIELFSFPFPPARPSRPEACGLRHLAFSVDDIDAAVAHLTAHGVECEAIR
FT                   VDPFTGKRFTFFSDPDDLPLEIYQQ"
FT   gene            238090..239403
FT                   /gene="tilS"
FT                   /locus_tag="KPN_00201"
FT   CDS_pept        238090..239403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tilS"
FT                   /locus_tag="KPN_00201"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00201"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75661"
FT                   /db_xref="GOA:A6T4Z0"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4Z0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR011063"
FT                   /protein_id="ABR75661.1"
FT                   /translation="MFVDMLADIAHTLHPHRQLLVAFSGGLDSTVLLHQLVQLREQDPA
FT                   LTLRAVHVHHGLSAHADQWVAHCRQVCQQWQVPLVVHHVTLARGGLGVEAHARAARYQA
FT                   FQETLNAGEVLVTAQHQDDQCETLLLALKRGSGPTGLSAMAPSSAFAGSRLLRPLLNET
FT                   RESLRQWALAHQLSWIEDESNQDDTYDRNFLRLRVIPVLRERWPHFSEAVARSASLCAE
FT                   QEQLLDEMLAAELASLVAEDGSLAIAPLATMSPPRRAALLRRWLAGQQAPMPAREVPER
FT                   LWHEVALAREDASPCLRLGEFTVRRFQQRLYWVKYLPGQTDSVQRWPDWRQPLRLADGL
FT                   GELTLQPGGRLRPPSADEPVTVRFRASGHLHIVGRHGGRKLKKLWQELGVAPWRRDTTP
FT                   LLFYGETPIAAADDLFVTTEGEVKDGEGVRLMWRKTGD"
FT   gene            complement(239417..239671)
FT                   /gene="rof"
FT                   /locus_tag="KPN_00202"
FT   CDS_pept        complement(239417..239671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rof"
FT                   /locus_tag="KPN_00202"
FT                   /product="modulator of Rho-dependent transcription
FT                   termination"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00202"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75662"
FT                   /db_xref="InterPro:IPR009778"
FT                   /db_xref="InterPro:IPR023534"
FT                   /db_xref="InterPro:IPR038626"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4Z1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR009778"
FT                   /protein_id="ABR75662.1"
FT                   /translation="MNDTYQPINCDDYDNLELACQHHLVLTLALKDGEQLQAKASDLIS
FT                   RKNIEYLVVELAGNVRELRLDKIASFSHPEIGTVVVSES"
FT   gene            complement(239664..239879)
FT                   /gene="yaeP"
FT                   /locus_tag="KPN_00203"
FT   CDS_pept        complement(239664..239879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeP"
FT                   /locus_tag="KPN_00203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00203"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75663"
FT                   /db_xref="InterPro:IPR009624"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4Z2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR009624"
FT                   /protein_id="ABR75663.1"
FT                   /translation="MTGGHVDHYCELIRKRYAEIASGDLGYIPDALGCVLKVLNEIAAD
FT                   EALSESVREKAAYAAANLLVSDYVNE"
FT   gene            240061..240606
FT                   /gene="yaeQ"
FT                   /locus_tag="KPN_00204"
FT   CDS_pept        240061..240606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeQ"
FT                   /locus_tag="KPN_00204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00204"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75664"
FT                   /db_xref="InterPro:IPR009822"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR038590"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4Z3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR009822"
FT                   /protein_id="ABR75664.1"
FT                   /translation="MALKATIYKAAVNVADLDRNQFLDANLTLAQHPSETQERMMLRLL
FT                   AWIKYADERLQFTRGLSSDDEPELWLLNDHLGVDLWIELGLPDERRIKKACSRAQAVAL
FT                   FAYNSRAAEIWWQQNQSKLAAYPKLTIWYLDDAQLALLSAFADRTMTLQATLQEGSIWL
FT                   SDARNNLEIQLTAWQASA"
FT   gene            240603..241016
FT                   /gene="yaeJ"
FT                   /locus_tag="KPN_00205"
FT   CDS_pept        240603..241016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeJ"
FT                   /locus_tag="KPN_00205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00205"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75665"
FT                   /db_xref="GOA:A6T4Z4"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4Z4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000352"
FT                   /protein_id="ABR75665.1"
FT                   /translation="MITISRSVALADDEIVLSGIRAQGAGGQHVNKASTAIHLRFDIKA
FT                   SSLPEFYKERLLAASHHLISADGVVIIKAQEYRSQEMNREAAIARLVALIKELTAVQKS
FT                   RRETRPTRASKERRLASKAQKSSVKALRGKVRQ"
FT   gene            241038..241757
FT                   /gene="cutF"
FT                   /locus_tag="KPN_00206"
FT   CDS_pept        241038..241757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutF"
FT                   /locus_tag="KPN_00206"
FT                   /product="copper homeostasis protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00206"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75666"
FT                   /db_xref="InterPro:IPR007298"
FT                   /db_xref="InterPro:IPR033450"
FT                   /db_xref="InterPro:IPR038139"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4Z5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR007298"
FT                   /protein_id="ABR75666.1"
FT                   /translation="MDDKESKVKKIVFSVIAACSLFALFGCNHRAETDTVQPAAMEELK
FT                   PMQQSWRGVLPCADCEGIDTSLFLEKDGTWVMNEHYQGARREPSSFASYGTWARTADKL
FT                   VLTNSKGEKSYFRAKGDKLEMLDRNGSPIQSPLNYTLEPVKASLPTTPMAMRGMYFYMA
FT                   DAATFTDCATGKRVAVANNAQLERDYAAARGTDTRPVLLVVEGHFTLEANPDTGEMMKT
FT                   LMTDQAGKFIPGKDCSH"
FT   gene            complement(241889..242731)
FT                   /gene="yaeF"
FT                   /locus_tag="KPN_00207"
FT   CDS_pept        complement(241889..242731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeF"
FT                   /locus_tag="KPN_00207"
FT                   /product="putative synthase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00207"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75667"
FT                   /db_xref="InterPro:IPR024453"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4Z6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75667.1"
FT                   /translation="MTAHLLRSGLLTFALLLLTACTLDVGRSSPSTSAADDHSSSWAVT
FT                   LQRQSSIAGSGLREIAESDLRSGDLLFSSSLGVTSLGIRAFSASSVSHVALYVGEGQVA
FT                   EATGAGVQVISLQQALAHSDKLFALRVPDLTPDQATTMKSFAWQVKDSGYNYRGIIQFI
FT                   PYMVTKPLCSLNPFSRDFRQQCVSGLAKAQLGDAASGDKKAWFCSEFVSEAFVRAGHPL
FT                   TLAQAAWISPSDLLHMREGDVATFKPETQLQYVGHLKLGVYLQAGKLVGLNKPKDGAE"
FT   gene            complement(242791..244509)
FT                   /gene="proS"
FT                   /locus_tag="KPN_00208"
FT   CDS_pept        complement(242791..244509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="KPN_00208"
FT                   /product="prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00208"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75668"
FT                   /db_xref="GOA:A6T4Z7"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T4Z7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002314"
FT                   /inference="protein motif:Pfam:IPR004154"
FT                   /inference="protein motif:Pfam:IPR007214"
FT                   /protein_id="ABR75668.1"
FT                   /translation="MRTSQYLLSTLKETPADAEVISHQLMLRAGMIRKLASGLYTWLPT
FT                   GVRVLKKVENIVREEMNNAGAIEVLMPVVQPSELWQESGRWEQYGPELLRIADRGDRPF
FT                   VLGPTHEEVITDLIRNELNSYKQLPLNFYQIQTKFRDEVRPRFGVMRSREFLMKDAYSF
FT                   HTSQESLQETYDAMYAAYSKIFSRMGLDFRAVQADTGSIGGSASHEFQVLAQSGEDDVI
FT                   FSDSSDYAANIEFAEAVAPKEPRAAATQEMTLVDTPNAKTIAELVEQFNLPIEKTVKTL
FT                   LVKAVEDSASPLVALLVRGDHELNEVKAEKLPQVASPLTFATEEEIRALVNAGPGSLGP
FT                   VNMPVPVIIDRTVAVMSDFAAGANIDGKHYFGINWDRDVATPEVADIRNVVAGDPSPDG
FT                   KGTLLIKRGIEVGHIFQLGTKYSEAMKAAVQGEDGRNQILTMGCYGIGVTRVVAAAIEQ
FT                   NFDDRGIVWPDAIAPFQVAILPMNMHKSYRVQELAEKLYAELSAQGIEVLMDDRKERPG
FT                   VMFADMELIGIPHTIVLGDRNLDNDDIEYKYRRNGEKQLIKTGDIVEYLVKAIKG"
FT   gene            complement(244621..245328)
FT                   /gene="yaeB"
FT                   /locus_tag="KPN_00209"
FT   CDS_pept        complement(244621..245328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeB"
FT                   /locus_tag="KPN_00209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00209"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75669"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="InterPro:IPR041369"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4Z8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001378"
FT                   /protein_id="ABR75669.1"
FT                   /translation="MSAFQFAQIGVIRSPYKEKFAVPRQPGLVKHGGGELHLVAPYNQA
FT                   DAVRGLESFSHLWILFVFHQTMEGGWRPTVRPPRLGGNARMGVFATRSTFRPNPIGMSL
FT                   VELKGIRCQKDQVILELGSLDLVDGTPVVDIKPYLPFAEALPDASASYAQQAPLAGMNV
FT                   SFTPEIDAQLLTLEKRYPHIKAFIREVLAQDPRPAYRKEEQAGKTYAVWLLDFNVRWRV
FT                   TASGFEVFALEAR"
FT   gene            complement(245325..245732)
FT                   /gene="rcsF"
FT                   /locus_tag="KPN_00210"
FT   CDS_pept        complement(245325..245732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rcsF"
FT                   /locus_tag="KPN_00210"
FT                   /product="regulator in colanic acid synthesis; interacts
FT                   with RcsB"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00210"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75670"
FT                   /db_xref="GOA:A6T4Z9"
FT                   /db_xref="InterPro:IPR030852"
FT                   /db_xref="UniProtKB/TrEMBL:A6T4Z9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75670.1"
FT                   /translation="MRALPICLLALMLSGCSMLSRSPVEPAQSTATPPVKSEPSKPRAT
FT                   RPAPVRIYTDASELVGKPFRDLGEVSGESCQASNQDSPPNIPTARKRLQINAARMKANA
FT                   VLLHRCEVTSGTPGCYRQAVCLGSALNVSAQ"
FT   gene            complement(245840..246655)
FT                   /gene="metQ"
FT                   /locus_tag="KPN_00211"
FT   CDS_pept        complement(245840..246655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metQ"
FT                   /locus_tag="KPN_00211"
FT                   /product="D-methionine transport protein (ABC superfamily,
FT                   peri_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00211"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75671"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:A6T500"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004872"
FT                   /protein_id="ABR75671.1"
FT                   /translation="MAFNFKTFAAVGALIGSLALVGCGQDEKDPNHIKVGVIVGAEQQV
FT                   AEVAQKVAKEKYGLDVELVTFNDYVLPNEALSKGDIDVNAFQHKPYLDQQIKDRGYKLV
FT                   AVGNTFVYPIAGYSKKIKSLDELQPGSQIAVPNDPTNLGRSLLLLQQVGLIKLKDGVGL
FT                   LPTSLDIVENPKNLKIVELEAPQLPRSLDDAQIALAVINTTYASQIGLTPAKDGIFVEG
FT                   KESPYVNLIVAREDNKDAENVKKFVQAYQSDEVYEAANKIFNGGAVKGW"
FT   gene            complement(246699..247352)
FT                   /gene="metI"
FT                   /locus_tag="KPN_00212"
FT   CDS_pept        complement(246699..247352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metI"
FT                   /locus_tag="KPN_00212"
FT                   /product="D-and L-methionine transport protein (ABC
FT                   superfamily, membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00212"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75672"
FT                   /db_xref="GOA:A6T501"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6T501"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000515"
FT                   /protein_id="ABR75672.1"
FT                   /translation="MSEAMMWLLLRGVWETLAMTFVSGFFGFVLGLPVGVLLYVTRPGQ
FT                   IVANAKLYRTLSALVNIFRSIPFIILLVWMIPFTRVIVGTSIGLQAAIVPLTVGAAPFI
FT                   ARMVENALLEIPTGLIEASRAMGATPLQIVRKVLLPEALPGLVNAATITLITLVGYSAM
FT                   GGAVGAGGLGQIGYQYGYIGYNATVMNTVLVLLVVLVYLIQFSGDRIVRAVTHK"
FT   gene            complement(247345..248376)
FT                   /gene="metN"
FT                   /locus_tag="KPN_00213"
FT   CDS_pept        complement(247345..248376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metN"
FT                   /locus_tag="KPN_00213"
FT                   /product="D-and L-methionine transport protein (ABC
FT                   superfamily, atp_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00213"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75673"
FT                   /db_xref="GOA:A6T502"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012692"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:A6T502"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003439"
FT                   /protein_id="ABR75673.1"
FT                   /translation="MIKLSNITKVFQQGNRSIQALNNVSLHVPAGQIYGVIGASGAGKS
FT                   TLIRCVNLLERPTEGSVQVDGQELTALSEKELTRARRQIGMIFQHFNLLASRTVFGNVA
FT                   LPLELDNTPQAEIKRRVTELLDLVGLGDKHDSYPANLSGGQKQRVAIARALASNPKVLL
FT                   CDEATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGQLIEQ
FT                   DTVSEVFSHPKTPLAQQFIQSTLHLDIPDDYQARLKPTATADSVPMLRMEFTGHSVDAP
FT                   LLSETARRFNVNNNIISAQMDYAGGVKFGIMLTEMHGTQEDTQAAIAWLQEHHVKVEVL
FT                   GYV"
FT   gene            248514..249131
FT                   /gene="gmhB"
FT                   /locus_tag="KPN_00214"
FT   CDS_pept        248514..249131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmhB"
FT                   /locus_tag="KPN_00214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00214"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75674"
FT                   /db_xref="GOA:A6T503"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A6T503"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75674.1"
FT                   /translation="MRKHAILAALVFFRSKPVAKSVPAIFLDRDGTINVDHGYVHEIDN
FT                   FEFIDGVIDAMRELKEMGYALVLVTNQSGIARGKFTEAQFETLTEWMDWSLADRGVDLD
FT                   GIYYCPHHPQGAVEEYRQTCDCRKPHPGMLISARDYLHIDMAASYMVGDKLEDMQAAAA
FT                   ADVGTKVLVRTGKPLTEEAEKAANWVLNSLAELPAAIKKQQK"
FT   gene            249501..251044
FT                   /gene="rrsH"
FT                   /locus_tag="KPN_00215"
FT   rRNA            249501..251044
FT                   /gene="rrsH"
FT                   /locus_tag="KPN_00215"
FT                   /product="16S ribosomal RNA (rrsH)"
FT   gene            251109..251185
FT                   /locus_tag="KPN_00216"
FT                   /note="tRNA-Ile"
FT   tRNA            251109..251185
FT                   /locus_tag="KPN_00216"
FT                   /product="tRNA-Ile"
FT   gene            251222..251297
FT                   /locus_tag="KPN_00217"
FT                   /note="tRNA-Ala"
FT   tRNA            251222..251297
FT                   /locus_tag="KPN_00217"
FT                   /product="tRNA-Ala"
FT   gene            251475..254378
FT                   /gene="rrlH"
FT                   /locus_tag="KPN_00218"
FT   rRNA            251475..254378
FT                   /gene="rrlH"
FT                   /locus_tag="KPN_00218"
FT                   /product="23S ribosomal RNA (rrlH)"
FT   gene            254476..254598
FT                   /gene="rrfH"
FT                   /locus_tag="KPN_00219"
FT   rRNA            254476..254598
FT                   /gene="rrfH"
FT                   /locus_tag="KPN_00219"
FT                   /product="5S ribosomal RNA (rrfH)"
FT   gene            254651..254727
FT                   /locus_tag="KPN_00220"
FT   tRNA            254651..254727
FT                   /locus_tag="KPN_00220"
FT                   /product="tRNA-Asp"
FT   gene            254892..255695
FT                   /gene="dkgB"
FT                   /locus_tag="KPN_00221"
FT   CDS_pept        254892..255695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dkgB"
FT                   /locus_tag="KPN_00221"
FT                   /product="2,5-diketo-D-gluconate reductase B"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00221"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75675"
FT                   /db_xref="GOA:A6T504"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A6T504"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001395"
FT                   /protein_id="ABR75675.1"
FT                   /translation="MAIPAFGLGTFRLKDDVVIASVKTALELGYRAIDTAQIYDNEAAV
FT                   GQAIAESGVPRDELFITTKIWIENLSKDKLIASLQESLQKLRTDYVDLTLIHWPSPNDA
FT                   VAVEEFMAALMEAKKLGLTRQIGISNFTIPLMERAIAAVGAENIATNQIELSPYLQNRK
FT                   VVDWAREHGIHITSYMTLAYGKALKDEVIARIAAKHNATPAQVILAWAMGEGYAVIPSS
FT                   TKRDNLASNLKALDLQLDDEDRQAIAALDCNDRLVSPEGLAPQWD"
FT   gene            complement(255741..256646)
FT                   /gene="yafC"
FT                   /locus_tag="KPN_00222"
FT   CDS_pept        complement(255741..256646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafC"
FT                   /locus_tag="KPN_00222"
FT                   /product="putative transcriptional regulator (LysR family)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00222"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75676"
FT                   /db_xref="GOA:A6T505"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6T505"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000847"
FT                   /inference="protein motif:Pfam:IPR005119"
FT                   /protein_id="ABR75676.1"
FT                   /translation="MRATSEEIAIFVAVVESGSFSRAAEQLGQANSAVSRAVKKLESKL
FT                   GVSLLNRTTRQLSLTEEGERYFRRMQVVLQEMAAAENDLLETRTTPRGLLRVDAATPVM
FT                   LHFLMPLVKPFRERYPEMTLSLVSSETFINLIERKVDVAIRAGTLTDSSLRARPLFTSY
FT                   RKIVASPDYVARYGMPQHPSDLKQHHCLGFTEPVSLNTWPVSCCDGQLLEIEAAVSSNS
FT                   GETLKQLCLTGNGIACLSDYMVDKEIASGEFVELLADKRLPVEMPFSAVYYSDRAVSTR
FT                   IRAFIDFLSDHVKQLPKELS"
FT   gene            256751..257941
FT                   /locus_tag="KPN_00223"
FT   CDS_pept        256751..257941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00223"
FT                   /product="putative drug efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00223"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75677"
FT                   /db_xref="GOA:A6T506"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A6T506"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR005828"
FT                   /protein_id="ABR75677.1"
FT                   /translation="MPLALFALTIGAFAIGTTEFVIVGLVPTIAQQLSISLPSAGLLVS
FT                   IYALGVAIGAPVLTALTGRMPRKQLLLALMVLFTAGNILAWQAPGYETLILARLLTGLA
FT                   HGVFFSIGSTIATSLVAKEKAASATAIMFGGLTVALVTGVPFGTFIGQHFGWRETFLAV
FT                   SILGVIALISSLILVPNNIPGRASASLRDQLKVLTHPRLLMIYAITALGYGGVFTAFTF
FT                   LAPMMQELAGFSPSAVSWLLLGYGVSVAIGNVWGGKLADKHGAVSALKFIFAALVVLLL
FT                   VFQLTASVHYAALATVLVMGVFAFGNVPGLQVYVVQKAEQYTPGAVDIASGLNIAAFNV
FT                   GIALGSIVGGQTVERYGLAQTPWIGAMIVLVALLLVVLSGRLDKLPRRSAALSPEG"
FT   gene            258065..258841
FT                   /gene="yafD"
FT                   /locus_tag="KPN_00224"
FT   CDS_pept        258065..258841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafD"
FT                   /locus_tag="KPN_00224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00224"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75678"
FT                   /db_xref="GOA:A6T507"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR022958"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A6T507"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR005135"
FT                   /protein_id="ABR75678.1"
FT                   /translation="MRYVAGQPAERILPPGAFAGVSPVYPAGTPLSSDEKIRVLVWNIF
FT                   KQQRAEWQSVLKNFGKDAHLVLLQEAQTTPELVRFATSNYLAADQVPALVLPQHPSGVM
FT                   TLASAHPIYCCPLREREPILRLPKSALVTVYPLPDARLLMVVNIHAVNFSLGVDVYSKQ
FT                   LLPIGDQIAHHSGPVIMAGDFNAWSRPRMNALYRFAREMSLREVRFSDDQRRRAFGRPL
FT                   DFVFYRGLSVHDASVLVTRASDHNPLLVEFSPGKPD"
FT   gene            258933..259703
FT                   /gene="yafE"
FT                   /locus_tag="KPN_00225"
FT   CDS_pept        258933..259703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafE"
FT                   /locus_tag="KPN_00225"
FT                   /product="putative biotin synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00225"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75679"
FT                   /db_xref="GOA:A6T508"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A6T508"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004033"
FT                   /protein_id="ABR75679.1"
FT                   /translation="MTTRSHHDNVEKQFGSQASAYLTSAVHASGRDLQRLAERLADFPQ
FT                   AKVLDMGCGAGHASFTAAGQVAEVTAYDLSSQMLEVVAAAAKEKGFSNIVTQQGYAETL
FT                   PFADVSFDVVISRYSAHHWHDVGQALREVKRVLKPGGVIIMMDVMSPGHPVRDVWLQTV
FT                   EALRDTSHVRNYSSGEWLTLATEAGLVVNQLLTDRLPLEFSSWVARMRTPEPLVEAIRL
FT                   YQQSASAEVKAYFELQEDGSFTSDTILFEAHKAV"
FT   gene            complement(259761..261128)
FT                   /gene="mltD"
FT                   /locus_tag="KPN_00226"
FT   CDS_pept        complement(259761..261128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mltD"
FT                   /locus_tag="KPN_00226"
FT                   /product="lytic murein transglycosylase C, membrane-bound"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00226"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75680"
FT                   /db_xref="GOA:A6T509"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A6T509"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002482"
FT                   /inference="protein motif:Pfam:IPR008258"
FT                   /inference="protein motif:Pfam:IPR010511"
FT                   /protein_id="ABR75680.1"
FT                   /translation="MKARAILLASVLLVGCQASKHDGTVEQRAQSLSAAGQGEAGKFTS
FT                   QARWLDDGTFYAQDQDLWTSIGDELKMGIPDNPRIREQKQKYLRNKSYLHDVTLRAEPY
FT                   MYWIAGQVKKRNMPMELVLLPIVESAFDPHATSGANAAGIWQIIPSTGRNYGLKQTRSY
FT                   DARRDVVASTTAALDMMQRLNKMFDGDWLLTVAAYNSGEGRVMKAVKANRSRGKPTDFW
FT                   SLSLPHETKIYVPKMLALSDILKNSKRYGVKLPTADESRALARVRLDSPVDISQLADMA
FT                   GMPVSKLKTFNAGVKGSTLGASGPKYVMVPQKHAAQLRESLASGDIAAVQPTQLADNTP
FT                   LTSRSYKVRSGDTISGIASRLGVTTRDLQQWNNLRGSGLKVGQNLVIGAGSSAQRLANN
FT                   SDSITYRVRKGDSLSSIAKRHGVNIRDVMRWNSDTDNLRPGDQLTLFVKNNDRPES"
FT   gene            complement(261200..261955)
FT                   /gene="gloB"
FT                   /locus_tag="KPN_00227"
FT   CDS_pept        complement(261200..261955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gloB"
FT                   /locus_tag="KPN_00227"
FT                   /product="probable hydroxyacylglutathione hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00227"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75681"
FT                   /db_xref="GOA:A6T510"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T510"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001279"
FT                   /protein_id="ABR75681.1"
FT                   /translation="MNLISIPAFQDNYIWVLSENNGRCIIVDPGEAAPVLAAIEENQWQ
FT                   PEAILLTHHHQDHVGGVKQLREKFPSIVVYGPAETQDKGVTQVVGDGDRLSILGHDFSI
FT                   FSTPGHTLGHICYYSEPYLFCGDTMFSGGCGRLFEGTAEQMYQSFMKINALPEETLICC
FT                   AHEYTLANMKFALSILPDDRDINDYYHKVNELRAKKQKTLPVTLKNERRINLFLRVNDI
FT                   DLIDKINKETNLQHSVARFAWLRSKKDDF"
FT   gene            262042..262710
FT                   /gene="yafS"
FT                   /locus_tag="KPN_00228"
FT   CDS_pept        262042..262710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafS"
FT                   /locus_tag="KPN_00228"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00228"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75682"
FT                   /db_xref="GOA:A6T511"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A6T511"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75682.1"
FT                   /translation="MPWGEYYRETLEQQMKPWLAKLYGFHLLKIGNLSAEINTEACAIS
FT                   HQVNVSLAGNPMQVRADPLHLPFAEKSVDACLLAHTLPWCSDPHRLLREADRVLIDDGW
FT                   MILTGFNPVSLMGLRKLVPVLRKGTPYNSRMFTLMRQLDWLALLNFEVLHYGRYQVLPW
FT                   SRHGGKLLSTHLPALGCLQLIVARKRTIPLTLNPMKSGKAKTQLRPAVGATRQWRKGQN
FT                   "
FT   gene            complement(262707..263174)
FT                   /gene="rnhA"
FT                   /locus_tag="KPN_00229"
FT   CDS_pept        complement(262707..263174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="KPN_00229"
FT                   /product="ribonuclease H"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00229"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75683"
FT                   /db_xref="GOA:A6T512"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T512"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002156"
FT                   /protein_id="ABR75683.1"
FT                   /translation="MLKQVEIFTDGSCLGNPGPGGYGAIMRYRQHEKTFSAGYRLTTNN
FT                   RMELMAAIVALEALKEHCEVVLSTDSQYVRQGITQWIHNWKKRGWKTAEKKPVKNVDLW
FT                   QRLDAALGQHKIKWEWVKGHAGHPENERCDELARAAASHPTLDDVGYLPES"
FT   gene            263239..263970
FT                   /gene="dnaQ"
FT                   /locus_tag="KPN_00230"
FT   CDS_pept        263239..263970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="KPN_00230"
FT                   /product="DNA polymerase III subunit epsilon"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00230"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75684"
FT                   /db_xref="GOA:A6T513"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A6T513"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR006055"
FT                   /protein_id="ABR75684.1"
FT                   /translation="MSTAITRQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVINRRLTG
FT                   NNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPTFADVADEFMDYIRGAELVIHNASFDI
FT                   GFMDYEFSKLNRGIGKTETFCKITDSLALARKMFPGKRNSLDALCSRYEIDNSKRTLHG
FT                   ALLDAQILADVYLMMTGGQTSMAFSMEGESQQQAGEMGIQRVVRAGSQLRVVYASDEEL
FT                   ANHESRLDLVQKKGGSCLWRA"
FT   gene            264104..264180
FT                   /locus_tag="KPN_00231"
FT                   /note="tRNA-Asp"
FT   tRNA            264104..264180
FT                   /locus_tag="KPN_00231"
FT                   /product="tRNA-Asp"
FT   gene            complement(264240..265121)
FT                   /locus_tag="KPN_00232"
FT   CDS_pept        complement(264240..265121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00232"
FT                   /product="putative transcriptional regulator (LysR family)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00232"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75685"
FT                   /db_xref="GOA:A6T514"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6T514"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000847"
FT                   /inference="protein motif:Pfam:IPR005119"
FT                   /protein_id="ABR75685.1"
FT                   /translation="MDLRRFITFKTVVEEGSFLRAAQKLCCTQSTVTFHIQQLEQELAI
FT                   PLFEKIGRRMCLTAAGKKVLPHVYDLTKVMASIRQAARQDDEPGGELRVATGETLLAYK
FT                   MPRVLQRFKQRAPKVRLSLQSLNCYSIRDALLADEVDLGVFYRVGNDDALTIMELGQQS
FT                   LALVASVEQAPVDFMRPRQHIPLSFIINEPQCVFRQIFESTLRQREITLENTIELWSIE
FT                   SIKQCVAGNLGVSFLPRFAVEDELKRGTLVELPFSETPLTIHALCAHHAGKAISPAMRV
FT                   FMQCMQEEQEAR"
FT   gene            265225..265815
FT                   /locus_tag="KPN_00233"
FT   CDS_pept        265225..265815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00233"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00233"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75686"
FT                   /db_xref="GOA:A6T515"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T515"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001123"
FT                   /protein_id="ABR75686.1"
FT                   /translation="MTPTLISAFLTYTLITALTPGPNNILALSSVTSHGLRRSLRVLAG
FT                   MSVGFIITMLICAALTFSLVELDSRFTLVLGWIGAAYILWLAWQIAKSKPATGTPSVEP
FT                   VGFWASLGLQFVNVKIILYGITALSTFVLPVTREPVWLISVSLLLAAIGALGNLCWALA
FT                   GHLFQRLFLLYGRQLNWMLAALLVYCAVRIVVE"
FT   gene            complement(265846..266631)
FT                   /gene="yafV"
FT                   /locus_tag="KPN_00234"
FT   CDS_pept        complement(265846..266631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafV"
FT                   /locus_tag="KPN_00234"
FT                   /product="putative amidase-type enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00234"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75687"
FT                   /db_xref="GOA:A6T516"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A6T516"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003010"
FT                   /protein_id="ABR75687.1"
FT                   /translation="MELTIVPGLKISLLQQPLVWMDGPANLRHFDRQLEGITGRDVIVL
FT                   PEMFTTGFAMEAAKQSLPEADVVEWMHARAAQSQALIAGSAALQTEHGAVNRFLLVEPD
FT                   GTVHHYDKRHLFRMADEHHHYEAGNQRVVFEWRGWRILPLVCYDLRFPVWSRNQNDYDL
FT                   ALYVANWPAPRSLHWQSLLIARAIENQAYVAGCNRVGTDGNGHHYRGDSRIINPQGEII
FT                   VTADPHQATRLDAELSLSALQEYREKFPAWRDADPFTIG"
FT   gene            complement(266795..269239)
FT                   /gene="fadE"
FT                   /locus_tag="KPN_00235"
FT   CDS_pept        complement(266795..269239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadE"
FT                   /locus_tag="KPN_00235"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00235"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75688"
FT                   /db_xref="GOA:A6T517"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR015396"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A6T517"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR006090"
FT                   /inference="protein motif:Pfam:IPR006092"
FT                   /protein_id="ABR75688.1"
FT                   /translation="MMILSIVATVVLLGALFYHRVSLLLSSVILLAWTAALGAAGVWNI
FT                   WLLLPLAIILLPFNFAPMRKSMISAPAFRTFRKVMPPMSRTEKEAIDAGTTWWEGDLFR
FT                   GNPDWQKLHNYPQPRLTAEEQAFLDGPVEEACRMANDFAITHEMADLPPELWAYLKEHR
FT                   FFAMIIKKEYGGLEFSAYAQARVLQKLSGVSGILAITVGVPNSLGPGELLQHYGTEEQK
FT                   NHYLPRLARGLEIPCFALTSPEAGSDAGAIPDTGVVCMGDWQGQQVLGMRLTWNKRYIT
FT                   LAPIATVLGLAFKLSDPDRLLGGEEELGITCALIPTSTPGVEIGRRHFPLNVPFQNGPT
FT                   RGKDIFVPIDYIIGGPSMAGQGWRMLVECLSVGRGITLPSNATGGLKSVAMATGAYAHI
FT                   RRQFKISIGKMEGIEEALARIAGNAYVMDAAASLITYGIMLGEKPAVLSAIVKYHCTHR
FT                   GQRSIIDAMDITGGKGIMLGEGNFLARAYQGAPIAITVEGANILTRSMMIFGQGAIRCH
FT                   PYVLEEMAAAQNNDLNAYDKLLFKHIGHVGSNKVRSFWLGLTGGRTSSAPTRDATRRYY
FT                   QQMNRLSANLALLSDVSMAVLGGSLKRRERISARLGDVLSQLYLASAVLKRYDDEGRNE
FT                   ADLPLVHWGVQDALHQAEQAIDDLLDNFPNRLVAGVMRLVIFPTGRHHHAPSDRLDHQV
FT                   AKILQVPSATRSRIGRGQYLTPSEHNPVGLLEEALLEVMAADPIHQRICKELGKNLPFT
FT                   RLDELAHNALAKGLISQDEAAILTRAEHSRLRSINVDDFAPEELATKPVKLPEKVRKVE
FT                   AA"
FT   gene            269479..270060
FT                   /gene="lpcA"
FT                   /locus_tag="KPN_00236"
FT   CDS_pept        269479..270060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpcA"
FT                   /locus_tag="KPN_00236"
FT                   /product="phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00236"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75689"
FT                   /db_xref="GOA:A6T518"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T518"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001347"
FT                   /protein_id="ABR75689.1"
FT                   /translation="MYQDLIRNELNEAAETLANFLQDEANIHAIQRAAVLLADSFKAGG
FT                   KVLSCGNGGSHCDAMHFAEELTGRYRENRPGYPAIAISDVSHLSCVSNDFGYEYVFSRY
FT                   VESVGRAGDVLLGISTSGNSGNVIKAIEAARAQGMKVITLTGKDGGKMAGSADVEIRVP
FT                   HFGYADRIQEIHIKVIHILIMLIEKEMAKG"
FT   gene            270135..270902
FT                   /gene="yafJ"
FT                   /locus_tag="KPN_00237"
FT   CDS_pept        270135..270902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafJ"
FT                   /locus_tag="KPN_00237"
FT                   /product="putative amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00237"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75690"
FT                   /db_xref="GOA:A6T519"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A6T519"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000583"
FT                   /protein_id="ABR75690.1"
FT                   /translation="MCELLGMSANVPTDICFSFTGLVQRGGGTGPHKDGWGITFYEGKG
FT                   CRTFKDPQPSFQSPIAKLVQDYPIKSCSVVAHIRQANRGRVALENTHPFTRELWGRNWT
FT                   YAHNGQLKGYKSLKTGNFHPVGETDSEKAFCWLLHRLTERYPRTPGNMLGVFKYIATLA
FT                   GELREKGVFNMLLSDGRYVMAFCSTNLHWITRRAPFGVAKLLDQDVEIDFQRETTPNDV
FT                   VTVIATQPLTANETWHKIMPGEWALFCLGERVV"
FT   gene            complement(270873..271613)
FT                   /gene="yafK"
FT                   /locus_tag="KPN_00238"
FT   CDS_pept        complement(270873..271613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafK"
FT                   /locus_tag="KPN_00238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00238"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75691"
FT                   /db_xref="GOA:A6T520"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A6T520"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR010355"
FT                   /protein_id="ABR75691.1"
FT                   /translation="MRKIALFIAMLLLPCVSFAGLLSSNSPTTPVSKEYKQQLMGSPVY
FT                   IEIFKEERMLDLYVKMGETYQLLDSYRICNYSGGLGPKQRQGDFKSPEGFYNVTRSQLK
FT                   PDSRFYKAINIGFPNAYDRAHGYEGKYLMIHGDCVSVGCYAMTDSGIDEIFQFVTGALV
FT                   FGQPSVQVSIYPFRMTNANMERHKYSYYADFWKQLKPGYDYFQQTHKPPVVSVTDGRYV
FT                   VSKPLSHEVVQPQLASNYTLPETK"
FT   gene            272025..273368
FT                   /locus_tag="KPN_00239"
FT   CDS_pept        272025..273368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00239"
FT                   /product="NADH-ubiquinone oxidoreductase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00239"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75692"
FT                   /db_xref="GOA:A6T521"
FT                   /db_xref="InterPro:IPR008703"
FT                   /db_xref="InterPro:IPR022615"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T521"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR008703"
FT                   /protein_id="ABR75692.1"
FT                   /translation="MIKITKGLDLPIAGMPLQQISPAPAVKRVALLGEEYVGMRPAMAV
FT                   KEGDRVKKGQILFEDKKIPGVCFTAPASGIVSAIHRGERRVLQSVVIDIEGNDAVAFTR
FT                   YAADALAELPRDTVQQQLLASGQWTALRTRPFSKTPLPGSTPAAIFVNAMDTNPLAAEP
FT                   QPIILAERAAFDAGLTVLTRLTDGKVHVCQPSGGKLGGHPLGQVCFNQFSGPHPAGLPG
FT                   THIHFLEPVSLNKQVWHLNYQDAIAIGKLFLDGELYCERIIALGGPQVTSPRLVKTTLG
FT                   ASLEDLLAGELQEGENRVISGSVLSGARAHGPHAFLGRFHLQVSVVKEGREKELFGWVM
FT                   PGKEKFSITRTTLGHFFKRKRFHFSTDTNGGERAMVPIGNYERVMPLDILPTILLRDLL
FT                   AGDTDSAQALGCLELDEEDLALCTYVCPGKYEYGPALRSVLTRIEQEG"
FT   gene            273372..274610
FT                   /locus_tag="KPN_00240"
FT   CDS_pept        273372..274610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00240"
FT                   /product="Na(+)-translocating NADH-quinone reductase, chain
FT                   B"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00240"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75693"
FT                   /db_xref="GOA:A6T522"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="InterPro:IPR010966"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T522"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004338"
FT                   /protein_id="ABR75693.1"
FT                   /translation="MGLKHLIEKLEPHFTHGGKLEKYYPLYEAAATIFYTPGQVTRGAA
FT                   HVRDAIDLKRMMILVWFAVFPAMFWGMYNVGLQTIPALHKLYGAEQLQQAIANNWHYSV
FT                   AQWLGVSFSADAGWLSMMTLGAVFFLPIYITVFIVGGFWEVLFAIVRKHEINEGFFVTS
FT                   ILFALIVPPTLPLWQAALGISFGVVIAKEIFGGTGRNFLNPALAGRAFLFFAYPAQISG
FT                   DLVWTAADGFSGATPLSQWASGGGEALVNVATGVPVSWMDAFLGNIPGSIGEVSTLMIF
FT                   IGGAIILFGRVASWRIVAGVMIGMIATATLFNVIGSDTNPMFAMPWYWHLVLGGFAFGM
FT                   MFMATDPVSASFTDKGKWSYGVLIGVMCVLIRVVNPAYPEGMMLAILFANLFAPLFDYL
FT                   VVQANIKRRKSRG"
FT   gene            274603..275016
FT                   /locus_tag="KPN_00241"
FT   CDS_pept        274603..275016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00241"
FT                   /product="Na+-transporting NADH:ubiquinone oxidoreductase,
FT                   subunit NqrC"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00241"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75694"
FT                   /db_xref="GOA:A6T523"
FT                   /db_xref="InterPro:IPR010204"
FT                   /db_xref="UniProtKB/TrEMBL:A6T523"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75694.1"
FT                   /translation="MAEKKSNDSIGKTLLVVLVLCLVCSIVVAGSAVGLKSRQQAQRAL
FT                   DKQRNILAVSGLMHPGMDADAVADTFAARITPRLVNLATGELLEKDPGKFNQAQALKDP
FT                   QQSMALDASQDPAGIKRRSNLAEIYLVRDAAED"
FT   gene            275388..276026
FT                   /locus_tag="KPN_00242"
FT   CDS_pept        275388..276026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00242"
FT                   /product="Na(+)-translocating NADH-quinone reductase, chain
FT                   D"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00242"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75695"
FT                   /db_xref="GOA:A6T524"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR011292"
FT                   /db_xref="UniProtKB/TrEMBL:A6T524"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003667"
FT                   /protein_id="ABR75695.1"
FT                   /translation="MAEQSDMKEVKRVLVGPLIANNPIALQVLGVCSALAVTTKLETAF
FT                   VMTIAVTLVTAFSSMFISMIRHHIPNSVRIIVQMAIIASLVIVVDQLLRAFAYETSKQL
FT                   SVFVGLIITNCIVMGRAEAYAMKSPPLASFMDGIGNGLGYGAILIIVGFLRELIGSGKL
FT                   FGITVLETVQNGGWYQPNGLFLLAPSAFFIIGLLIWALRSWKPEQQEKE"
FT   gene            276033..276629
FT                   /locus_tag="KPN_00243"
FT   CDS_pept        276033..276629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00243"
FT                   /product="Na(+)-translocating NADH-quinone reductase
FT                   subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00243"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75696"
FT                   /db_xref="GOA:A6T525"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR010967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T525"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003667"
FT                   /protein_id="ABR75696.1"
FT                   /translation="MAHYISLFVRAVFVENMALAFFLGMCTFLAVSKKVSTASGLGVAV
FT                   TVVLGLAVPINNLVYNLVLRDGALVEGVDLSFLNFITFIGVIAALVQILEMILDKYFPA
FT                   LYNALGIFLPLIAVNCAIFGGVSFMVQRDYNFPESIVYGFGSGIGWMLAIVAMAGIREK
FT                   MKYANVPAGLRGLGITFITTGLMALGFMSFSGVQL"
FT   gene            276642..277865
FT                   /locus_tag="KPN_00244"
FT   CDS_pept        276642..277865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00244"
FT                   /product="Na-translocating NADH ubiquinone oxidoreductase,
FT                   beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00244"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75697"
FT                   /db_xref="GOA:A6T526"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR010205"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T526"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001041"
FT                   /inference="protein motif:Pfam:IPR001433"
FT                   /inference="protein motif:Pfam:IPR008333"
FT                   /protein_id="ABR75697.1"
FT                   /translation="MEIILGVVMFTLIVLVLSGLILAARSKLVNAGDVVIEINNEADKQ
FT                   IRTPAGDKLLNTLSSNGIFVSSACGGGGSCGQCRVTVKEGGGDILPTELSHITKRDAKA
FT                   GCRLACQVAVKQNMKIELPEEIFGVKKWECEVISNDNKATFIKELKLRIPEGEVVPFRA
FT                   GGYIQIECPPHKVAYADFDVPDEYRSDWDKFNLFRYVSEVKEPTLRAYSMANYPEEKGI
FT                   IMLNVRIATPPPKVPDAPPGIMSSYIWSLKPGDKVTISGPFGEFFAKETDAEMVFIGGG
FT                   AGMAPMRSHIFDQLKRLHSTRKISFWYGARSLREMFYDEEFEQLARDNPNFTFHVALSD
FT                   PLPEDNWTGHTGFIHNVLYENYLRDHPAPEDCEFYMCGPPVMNAAVIKMLKDLGVEDEN
FT                   ILLDDFGG"
FT   gene            277868..278083
FT                   /locus_tag="KPN_00245"
FT   CDS_pept        277868..278083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00245"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75698"
FT                   /db_xref="GOA:A6T527"
FT                   /db_xref="InterPro:IPR007495"
FT                   /db_xref="UniProtKB/TrEMBL:A6T527"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR007495"
FT                   /protein_id="ABR75698.1"
FT                   /translation="MLTVFIATFVIFALVILGMSLGYLVKRKSIQGSCGGISALGLEKV
FT                   CDCPEPCDARKKRLAREAQRQQQRIL"
FT   gene            complement(278306..279166)
FT                   /locus_tag="KPN_00246"
FT   CDS_pept        complement(278306..279166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00246"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75699"
FT                   /db_xref="GOA:A6T528"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A6T528"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004129"
FT                   /protein_id="ABR75699.1"
FT                   /translation="MKKILTALCLLATAGAWAAPQLIAHRGGTGDAPENTLPAIKLALE
FT                   NNAEAIWVTVQLSRDGVPVLYRSSDLSTLTNSEGKVSSLTAAELAKVDAGWKWGDDSHP
FT                   WRGKQATIPTLQSVLQQWPHTFFYIDIKSPDADPTVMGQRLLEVLKTTDSLDRVRVYST
FT                   EDRYIAALPPAIPRFVTRSETRTRLANISLSHQCQPASQRDGEQWYGLELKRKVEVVEK
FT                   FTLGEGISPATLTWDKEAMDCFRSQDKAHIIFFGINSAEDYRTAIELGADGVMVDSPAQ
FT                   AKSWQ"
FT   gene            279293..280381
FT                   /gene="dinB"
FT                   /locus_tag="KPN_00247"
FT   CDS_pept        279293..280381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinB"
FT                   /locus_tag="KPN_00247"
FT                   /product="DNA polymerase IV"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00247"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75700"
FT                   /db_xref="GOA:A6T529"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:A6T529"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001126"
FT                   /protein_id="ABR75700.1"
FT                   /translation="MLYGYTVLSLTMRKIIHVDMDCFFAAVEMRDNPALRDIPLAIGGS
FT                   RVQRGVISTANYPARKFGVRSAMPTATALKLCPHLTLLPGRFDAYKEASNHIREIFSRY
FT                   TSRIEPLSLDEAYLDVSDSEHCHGSATLIAQEIRQTIERELRLTASAGVAPVKFLAKIA
FT                   SDMNKPNGQFVIAPHQVAEFVRALPLAKIPGVGKVSAAKLENMGLRTCGDVQNSDLAML
FT                   LKRFGKFGRILWERSHGIDEREIHNDRQRKSVGVERTLAEDIHEWPECEAIIENLYPEL
FT                   ERRLAKVKPDLLIARQGIKLKFNDFQLTTQEHVWPRLNKEDLIATAHKAWDERRGGRGV
FT                   RLVGLHVTLLDPQLERQLLLGI"
FT   gene            280384..280836
FT                   /gene="yafP"
FT                   /locus_tag="KPN_00248"
FT   CDS_pept        280384..280836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafP"
FT                   /locus_tag="KPN_00248"
FT                   /product="putative acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00248"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75701"
FT                   /db_xref="GOA:A6T530"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A6T530"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000182"
FT                   /protein_id="ABR75701.1"
FT                   /translation="MHIRAYRDSDLPLLCQIFLRAVRETASRDYTPGQIAAWAQVDETR
FT                   WRQKLADSIGLVAVVNSQPVGFITAIGTHIDLLFVSPDRARQGIGGALIEALCVQYPAQ
FT                   ILTVDASITAKPCFTAHGFKVVAEQRVAARGEWFINYRMEKRVALR"
FT   gene            complement(280879..282228)
FT                   /gene="pepD"
FT                   /locus_tag="KPN_00249"
FT   CDS_pept        complement(280879..282228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepD"
FT                   /locus_tag="KPN_00249"
FT                   /product="aminoacyl-histidine dipeptidase (peptidase D)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00249"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75702"
FT                   /db_xref="GOA:A6T531"
FT                   /db_xref="InterPro:IPR001160"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:A6T531"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002933"
FT                   /protein_id="ABR75702.1"
FT                   /translation="MGWAKEKGLHAERDQVGNILIRKGATAGMENRKPVALQAHLDMVP
FT                   QKNNDTVHDFVKDPIQPYIDGEWVKARGTTLGADNGIGMASALAVLADDSVAHGPLEVL
FT                   LTMTEEAGMDGAFGLQANWLQADILINTDSEEEGEIYMGCAGGIDFTSNLALTREAIPA
FT                   GFQSFKVTLKGLKGGHSGGDIHLGLGNANKLLSRFLAGHADELDLRLVDFNGGTLRNAI
FT                   PREAYATVAVAADKADALKALVNTYQALLKNELEAKEKNLVVLLEAVDNDKAALTQASR
FT                   DTFIRLLNATPNGVIRNSDVAKGVVETSLNVGVVTMTDDNVQIHCLIRSLIDSGKDYVV
FT                   SMLDSLGKLAGAKTEAKGAYPGWQPDANSPVMHLVRETYQRLFNKTPNIQIIHAGLECG
FT                   LFKKPYPEMDMVSIGPTITGPHSPDEQVHIESVGQYWTLLTELLKAIPAK"
FT   gene            282594..283052
FT                   /gene="gpt"
FT                   /locus_tag="KPN_00250"
FT   CDS_pept        282594..283052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpt"
FT                   /locus_tag="KPN_00250"
FT                   /product="xanthine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00250"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75703"
FT                   /db_xref="GOA:A6T532"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023747"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T532"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000836"
FT                   /protein_id="ABR75703.1"
FT                   /translation="MSEKYVVTWDMLQIHARKLASRLLPVEQWKGIIAVSRGGLVPGAL
FT                   LARELGIRHVDTVCISSYDHDNQRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMY
FT                   PKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVFVPPIAGR"
FT   gene            283158..284402
FT                   /gene="yafA"
FT                   /locus_tag="KPN_00251"
FT   CDS_pept        283158..284402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafA"
FT                   /locus_tag="KPN_00251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00251"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75704"
FT                   /db_xref="InterPro:IPR010520"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T533"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR010520"
FT                   /protein_id="ABR75704.1"
FT                   /translation="MSQANLSETLFKPRFKHPETSTLVRRFSAGKPQAMQSALSGNHVD
FT                   HWYRLINRLMWIWRGVTPQEILDVQARIVMSEAERTDPELFDTVIGYRGGNWIFEWAKE
FT                   AMQWQQKAGQEADPLLSGRHWLHASNLYSIAAYPHIKGDELAEQAQALANRAYEEAAQR
FT                   LPGSLRELEFTIPGGSPITGFLHMPKGEGPFPTVLMCGGLDSLQTDYYNLYENYFSPLG
FT                   IAMLTIDMPSIGFSSKWTLNQDTSLLHQHALRHLENVPWIDHTRVAAFGFRFGANIAVR
FT                   LGYLEPQRLKAVACLGPVVHGLLVDPLHQGRVPEMYLDVLASRLGMHDASDEALRVELN
FT                   RYSLKTQGLLGRRCPTPMLSGFWKDDPFSPEEESRLITSSSADGKLLEIPFNPVYRNFD
FT                   HALRQIARWINHRFG"
FT   gene            284460..284858
FT                   /gene="crl"
FT                   /locus_tag="KPN_00252"
FT   CDS_pept        284460..284858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crl"
FT                   /locus_tag="KPN_00252"
FT                   /product="transcriptional regulator of cryptic csgA gene
FT                   for curli surface fibers"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00252"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75705"
FT                   /db_xref="GOA:A6T534"
FT                   /db_xref="InterPro:IPR009986"
FT                   /db_xref="InterPro:IPR038208"
FT                   /db_xref="UniProtKB/TrEMBL:A6T534"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR009986"
FT                   /protein_id="ABR75705.1"
FT                   /translation="MTLPSGHLKSKLIKKFTALGPYIREEQCHDNRFFFDCLAVCVNVK
FT                   PAPEKREFWGWWMEMEAQESRFTYSYQFGLFNKEGSWQAVDIDDPEVSDRLEKTLREFH
FT                   ERAAALLTTFNLKLEPADDFSEPVRLRA"
FT   gene            complement(284944..285636)
FT                   /gene="ygaE"
FT                   /locus_tag="KPN_00253"
FT   CDS_pept        complement(284944..285636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygaE"
FT                   /locus_tag="KPN_00253"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00253"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75706"
FT                   /db_xref="GOA:A6T535"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6T535"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000524"
FT                   /protein_id="ABR75706.1"
FT                   /translation="MTAIPQATAIDGYRWLKNDIIRGVYHPDEKLRMSLLTSRYGLGVG
FT                   PLREALSQLVAERLVTVVNQKGYRVAPMSEQELLDIFDARANMEAMLVRLAIERGGDEW
FT                   EAELLARAHLLNKLESCEASEHLLDEWDQRHQAFHTAIVAGCGSQYLLQMRERLFDLAA
FT                   RYRFIWLRTTVLSVEMLEDKHVQHQTLVDAILARDAEQASALMREHLLTPIPIIQQAMA
FT                   GKLSPQAG"
FT   gene            complement(285682..287085)
FT                   /gene="gabP"
FT                   /locus_tag="KPN_00254"
FT   CDS_pept        complement(285682..287085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabP"
FT                   /locus_tag="KPN_00254"
FT                   /product="gamma-aminobutyrate transport protein,
FT                   RpoS-dependent (APC family)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00254"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75707"
FT                   /db_xref="GOA:A6T536"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="InterPro:IPR011265"
FT                   /db_xref="UniProtKB/TrEMBL:A6T536"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004841"
FT                   /protein_id="ABR75707.1"
FT                   /translation="MMGQLSQSQDLGAGLKSRHVTMLSIAGVIGASLFVGSSVAIAEAG
FT                   PAVLLAYLFAGLLVVMIMRMLAEMAVATPDTGSFSTYADKAIGRWAGYTIGWLYWWFWV
FT                   LVIPLEANIAAIILHSWVPGVPVWLFSLVITLALTGSNLLSVKNYGEFEFWLALCKVIA
FT                   ILAFIVLGAVAITGFYPYAEVSGISRLWDHGGFMPNGFGAVLSAMLITMFSFMGAEIVT
FT                   IAAAESDTPDKHIVRATNSVIWRISIFYLCSIFIVVALIPWNMPGLKSIGSYRSVLELL
FT                   HIPYAKLIMDGVILLSVTSCLNSALYTASRMLYSLSRRGDAPAIMGRTNRSKTPYVAVL
FT                   LSTGAAFLTVVVNYYAPAKVFKFLIDSSGAIALLVYLVIAVSQLRMRKILQAQGGEIRL
FT                   RMWLYPYLTWLVIAFITFVLVVMLFRPAQQLEVISTGLLALGIICTVPIMSRWKKLVLW
FT                   QKLPLQNTR"
FT   gene            complement(287232..288515)
FT                   /gene="gabT"
FT                   /locus_tag="KPN_00255"
FT   CDS_pept        complement(287232..288515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabT"
FT                   /locus_tag="KPN_00255"
FT                   /product="4-aminobutyrate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00255"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75708"
FT                   /db_xref="GOA:A6T537"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A6T537"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR005814"
FT                   /protein_id="ABR75708.1"
FT                   /translation="MNSNKAMMARRSDAVPRGVGQIHPIFAERAENCRVWDVEGREYLD
FT                   FAGGIAVLNTGHLHPQVVAAVEDQLKKLSHTCFQVLAYEPYLALCEKMNQKVPGDFAKK
FT                   TLLVTTGSEAVENAVKIARAATGRSGAIAFTGAYHGRTHYTLSLTGKVNPYSAGMGLMP
FT                   GHVYRALYPCALHGVSDDEAIASIHRIFKNDAAPEDIAAIIIEPVQGEGGFYAASPAFM
FT                   QRLRALCDEHGIMLIADEVQSGAGRTGTLFAMEQMGVAADITTFAKSIAGGFPLAGVTG
FT                   RAEVMDAIAPGGLGGTYAGNPIACAAALAVLQIFEQENLLEKANQLGDTLRQGLLAIAE
FT                   DHPEIGDVRGLGAMIAIELFEEGDHSRPNARLTADIVARARDKGLILLSCGPYYNVLRI
FT                   LVPLTIEEAQIEQGLKIIADCFSEAKQA"
FT   gene            complement(288528..289976)
FT                   /gene="gabD"
FT                   /locus_tag="KPN_00256"
FT   CDS_pept        complement(288528..289976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="KPN_00256"
FT                   /product="succinate-semialdehyde dehydrogenase I,
FT                   NADP-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00256"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75709"
FT                   /db_xref="GOA:A6T538"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A6T538"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002086"
FT                   /protein_id="ABR75709.1"
FT                   /translation="MQLNDMTLFRQQALIDGQWRDAPNGDVIAVTNPANGEQLGSVPKM
FT                   GADETREAIEAANRALPAWRALTAKERANILRRWFDLMMENQDDLARLMTLEQGKPLAE
FT                   AKGEISYAASFIEWFAEEGKRIYGDTIPGHQADKRLLVIKQPIGVTAAITPWNFPAAMI
FT                   TRKAGPALAAGCTMVLKPASQTPFSALALAELANRAGIPAGVFNVVTGSAGAVGGELTS
FT                   NPLVRKLSFTGSTEIGRQLMEQCAKDIKKVSLELGGNAPFIVFDDADLDKAVEGALASK
FT                   FRNAGQTCVCANRLYVQDGVYDRFAEKLQQAVEKLRIGDGLQDGVTTGPLIDEKAVAKV
FT                   EEHIADAIAKGAKVVTGGKPHALGGNFFQPTILVNVPDSAKVAKEETFGPLAPLFRFKD
FT                   EADVIAQANDTEFGLAAYFYARDLSRVFRVGEALEYGIIGINTGIISTEVAPFGGVKAS
FT                   GLGREGSKYGIEDYLEIKYMCIGL"
FT   gene            complement(290002..291270)
FT                   /gene="ygaF"
FT                   /locus_tag="KPN_00257"
FT   CDS_pept        complement(290002..291270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygaF"
FT                   /locus_tag="KPN_00257"
FT                   /product="putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00257"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75710"
FT                   /db_xref="GOA:A6T539"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR030862"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A6T539"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR006076"
FT                   /protein_id="ABR75710.1"
FT                   /translation="MYDFVIIGGGIIGMSTAMQLIEIYPDARIALLEKEAGPACHQTGH
FT                   NSGVIHAGVYYTPGSLKAQFCLAGNRATKAFCEQNGIRYDVCGKMLVATSPLEMERMRA
FT                   LWDRTAANGLQREWLSAGELREREPNITGLGGIFVPSSGIVSYREVAAAMAKNFEAKGG
FT                   TIVYNAEVSALKEHASGVVIRTRQGGEYEASTLIACSGLMADRLVKMLGVDPGFIICPF
FT                   RGEYFQLAPQHNQIVNHLIYPIPDPAMPFLGVHLTRMIDGSVTVGPNAVLALKREGYRK
FT                   RDISLADTLEILTSPGIRRVLQNNLRSGLGEMKNSLCRSGYLRLVQKYCPSLTLSDLRP
FT                   WPAGVRAQAVSPQGKLIDDFLFVTTARSIHTCNAPSPAATSAIPIGAHIVSKVQSLLAS
FT                   QSNPGRTLRAARSVETLHAAFTR"
FT   gene            complement(291298..292314)
FT                   /gene="csiD"
FT                   /locus_tag="KPN_00258"
FT   CDS_pept        complement(291298..292314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csiD"
FT                   /locus_tag="KPN_00258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00258"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75711"
FT                   /db_xref="GOA:A6T540"
FT                   /db_xref="InterPro:IPR015038"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:A6T540"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75711.1"
FT                   /translation="MNITLTLQRGTILMNALTAVKPTPAPVAQQYPGFSFTPSAQSPRL
FT                   LELTFSAETTTQFLQQVAQWPVQALEYKSFLRFQVGKILDDLCGNQLQPLLIKTLLDRA
FT                   EGALLINGEGIDHVSQAEEMVKLATAVAHLIGRSNFDAMSGQYYARFVVKNVDNSDSYL
FT                   RQPHRVMELHNDGTYVEEQTDYVLMMKIDEQNMQGGNSLLLHLDDWEHLDEFFRDPLAR
FT                   RPMRWAAPPSKNVSKDVFHPVFDVDSLGRPVMRYIDQFVQPKDFEEGTWLSRLSDALET
FT                   SKNILSIPVPVGKFLLINNLFWLHGRDRFTPHPDLRRELMRQRGYFAYSTNHYQTHQ"
FT   gene            292737..292994
FT                   /gene="xdhC"
FT                   /locus_tag="KPN_00259"
FT   CDS_pept        292737..292994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xdhC"
FT                   /locus_tag="KPN_00259"
FT                   /product="putative xanthine dehydrogenase, Fe-S subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00259"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75712"
FT                   /db_xref="InterPro:IPR018654"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T541"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75712.1"
FT                   /translation="MNLSRQEQRTLHVLAKGGRIAHVRDTSGRITAVECYTREGLLLSD
FT                   CTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRAQADNR"
FT   gene            293052..293801
FT                   /locus_tag="KPN_00260"
FT   CDS_pept        293052..293801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00260"
FT                   /product="KpLE2 phage-like element; putative
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00260"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75713"
FT                   /db_xref="GOA:A6T542"
FT                   /db_xref="InterPro:IPR017031"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A6T542"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75713.1"
FT                   /translation="MIDIPRIFTISESEHRIHNPFTPEKYATLGRALRMAPGTTILDLG
FT                   SGSGEMLCSWAHDHQIVGTGVDMSLLFSQQAAARAEELGVSDRVTFVHQDASGYVASQP
FT                   CDVAACVGATWIGGGVAGTIELLKQSLTPGGMLLIGEPWWRKRPATAEEAIACGAQSPD
FT                   DFLTLPALVAHFGELGYDVVEMVLADQEGWDRYEAAKWLTMRRWLEANPHDDFAPEVRQ
FT                   QLTTAPLHHVTWTREYLGWGVFVLMAR"
FT   gene            294073..294537
FT                   /locus_tag="KPN_00261"
FT   CDS_pept        294073..294537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00261"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75714"
FT                   /db_xref="GOA:A6T543"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:A6T543"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002711"
FT                   /protein_id="ABR75714.1"
FT                   /translation="METLVILAVVVWVLFKLVQKVTSKLYPPDSVKVQEKPDTTPATDA
FT                   WGNYPKAEGHVVLFEQYRREQALRQQAAKEADTFYRSREWRRLRYQAFQRYGNKCCVCG
FT                   RGANDGMVMHVDHIKPRSLYPHLALDIANLQIMCNECNVSKGNRDEVEWQ"
FT   gene            complement(294732..295466)
FT                   /gene="stbE"
FT                   /locus_tag="KPN_00262"
FT   CDS_pept        complement(294732..295466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stbE"
FT                   /locus_tag="KPN_00262"
FT                   /product="putative fimbriae; chaparone"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00262"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75715"
FT                   /db_xref="GOA:A6T544"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:A6T544"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001829"
FT                   /protein_id="ABR75715.1"
FT                   /translation="MRSYRQWLVFSKALLALLLLAGITPAPFAAVNVDRTRLVFAANDI
FT                   VQSLTLTNNSVTPMLLQVWTDAGETASSPDSSRTPLVVLPPVFKMQPDELRTLRVMLSS
FT                   RRSLPGDRESLFWLNIYQIPPEQNASDSVTRKLVLPLRLRLKVFIRPHGLKAPTSNDER
FT                   KLRFSIASQGITITNPTPWYMSLAVAPIKGISIGNIMLAPYEQRDVALSNMPAAGSTVD
FT                   YAVINDSGNWRTYTATIMDKEI"
FT   gene            complement(295432..296766)
FT                   /gene="stbD"
FT                   /locus_tag="KPN_00263"
FT   CDS_pept        complement(295432..296766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stbD"
FT                   /locus_tag="KPN_00263"
FT                   /product="putative fimbriae; usher"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00263"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75716"
FT                   /db_xref="GOA:A6T545"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR011228"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A6T545"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000259"
FT                   /protein_id="ABR75716.1"
FT                   /translation="MCHLRRTLLFAAGLLFSTAPWANCVKVTDNSFLSEAAIKAGYTAR
FT                   YWRGAYDDNIGHLGLPSVISVSANNKFQPSGTVLASAVANFLTAGVQTPYSAKQVLYRC
FT                   DLKDAGQLYELYSTNADNPFVGGRRAKEVEGAYYDAERNVAVRMTNLSTGEYYSRYWKQ
FT                   RQLTADSWFQDDRAIYIPAGAFSNVLYEMIKIAASDQYIYSDRINKDLYTQPRGYIAFK
FT                   GPGLITSAIQPGMDHASSYYGWPAYWPGAWSSYNQVTYIRGAACTIEDYPATVLLPTIS
FT                   AEALTSGESSEAPFSITLECEAGAMSSTHPTTQVANVAMGFLVNQPAAVAAARRLGLTT
FT                   TGGGLTWLLDTHYGEKGVASGVGIRIYDERGAPLNLLPDKTSTGTGNARGWYGYKELTV
FT                   QTGKKDRGSVEIWHGDFTASLEALGGQTVTVGSVNAQLQAVVSFQ"
FT   gene            complement(296771..299326)
FT                   /gene="stbC"
FT                   /locus_tag="KPN_00264"
FT   CDS_pept        complement(296771..299326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stbC"
FT                   /locus_tag="KPN_00264"
FT                   /product="putative fimbriae; usher"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00264"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75717"
FT                   /db_xref="GOA:A6T546"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:A6T546"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000015"
FT                   /protein_id="ABR75717.1"
FT                   /translation="MSLKVKFSRQNIFVILAVACVGQAFGEEYYFDPSLLQGTAYGQGM
FT                   ASVNGPDTPAGEYLVDVIVNGTLIKSGVKIRFSPVNGGQRTEPCLPLSLMQAAQVKSLP
FT                   DNALQNSCRPLRDWVSRGEWQFDSATLQFRLTLPMSELMHRPRGYIPPSQWDSGALALF
FT                   LRHNTNWTHTDNTSQHFRYHYLWSGINVGSNIGLWQLRHQGNLRYADSNQSGSAWHYNR
FT                   VRTWVQRPLTAIDSIMAFGDNYTDSSLFGSLSFNGIKLATDERMWPQGKRGYAPEVHGV
FT                   ASSSARVVIKQLGKVIYETHVPPGPFYIDDLYNTRYQGDLQVKVIEANGKVSRFTVPYS
FT                   AVPDSVRPGNWHYAFALGKVRQYYRIDNRFLEGTLQHGVNNHLTLNLGSRLAHDYQAWL
FT                   AGGVLATRLGAFGMNATWSGAQVEHNDRQQGWRAEFSYSKTFSTGTNLVLAAYRYSTGG
FT                   FRDLEDVFGVRQQEHNSIVYYSDTLHQRQRLSATVSQPLGRLGTLNLSASTADYYNNRS
FT                   RITQLQLGYSNQWRKVSYGFNLARQRSTWDDGRFYHSVNEPQDLNQRQKYTETTLSFTL
FT                   SIPFNWGDNPTSVAMNYNQSRANRSSTLSMNGTRGEQTELSWSVYGGYDRYRNGDEGTA
FT                   TTFGGNVQQNTRFGALRVGYDQGKDYRQVALGSSGTVVLHSGGVTFGPYASDTFALIHA
FT                   DGAQGAVVQNGQGAVIDRFGYAILPSLSPYRRNNVSLDTRQMRSDAELTGGSQQVVPYA
FT                   GAIARVNFSTITGKAVLIAVKMADGGIPPMGAEVMNSEGAVIGMVGQGGQVYARISTPS
FT                   GSLLVRWGKGANRRCRVPYQFDMHSPENVIYLTTTCERK"
FT   gene            complement(299310..300068)
FT                   /gene="stbB"
FT                   /locus_tag="KPN_00265"
FT   CDS_pept        complement(299310..300068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stbB"
FT                   /locus_tag="KPN_00265"
FT                   /product="putative fimbriae; chaparone"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00265"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75718"
FT                   /db_xref="GOA:A6T547"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:A6T547"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001829"
FT                   /protein_id="ABR75718.1"
FT                   /translation="MKKDAPRSGLRYLVLLIALFFPVTGAWASVTIVGSRIIYPSTVAS
FT                   VDVQLKNNDDFPYIVQTWFDNGDLHIGPENASGIPFISTPPVFRIQPKSGQIVRVVYSQ
FT                   RKALPHDRESVFWFNALQVPPANIGGRQQNKVLVMLRTRIKLFYRPEGIGSPGNLAKKL
FT                   HITVVRNARKGAGIVISNPQPWYASLSNLSVKVNGTSHELNVDMVPPFSSRTFWIPGNV
FT                   SANSLNGTVTVTVVNDQGARISERYHVAEG"
FT   gene            complement(300128..300664)
FT                   /gene="stbA"
FT                   /locus_tag="KPN_00266"
FT   CDS_pept        complement(300128..300664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stbA"
FT                   /locus_tag="KPN_00266"
FT                   /product="putative fimbriae; major subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00266"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75719"
FT                   /db_xref="GOA:A6T548"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A6T548"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000259"
FT                   /protein_id="ABR75719.1"
FT                   /translation="MFKKTTLALLTASLFISTSALAISNNTITFRGEVSDETCSVAING
FT                   NQAKPVVILPTVSAKELAKGGDVAGQVTFDIGLTGCTGNTDRATKISTVFVGNQVTSNG
FT                   NLGNTGDATNVEVQLLDTANKVINLTNGFKGEGDLQLKPGETEASATYTAQYYATGAAS
FT                   AGTVEATLQYAVSYL"
FT   gene            complement(300984..301142)
FT                   /locus_tag="KPN_00267"
FT   CDS_pept        complement(300984..301142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00267"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75720"
FT                   /db_xref="UniProtKB/TrEMBL:A6T549"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75720.1"
FT                   /translation="MENPFFNTLTLSPVILTQGEMISPTLTFAIFSQNTVTNISSATLI
FT                   AYSSPNQ"
FT   gene            302470..303981
FT                   /locus_tag="KPN_00268"
FT   CDS_pept        302470..303981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00268"
FT                   /product="putative Diguanylate cyclase/phosphodiesterase
FT                   domain 1"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00268"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75721"
FT                   /db_xref="GOA:A6T550"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A6T550"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001633"
FT                   /protein_id="ABR75721.1"
FT                   /translation="MMITLALLVSVLQFKQDVALSAKTLLRFSEDVSTASWRVTGQAVK
FT                   LADRPCAEILSELNRTRAFTPYIRDIGLLEKGNLLCSFVSREQAHPFPLPPGKTLPTPL
FT                   PARWVRSFSWMAGGPGRPAVVYTQQVAADKAAFVIVDSRYVQELMDVLSEEREAVFSLR
FT                   FGKGDAIISQPAQYDRIVMTQNYVTDDGKISLTVAAPLGTLTAVWMKSLLIFIPLSFCF
FT                   SFLTLVLYRHWSKMRMSMAREIIRGMKNAQFTVHYQPVFNVNRGNCGGVEALMRWPLPD
FT                   GRFITPDIFITAAENEGMIVPLSRHLFKLIAEDVERWQVAEGFYISVNISPEHLVHESF
FT                   IEDVELLQARLGNLRLMLELTERSLIVQPALVSDKLIRLREKGILIAIDDFGTGYCSLS
FT                   YLQQLPVDYLKIDRTFVDTIDTSGSDVPILDTIIMLSRKLGLNIVAEGVSSEHQLSYIL
FT                   DHNVGFIQGYLYAKPMCSSDFTRWLDTRANEQNDRIKCKKCSINQ"
FT   gene            305359..305979
FT                   /locus_tag="KPN_00269"
FT   CDS_pept        305359..305979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00269"
FT                   /product="putative outer membrane protein"
FT                   /note="ail and ompX"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00269"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75722"
FT                   /db_xref="GOA:A6T551"
FT                   /db_xref="InterPro:IPR000758"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:A6T551"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000758"
FT                   /protein_id="ABR75722.1"
FT                   /translation="MVILLPQSVFYGDCLLISIELFTSKELYMQRIFSPWIMAALLFSP
FT                   ALAVAMENHTLSVGYAQTHLSALKNSASKDLRGLALKYRYEFNSDWGVLTSLTATRHEV
FT                   QNYKWDAGKLHKDGDNTTSYSSLMIGPTYRFNDYISLYGNVGMAEMKIKNRDNHSSSEN
FT                   AFAYGAGVIFNPLTNLSLGLSWETAKLLFVDTNTFGVSVGYRF"
FT   gene            306218..306574
FT                   /locus_tag="KPN_00270"
FT   CDS_pept        306218..306574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00270"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75723"
FT                   /db_xref="InterPro:IPR025294"
FT                   /db_xref="UniProtKB/TrEMBL:A6T552"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75723.1"
FT                   /translation="MNKKMVFLAAFMLTACSANSLQHGAEGVRITHNEPDASCTYLGDV
FT                   TGSQGNFFTGGWTSNSNLETGARNDLKNKAWKMGGNVVVLLTQRAGQTGSVYHGTGSSQ
FT                   QTNVTLSGTVYRCR"
FT   gene            complement(306831..307304)
FT                   /locus_tag="KPN_00271"
FT   CDS_pept        complement(306831..307304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00271"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75724"
FT                   /db_xref="GOA:A6T553"
FT                   /db_xref="UniProtKB/TrEMBL:A6T553"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75724.1"
FT                   /translation="MNRIKFAFGFFISGALLGLFYNLLNDKIHHKEECTASLVVFKGNT
FT                   QTNLTLNFMYSLDESKGTVAVSGSYLDGGKLQGHIRRDVIYDMVKNHESHHFHSREINR
FT                   YGNIDSVSDTFLATILPDFYVYPDEKISYIISKQNEHSFLIKVGSRPLLYCAN"
FT   gene            complement(307297..308121)
FT                   /locus_tag="KPN_00272"
FT   CDS_pept        complement(307297..308121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00272"
FT                   /product="putative sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00272"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75725"
FT                   /db_xref="GOA:A6T554"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A6T554"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001867"
FT                   /protein_id="ABR75725.1"
FT                   /translation="MYWIINKNIEFWPENKRLISLKNPAQSVTLTAPASHCLVLLLEAT
FT                   PELVSQQVFFKKVWEDEGILVPANTLYQNISIVRRGLRDVGETDNSIVVTVPRKGFHIN
FT                   PNVNVERMDKKPLNSESYNDITIISQDDVAEKNPTTEPGDIVQTATRKNIGAKATTFLI
FT                   MLLSLLAGCLSFHYIWHFHDEKPFFSSYTLVENDRGCHFYTKDDNHAKVDKFNYYKSLI
FT                   FKSGLDCKKYPFVYFSMSQMSPGFIVFICRKSYSEKVSAGCVTLSFRGIVYE"
FT   gene            complement(308354..309334)
FT                   /locus_tag="KPN_00273"
FT   CDS_pept        complement(308354..309334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00273"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75726"
FT                   /db_xref="GOA:A6T555"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:A6T555"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002559"
FT                   /protein_id="ABR75726.1"
FT                   /translation="MSHQLTFADSEFSTKRRQTRKEIFLSRMEQILPWQNMVEVIEPFY
FT                   PKAGNGRRPYPLETMLRIHCMQHWYNLSDGAMEDALYEIASMRLFARLSLDSALPDRTT
FT                   IMNFRHLLEQHQLARQLFKTINRWLAEAGVMMTQGTLVDATIIEAPSSTKNKEQQRDPE
FT                   MHQTKKGNQWHFGMKAHIGVDAKSGLTHSLVTTAANEHDLNQLGNLLHGEEQFVSADAG
FT                   YQGAPQREELAEVDVDWLIAERPGKVKTLKQHPRKNKTAINIEYMKASIRARVEHPFRI
FT                   IKRQFGFVKARYKGLLKNDNQLAMLFTLANLFRVDQMIRQWERSQ"
FT   gene            309928..310323
FT                   /locus_tag="KPN_00274"
FT   CDS_pept        309928..310323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00274"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00274"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75727"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A6T556"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004360"
FT                   /protein_id="ABR75727.1"
FT                   /translation="MFSYIMLGTNDPQASYKFYAPLMRVLGHPLDGRSEKGAAWGTFKD
FT                   NHTTGLCVGMPFDNLPATRGNGVMVALNAVSVDMVQELYRLAIENGGEDEGPPDYRPHY
FT                   GADFYSAYVRDPDKNKIAFVFYDASKR"
FT   gene            311624..312142
FT                   /locus_tag="KPN_00275"
FT   CDS_pept        311624..312142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00275"
FT                   /product="fimbrial subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00275"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75728"
FT                   /db_xref="GOA:A6T557"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A6T557"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000259"
FT                   /protein_id="ABR75728.1"
FT                   /translation="MKKLSAAAFAFGLLSVSVSQALAADATVNFSGTILQEACSVDTSD
FT                   NTVNVQLGTYGAAQFPTVGTTTLPVPFAINLTGCPASGGPTAALVTFSGAADAAGDLAL
FT                   TAGGASGVSINIKKADGTNIDINSTDSGIALTSATTQQLRFTANYISTAASVTAGAANA
FT                   VAQVNISYM"
FT   gene            312191..312889
FT                   /locus_tag="KPN_00276"
FT   CDS_pept        312191..312889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00276"
FT                   /product="putative fimbrial chaparone"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00276"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75729"
FT                   /db_xref="GOA:A6T558"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:A6T558"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001829"
FT                   /protein_id="ABR75729.1"
FT                   /translation="MKALLVLSLMTSCLIFSINSHATVSVGGTRLVFHGDEKEASITVS
FT                   NTDKGIPVLIQSWVDEGENSKAKAPFMITPPLFRLEPGQDNTLRAVFTGANLAQDRESL
FT                   FWLNIKTIPSVKKNEVQANTLQLAIKKRLKFIYRPSAVKGLPEENADKLVWKKIGNQIQ
FT                   VTNPTPFYMNFSVITVGGKTFKPTLPEQTYVAPATERLFTIPAGAVGNTISWKIINDYG
FT                   TSGKEFHSKY"
FT   gene            312969..315452
FT                   /locus_tag="KPN_00277"
FT   CDS_pept        312969..315452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00277"
FT                   /product="putative fimbrial usher"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00277"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75730"
FT                   /db_xref="GOA:A6T559"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:A6T559"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000015"
FT                   /protein_id="ABR75730.1"
FT                   /translation="MMSALFNAPAISFADEFFNPALLEVREGEGAPTTDLSVFEVVNGQ
FT                   PAGNYRVDIYVNNEMVTADARDVMFSKNQDGKLEPCVTLAELSQWGVDTASFPELAVSD
FT                   SECANLAGIPDAFADFQFNRQKLNLSIPHAAMNTRSLDEVPIERWDEGIPALLLNYNMN
FT                   SYQSRYKGAETYESTYLNLRPGLNIGPWRLRNYTTFEHSNQSGSKWDNVYSYLQRNIVS
FT                   LRSQLTLGDSSAPADVFDSVPFRGFQMASDDDMLPSSVRNYAPVIRGVARSNALVTIRQ
FT                   NGYVVYETKVAPGAFEISDLASTGGAGDLDVTIKEADGSEQHLRIPYASLPVLQREGKF
FT                   RYSVTGGQFRAYDSHTEKNLFVQGTGIYGLPWGFTLYGGVQNAGNKYQSYALGVGKNIG
FT                   SWGAFSADAIHSRSMSTDAGRQQGQSLRVRYSKNFLQTGTNFTIAGYRYSTSGFRSLEE
FT                   TLGTYRSDNNIPSYITDRRRNRAELSLNQDLGDNFGALNASLISEDYWQNERNSLSANL
FT                   GYYKNFNAIGISLNYSWNRNTGLYGHAEQDNVVSFEINVPLDKFLNRTYASYGTTHASG
FT                   NGTSHNLRLNGSAFDDASLDWGINATLAGRSEQQVVGGNVSWKASHGTLNGSYSRSRDS
FT                   QQLGYGIAGGVVIHENGITLSQSLGETIGLVKAPGAEGIGVNNYAGISTDSRGYAVVPY
FT                   LTPYRRNDISLNSKTLRDDTDITYMTNKVVPTRGAIVRAEYKTAIGHRVLMTLTRPGGK
FT                   PVPFGAMASLLKSEENASIVGDGGEVLLSGLPQKGTLQVKWGNGQGQETTCRADYIAHK
FT                   SAGASGLWNATSVCQ"
FT   gene            315503..316657
FT                   /locus_tag="KPN_00278"
FT   CDS_pept        315503..316657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00278"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75731"
FT                   /db_xref="UniProtKB/TrEMBL:A6T560"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75731.1"
FT                   /translation="MKWFVFMFAAIAATLMVTPEANSGSFDPVTGAYTTDPITVTLTPK
FT                   TVAVSTSVIANGERVYWATDKYPQGAGTFYWGSHTYTLESASDVTLAIPGINASGVCTA
FT                   TGSGTSLTINGCFSFSHNGTIYMGKSASCKSFFSLQSNLSSLTNFGDFVALTLGPGTNT
FT                   IQLNKTGITDVNTTSFTYPSTTRSTSYRWTTYDINLQATLSAKTPPYTYLYCSVSQGLR
FT                   VIMTTGGVVPNPFAMVPAASKPAYSPTISYSPALPIINTIAVNIRNITAIDILPRTVFN
FT                   TGTISAWRTTYMEQPLTVTGQGNITRDFGASQNFNVLESWTCATTGQIDFRIMRDNTNA
FT                   NVCSGATYTHPVQTPQSLTAQWKAQSSTASGAWSARATVTFTLP"
FT   gene            complement(317131..317206)
FT                   /locus_tag="KPN_00279"
FT                   /note="tRNA-Thr"
FT   tRNA            complement(317131..317206)
FT                   /locus_tag="KPN_00279"
FT                   /product="tRNA-Thr"
FT   gene            complement(317320..318573)
FT                   /gene="proA"
FT                   /locus_tag="KPN_00280"
FT   CDS_pept        complement(317320..318573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="KPN_00280"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00280"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75732"
FT                   /db_xref="GOA:A6T561"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T561"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75732.1"
FT                   /translation="MLEQMGIAAKAASWQLALLSSREKNQVLEKIADYLEAQTDDILRA
FT                   NAEDLAEARANGLSEAMLDRLALTPARLSGIANDVRQVCNLADPVGQVIDGGLLDSGLR
FT                   IERRRVPLGVIGVIYEARPNVTVDVASLCLKTGNAAILRGGKETWRTNAATVKVIQQAL
FT                   QECGLPAAAVQAIDSPDRALVGEMLKMDKYIDMLIPRGGAGLHKLCREQSTIPVITGGI
FT                   GVCHIFVDETAEIPPALKIIVNAKTQRPSTCNTVETLLVHRNIADTFLPALSKQMAESG
FT                   VTLHAAPSALPALQNGPAKVEPVKAEQYDDEYLSLDLNVKVVADMDEAIAHIREHGTQH
FT                   SDAILTRTLRNANRFINEVDSSAVYVNASTRFTDGGQFGLGAEVAVSTQKLHARGPMGL
FT                   EALTTYKWIGFGDDTIRA"
FT   gene            complement(318584..319687)
FT                   /gene="proB"
FT                   /locus_tag="KPN_00281"
FT   CDS_pept        complement(318584..319687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="KPN_00281"
FT                   /product="gamma-glutamyl kinase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00281"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75733"
FT                   /db_xref="GOA:A6T562"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T562"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001048"
FT                   /inference="protein motif:Pfam:IPR002478"
FT                   /protein_id="ABR75733.1"
FT                   /translation="MSESQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAMGHRI
FT                   VIVTSGAIAAGREHLGYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLT
FT                   RADMEDRERFLNARDTLRALLDNSIVPVINENDAVATAEIKVGDNDNLSALAAILAGAD
FT                   KLLLLTDQPGLFTADPRSNPQAELIKDVYGIDDALRAIAGDSVSGLGTGGMGTKLQAAD
FT                   VACRAGIDTIIAAGNRPDVIGHAMAGLPVGTCFHAQESPLENRKRWIFGAPPAGEITVD
FT                   AGATQAILERGSSLLPKGIKIVSGNFSRGEVIRIRNSEGRDIAHGVSRYNSDALRLIAG
FT                   QHSQQIDAILGYEYGPVAVHRDDMIIR"
FT   gene            320001..321029
FT                   /gene="phoE"
FT                   /locus_tag="KPN_00282"
FT   CDS_pept        320001..321029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoE"
FT                   /locus_tag="KPN_00282"
FT                   /product="outer membrane pore protein E (E,Ic,NmpAB)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00282"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75734"
FT                   /db_xref="GOA:A6T563"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR001897"
FT                   /db_xref="InterPro:IPR013793"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A6T563"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001702"
FT                   /protein_id="ABR75734.1"
FT                   /translation="MMMGFVASTATQAAEVYNKNANKLDVYGKIKAMHYFSDYDSKDGD
FT                   QTYVRFGIKGETQINDDLTGYGRWESEFSGNKTESDSSQKTRLAFAGVKLKNYGSFDYG
FT                   RNLGALYDVEAWTDMFPEFGGDSSAQTDNFMTKRASGLATYRNTDFFGLVDGLDLTLQY
FT                   QGKNEGREAKKQNGDGVGTSLSYDFGGSDFAVSAAYTSSDRTNDQNLLARGQGSKAEAW
FT                   ATGLKYDANNIYLATMYSETRKMTPISGGFANKAQNFEAVAQYQFDFGLRPSLGYVLSK
FT                   GKDIEGVGSEDLVNYIDVGLTYYFNKNMNAFVDYKINQLKSDNKLGINDDDIVALGMTY
FT                   QF"
FT   gene            complement(321074..321535)
FT                   /gene="nlpC"
FT                   /locus_tag="KPN_00283"
FT   CDS_pept        complement(321074..321535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nlpC"
FT                   /locus_tag="KPN_00283"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00283"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75735"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A6T564"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000064"
FT                   /protein_id="ABR75735.1"
FT                   /translation="MTIDGGSDDLIPVVAALHDQMHTWQGTPYEWGGTEQSGVDCSGFV
FT                   WRTLKDRFNLPMERITTRELLHMGVRVNKRDLRPGDLVFFRTRAGMHVGFYDTDHNFLH
FT                   ASSSQGVMRSSLDNPYWESAFYQARRLPKEYNAQITMNSDTLHLAKNRR"
FT   gene            complement(324274..324444)
FT                   /gene="yeiE"
FT                   /locus_tag="KPN_00284"
FT   CDS_pept        complement(324274..324444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeiE"
FT                   /locus_tag="KPN_00284"
FT                   /product="putative transcriptional regulator (LysR
FT                   familiy)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00284"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75736"
FT                   /db_xref="UniProtKB/TrEMBL:A6T565"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75736.1"
FT                   /translation="MASGTELRLCRVAAAPYPAYNPKSPLALGLLKLPVLAASTSLRRS
FT                   RKAGAARMDAG"
FT   gene            complement(324595..324780)
FT                   /gene="yhhM"
FT                   /locus_tag="KPN_00285"
FT   CDS_pept        complement(324595..324780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhhM"
FT                   /locus_tag="KPN_00285"
FT                   /product="putative receptor"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00285"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75737"
FT                   /db_xref="UniProtKB/TrEMBL:A6T566"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75737.1"
FT                   /translation="MASGTELRLYRMAAAPYPAYSSGSDCLQARQATAPPGDGIRHGAA
FT                   FMPRGGYALPDLLVQL"
FT   gene            complement(324994..325878)
FT                   /gene="phnE"
FT                   /locus_tag="KPN_00286"
FT   CDS_pept        complement(324994..325878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnE"
FT                   /locus_tag="KPN_00286"
FT                   /product="membrane channel protein component of Pn
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00286"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75738"
FT                   /db_xref="GOA:A6T567"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005769"
FT                   /db_xref="InterPro:IPR017797"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6T567"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000515"
FT                   /protein_id="ABR75738.1"
FT                   /translation="MSVWHMQPDIAASRRQHKQLYQVQGRYLRYVGLVALACLLYYVWF
FT                   FLQFGVSGEQLTTGLQQIGRYLARMLVWHDFWNWPFGYYFTQIGVTLAIVFAGTLTATV
FT                   LALLLSFFAARNIMRGVVLGPLALLMRRLFDVLRGIDMAIWGLIFVRAVGLGPLAGVLA
FT                   IIMQDTGLLGRLYAEGHEAVDRSPGRGLTAVGANGLQKHRFGIFTQSFPTFLALSLYQI
FT                   ESNTRSAAVLGFVGAGGIGLIYAENMRLWNWDVVMFITLLLVAVVMIMDTLSAWLRRRY
FT                   IGGAAVPLYQGGR"
FT   gene            complement(325875..326747)
FT                   /locus_tag="KPN_00287"
FT   CDS_pept        complement(325875..326747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00287"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00287"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75739"
FT                   /db_xref="GOA:A6T568"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005769"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6T568"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000515"
FT                   /protein_id="ABR75739.1"
FT                   /translation="MKTTHTEFERYYQQVRSRQKRDAVCWSLLLLALYFAAGSAAEFNL
FT                   LTIWHSLPHFFDYMAETIPPLSAGNLFADVQTKGSLAWWGYRLPIQLPLIWETLQLALA
FT                   STLVAVAIATVFAFLAANNAWTPAPVRFAIRVLVAFLRTMPELAWAVIFVMAFGIGAIP
FT                   GFLALMLHTVGSLTKLFYEAVESAQNKPVRGLAACGASPLQKIRFALWPQVKPLFLSYG
FT                   FMRLEINFRSSTILGLVGAGGIGQELMTNIKLDRYDQVSITLLLIILVVSALDMLSGRL
FT                   RLWVLEGKK"
FT   gene            complement(327775..328638)
FT                   /gene="phnC"
FT                   /locus_tag="KPN_00288"
FT   CDS_pept        complement(327775..328638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnC"
FT                   /locus_tag="KPN_00288"
FT                   /product="ATP-binding component of phosphonate transport"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00288"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75740"
FT                   /db_xref="GOA:A6T569"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012693"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6T569"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003439"
FT                   /protein_id="ABR75740.1"
FT                   /translation="MTNLDTLMNSSLAAVAETDFQPFTDLAAGRQRKVLSVRNLSKAYQ
FT                   AQHKVLDGISFDLHAGEMVGVIGRSGAGKSTLLHVLNGTHSASGGEILSYPEVGTPHDV
FT                   SQLKGRALNAWRSHCGMIFQDFCLVPRLDVLTNVLLGRLSQTSTLKSLFKIFPAADRAR
FT                   AIALLEWMNMLPHALQRAENLSGGQMQRVAICRALMQNPGILLADEPVASLDPKNTQRI
FT                   MDVLREISEQGISVMVNLHSVELVRAYCTRVIGVASGQLIFDDHPSRLTQDVLQRLYGD
FT                   EVSQLH"
FT   gene            328747..328878
FT                   /gene="yfeU"
FT                   /locus_tag="KPN_00289"
FT   CDS_pept        328747..328878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfeU"
FT                   /locus_tag="KPN_00289"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00289"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75741"
FT                   /db_xref="UniProtKB/TrEMBL:A6T570"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75741.1"
FT                   /translation="MLAAGEAPKSRYALEGAETDRFVGVGSLRQSSLNLDEEDRLIE"
FT   gene            329466..330008
FT                   /gene="ykgK"
FT                   /locus_tag="KPN_00290"
FT   CDS_pept        329466..330008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgK"
FT                   /locus_tag="KPN_00290"
FT                   /product="putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00290"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75742"
FT                   /db_xref="GOA:A6T571"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T571"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000792"
FT                   /protein_id="ABR75742.1"
FT                   /translation="MEYKSCSDKYIWSADDSYFYKGLSELIVDIDELIYLSLEKIRKDF
FT                   VFINLNTASLNEFIRRDSEWLSAVKGKQVVLIAARKSEALANYWYYNSDIRGVVYVGLS
FT                   RDIRKELAYVINGRFLRKDIKKDKITDREMKIIRMTAQGMQPKSIARIENCSVKTVYTH
FT                   RRNAEAKLYSKIYKLVQ"
FT   gene            330083..330670
FT                   /gene="yagZ"
FT                   /locus_tag="KPN_00291"
FT   CDS_pept        330083..330670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagZ"
FT                   /locus_tag="KPN_00291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00291"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75743"
FT                   /db_xref="GOA:A6T572"
FT                   /db_xref="InterPro:IPR016514"
FT                   /db_xref="InterPro:IPR038478"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T572"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75743.1"
FT                   /translation="MKKKVLAIALVTAFTGMGVAQAADVTAQAVATWSATAKKDTTSKL
FT                   VVTPLGSLAFQYAEGIKGFNSQKGLFDVAIEGDTTATAFKLTSRLITNTLTQLDTSGST
FT                   LSVGVDYNGAAVEKTGDTVMIDTANNIMGGNLSALANGYNASGRTTAQDGFTFSIISGT
FT                   TNGTTAVTDYSTLPEGIWSGDVSVQFDATWTS"
FT   gene            330729..331397
FT                   /gene="yagY"
FT                   /locus_tag="KPN_00292"
FT   CDS_pept        330729..331397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagY"
FT                   /locus_tag="KPN_00292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00292"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75744"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR040695"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T573"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75744.1"
FT                   /translation="MKKHLLALGLLLAGVSPAQALDVGDISSFMNSGSSTLSKTIKNST
FT                   DSGRLINIHLERLSSPLDGGQVIPMDKPDEVLLTPASLLLPAQASDVIRFFYKGPADDK
FT                   ERYYRIVWFDQALSDAQRDNANRSAVATASARIGTILVVAPRQVNYRFQYANGSLTNTG
FT                   NATLRILAYGPCLKAADGKECKENYYLMPGKSRRFTRVDTADKKGRVALWQGEQFVPVK
FT                   "
FT   gene            331474..333948
FT                   /gene="yagX"
FT                   /locus_tag="KPN_00293"
FT   CDS_pept        331474..333948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagX"
FT                   /locus_tag="KPN_00293"
FT                   /product="putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00293"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75745"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR031917"
FT                   /db_xref="InterPro:IPR032636"
FT                   /db_xref="UniProtKB/TrEMBL:A6T574"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75745.1"
FT                   /translation="MIFLFVQPDASAAAAGAQQIGGVIIPQAFSQALQDGMSVPLYIHL
FT                   AGSQGIRDDQRIGSAFIWLDGGQLRVRQIQLEESEGNASVNEQTRQQLIGLANAPFSET
FT                   LTIPLTDSAQLDLSLRQLLLQLVVKREALGTVLRSRSEDIGQSSVNALSSNLSYNLGVY
FT                   NNQMRNGGSNTSSYLSLNNVTALREHHVVLDGSLYGIGSGQQDSELYKAMYERDFAGHR
FT                   FAGGMLDTWNLQSLGPMTAISAGKIYGLSWGNQASSTVFDNSQSATPVIAFLPAAGEVH
FT                   LTRDGRLLSVQNFAMGNHEVDTRGLPYGIYDVEVEVIVNGRVVSKRTQRVNKLFSRGRG
FT                   AGAPLAWQVWGGSFHMDRWSESGKKTRPAKESWLAGLSASGSLSTLSWAATGYGYDNQA
FT                   VGETRLTLPLGESINVNLQNMLASDSSWSSVGSISATLPGGFSSVWVNQERTRIGDQLR
FT                   RSDADNRAIGGTLNLNALWSKLGTFSVSYNDDRRYNSHYYTADYYQTVYSGAFGSLGLR
FT                   AGIQRYNNGDSSANTGKYIALDLSLPLGNWFSAGMTHQNGYTMANLSARKQFDEGTIRT
FT                   IGANLSRAISGDTGDDKTLSGGAYAQFDARYASGTLNVNSAADGYVNTNLTASGSVGWQ
FT                   GKNIAASGRTDGNAGVIFNTGLEDDGQISARVNGRIFPLSGKRNYLPLSPYGRYEVELQ
FT                   NSKNSLDSYDIVSGRKSHLTLYPGNVAVIEPEVKQMVTVSGRIRAEDGTLLANARINNH
FT                   IGRTRTDENGEFVMDVDKKYPTIDFSYGGNKTCEVALELSQARGAVWVGDVVCSGLSSW
FT                   AAVQQSGEENES"
FT   gene            333938..335581
FT                   /gene="yagW"
FT                   /locus_tag="KPN_00294"
FT   CDS_pept        333938..335581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagW"
FT                   /locus_tag="KPN_00294"
FT                   /product="putative receptor"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00294"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75746"
FT                   /db_xref="UniProtKB/TrEMBL:A6T575"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75746.1"
FT                   /translation="MKVNALMALAILALLWPAAALRAAVTKTTWSDAPAREFVFVENNS
FT                   DDNFFVTPGGALDPRMTGANRWTGLKYTGSGTIYQQSLGYIDNGYNTGLNANWKFDMWL
FT                   ENSPVSHPLTGLRCINWYAGCDMATSLILPQTTDASGFYGATVTSGGAKWMHGMMSDAF
FT                   YQYLQQMPVGGSFTMTINACQTSVNYDASSGARCKDQASGNWYVRNVTHTKAANLRLIN
FT                   THSLAEVFINSDGVPTLGEGNADCRTQTIGSRSGLSCKMVNYTLQTNGLSNTSIHIFPA
FT                   IANSSLASAVGAYDMQFSLNGSSWKPVSNTAYYYTFNEMKSSDSIYVFFSSNFFKQMVN
FT                   LGISDINTKDLFNFRFQNTTSPESGWYEFSTSNTLIIKPRDFSISIISDEYTSAPSREG
FT                   YVGSGEPALDFGYIVTTSGKTAADEVLIKVTGPAQVIGGRSYCLFSSDDGTAKVPFPAT
FT                   LSFITRSGTTQTYDAGCDDSWRDMTDALWLTTPWTDISGEVGQMDKTTVKFSIPMDNAI
FT                   SLRTVDDNGWFGEVSASGEIHVQATWRNIN"
FT   gene            335550..336260
FT                   /gene="yagV"
FT                   /locus_tag="KPN_00295"
FT   CDS_pept        335550..336260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagV"
FT                   /locus_tag="KPN_00295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00295"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75747"
FT                   /db_xref="GOA:A6T576"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="UniProtKB/TrEMBL:A6T576"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75747.1"
FT                   /translation="MSRRRGATLTKALLTVGCLLAAPLAQAISVGNLTFSLPAEADFAS
FT                   KRVVNNNKSARLYRIAVSAIDRPGGSEVRSRPVDGELLFAPRQLVLQAGESEYFKFYYH
FT                   GPRDNRERYYRVSFREIPTRNLTRRSPTGGEVSMEPVVVMDTILVVRPREVQFKWSFDK
FT                   VAGTVSNTGNTWFKLLIKPGCDSTEEEGDAWYLRPGDVVRQPALRQPGNHYLVYNDKFI
FT                   KISDTCPLKPRPAE"
FT   gene            complement(336264..336953)
FT                   /gene="yhdY"
FT                   /locus_tag="KPN_00296"
FT   CDS_pept        complement(336264..336953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhdY"
FT                   /locus_tag="KPN_00296"
FT                   /product="putative amino acid transport protein (ABC
FT                   superfamily, membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00296"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75748"
FT                   /db_xref="GOA:A6T577"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6T577"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000515"
FT                   /protein_id="ABR75748.1"
FT                   /translation="MNANLAVIADNLDYLLWGRLAEGQPGGVALTLLMAIGATLLALPG
FT                   GIALAGLAWRYGGLVRRLLFLWAEIIRGIPLIFVIFWLWYLLPMLTGGDLPGAVTVTLA
FT                   LAWFTAASVMHSVLAGLQSLPKGQYEAALTQGFAPGQTLRLVLLPQALRNVQPSLVGIF
FT                   IGLLKDTSLAFIVNVPELTTVAGQVNNRVQIYPLAIFVFTGAVYYLLCCGLSLLASRRF
FT                   TRRATTR"
FT   gene            complement(336943..337686)
FT                   /gene="gltJ"
FT                   /locus_tag="KPN_00297"
FT   CDS_pept        complement(336943..337686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltJ"
FT                   /locus_tag="KPN_00297"
FT                   /product="glutamate/aspartate transport protein (ABC
FT                   superfamily, membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00297"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75749"
FT                   /db_xref="GOA:A6T578"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6T578"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000515"
FT                   /protein_id="ABR75749.1"
FT                   /translation="MLDWHGVLSGQPLQWIISGFLTTVWVSVAGILLATLLAVLLLALR
FT                   LGGGRAGRGLVAAWVSLFRNTPLLVQLLFWYFAAWNLLPLAVKEVVNDEHAWSILPGNV
FT                   WWLTPEFLCSMWGLGVFTSAFLVEEIASGLRAVSHGQREAALSQGFTPWQELRFILLPQ
FT                   GLANAWQPIVGQYLNLMKLSSLASGIGFAELTYQVRQIESYNAHALEAFAVGTALYLAL
FT                   GVAMGVALTRLGPGRKLQRSARHER"
FT   gene            complement(337692..338510)
FT                   /gene="gltL"
FT                   /locus_tag="KPN_00298"
FT   CDS_pept        complement(337692..338510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltL"
FT                   /locus_tag="KPN_00298"
FT                   /product="ATP-binding protein of glutamate/aspartate
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00298"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75750"
FT                   /db_xref="GOA:A6T579"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A6T579"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003439"
FT                   /protein_id="ABR75750.1"
FT                   /translation="MFSGLLSHSAAPAADFSRLQRASITFRDVAKRYGDHQVLNAINLQ
FT                   VEPGEVVAILGPSGSGKSTLIRLINQLESLSGGEILIDGKPTSRLSGSALRQLRSRVGF
FT                   VFQQFNLYAHLTAQENITLALERVHGWGKSAAQARALALLRQVGLEEKAQQMPAQLSGG
FT                   QQQRVAIARALASSPQIILFDEPTSALDPEMIGEVLQVMKTLAHSGITMLVVTHEMQFA
FT                   REIADRVVFIDGGDILEVAPPAEFFAHPQHARARRFLQKVLDPLHQESLE"
FT   gene            complement(338512..339321)
FT                   /gene="fliY"
FT                   /locus_tag="KPN_00299"
FT   CDS_pept        complement(338512..339321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliY"
FT                   /locus_tag="KPN_00299"
FT                   /product="cysteine transport protein (ABC superfamily,
FT                   peri_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00299"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75751"
FT                   /db_xref="GOA:A6T580"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A6T580"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001638"
FT                   /protein_id="ABR75751.1"
FT                   /translation="MRNKTTKIALALGMLLLASQAQADQLADIKAAGVVKVATFDANPP
FT                   FGSVDAKTHHIVGYDVDFAQALAKALGVKLELVATNPANRIPLLQSGKADLIVADITIT
FT                   PERAQVIDFSTPYFVTGQQFLVPAGSPDKLDEYSKARIGAVKGTTGEQALHQRFPQARV
FT                   LSYDDIPLALTALRNGNVQAITQDSTILAGLLAEAPDKAKFKILPDLLSKEEIGVGVKK
FT                   GEPALLKAVNDELVKLEKTGEAAKIYDVWFGPATKTPQPRAFTIEAK"
FT   gene            339656..339826
FT                   /gene="umuC"
FT                   /locus_tag="KPN_00300"
FT   CDS_pept        339656..339826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="umuC"
FT                   /locus_tag="KPN_00300"
FT                   /product="DNA polymerase IV"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00300"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75752"
FT                   /db_xref="UniProtKB/TrEMBL:A6T581"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75752.1"
FT                   /translation="MALWQRLTGWLAFLSNGEAGQQDTQRVMEAILPVASLYGVDIGNV
FT                   ETRWFRHDKTY"
FT   gene            complement(339943..340638)
FT                   /gene="livF"
FT                   /locus_tag="KPN_00301"
FT   CDS_pept        complement(339943..340638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livF"
FT                   /locus_tag="KPN_00301"
FT                   /product="ATP-binding component of leucine transport"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00301"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75753"
FT                   /db_xref="GOA:A6T582"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6T582"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003439"
FT                   /protein_id="ABR75753.1"
FT                   /translation="MLNARELKVFYGVIQGLKGVDIDVYDREIVTLIGSNGAGKTSTLN
FT                   GIVNLVRSSGRVSFLNDDISRSQTHQIVRRGLALVPEGRRVFTNLTIEENLRMGAYNNL
FT                   AGYARLRDRMYALFPRLKERRHQMAGTMSGGEQQMLAIARALMSEPVLLMLDEPSLGLA
FT                   PKIVGELFGIIKQLREENMTVLLVEQNATAALAIADRAYVLENGRITLSGAAREMLTNP
FT                   EIKRMYLGG"
FT   gene            complement(340631..341413)
FT                   /gene="livG"
FT                   /locus_tag="KPN_00302"
FT   CDS_pept        complement(340631..341413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livG"
FT                   /locus_tag="KPN_00302"
FT                   /product="ATP-binding component of high-affinity
FT                   branched-chain amino acid transport system"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00302"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75754"
FT                   /db_xref="GOA:A6T583"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6T583"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003439"
FT                   /protein_id="ABR75754.1"
FT                   /translation="MAENNVILQVQDVTMQFGGLRAIDNVSFHVDEAEIFGLIGPNGAG
FT                   KTTLFNVITANYKPTSGSVTLAGTSLKGLKPNQVVNAGIARTFQNIRLFNSMTVLENVM
FT                   VGLDRASRYSLLEAALHIGRYFPAERAAKAKAMAILEDIGIAHFAHMQATNLSYGNQRK
FT                   VEIARALATAPKLLLLDEPAAGMNPKETEDLAELIFRMRHDYQLSVLLIEHDMPFVNRL
FT                   CERVMVLEYGKPLFSGLMAEAIQHPDVISAYLGEANYA"
FT   gene            complement(341400..342449)
FT                   /gene="livM"
FT                   /locus_tag="KPN_00303"
FT   CDS_pept        complement(341400..342449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livM"
FT                   /locus_tag="KPN_00303"
FT                   /product="high-affinity branched-chain amino acid
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00303"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75755"
FT                   /db_xref="GOA:A6T584"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A6T584"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001851"
FT                   /protein_id="ABR75755.1"
FT                   /translation="MLNATTTAGAQLRNLVIIVICIALLAGINVVFNDYIVRVISTIFI
FT                   FMILAVSYNLINGVTGQLSLEPNGFVAVGAYVTALLILSSDSKVDMFEMAAPSPWILSL
FT                   HAGFLPALLISGLCAAALAVCLAVPVFRVRGDYLAIVTLGFGFIIKILAINNPQITNGA
FT                   IGLNDIPQQPHLLFWCGLFALLATGMILQLVWSKYGRMMKAIRDDEDAAIAMGVNTFRI
FT                   KTCAFATSAFFEGIGGGLLASLLTTISPGLFDFMLTFQLLIIIVLGGLGSTTGALLGTV
FT                   LVVGSGEWLRFLDQPLQFFGHDLGAYPGLRMVVFSLLLLIIMLFAREGLLGKKEIWQTG
FT                   RRSGGYGGK"
FT   gene            complement(342449..343348)
FT                   /gene="livH"
FT                   /locus_tag="KPN_00304"
FT   CDS_pept        complement(342449..343348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livH"
FT                   /locus_tag="KPN_00304"
FT                   /product="high-affinity branched-chain amino acid transport
FT                   protein (ABC superfamily, membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00304"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75756"
FT                   /db_xref="GOA:A6T585"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A6T585"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001851"
FT                   /protein_id="ABR75756.1"
FT                   /translation="MDGAIFLQQVVNGMSLGGMYALIAIGYTMVYGVLRLINFAHADVM
FT                   MVGAFSTLFLFSSVGLPFGVAVFLTLGLCGLFGMLIDRVAYRPLRQASKISMLITAIGV
FT                   SFFLENLFNVLFGGSSRFFSAPDFFNQTRAFGSVIITNVAWIVPLITVLLLLAILWLLY
FT                   RTRYGMAIRAVAFDVNTVRLMGIDANRIISLVFALGSSLAALGGVFYSISYPTIDPLMG
FT                   VLIGLKAFAAAVLGGIGSVTGAVLGGFILGFTEVVAVAIFPELGGYKDAFAFLFLILVL
FT                   LFRPVGIMGDERLERSRF"
FT   gene            complement(343368..344474)
FT                   /gene="livJ"
FT                   /locus_tag="KPN_00305"
FT   CDS_pept        complement(343368..344474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livJ"
FT                   /locus_tag="KPN_00305"
FT                   /product="high-affinity branched-chain amino acid transport
FT                   protein (ABC superfamily, peri_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00305"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75757"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A6T586"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001828"
FT                   /protein_id="ABR75757.1"
FT                   /translation="MATLVAALVGASSAQAAEIKIGVVLPLSGALSGYGQPSQKGLDII
FT                   QAITPTLKNGDTIKLIVIDDKSDKVEAANAMQRLVSSDKVDAVIGEVTSSNTLAMTKIA
FT                   DDSKTPLVSSTATNDRVTRNHPYVSRVCFSDSFQGVVGANLASRDLKAKTAAIVFDSSN
FT                   DYSVGLAKAFRTQFLKNGGTIPIEVQAPGGSKDFKAQLASVKAKNVDMIYMPIYYTEGA
FT                   LIAVQSKQLGLNKPVVGGDGLAADQVFFDVGKDAVNGYMTTDYYSPNAKEQTPAGETFI
FT                   KAWEAKYQQPTHTWGAMAADAYNVIVNAMNQCSDPHDRVCVNEKIRATKDFQGVTGTLT
FT                   LQNGDAIRSAVINEVKDGKLAFRTVVNP"
FT   gene            complement(345049..345825)
FT                   /gene="eutC"
FT                   /locus_tag="KPN_00306"
FT   CDS_pept        complement(345049..345825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eutC"
FT                   /locus_tag="KPN_00306"
FT                   /product="ethanolamine ammonia-lyase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00306"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75758"
FT                   /db_xref="GOA:A6T587"
FT                   /db_xref="InterPro:IPR009246"
FT                   /db_xref="InterPro:IPR042251"
FT                   /db_xref="InterPro:IPR042255"
FT                   /db_xref="UniProtKB/TrEMBL:A6T587"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR009246"
FT                   /protein_id="ABR75758.1"
FT                   /translation="MNRPDAWNPLREFTDARIALGRSGASLPTREVLNFGLAHARARDA
FT                   IHQPFASQQLVAPLAALGLEALTVHSAAPDRHTYLRRPDLGRQLADESRADLAASGVRP
FT                   ADLLLVIGDGLSSWAVERQAVPLIRALLPYLRTLGIGLAPVVLAHQSRVALGDDIGETL
FT                   KARAVAILIGERPGLSSPDSLGVYLTWQPHRQRLESERNCISNIRPEGLSHDAAAFKLA
FT                   WLLEQAFLRRLTGVGLKDESDNPALHGKIKPLPPLK"
FT   gene            complement(345822..347210)
FT                   /gene="eutB"
FT                   /locus_tag="KPN_00307"
FT   CDS_pept        complement(345822..347210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eutB"
FT                   /locus_tag="KPN_00307"
FT                   /product="ethanolamine ammonia-lyase, heavy chain"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00307"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75759"
FT                   /db_xref="GOA:A6T588"
FT                   /db_xref="InterPro:IPR010628"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A6T588"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR010628"
FT                   /protein_id="ABR75759.1"
FT                   /translation="MYKTTLSGQVWRFDSLKTLMAKASPARSGDALAGIIATSAEERMA
FT                   AKMALAEVPLTDILDNPLIPYEQDEVTRLILDTHDAQGFAALRHLTVGDFRDWLLDDAT
FT                   DTATLQRVARAITPEMAAAVSKLMRNQDLILAASKCQVVTRFRNTIGLPGHLSVRLQPN
FT                   HPTDDLKGIAASMLDGLLYGAGDAVIGINPASDSLPVLAQLNVMLDDIIQRFAIPTQSC
FT                   ILTHVTNTLQLIERGAPVDLVFQSVAGTEAANSGFGINLAMLQEAREAALSLRRGTLGN
FT                   NVMYFETGQGSCLSANAHHGVDQQTCEARAYAVARHFEPLLVNTVVGFIGPEYLYDGKQ
FT                   IIRAGLEDHFCGKLMGLPIGCDVCYTNHAEADQDDMDTLLTLLCAAGLTFLIGVPGADD
FT                   IMLNYQSTSFHDALYARRLLGLKHAPEFADWLAKMQIIDPHGALRLTDARHPLLSVLPQ
FT                   GASV"
FT   gene            complement(347220..348599)
FT                   /gene="yhfM"
FT                   /locus_tag="KPN_00308"
FT   CDS_pept        complement(347220..348599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhfM"
FT                   /locus_tag="KPN_00308"
FT                   /product="putative amino acid/amine transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00308"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75760"
FT                   /db_xref="GOA:A6T589"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004757"
FT                   /db_xref="UniProtKB/TrEMBL:A6T589"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004841"
FT                   /protein_id="ABR75760.1"
FT                   /translation="MTEHTTTLKRTLGSFRLWGIAVGLVISGEYFGWSYGWSQAGTMGF
FT                   MVVALAVAAMYCAFIFSFTELTTAIPHAGGPFAYAYRAFGPTGGFIAGFATLIEFVFAP
FT                   PAIAMAIGAYLNVQFPALDPKWVACGAYVIFMTLNILGVGIAATFELIVTLLAIFELLV
FT                   FMGVVAPGFSWSHFTTNGWAGADSFSGLALPGMFAAIPFAIWFFLAIEGASMAAEEAKD
FT                   PQRTIPRALGGGILTLTVLAIGVMVFAGGVGDWRALSNINDPLPQAMKTVVGNGSGWLH
FT                   MLVWLGLFGLVASFHGIIMGYSRQIYSLARAGYLPAGLASLNRRTRTPHLAILAGGVVG
FT                   IAAIFSDSLITISGMPLTACIVTMSVFGAIVMYITSMAALFKLRRSEPKLIRPFRAPLY
FT                   PLAPAFALGMAVLCLVAMVWYNLLLALIFAAMMLGGYLWFRKTAAARERAPVDPQLRTV
FT                   S"
FT   gene            348873..350282
FT                   /gene="mmuP"
FT                   /locus_tag="KPN_00309"
FT   CDS_pept        348873..350282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmuP"
FT                   /locus_tag="KPN_00309"
FT                   /product="putative S-methylmethionine transport protein
FT                   (APC family)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00309"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75761"
FT                   /db_xref="GOA:A6T590"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A6T590"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004841"
FT                   /protein_id="ABR75761.1"
FT                   /translation="MQSTTQQQGGQLKRTMKTRHLIMLSLGGVIGTGLFFNTGYIISTT
FT                   GAAGTLLAYLIGALVVWLVMQCLGELSVAMPETGAFHVYAARYLGPATGYTVAWLYWLT
FT                   WTVALGSSFTAAGFCMQYWFPQVPVWIWCVVFCAVIFGLNIISTRFFAEGEFWFSLVKV
FT                   ITIVAFIILGGAAIFGIIPMQDGSPAPGLRNITAEGWFPHGGLPILMTMVAVNFAFSGT
FT                   ELIGIAAGETENPHKVIPVAIRTTIARLIIFFIGTVFVLAALIPMQQAGVEKSPFVLVF
FT                   EKVGIPYAADMFNFVILTAILSAANSGLYASGRMLWSLSNEKTLPACFAKVNKRGVPVT
FT                   ALSVSMLGGVLALFSSVVAPDTVFVALSAISGFAVVAVWLSICASHFMFRRRHLQQGKA
FT                   LSDLQYRAPWYPVVPVLGFVLCLVACVGLAFDPSQRIALWCGIPFVALCYGAWYLTRSR
FT                   NMTQEPQHVAD"
FT   gene            350269..351201
FT                   /gene="mmuM"
FT                   /locus_tag="KPN_00310"
FT   CDS_pept        350269..351201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmuM"
FT                   /locus_tag="KPN_00310"
FT                   /product="homocysteine methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00310"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75762"
FT                   /db_xref="GOA:A6T591"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR017226"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:A6T591"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003726"
FT                   /protein_id="ABR75762.1"
FT                   /translation="MSQTNPFTALLDAQPFVLLDGAMATELEARGCDLADSLWSAKVLL
FT                   ENPQLIRDVHLDYFRAGAQVAITASYQATPAGFAARGLDEAQSRALIGKSVELARKARE
FT                   AYLAENPQAGTLLVAGSVGPYGAFLADGSEYRGDYQRSAAEFQAFHRPRVEALLDAGAD
FT                   LLACETLPSFAEIQALAALLQEYPRARAWYSFTLRDAEHLSDGTPLREVMAALADNPQV
FT                   VAVGINCIALENTPAALAHLHSLTALPLVVYPNSGEHYDAVSKTWHHHGEACASLADYL
FT                   PQWLAAGAKLIGGCCRTTPKDIAALNAKR"
FT   gene            351442..352404
FT                   /gene="tauA"
FT                   /locus_tag="KPN_00311"
FT   CDS_pept        351442..352404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauA"
FT                   /locus_tag="KPN_00311"
FT                   /product="taurine transport protein (ABC superfamily,
FT                   peri_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00311"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75763"
FT                   /db_xref="GOA:A6T592"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR010068"
FT                   /db_xref="UniProtKB/TrEMBL:A6T592"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR007210"
FT                   /inference="protein motif:Pfam:IPR009541"
FT                   /protein_id="ABR75763.1"
FT                   /translation="MAFTSRITLLAALAVAAFQAQAVNVTVAYQTSAEPAKVAQADNTF
FT                   AKTSGATVDWRKFDSGASVVRALASGDVQIGNIGSSPLAVAASQQVPIEVFLLASKLGN
FT                   SEALVVKKSITKPEDLIGKRIAVPFISTTHYSLLSALKHWGIKPGQVQIINLQPPAIIA
FT                   AWQRGDIDGAYVWAPAVNELEKEGKVLTDSSQVGEWGAPTLDVWVVRKDFAEQHPEIVK
FT                   AFAKSAIDAQQPYIANPEAWLKQPDNISKLARLSGVPEADVPGLVKGNTYLTAAEQAQA
FT                   LNGPVNQAIVDTARFLKEQGKVPAAGTDYRQYVTDRFVK"
FT   gene            352416..353183
FT                   /gene="tauB"
FT                   /locus_tag="KPN_00312"
FT   CDS_pept        352416..353183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauB"
FT                   /locus_tag="KPN_00312"
FT                   /product="taurine ATP-binding component of a transport
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00312"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75764"
FT                   /db_xref="GOA:A6T593"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015859"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6T593"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003439"
FT                   /protein_id="ABR75764.1"
FT                   /translation="MLQISHLSADYGGKPALADINLTLESGELLVVLGPSGCGKTTLLN
FT                   LIAGFVPYQHGSITLEGQRVTGPGAERGVVFQNEGLLPWRNVQDNVALGLQLAGVDKAQ
FT                   RRQAAAQMLKKVGLEGAEKRFIWQLSGGQRQRVGIARALAANPQLLLLDEPFGALDAFT
FT                   REQMQTLLLKLWHETGKQVLLITHDIEEAIFMATELVLLSPGPGRVVERLRLDFSRRFV
FT                   AGESCRSIKSDPRFIEQREYILSRVFDQREAFS"
FT   gene            353180..354007
FT                   /gene="tauC"
FT                   /locus_tag="KPN_00313"
FT   CDS_pept        353180..354007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauC"
FT                   /locus_tag="KPN_00313"
FT                   /product="taurine transport protein (ABC superfamily,
FT                   membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00313"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75765"
FT                   /db_xref="GOA:A6T594"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6T594"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000515"
FT                   /protein_id="ABR75765.1"
FT                   /translation="MSVVLNDKPRQSTLKWRWPLSRQLTLSVATLAVLLAVWWAVAALQ
FT                   LISPLFLPPPGQVLQKLITIAGPQGFMDATLWQHLAASLTRIVIALLAAVLIGVPVGIA
FT                   MGLNSTVRGILDPLIELYRPVPPLAYLPLMVIWFGIGETSKILLIYLAIFAPVAMSALA
FT                   GVKSAQQVRIRAARSLGASRAQVLWLVILPGALPEILTGLRIGLGVGWSTLVAAELIAA
FT                   TRGLGFMVQSAGEFLATDVVLAGIAVIAIIAFLLELGLRALQRRLTPWHGEVQ"
FT   gene            354004..354855
FT                   /gene="tauD"
FT                   /locus_tag="KPN_00314"
FT   CDS_pept        354004..354855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauD"
FT                   /locus_tag="KPN_00314"
FT                   /product="taurine dioxygenase, 2-oxoglutarate-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00314"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75766"
FT                   /db_xref="GOA:A6T595"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:A6T595"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003819"
FT                   /protein_id="ABR75766.1"
FT                   /translation="MSERLSITPLGPYIGAQVSGADLTRPLSDNQFEQLYHAVLRHQVV
FT                   FLREQNITPAQQRDLALRFGDLHIHPVYPHAPGVEEIIVLDTHNDNPPDNDNWHTDVTF
FT                   IDTPPAGAILAAKELPTTGGDTLWTSGIAAWEALSEPFRQLLSGLHAEHDFRKSFQEYK
FT                   YNKTEAEHRRWQEAVAKHPPLLHPVVRTHPVTGKQALFVNEGFTTRIVEVSEKESAALL
FT                   NFLFAHVTKPEFQVRWRWQPNDVAIWDNRVTQHYANADYLPQRRIMHRATILGDKPYYR
FT                   AG"
FT   gene            complement(355011..356729)
FT                   /gene="yhjT"
FT                   /locus_tag="KPN_00315"
FT   CDS_pept        complement(355011..356729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhjT"
FT                   /locus_tag="KPN_00315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00315"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75767"
FT                   /db_xref="GOA:A6T596"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A6T596"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002123"
FT                   /protein_id="ABR75767.1"
FT                   /translation="MFSLDNVLDDLWPQARPAPWQKKLLKKLFYEEEFQQFADRHRHLK
FT                   GLDTVEQVLEYLNIRCAIPAHDLEQIPEYGPLVIIANHPTGTLDGLALLYAVSRVRRDV
FT                   KVVTNRMLTHLEPLSSLFIPVDNIHGRTAKAALQQMDQQLQAGGVLIFFPAGEVSRLTR
FT                   RGIRDKKWHSGFIKLAAKYRAPLLPAWINARNSALFYASTLVSDNLPLLLLMQQMFRRR
FT                   NSSLPVRIGQQIPWSNWFDAQSSARELTGRCYQHLEQLRKGLPGRFKTESAIARPEDRA
FT                   LLKRELHKAECLGRTADGKVIYLWQRNGQEDAPLLRELGRLREIAFRAVGEGSGKRRDI
FT                   DGYDDDYLHLILWDEEDLEIVGAYRFMPTTIQLAKRGLEGIYSYSLFHYDGRMDDVLQH
FT                   GIELGRSFIQPRYWGRRGLDYLWSGIGAYLARYPHYRYLFGPVSISGGLPPAARDLLVA
FT                   FYRLWFPATHPLAESRRPYPASLPDVLAQFGGEDYNDDLARLKSLLGNLGCAIPPLYKQ
FT                   YSEVCEPGGVQFIDFGSDPDFNNCVDGLVLVDLTYLKANRYQRYIGAHLGAQKSA"
FT   gene            complement(356933..357907)
FT                   /gene="hemB"
FT                   /locus_tag="KPN_00316"
FT   CDS_pept        complement(356933..357907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="KPN_00316"
FT                   /product="delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00316"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75768"
FT                   /db_xref="GOA:A6T597"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A6T597"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001731"
FT                   /protein_id="ABR75768.1"
FT                   /translation="MTDLITRPRRLRQSAALRALFEETTLSLNDLVLPIFVEEEIDDYK
FT                   AIEAMPGVMRIPEKYLAREIERIANAGIRSVMTFGISHHTDATGSDTWNENGLVARMSR
FT                   ICKSTVPEMIVMSDTCFCEYTSHGHCGVLCDHGVDNDATLENLGKQAVVAAAAGADFIA
FT                   PSAAMDGQVQAIRRSLDAAGFTNTAIMSYSTKFASSFYGPFREAAGTALKGDRKTYQMS
FT                   PMNRREAIRESLLDEAQGADCLMVKPAGAYLDILRDIRERSDLPLGAYQVSGEYAMIKF
FT                   AAQAGAIDEEKVVLESLGAIKRAGADLIFSYFALDLAEKKILR"
FT   gene            complement(358014..359174)
FT                   /gene="ampH"
FT                   /locus_tag="KPN_00317"
FT   CDS_pept        complement(358014..359174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampH"
FT                   /locus_tag="KPN_00317"
FT                   /product="beta-lactamase/D-ala carboxypeptidase,
FT                   penicilling binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00317"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75769"
FT                   /db_xref="GOA:A6T598"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A6T598"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001466"
FT                   /protein_id="ABR75769.1"
FT                   /translation="MKRSLLIFAALCAASWTSVQAAQPTVDPVFASDVVDRYANHIYYG
FT                   SGATGMALVVIDGNQRVFRSFGETRPGNNQHPQLDSVIRIASLSKLMTSEMLVKLLDQG
FT                   VVKLNDPLSKYAPPGARVPDWQGKPITLVNLATHTSALPREQPGGAAHRPVFVWPTRQQ
FT                   RWNWLSTATLKTAPGSQAAYSNLAFDLLADALSTAAGKPYPQLFEEQITRPLGMKDTTF
FT                   TPSPDQCQRLMIPEKGASPCNNTLAAIGSGGVYSTPGDMMRWMQQFLSSDFYTRSQQAD
FT                   RMQTLIYQRNQLTRVIGMDVPGRADALGLGWVYMKPKNGHPGIIQKTGGGGGFITYMAM
FT                   NPQANVGAFVVVTRSPLTRFNNMSDGINDLVSELSGAQPNMQTASQ"
FT   gene            359373..359906
FT                   /locus_tag="KPN_00318"
FT   CDS_pept        359373..359906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00318"
FT                   /product="hypothetical isochorismatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00318"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75770"
FT                   /db_xref="GOA:A6T599"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A6T599"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000868"
FT                   /protein_id="ABR75770.1"
FT                   /translation="MTAQRVVMVVDMQNGVFATPRLARERCVAQINRLVRAADKVIFIQ
FT                   HDEAGGLEAGSEGFALLPELEQPAGALYVTKTACDAFYHTSLAQVLDEHDIQQFVICGC
FT                   ATDYCLDTTIKNGASRGYGIVIAEDAHTTADRPAAQAATLIAHYNEVWRTLTIPGNPLQ
FT                   VKPTETILHAWQQN"
FT   gene            360021..361244
FT                   /gene="sbmA"
FT                   /locus_tag="KPN_00319"
FT   CDS_pept        360021..361244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbmA"
FT                   /locus_tag="KPN_00319"
FT                   /product="microcin B17 transport protein (ABC superfamily,
FT                   atp_bind and membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00319"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75771"
FT                   /db_xref="GOA:A6T5A0"
FT                   /db_xref="InterPro:IPR009248"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5A0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR009248"
FT                   /protein_id="ABR75771.1"
FT                   /translation="MMFKSFFPKPGPFFISAFIWSLLAVIFWQAGGGDWLLRVTGASQN
FT                   VAISAARFWSLNYLVFYAYYLFCVGVFALFWFVYCPHRWQYWSILGTSLIIFVTWFLVE
FT                   VGVAINAWYAPFYDLIQSALATPHKVSINQFYQEIGVFLGIAIIAVIIGVMNNFFVSHY
FT                   VFRWRTAMNEHYMAHWQHLRHIEGAAQRVQEDTMRFASTLEDMGVSFINAVMTLIAFLP
FT                   VLVTLSEHVPDLPIVGHLPYGLVIAAIVWSLMGTGLLAVVGIKLPGLEFKNQRVEAAYR
FT                   KELVYGEDDETRATPPTVRELFRAVRRNYFRLYFHYMYFNIARILYLQVDNVFGLFLLF
FT                   PSIVAGTITLGLMTQITNVFGQVRGSFQYLISSWTTLVELMSIYKRLRSFERELDGKPL
FT                   QEAIPTLR"
FT   gene            361263..362369
FT                   /gene="yaiW"
FT                   /locus_tag="KPN_00320"
FT   CDS_pept        361263..362369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiW"
FT                   /locus_tag="KPN_00320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00320"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75772"
FT                   /db_xref="InterPro:IPR009017"
FT                   /db_xref="InterPro:IPR011673"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5A1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75772.1"
FT                   /translation="MAARLSRIIPVSLTLLAAMALSACTSQQAPALKEGEKPVDVASVV
FT                   RQKMPASVKDREAWAQAIATAFDSQKLAPTEENVCSVLAVAQQESNYQSDPVVPGLNKI
FT                   AWQEIDRRAEKMHIPPFLVHTALKITSPNGKSYSDRLDNVKTEKQLSAIFDDFIGMVPM
FT                   GQKLFGSLNPVHTGGPMQVSIAFAEQHTSGYPWKMNGTVRQEVFSLRGGLWFGTYHLLN
FT                   YPASYSAPLYRFADFNAGWYASRNAAFQNAVVKASGVKLALDGDLIRYDSEEPGSTELA
FT                   VRRLASQLGMSDSEIHRQLKKGDSLAFEKTDLYQQVFRLAEKKTGKTLPREMLPGIQLE
FT                   SPKITRNLTTAWFAKRVDERRANCMARR"
FT   gene            complement(362366..362668)
FT                   /gene="yaiY"
FT                   /locus_tag="KPN_00321"
FT   CDS_pept        complement(362366..362668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiY"
FT                   /locus_tag="KPN_00321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00321"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75773"
FT                   /db_xref="GOA:A6T5A2"
FT                   /db_xref="InterPro:IPR020513"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5A2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75773.1"
FT                   /translation="MAEFSFSKSLLGNKKRGALTGSHVAYGLFVLICCWAGAQMLSMLI
FT                   HAPGVFERLMQAQDASRPQVDISLAVGTLFGLIPFLIGCTFIGVLALIVRWRQRR"
FT   gene            362921..363124
FT                   /gene="yaiZ"
FT                   /locus_tag="KPN_00322"
FT   CDS_pept        362921..363124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiZ"
FT                   /locus_tag="KPN_00322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00322"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75774"
FT                   /db_xref="GOA:A6T5A3"
FT                   /db_xref="InterPro:IPR020490"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5A3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75774.1"
FT                   /translation="MKLTDKIRRDWHYYAVALGLIFILNGVVGLLGFETQGWQSYAVGL
FT                   ITWVISFWIAGFVIRRRPAEEA"
FT   gene            complement(363157..364287)
FT                   /gene="ddl"
FT                   /locus_tag="KPN_00323"
FT   CDS_pept        complement(363157..364287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddl"
FT                   /locus_tag="KPN_00323"
FT                   /product="D-alanylalanine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00323"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75775"
FT                   /db_xref="GOA:A6T5A4"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5A4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR011095"
FT                   /inference="protein motif:Pfam:IPR011127"
FT                   /protein_id="ABR75775.1"
FT                   /translation="MPFDVIWMEVEMAKMRVGIVFGGKSAEHEVSLQSAKNIVEAIDKS
FT                   RFDVVLLGIDKQGLWHINDAGNYLLNAQDPARIALRPSTVTLAQIPGREAQQLINAESG
FT                   QPLAAIDVIFPIVHGTLGEDGSLQGMLRMANLPFVGSDVLGSAACMDKDVTKRLLRDAG
FT                   LAVAPFITLTRANRAQFSFADVEAKLGLPLFVKPANQGSSVGVSKVKNEEQYHQAVALA
FT                   FEFDHKVVVEQGIKGREIECAVLGNDHPQASTCGEIVLNSEFYAYDTKYIDDQGAQVVV
FT                   PAAIAPEINDKIRAIAVQAYQTLGCSGMARVDVFLTADNEVVINEINTLPGFTNISMYP
FT                   KLWQASGLDYTSLITRLIELALERHAADRALKTSMN"
FT   gene            364348..365037
FT                   /locus_tag="KPN_00324"
FT   CDS_pept        364348..365037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00324"
FT                   /product="putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00324"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75776"
FT                   /db_xref="InterPro:IPR009683"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5A5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR009683"
FT                   /protein_id="ABR75776.1"
FT                   /translation="MGVRGKTLLVLAGLLGAGLLGYRNLPPHLNPLAPLALDDPPGWLT
FT                   SFKLRRLTADQCASLLAEANRRRLIASRPVADSEGSCPLRNVVRVANFGSVQLSSSFLA
FT                   SCPLALSSALYIEQQAKPLTRQLMASDLRQIDHLGSFACRNIYHRQQARRSEHATADAL
FT                   DVSGFRLADGRRVSVLQGWRSETSRPWLAALLSSSCHYFGNALGPEYNAAHANHFHFGM
FT                   RGQGFCF"
FT   gene            365207..366406
FT                   /locus_tag="KPN_00325"
FT   CDS_pept        365207..366406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00325"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00325"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75777"
FT                   /db_xref="GOA:A6T5A6"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5A6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75777.1"
FT                   /translation="MESWKVNLISVWFGCFFTGLAISQILPFLPLYVSQLGVTSHEALS
FT                   MWSGLTFSVTFLVSAIVSPMWGSLADRKGRKLMLLRASLGMAIAILLQAFATNVWQLFI
FT                   LRAIMGLTSGYIPNAMALVASQVPRERSGWALSTLSTAQISGVIGGPLLGGFLADHVGL
FT                   RMVFFITAILLTISFLVTLFLIKEGVRPQVSKSERLTGKQVFASLPYPGLVISLFFTTL
FT                   VIQLCNGSIGPILALFIKSMAPDSNNIAFLAGMIAAVPGVSALISAPRLGKLGDRIGTS
FT                   RILLATLCCAVVMFFAMSFVTTPLQLGTLRFLLGFADGAMLPAVQTLLLKYSSDSVTGR
FT                   IFGYNQSFMYLGNVAGPLIGASVSAMAGFRWVFIATAIIVFINLWQLAWMLRQTRRANA
FT                   "
FT   gene            366706..366966
FT                   /gene="yaiB"
FT                   /locus_tag="KPN_00326"
FT   CDS_pept        366706..366966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiB"
FT                   /locus_tag="KPN_00326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00326"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75778"
FT                   /db_xref="GOA:A6T5A7"
FT                   /db_xref="InterPro:IPR019732"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T5A7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75778.1"
FT                   /translation="MKNLIAELLVKLAQKEEEAKELTVQVEALEIVVTALLRHMEHDAQ
FT                   QALIQDIEQAIDQVTPCPPVNDHDAMLLQQYLKKLLRHPRS"
FT   gene            367056..368486
FT                   /gene="phoA"
FT                   /locus_tag="KPN_00327"
FT   CDS_pept        367056..368486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoA"
FT                   /locus_tag="KPN_00327"
FT                   /product="alkaline phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00327"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75779"
FT                   /db_xref="GOA:A6T5A8"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR018299"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5A8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001952"
FT                   /protein_id="ABR75779.1"
FT                   /translation="MEMTKVKLSALFIALIPLLGSPVIHAETTAAPVLENRAAQGDITT
FT                   PGGARRLTGDQTEALRASLINKPAKNVILLIGDGMGDSEITAARNYAEGAGGFFKGIDA
FT                   LPLTGQYTHYSLDKKTGKPDYVTDSAASATAWTTGVKTYNGALGVDIHENAHQTILELA
FT                   KAAGLATGNVSTAELQDATPAALVAHVTSRKCYGPTVTSEKCPSNALEKGGKGSITEQL
FT                   LNARPDVTLGGGAKTFAETATAGEWQGKTLREQAQARGYQIVSDAASLAAATEASQDKP
FT                   LLGLFADGNMPVRWEGPKASYHGNIDKPPVTCTPNPKRDASVPTLAQMTEKAIDLLSRN
FT                   EKGFFLQVEGASIDKQDHAANPCGQIGETVDLDEAVQKALEFARKDGNTLVIVTADHAH
FT                   ASQIIPADSKAPGLTQALNTHDGAVMVMSYGNSEEESMEHTGTQLRIAAYGPHAANVVG
FT                   LTDQTDLFSTMKAALSLK"
FT   gene            368596..368895
FT                   /gene="psiF"
FT                   /locus_tag="KPN_00328"
FT   CDS_pept        368596..368895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psiF"
FT                   /locus_tag="KPN_00328"
FT                   /product="hypothetical protein"
FT                   /note="induced by phosphate starvation"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00328"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75780"
FT                   /db_xref="InterPro:IPR011690"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5A9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75780.1"
FT                   /translation="MTLLFGLIFISAVGAAEKTPTPQQQRMTDCNQQASAKMLKGEERK
FT                   TFMSQCLKKETTTSQGKALTPQQQKMSDCSKAATAKSLKGDERSTFMSSCLKKA"
FT   gene            complement(368962..369777)
FT                   /gene="proC"
FT                   /locus_tag="KPN_00329"
FT   CDS_pept        complement(368962..369777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="KPN_00329"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00329"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75781"
FT                   /db_xref="GOA:A6T5B0"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5B0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000304"
FT                   /protein_id="ABR75781.1"
FT                   /translation="MVMDKKIGFIGCGNMGKAILGGLIASGQVQPGQIWVYTPSPDKVA
FT                   ALRDQYGINAASSAQEVAQIADIVFGAVKPGIMTKVLGDIASSLNKESLVVSIAAGVTL
FT                   EQLARALGHDRKIIRAMPNTPSLVNAGMTSVTPNALVSSEDVAEVLTIFRCFGQAEQIA
FT                   EPMIHPVVGVSGSAPAYVFMFIEAMADAAVLGGMPRAQAYKFAAQAVMGSAKMVLESGE
FT                   HPGALKDMVCSPGGTTIEAVRVLEEKGFRSAVIEAITQCMEKSEKLSRS"
FT   gene            369888..370346
FT                   /gene="yaiI"
FT                   /locus_tag="KPN_00330"
FT   CDS_pept        369888..370346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiI"
FT                   /locus_tag="KPN_00330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00330"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75782"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T5B1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003791"
FT                   /protein_id="ABR75782.1"
FT                   /translation="MAIWVDADACPNVIKEILFRAAERTQTPLTLVANQPLRVPPSRFI
FT                   RTLRVEQGFDVADNEIVRQCAAGDLVITADIPLAAEVLAKGGAALNPRGERYSEASIRE
FT                   RLTMRDFMETLRASGVQTGGPDSLSQRDRQQFAAELEKWLLAVKRRQG"
FT   gene            complement(370343..371053)
FT                   /locus_tag="KPN_00331"
FT   CDS_pept        complement(370343..371053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00331"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00331"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75783"
FT                   /db_xref="InterPro:IPR018648"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5B2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75783.1"
FT                   /translation="MQSEEQRLIDGLFSRLKEAEAHSASRDASAEERIAQHVSAQPAAP
FT                   YYMAQTILIQEAAIKQLNDRIQALESQVSQLQAAKPSSGGFLSGLFGGGGSSRGSDPIP
FT                   GAEQYGRPQASAQPQYTPPPQQNYAPQAAARGGGFMAGALQTAAGVAGGVVLGNMLTNM
FT                   FSGSHPQEIVNIIEEKPQPDAASAQDSIAQDTTAGDDPFRQGDDQFLADNTWNDDFDAG
FT                   FGDDDFGSDDDSWV"
FT   gene            371382..371915
FT                   /gene="aroL"
FT                   /locus_tag="KPN_00332"
FT   CDS_pept        371382..371915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroL"
FT                   /locus_tag="KPN_00332"
FT                   /product="shikimate kinase II"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00332"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75784"
FT                   /db_xref="GOA:A6T5B3"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5B3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000623"
FT                   /protein_id="ABR75784.1"
FT                   /translation="MTQPIFLIGPRGCGKTTVGHALARARHFQFSDTDHRLQAHEQRTV
FT                   AEIVQAEGWARFRELETLSLKAVTLPNTVIATGGGIVLAEGNRQFMRENGVVIYLQASV
FT                   SALIDRLEAYPKAEQRPTLTGKPVREEVGEVLAQREALYRDAAHHIVDATASPDRVVEQ
FT                   IMSMLCSATATPVS"
FT   gene            371987..372178
FT                   /gene="yaiA"
FT                   /locus_tag="KPN_00333"
FT   CDS_pept        371987..372178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiA"
FT                   /locus_tag="KPN_00333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00333"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75785"
FT                   /db_xref="InterPro:IPR032303"
FT                   /db_xref="InterPro:IPR038462"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5B4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75785.1"
FT                   /translation="MPNRPPYPREARVVAVEKGPQGQTVTWYQLRADYPEPDSLISEHP
FT                   TEQEAVDAKRRYEDPDKS"
FT   gene            372434..373114
FT                   /gene="aroM"
FT                   /locus_tag="KPN_00334"
FT   CDS_pept        372434..373114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroM"
FT                   /locus_tag="KPN_00334"
FT                   /product="protein of aro operon, regulated by aroR"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00334"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75786"
FT                   /db_xref="InterPro:IPR010843"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5B5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR010843"
FT                   /protein_id="ABR75786.1"
FT                   /translation="MSSATMAILTIGVVPLAGVLPLLTEHIREEQIAHISLLGEMTPDE
FT                   VMAEYAVGDGEKGLLTLLSNNQLVMVSRQKIERDVRSAIAMLDRQHYDVILLLSSEQLT
FT                   GFTTHHAILLEPQRIIPPLVASIVDGHQVGVIVPVEEIMPMQRQKWLSLEKSPYYALAN
FT                   PFTGSDSELLTAGKTLLEQGADVLVLDCLGYYQHHRDVLQKALDVPVLLSNVLVSRLAA
FT                   ELLV"
FT   gene            373192..373476
FT                   /gene="yaiE"
FT                   /locus_tag="KPN_00335"
FT   CDS_pept        373192..373476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiE"
FT                   /locus_tag="KPN_00335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00335"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75787"
FT                   /db_xref="GOA:A6T5B6"
FT                   /db_xref="InterPro:IPR009664"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T5B6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR009664"
FT                   /protein_id="ABR75787.1"
FT                   /translation="MLQSNEYFDGKVKSIGFTSSSTGRASVGVMAEGEYTFGTAQPEEM
FT                   TVVSGALNVLLPGETEWKVYAAGEVFNVPGNSEFHLQVAEPTSYLCRYL"
FT   gene            complement(373548..374459)
FT                   /gene="rdgC"
FT                   /locus_tag="KPN_00336"
FT   CDS_pept        complement(373548..374459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdgC"
FT                   /locus_tag="KPN_00336"
FT                   /product="recombination associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00336"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75788"
FT                   /db_xref="GOA:A6T5B7"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T5B7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR007476"
FT                   /protein_id="ABR75788.1"
FT                   /translation="MLWFKNLMVYRLSRDIELRAEEMEKQLAELTFTPCGSQDMAKTGW
FT                   VSPMGSHSDALTHTANGQIIICARKEEKILPSPVIKQALEAKIQKLEADQGRKLKKTEK
FT                   DSLKDEVLHSLLPRAFSRFSQTMMWIDTVNGLIMVDCASAKKAEDTLALLRKTLGSLPV
FT                   VPLTLENPIELTLTEWVRSGTVAQGFQLLDEAELKAMLEDGGVIRAKKQDLVSDEIAVH
FT                   IEAGKVVTKLALDWQQRIQFVICDDASIKRLKFCDELRDQNEDIDREDFAQRFDADFIL
FT                   MTGELAALIQSLVEGLGGEAQR"
FT   gene            374516..375463
FT                   /gene="yajF"
FT                   /locus_tag="KPN_00337"
FT   CDS_pept        374516..375463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajF"
FT                   /locus_tag="KPN_00337"
FT                   /product="possible NAGC-like transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00337"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75789"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5B8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000600"
FT                   /protein_id="ABR75789.1"
FT                   /translation="MLALLIGEELSVRIGIDLGGTKTEVIALSDQGEQLFRHRLPTPRQ
FT                   DYRQTIETIATLVAMAEQATGQQGTVGMGIPGSISPYTGVVKNANSTWLNGQPFDKDLS
FT                   LRLEREVRLANDANCLAVSEAVDGAAAGAQTVFAVIIGTGCGAGVALNGRAHIGGNGNA
FT                   GEWGHNPLPWMNDDELRYRAEVPCYCGKQGCIETFISGTGFATDYQRLSGKGLTGSEIM
FT                   RLVGEGDEKAELALSRYEQRLAKSLAHVVNILDPDVIVLGGGMSNVERLYQTVPDLVKQ
FT                   WVFGGECETPIRKAMHGDSSGVRGAAWLWPLQGT"
FT   gene            complement(375537..378674)
FT                   /gene="sbcC"
FT                   /locus_tag="KPN_00338"
FT   CDS_pept        complement(375537..378674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbcC"
FT                   /locus_tag="KPN_00338"
FT                   /product="ATP-dependent dsDNA exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00338"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75790"
FT                   /db_xref="GOA:A6T5B9"
FT                   /db_xref="InterPro:IPR004592"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5B9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75790.1"
FT                   /translation="MKILSLRLKNLNSLKGEWKIDFTAEPFASNGLFAITGATGAGKTT
FT                   LLDAICLALYHETPRLNKVSQSQNDLMTRDTAECLAEVEFEVKGIAYRAFWSQNRARNQ
FT                   PDGNLQAPRVELARCADGKILADKVSDKLEQTATLTGLDYGRFTRSMLLSQGQFAAFLN
FT                   AKPSDRAELLEELTGTEIYGQISAMVYEQHKAARHALEKFEAQAAGIVLLTEAQQQALQ
FT                   ESLQVLTDEEKALLAQQQSQQQQLQWLTRRDELAQQQQQAATRQQQARQALADAAPALA
FT                   KLELAQPAAQLRPLWERQQEQTAGLAQTRQRISEVNARLLASTALRARIRQGALRAQQQ
FT                   RQAELADLAQWLAAHERFRLWGQEIAGWRAQFSQLTRDKQQLTAQSTRLAALRQKLATL
FT                   PASPLTLSADDVAAAIEQQTQSRPLRQRLLSLHEQHQLLRKRLRQNAESVQQAQAEQVK
FT                   LNATLTLRREQYKDKNQHYLDLKALCQREETIKDLESYRDRLEAGKPCPLCGACEHPAI
FT                   EQYASLTLTDNQRRRDALEKEVAALKEEGLLILGQVKALTQQLQRDTEAAGRLAEEEQA
FT                   LTKAWQETCASLHIARDIAQEINDWMQEQERYEQQLYQLSQRLMLQSQLNDQQALERQA
FT                   EQQLAATRQGLESALQALALSLPAEGTEAAWLHARESEFAQWQAQQTQHDAIQQQIAAL
FT                   RPLLETLPTSDETEVEAESAIPDNWREIHEECLSLHSQLVAQQQQETQEKARLDQSQAQ
FT                   FTSALAASRFSDREAFLAALLDDETAQRLTQLKQTLEQQLQQAAALCEQATRQHEAHLA
FT                   LRPQGVDADVPTLQTQLHALAQRLRDNTTRQGEIRQQLRQDAESRQQQQALGQQIAEAA
FT                   QLADDWGYLNSLIGSSTGDRFRKFAQGLTLDNLVWLANQQLNRLHGRYLLQRKASEALE
FT                   LEVVDTWQADAVRDTRTLSGGESFLVSLALALALSDLVSHKTRIDSLFLDEGFGTLDSE
FT                   TLDTALDALDALNASGKIIGVISHVEAMKDRIPVQIKVKKINGLGYSRLDKAFAVE"
FT   gene            complement(378671..379876)
FT                   /gene="sbcD"
FT                   /locus_tag="KPN_00339"
FT   CDS_pept        complement(378671..379876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbcD"
FT                   /locus_tag="KPN_00339"
FT                   /product="ATP-dependent dsDNA exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00339"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75791"
FT                   /db_xref="GOA:A6T5C0"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5C0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004843"
FT                   /protein_id="ABR75791.1"
FT                   /translation="MRLLHTSDWHLGQNFYSKSRAAEHDAFLTWLLDRAQEHEVDAIIV
FT                   AGDIFDTGSPPSYARELYNRFVVQLQQTGCRLVVLAGNHDSVAMLNESRDILAFLHTTV
FT                   VANAGYAPIELPLRDGTPGAIFCPVPFLRPRELVTSQAGHSGREKQQLLLHAISDYYQE
FT                   QYQQACALRGDRPLPIIASGHLTTVGASKSDAVRDIYIGTLDAFPAQHFPPADYIALGH
FT                   IHRAQMVGDCEHIRYSGSPLPLSFDETGKAKSVHLVSFSEGRLSAVETLEVPVTQPLAV
FT                   IKGDLATITAQLEQWRGVEQDPPVWLDIEITTEDYLHDIQRHIQALTEDLPVEVLLVRR
FT                   SREQREKILLNAQRETLSELKVEEVFERRLALTEIDEMKRARLHELFAHTVHTLTAEDE
FT                   NA"
FT   gene            380059..380748
FT                   /gene="phoB"
FT                   /locus_tag="KPN_00340"
FT   CDS_pept        380059..380748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoB"
FT                   /locus_tag="KPN_00340"
FT                   /product="positive response regulator for pho regulon,
FT                   sensor is PhoR (or CreC)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00340"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75792"
FT                   /db_xref="GOA:A6T5C1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011879"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5C1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001789"
FT                   /inference="protein motif:Pfam:IPR001867"
FT                   /protein_id="ABR75792.1"
FT                   /translation="MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEP
FT                   WPDLILLDWMLPGGSGLQFIKLLKREAMTRDIPVVMLTARGEEEDRVRGLETGADDYIT
FT                   KPFSPKELVARIKAVMRRISPMAVEEVIEMQGLSLDPSSHRVMTGDSPLDMGPTEFKLL
FT                   HFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALEHSGHDRMVQTVRGTG
FT                   YRFSARF"
FT   gene            380770..382065
FT                   /gene="phoR"
FT                   /locus_tag="KPN_00341"
FT   CDS_pept        380770..382065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoR"
FT                   /locus_tag="KPN_00341"
FT                   /product="positive and negative sensor protein for pho
FT                   regulon"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00341"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75793"
FT                   /db_xref="GOA:A6T5C2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR021766"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5C2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000014"
FT                   /inference="protein motif:Pfam:IPR003594"
FT                   /inference="protein motif:Pfam:IPR003661"
FT                   /protein_id="ABR75793.1"
FT                   /translation="MLERLSWKRLALELFLACIPALILGAFVGHLPWFLLAAVTGLLIW
FT                   HFWNLMRLSWWLWVDRSMTPPPGRGSWEPLLYGLHQMQMRNKKRRRELGSLIKRFRSGA
FT                   ESLPDAVVLTTEEGAIFWCNGLAQQILNLRWPDDSGQNILNLLRYPEFANYLKQRDFSK
FT                   PLNLVLNNARHLEIRVMPYSDKQWLMVARDVTQMHQLEGARRNFFANVSHELRTPLTVL
FT                   QGYLEMMQEQVLEGATREKALHTMREQTQRMEGLVKQLLTLSRIEAAPALAMNDRIDVP
FT                   MMLRVVEREAQTLSQEKQTLIFTVDEQLKVLGNEEQLRSAISNLVYNAVNHTPPGTEIR
FT                   VSWQRTPQGALFSVEDNGPGIAPEHIPRLTERFYRVDKARSRQTGGSGLGLAIVKHAVN
FT                   HHDSRLEIDSTVGNGTRFSFLLPERLIAKNDA"
FT   gene            382480..383799
FT                   /gene="brnQ"
FT                   /locus_tag="KPN_00342"
FT   CDS_pept        382480..383799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="brnQ"
FT                   /locus_tag="KPN_00342"
FT                   /product="branched chain amino acid transport system II
FT                   carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00342"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75794"
FT                   /db_xref="GOA:A6T5C3"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5C3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004685"
FT                   /protein_id="ABR75794.1"
FT                   /translation="MTHQLKSRDIIALGFMTFALFVGAGNIIFPPMVGLQAGEHVWTAA
FT                   IGFLITAVGLPVLTVVALAKVGGGVESLSTPIGKVAGILLAVVCYLAVGPLFATPRTAT
FT                   VSFEVGIAPLTGDGPLPLLIYSVIYFALVILVSLYPGKLLDTVGNFLAPLKIIALIVLA
FT                   VAAIIWPAGPISDALEAYRTAPFSNGFVNGYLTMDTLGAMVFGIVIVNAARSRGVSEAR
FT                   LLTRYTVWAGLMAGVGLTLLYLALFRLGSDSATLVDQSANGAAILHAYVQHTFGGAGSF
FT                   LLAALIFIACLVTAVGLTCACAEFFAQYLPFSYRTLVFVLGLFSMAVSNLGLSHLIQVS
FT                   IPVLTAIYPPCIALVVLSFTRSWWHNSSRVIAPAMFISLMFGIIDGIKSSAFAAILPDW
FT                   TARLPLAEQGLAWLMPTAVMTILAVIWDRAAGRQVTSSAH"
FT   gene            383940..385259
FT                   /gene="proY"
FT                   /locus_tag="KPN_00343"
FT   CDS_pept        383940..385259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proY"
FT                   /locus_tag="KPN_00343"
FT                   /product="proline permease transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00343"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75795"
FT                   /db_xref="GOA:A6T5C4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5C4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004841"
FT                   /protein_id="ABR75795.1"
FT                   /translation="MALGSAIGTGLFYGSADAIKMAGPSVLLAYIIGGVAAYIIMRALG
FT                   EMSVHNPAASSFSRYAQENLGGLAGYITGWTYCFEILIVAIADVTAFGIYMGVWFPTVP
FT                   HWIWVLSVVLIICAVNLMSVKVFGELEFWFSFFKVATIIIMILAGFGIIIWGIGNGGQP
FT                   TGIHNLWSNGGFFSNGWLGMVMSLQMVMFAYGGIEIIGITAGEAKDPEKSIPRAINSVP
FT                   MRILVFYVGTLFVIMSIYPWNQVGTDGSPFVLTFQHLGITFAASILNFVVLTASLSAIN
FT                   SDVFGVGRMLHGMAEQGSAPKVFAKTSRRGIPWVTVMVMTIALLFAVYLNYIMPENVFL
FT                   VIASLATFATVWVWIMILLSQIAFRRRLSPEEVKALKFKVPGGVVTTVIGLLFLAFIIA
FT                   LIGYHPDTRISLYVGMAWIALLLLGWVFKTRRERRLAQAQ"
FT   gene            385411..387228
FT                   /gene="malZ"
FT                   /locus_tag="KPN_00344"
FT   CDS_pept        385411..387228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malZ"
FT                   /locus_tag="KPN_00344"
FT                   /product="maltodextrin glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00344"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75796"
FT                   /db_xref="GOA:A6T5C5"
FT                   /db_xref="InterPro:IPR004185"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017069"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5C5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR006047"
FT                   /protein_id="ABR75796.1"
FT                   /translation="MLKAWHLPVAPFIKVQQDRLFITLWLSGESLPQRITLRAEEDNEE
FT                   LSLPMQRLRQAPQPGVVAWRGEISLASGQPRRRYSFKLLWADHQRWFTPQGFTRFPPAR
FT                   LEQFAIDLPDAGPQWVADQVFYQIFPDRFARSAARDADQDAVYYHHAAGREIVRKAWDD
FT                   PLTGEAGGSTFYGGDLDGISEKLPYLKQLGVTALYLNPVFAAPSVHKYDTEDYRRVDPQ
FT                   FGGDAALLRLRHNTQRAGMRMILDGVFNHTGDSHPWFDRHQQGSGGAGHDPDSPWRDWF
FT                   TFSEEGQAHNWLGYASLPKLDYRSTSLVNEIYAGEDSIVRHWLKAPWSMDGWRLDVVHM
FT                   LGEGGGARNNLQHIAGITQAAKQAQPEAFVFGEHFGDARQWLQADAEDAAMNYRGFTFP
FT                   IWGFLANTDISYDPQKIDAQTCMAWMDNYRAGLSHQQQLRMFNQLDSHDTARFKSLLGK
FT                   DVARLPLAVVWLFSWPGVPCIYYGDEVGVDGNNDPFCRKPFPWDPALQDTQLLALYQRM
FT                   AKLRKAHQALRYGGCQVIYAEDNVVVFVRVYKQQRVLVAINRGEACEVVIEDSPLLNVA
FT                   GWTLQEGAGAFQDGVLTLPAISANVWSGR"
FT   gene            complement(387225..388127)
FT                   /locus_tag="KPN_00345"
FT   CDS_pept        complement(387225..388127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00345"
FT                   /product="putative transcriptional regulator (LysR family)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00345"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75797"
FT                   /db_xref="GOA:A6T5C6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5C6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000847"
FT                   /inference="protein motif:Pfam:IPR005119"
FT                   /protein_id="ABR75797.1"
FT                   /translation="MRVNFDVLMILDALDRHGSFATAAESLYKTPAALSYMIQKLESDL
FT                   NIVLLDRSGHRAKFTDTGRLMLEKGRQLLSAARDLEKQAQQLSAGWERELAIALDASFP
FT                   FSALLPLIAEFYAQNPQTRLNFSHHTLAGSWEELTHHGADIILGAINEPPTSAEWSWQT
FT                   LGALDNIFVVAPHHPLAQAKEPLANKQLSQHRAIVIRDSARYCHPLNSNLLDEQPQIGV
FT                   DDFASKVELLYAGLGCGFLPRHIARPWLVKGSLVEKSVACWREKDITYMAWRSGNDGLA
FT                   QRWWREALLRGDLLSQLYH"
FT   gene            388394..389035
FT                   /locus_tag="KPN_00346"
FT   CDS_pept        388394..389035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00346"
FT                   /product="putative cysteine hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00346"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75798"
FT                   /db_xref="GOA:A6T5C7"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5C7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000868"
FT                   /protein_id="ABR75798.1"
FT                   /translation="MSIRELLDPTNSALIFIDHQPQMSFGVANIDRQTLKNNTVALAKA
FT                   GKIFNVPVIYTSVETKSFSGYIWPELLAVHPDVKPIERTSMNSWEDDAFVAAVKATGRK
FT                   KLVISALWTEVCLTFPALMALEAGYEVYVVTDTSGGTSVDAHERSIDRMVQAGAVPVTW
FT                   QQVLLEYQRDWSRKATYDAVMDLVREHSGAYGMGVDYAYTMVHGAPERKA"
FT   gene            389222..389767
FT                   /locus_tag="KPN_00347"
FT   CDS_pept        389222..389767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00347"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00347"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75799"
FT                   /db_xref="GOA:A6T5C8"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR038762"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5C8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR007138"
FT                   /protein_id="ABR75799.1"
FT                   /translation="MAQQKSVTLVISHLLDPQHSQRYEEWLGKIMPIAAEFPGHLGANV
FT                   IRPAAGQNLWSVIIRFDTLEHLYAWTQSETRRQLVAEIAPLLTEGDRTEVRTEPAFWFT
FT                   PPTVNVRQPRRWKQFLITLLVIFPSTNLVPAVTGMLLPSLKGSLLLHLINDACVVALVV
FT                   WFWMPIVTRLFAGWLKKN"
FT   gene            389792..391660
FT                   /locus_tag="KPN_00348"
FT   CDS_pept        389792..391660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00348"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00348"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75800"
FT                   /db_xref="GOA:A6T5C9"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5C9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75800.1"
FT                   /translation="MSQTATLILTHGQIHTLDRANPLAEAVAIADGKIVATGSHDRIMS
FT                   FAAEGTQIVDLKGHTVIPGLNDSHLHLIRGGLNYNLELRWEGVPSLADALRMLKDQADR
FT                   TPSPQWVRVVGGWSEFQFAERRMPTLEELNEAAPDTPVFVLHLYDRALLNRAALKAVGY
FT                   TKETPDPAGGEIVRDSHGNPTGMLIAKPNAMILYATLAKGPKLPLDLQVNSTRQFMREL
FT                   NRLGLTSAIDAGGGFQNYPEDYEIIEQLHAKDQMTVRIAYNLFTQRPKQELEDFERWTD
FT                   MLKPGQGTDFYRANGAGEMLVFSAADFEDFLQPRPDLPQGMEDELERVVRHLVEHRWPF
FT                   RLHATYDESISRMLDVFEKVNRDIPFNGLHWFFDHAETITERNIERVKALGGGLAVQHR
FT                   MAFQGEYFVDRYGKEAVKHTPPVAKMLALDVPVGLGTDATRVASYNPWTALYWLVSGRT
FT                   VGGMAMYDDANRLPRDVALELWTAGSAWFSSEQGKKGRLAAGQLADLVVLSKDYFSVAE
FT                   EEIKGIESVLTVVDGKVVYAAGHFSPLAPPPIPVLPEWSPVVKVPGHYRSAPPATAKIG
FT                   AMVQMHQCCGSCGVHGHQHDIARKSSIPVSDEQAFWGVLGCSCFAF"
FT   gene            complement(391719..392579)
FT                   /locus_tag="KPN_00349"
FT   CDS_pept        complement(391719..392579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00349"
FT                   /product="putative fructose-1,6-bisphosphate aldolase type
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00349"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75801"
FT                   /db_xref="GOA:A6T5D0"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR011289"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5D0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000771"
FT                   /protein_id="ABR75801.1"
FT                   /translation="MLVSMKDMLQHALRDGYAVGQFNINNLEWVGAVLSTAQQCRSPVI
FT                   LGVSGGTVKHMLGLKCIHDIVVNAMEYLHIDVPVALHLDHGTSREACEAAIAAGFSSIM
FT                   FDGSHLPFRENLAITRHLVTLAHSKGISVEAELGTIAGSEDGIVNSEVIYADPQECYTL
FT                   VTETQVDCLAAALGSTHGLYKGKARLGFTEMKAIAEQVKVPLVLHGGTGIADEDMRRAI
FT                   ACGTAKINVNTENMYAWCQQVKAIFAADTGHDVNDPRKVIAQGLQPVREMIARRMALFG
FT                   SEQRY"
FT   gene            complement(392609..393571)
FT                   /locus_tag="KPN_00350"
FT   CDS_pept        complement(392609..393571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00350"
FT                   /product="putative kinase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00350"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75802"
FT                   /db_xref="GOA:A6T5D1"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5D1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002173"
FT                   /protein_id="ABR75802.1"
FT                   /translation="MAILSIGFACFDQFFFLNEWPQENTKNFCHDFIESGGGPAANAAW
FT                   LLGLWGEEVYYIGHLQQDLYGQRIIDEFAEAGVDTSQVVFSDDMITPLASVLVNRLTGS
FT                   RTIITRKMQTPPSLTYEQKLKLDDLAERLIASEEPVTILIDGHEAEISEYLIKKLPNAR
FT                   VVMDGGSLRASNIKLAAWTDYFVVSEHFARDYMSYRSLSTEAEIKAALIELNKICRGEA
FT                   FITLGEKGCAFLKSGMLQIVPSWLCNAVDTTGAGDVFHGAFTYGVHYSWHIDNIILFAS
FT                   LTAAISIEKKGVRESMPDLAVVHHSLNSYERNLTQYFEE"
FT   gene            complement(393637..394974)
FT                   /locus_tag="KPN_00351"
FT   CDS_pept        complement(393637..394974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00351"
FT                   /product="putative sugar-specific permeas"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00351"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75803"
FT                   /db_xref="GOA:A6T5D2"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5D2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR007333"
FT                   /protein_id="ABR75803.1"
FT                   /translation="MGLIAFVGLVALRSPGNKLLTGTLKPILGYLMLSAGAGVIVANLN
FT                   PLGGIIEAGFNIRGVIPNNEAIVSVAQKMLGVETMSILLLGFIFNLIIARCTKYKYIFL
FT                   TGHHSFFLACLFSAVLQAAEFQGWMLILIGGFLLGSWSAISPAIGQRYTRQVTEDGGIA
FT                   MGHFGSLGYYLSAWIASRTGNPANSFADTEISEKWGFLRDTTVTTGIVMFVIYFVCSAV
FT                   AGSAYLSTITDQNMLIFSVLTGLQFAVGVAIVYNGVRLILGDLVPAFQGISQKLIPDSI
FT                   PAVDCAVFFTFSPTAVVVGFISSFVGGLVGMLLLGGLGMALIIPGMVPHFFCGGTSGVF
FT                   ADKLGGKRGCIIASFIGGIFLAFLPAMLLPALGNLGFENSTFADFDFAVWGIIIGNAFT
FT                   QFGQITIYLICLALLVALLAPFCFRHVQVVGNTLSYEELTARQKNE"
FT   gene            complement(395049..395336)
FT                   /locus_tag="KPN_00352"
FT   CDS_pept        complement(395049..395336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00352"
FT                   /product="putative phosphotransferase system,
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00352"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75804"
FT                   /db_xref="GOA:A6T5D3"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5D3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003501"
FT                   /protein_id="ABR75804.1"
FT                   /translation="MLVIRTVCGNGIGSSLMAANNVKKICDELGIKADVASVDFANAVG
FT                   EKADLYVTIKELANQFPAHCHVAIIRSYVHKAKIAEDITDALMKIAATHS"
FT   gene            complement(395342..395785)
FT                   /locus_tag="KPN_00353"
FT   CDS_pept        complement(395342..395785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00353"
FT                   /product="putative phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00353"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75805"
FT                   /db_xref="GOA:A6T5D4"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5D4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002178"
FT                   /protein_id="ABR75805.1"
FT                   /translation="MEIIFDPSLIALKQNISHAEEAIELAGSLLARRQICSAEYVNEML
FT                   TVYEDFGAAIVIDDGIAMPHARPEKGALQTGFSLVTTARPISFGHDEFDPVSVVIAIAG
FT                   ADADSHIKMIQLIASLIESDIVTFLQQENDVNSVLHFIQKQME"
FT   gene            complement(396132..396734)
FT                   /locus_tag="KPN_00354"
FT   CDS_pept        complement(396132..396734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00354"
FT                   /product="putative thiol-alkyl hydroperoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00354"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75806"
FT                   /db_xref="GOA:A6T5D5"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5D5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000866"
FT                   /protein_id="ABR75806.1"
FT                   /translation="MVLVTRQAPDFTAAAVLGNGEIVEKFNFKQHTNGKPTVLFFWPMD
FT                   FTFVCPSELIAFDKRYEEFQKRGVEVVGVSFDSEFVHNAWRNTPVDQGGIGPVKYAMVA
FT                   DIKREIQKAYGIEHPDEGVALRGSFLIDANGVVRHQVVNDLPLGRNIDEMLRMVDALQF
FT                   HEEHGEVCPAQWEKGKEGMAASPEGVAKYLTENVSSL"
FT   gene            complement(396862..397443)
FT                   /gene="yajB"
FT                   /locus_tag="KPN_00355"
FT   CDS_pept        complement(396862..397443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajB"
FT                   /locus_tag="KPN_00355"
FT                   /product="putative glycoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00355"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75807"
FT                   /db_xref="GOA:A6T5D6"
FT                   /db_xref="InterPro:IPR007431"
FT                   /db_xref="InterPro:IPR023491"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T5D6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR007431"
FT                   /protein_id="ABR75807.1"
FT                   /translation="MNFLAHLHLAHLADSSLPGNLMADFVRGNPQGDYPAEIIDGIYMH
FT                   RRIDVMTDNLAEVKEAREWFRPQTRRVAPITLDVMWDHFLSQHWAQLSPDLPLDEFVRY
FT                   AERQIVPILPDSPPRFVNLNQYLWSERWLERYREMDFIQRVLNGMASRRPRLEALRDSW
FT                   QDLDTHYDRLETQFWRFYPQMMRLAENKQL"
FT   gene            397699..398763
FT                   /gene="queA"
FT                   /locus_tag="KPN_00356"
FT   CDS_pept        397699..398763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="KPN_00356"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00356"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75808"
FT                   /db_xref="GOA:A6T5D7"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T5D7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003699"
FT                   /protein_id="ABR75808.1"
FT                   /translation="MRVTDFAFELPESLIAHYPMPERSSCRLLSLDGPTGALTHGTFTD
FT                   ILDKLNPGDLLVFNNTRVIPARLFGRKASGGKIEVLVERMLDDKRILAHIRASKAPKPG
FT                   AELLLGDDESIKATMLARHGALFEVEFNDERPVLEILNGIGHMPLPPYIDRPDEDADRE
FT                   LYQTVYGTRPGAVAAPTAGLHFDEPLLDKLRAKGVEMAFVTLHVGAGTFQPVRVDSIEE
FT                   HTMHSEYAEVPQEVVDAVLAAKARGNRVIAVGTTSVRSLESAAQAAKDALIAPFFDDTQ
FT                   IFIYPGYQYQVIDALVTNFHLPESTLIMLVSAFAGYQHTMNAYKVAVEQKYRFFSYGDA
FT                   MFITYNPQAISERP"
FT   gene            398872..399999
FT                   /gene="tgt"
FT                   /locus_tag="KPN_00357"
FT   CDS_pept        398872..399999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="KPN_00357"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00357"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75809"
FT                   /db_xref="GOA:A6T5D8"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T5D8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002616"
FT                   /protein_id="ABR75809.1"
FT                   /translation="MKFELDTTDGRARRGRLVFERGVVETPAFMPVGTYGTVKGMTPEE
FT                   VEATGAQIILGNTFHLWLRPGQEIMKLHGDLHDFMQWKGPILTDSGGFQVFSLGDIRKI
FT                   TEQGVHFRNPINGDPIFLDPEKSMEIQYDLGSDIVMIFDECTPYPADWDYAKRSMEMSL
FT                   RWAKRSRDRFDSLGNKNALFGIIQGSVYEDLRDISVKGLVEIGFDGYAVGGLAVGEPKE
FT                   DMHRILEHVCPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTD
FT                   GVVKIRNAKHKSDTAPLDAECDCYTCRNYSRAYLHHLDRCNEILGARLNTIHNLRYYQR
FT                   LMAGLRKAIEEGKLESFVTDFYQRQGRTVPPLNVD"
FT   gene            400022..400354
FT                   /gene="yajC"
FT                   /locus_tag="KPN_00358"
FT   CDS_pept        400022..400354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajC"
FT                   /locus_tag="KPN_00358"
FT                   /product="preprotein translocase subunit YajC"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00358"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75810"
FT                   /db_xref="GOA:A6T5D9"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5D9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003849"
FT                   /protein_id="ABR75810.1"
FT                   /translation="MSFFISDAVAATGAPAQGSPMSLILMLVVFGLIFYFMILRPQQKR
FT                   TKEHKNLMNSIAKGDEVLTNGGLVGRVTKVAETGYIAIALNDTTEVVIKRDFVAAVLPK
FT                   GTMKAL"
FT   gene            400414..402228
FT                   /gene="secD"
FT                   /locus_tag="KPN_00359"
FT   CDS_pept        400414..402228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="KPN_00359"
FT                   /product="protein export protein SecD"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00359"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75811"
FT                   /db_xref="GOA:A6T5E0"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5E0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003335"
FT                   /protein_id="ABR75811.1"
FT                   /translation="MLVVVIVVGLIYALPNLYGEDPAVQITGARGVAASEQTLIQVQKT
FT                   LQEEKITAKSVALEEGAILARFDTTDTQLRAREALLNVLGDKYVVALNLAPATPRWLAA
FT                   LYAEPMKLGLDLRGGVHFLMEVDMDTALGKLQEQNIDSLRSELRDKGIPYATVRKEDNY
FT                   GLSIVFRDSAARDQAISYLSPRHRDLVISSQGDNSLKAVMTDERLKEAREYAVQQNINI
FT                   LRNRVNQLGVAEPLVQRQGADRIVVELPGIQDTARAKEILGATATLEFRLVNTNVDQSA
FT                   AASGRVPGDSEVKQTREGQPVVLYKRVILTGDHITDSTSSMDEYNQPQVNISLDSAGGN
FT                   IMSNFTKDNIGKPMATLFVEYKDSGKKDANGRAILAKEEEVINIANIQSRLGNSFRITG
FT                   ISNPNEARQLSLLLRAGALIAPIQIVEERTIGPTLGMQNIKQGLEACLAGLVVSILFMI
FT                   LFYKKFGLIATSALIANLILIVGIMSLIPGATLTMPGIAGIVLTLAVAVDANVLINERI
FT                   KEELSNGRTVQQAIDEGYRGAFSSIFDANVTTLIKVIILYAVGTGAIKGFAITTGIGIA
FT                   TSMFTAIVGTRAIVNLLYGGKRVKKLSI"
FT   gene            402239..403210
FT                   /gene="secF"
FT                   /locus_tag="KPN_00360"
FT   CDS_pept        402239..403210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="KPN_00360"
FT                   /product="protein export protein SecF"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00360"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75812"
FT                   /db_xref="GOA:A6T5E1"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5E1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003335"
FT                   /protein_id="ABR75812.1"
FT                   /translation="MAQEYTVEQLNHGRKVWDFMRWDYWAFGISGFLLIVSIAIIGVRG
FT                   FNWGLDFTGGTVIEITLEKPVDLDQMRDSLQKAGFEEPQVQNFGSSRDIMVRMPPVHDA
FT                   NGSQELGSKVVTVINESTSQNAAVKRIEFVGPSVGADLAQTGALALIAALVCILIYVGF
FT                   RFEWRLAAGVVIALAHDVVITMGVLSLFHIEIDLTIVASLMSVIGYSLNDSIVVSDRIR
FT                   ENFRKIRRGTPYEIFNVSLTQTLHRTLITSGTTLMVILMLFLFGGPILEGFSLTMLIGV
FT                   SIGTASSIYVASALALKLGMKREHLIQQKVEKEGADQPSILP"
FT   gene            403347..403712
FT                   /locus_tag="KPN_00361"
FT   CDS_pept        403347..403712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00361"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00361"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75813"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5E2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004360"
FT                   /protein_id="ABR75813.1"
FT                   /translation="MNNVINWFEIPVADMDRAVAFYEPLMQVSLRRETMDCAELAVFPH
FT                   QDPAPGGALAKFEGIAPSAQGAIIYLHTDHLAATLERVASAGGACVFGPLTLPNDIGTI
FT                   ALFTDSEGNRVGLHQPA"
FT   gene            403736..404431
FT                   /locus_tag="KPN_00362"
FT   CDS_pept        403736..404431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00362"
FT                   /product="putative deoR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00362"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75814"
FT                   /db_xref="GOA:A6T5E3"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5E3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75814.1"
FT                   /translation="MTRRADRLFQIVQILRGRRLTTAALLAERLGVSERTVYRDIRDLS
FT                   LSGVPVEGEAGSGYRLLAGYDLPPLMLTTKESEALIAAIRLLKTWGGEALSQSLESAQE
FT                   KMLAILPEARRRQAEQTRLFAPDLGAHRYAKTHFDVIHQAVSNQKVLQLRYQDESGQVT
FT                   WREVLPLGLFFWGERWLLVAWCELRNDYRNFRLDRCLEVRRTERRFSECADRSLSDFLR
FT                   KVRCEVREK"
FT   gene            complement(404486..405370)
FT                   /gene="tsx"
FT                   /locus_tag="KPN_00363"
FT   CDS_pept        complement(404486..405370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsx"
FT                   /locus_tag="KPN_00363"
FT                   /product="nucleoside channel; receptor of phage T6 and
FT                   colicin K"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00363"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75815"
FT                   /db_xref="GOA:A6T5E4"
FT                   /db_xref="InterPro:IPR003055"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5E4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003055"
FT                   /protein_id="ABR75815.1"
FT                   /translation="MKKTLLAAGAVVALSTTFAAGAAENDKPQYLSDWWHQSVNVVGSY
FT                   HTRFGPQIRNDTYLEYEAFAKKDWFDFYGYIDAPVFFGGNSTAKGIWNKGSPLFMEIEP
FT                   RFSIDKLTNTDLSFGPFKEWYFANNYIYDMGRNDSQEQSTWYMGLGTDIDTGLPMSLSL
FT                   NVYAKYQWQNYGASNENEWDGYRFKVKYFVPLTDLWGGSLSYIGFTNFDWGSDLGDDNF
FT                   YDLNGKHARTSNSIASSHILALNYAHWHYSIVARYFHNGGQWADDAKLNFGDGPFSVRS
FT                   TGWGGYFVVGYNF"
FT   gene            complement(405669..406208)
FT                   /gene="yajI"
FT                   /locus_tag="KPN_00364"
FT   CDS_pept        complement(405669..406208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajI"
FT                   /locus_tag="KPN_00364"
FT                   /product="hypothetical lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00364"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75816"
FT                   /db_xref="InterPro:IPR021658"
FT                   /db_xref="InterPro:IPR037125"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5E5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75816.1"
FT                   /translation="MTRRYLKLAIAGCLFTLTACAQQSEIRQMHQSVSTLSQEMTQLNQ
FT                   QTIKITQQNALNAKSTRGVYLLPEAKTPARLESQIGTLRMSVGSITPDGDGSRLTLRIQ
FT                   GESNDPLPAFTATVASGQITGTTHSYQEVNVQDQLISAPASTLAPSDVDIPLRLNVTPD
FT                   KVGFIRVHDIQPAAAQ"
FT   gene            406356..406805
FT                   /gene="ybaD"
FT                   /locus_tag="KPN_00365"
FT   CDS_pept        406356..406805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaD"
FT                   /locus_tag="KPN_00365"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00365"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75817"
FT                   /db_xref="GOA:A6T5E6"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T5E6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR005144"
FT                   /protein_id="ABR75817.1"
FT                   /translation="MHCPFCFAVDTKVIDSRLVGEGSSVRRRRQCLVCNERFTTFEVAE
FT                   LVMPRVVKSNDVREPFNEDKLRSGMLKALEKRPVSADDVEMAVNHIKTHLRGTGEREVA
FT                   SKMIGNLVMEQLKKLDKVAYIRFASVYRSFEDIKEFGEEIARLQD"
FT   gene            406809..407912
FT                   /gene="ribD"
FT                   /locus_tag="KPN_00366"
FT   CDS_pept        406809..407912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="KPN_00366"
FT                   /product="bifunctional
FT                   diaminohydroxyphosphoribosylaminopyrimidine deaminase/
FT                   5-amino-6-(5-phosphoribosylamino) uracil reductase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00366"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75818"
FT                   /db_xref="GOA:A6T5E7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5E7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002125"
FT                   /inference="protein motif:Pfam:IPR002734"
FT                   /protein_id="ABR75818.1"
FT                   /translation="MQDEMYMARALKLAARGRFTTHPNPNVGCVIVKDGEIVGEGFHYR
FT                   AGEPHAEVHALRMAGEKARGATAYVTLEPCSHHGRTPPCCDALIAAGVSRVVAAMQDPN
FT                   PQVAGRGLYRLQQAGIEVSHGLMMNEAEALNKGFLKRMRTGFPWVQLKLGASLDGRTAM
FT                   ASGESQWITSPQARRDVQRLRAQSHAILTSSATVLADDPALTVRWQELSADTQALYPEE
FT                   NLRQPLRVVIDSQNRVTPEHRIVQQAGETLFARLRADARQWPESARTLLVPEHNGHLDL
FT                   VLLMMLLGKQQINSVWVEAGATLAGALLQAGLVDELIVYIAPKLLGNTARGLCALPGLE
FT                   ELSQAPHFKFNEIRQVGPDVCLHLTTA"
FT   gene            408000..408470
FT                   /gene="ribH"
FT                   /locus_tag="KPN_00367"
FT   CDS_pept        408000..408470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="KPN_00367"
FT                   /product="riboflavin synthase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00367"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75819"
FT                   /db_xref="GOA:A6T5E8"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T5E8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002180"
FT                   /protein_id="ABR75819.1"
FT                   /translation="MNIIEANVATPDARVAITIARFNNFINDSLLEGAIDALKRIGQVK
FT                   DENITVVWVPGAYELPLAAGALAKTGKYDAVIALGTVIRGGTAHFEYVAGGASNGLAHV
FT                   AQDSEIPVAFGVLTTESIEQAIERAGTKAGNKGAEAALTALEMINVLKAIKA"
FT   gene            408490..408909
FT                   /gene="nusB"
FT                   /locus_tag="KPN_00368"
FT   CDS_pept        408490..408909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="KPN_00368"
FT                   /product="transcription antitermination protein NusB"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00368"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75820"
FT                   /db_xref="GOA:A6T5E9"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T5E9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR006027"
FT                   /protein_id="ABR75820.1"
FT                   /translation="MKPAARRRARECAVQALYSWQLSHNDIADVEYQFLAEQDVKDVDV
FT                   LYFRELLSGVATNSAYLDGLMKPYLSRQLEELGQVEKAVLRIALFELSKRDDVPYKVAI
FT                   NEAIELAKTFGAEDSHKFVNGVLDKAAPVIRPHKK"
FT   gene            408981..409952
FT                   /gene="thiL"
FT                   /locus_tag="KPN_00369"
FT   CDS_pept        408981..409952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="KPN_00369"
FT                   /product="thiamine monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00369"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75821"
FT                   /db_xref="GOA:A6T5F0"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5F0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR010918"
FT                   /protein_id="ABR75821.1"
FT                   /translation="MACGEFSLIARYFDRVKSARLDVETGIGDDCALLHIPEKKTLAIS
FT                   TDTLVAGNHFLPDIDPADLAYKALAVNLSDLAAMGAEPAWLTLALTLPEVDEVWLEAFS
FT                   DSLFVQLDYYDMQLIGGDTTRGPLSMTLGIHGFVPPGRAMKRAGAKPGDWIYVTGTPGD
FT                   SAAGLAVLQNRLTVDEPSDADYLLARHLRPMPRVLQGQALRDLATSAIDLSDGLISDLG
FT                   HILKASGCGARIDLDAMPYSDAMLRQVDSEQALRWALAGGEDYELCFTVPELNRGALDV
FT                   ALGHLGARFTCIGQIAPESEGLQFIRDGKPVALDLKGYDHFA"
FT   gene            409981..410448
FT                   /gene="pgpA"
FT                   /locus_tag="KPN_00370"
FT   CDS_pept        409981..410448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgpA"
FT                   /locus_tag="KPN_00370"
FT                   /product="phosphatidylglycerophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00370"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75822"
FT                   /db_xref="GOA:A6T5F1"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5F1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR007686"
FT                   /protein_id="ABR75822.1"
FT                   /translation="MRNPWHLLATGFGSGLSPVVPGTMGSLAAIPFWYLMTFLPWQLYS
FT                   LVVMMSICIGVYLCHRTAKDMGTHDHGSIVWDEFVGMWITLMALPTLDWQWVAAGFVIF
FT                   RIFDMWKPWPIRWFDRNIHGGMGIMVDDIVAGVISAGVLYVIGHHWPIGLL"
FT   gene            complement(410494..411408)
FT                   /gene="yajO"
FT                   /locus_tag="KPN_00371"
FT   CDS_pept        complement(410494..411408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajO"
FT                   /locus_tag="KPN_00371"
FT                   /product="putative NAD(P)H-dependent xylose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00371"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75823"
FT                   /db_xref="GOA:A6T5F2"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5F2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001395"
FT                   /protein_id="ABR75823.1"
FT                   /translation="MTFGEPDRGRHAWTLPEESSRPLIQHAIEGGINFFDTANSYSDGS
FT                   SEEIVGRALRDFARRDEVVVATKVYHQVGDLAEGLSRAQILRSIDDSLRRLGMDYVDLL
FT                   QIHRWDYTTPIEETLEALDEVVKAGKARYIGASSMHARQFAQALALQQQNGWARFVTMQ
FT                   DHYNLIYREEENEMLPLCQRNGVAVIPWSPLARGRLTRPWGETTARLVSDEFGKSLYSA
FT                   SEENDAQIAGNLADVAEELDASRAQVALAWLLSKPGVAAPIIGPSRQEQLDDLLQAVDL
FT                   TLSPEQIDKLEAPYQPHPVVGFK"
FT   gene            complement(411529..413391)
FT                   /gene="dxs"
FT                   /locus_tag="KPN_00372"
FT   CDS_pept        complement(411529..413391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxs"
FT                   /locus_tag="KPN_00372"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00372"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75824"
FT                   /db_xref="GOA:A6T5F3"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T5F3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR005475"
FT                   /inference="protein motif:Pfam:IPR005476"
FT                   /protein_id="ABR75824.1"
FT                   /translation="MSFDIAKYPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSR
FT                   SSGHFASGLGTVELTVALHYVYNTPFDRLIWDVGHQAYPHKILTGRRDKIGTIRQKGGL
FT                   HPFPWRGESEYDVLSVGHSSTSISAGIGVAIAAAKEDKQRRAVCVIGDGAITAGMAFEA
FT                   MNHAGDIKPDLLVVLNDNEMSISENVGALNNHLAQLLSGKLYSTLREGGKKVFSGVPPI
FT                   KELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVLGLVSTLKNMRDLKGPQFLHIM
FT                   TKKGRGYEPAEKDPITFHAVPKFDHTSGVLPKSSGGLPSYSKIFGDWLCETAAKDNKLM
FT                   AITPAMREGSGMVEFSKKFPDRYFDVAIAEQHAVTFAAGLAIGDYKPVVAIYSTFLQRA
FT                   YDQVIHDVAIQKLPVLFTIDRAGIVGADGQTHQGAFDLSFLRCIPDMVVMTPSDENECR
FT                   QMLYTGYHYSDGPCAVRYPRGSGTGATLEPLASLPIGKGVVKRQGEKIAILNFGTLLPE
FT                   AAAVADKLNATLVDMRFVKPLDTALILQLAGEHDALVTLEENAIMGGAGSGVNEVLMAH
FT                   RRAVPVLNIGLPDYFIPQGTQEEIRADLGLDAAGIEAKIRDWLA"
FT   gene            complement(413410..414309)
FT                   /gene="ispA"
FT                   /locus_tag="KPN_00373"
FT   CDS_pept        complement(413410..414309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispA"
FT                   /locus_tag="KPN_00373"
FT                   /product="geranyltranstransferase (farnesyldiphosphate
FT                   synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00373"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75825"
FT                   /db_xref="GOA:A6T5F4"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5F4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000092"
FT                   /protein_id="ABR75825.1"
FT                   /translation="MDFPQQLQACVEQANEALRRFIAPQPFQNTPLVEAMHYGALLGGK
FT                   RLRPFLVYATGEMFGVCRTTLDAPAAAVECIHAYSLMHDDLPAMDDDDLRRGLPTCHIK
FT                   FGEANAILAGDALQTLAFSILSDAPMVDVPDRDRLAMVSELAQASGVAGMCGGQALDLQ
FT                   AEGQQVDLQALERIHRHKTGALIRAAVRMGALSAGERGRAALPALDRYAENIGLAFQVQ
FT                   DDILDVVGDTATLGKRQGADQQLGKSTYPALLGLEQARKKAHDLIADARRSLDELAAQS
FT                   LDTSALEALANYIIQRDK"
FT   gene            complement(414310..414552)
FT                   /gene="xseB"
FT                   /locus_tag="KPN_00374"
FT   CDS_pept        complement(414310..414552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="KPN_00374"
FT                   /product="exodeoxyribonuclease VII small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00374"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75826"
FT                   /db_xref="GOA:A6T5F5"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T5F5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003761"
FT                   /protein_id="ABR75826.1"
FT                   /translation="MPKKNEAPASFETALGELEQIVNRLESGDLPLEEALSEFERGVQL
FT                   ARQGQSQLQKAEQRVQILLADSEDSPTTPFTPDAE"
FT   gene            414734..416182
FT                   /gene="thiI"
FT                   /locus_tag="KPN_00375"
FT   CDS_pept        414734..416182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiI"
FT                   /locus_tag="KPN_00375"
FT                   /product="thiamine biosynthesis protein ThiI"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00375"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75827"
FT                   /db_xref="GOA:A6T5F6"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR003720"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="InterPro:IPR026340"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T5F6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003720"
FT                   /inference="protein motif:Pfam:IPR004114"
FT                   /protein_id="ABR75827.1"
FT                   /translation="MKFIIKLFPEITIKSQSVRLRFIKILTGNIRNVLKNYDETLAVVR
FT                   HWDHIEVRAKDENQRPAIRDALTRIPGIHHILEVEDVPFTSLHDIFEQTLPLWREALEG
FT                   KTFCVRVKRRGKHEFTSIEVERYVGGGLNQHIETARVKLTDPDVTVNLEIENDRLLLVK
FT                   GRYEGIGGFPIGTQEDVLSLISGGFDSGVSSYMLMRRGCRVHYCFFNLGGAAHEIGVRQ
FT                   VAHYLWNRFGSSHRVRFVAINFEPVVGEILEKVDDGQMGVVLKRMMVRAASKVAERYGV
FT                   QALVTGEALGQVSSQTLTNLRLIDNVSDTLILRPLISHDKEHIIDLAREIGTEDFARTM
FT                   PEYCGVISKSPTVKAVKAKIEAEEEHFDFSILDKVVEEASNIDIREIAQQTEETVVEVE
FT                   TVTGFGANDAILDIRSIDEQEDKPLKVEGVEVVSLPFYKLSTKFGDLDQSKTWLLWCER
FT                   GVMSRLQALYLREQGFSNVKVYRP"
FT   gene            complement(416249..416725)
FT                   /locus_tag="KPN_00376"
FT   CDS_pept        complement(416249..416725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00376"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00376"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75828"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5F7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75828.1"
FT                   /translation="MSRSATDSRDLVISRLLSAPAPALWRAWADPALLRTWWCPKPWQT
FT                   EVLAFDFRAGGAFHTVMHGPDGERSDNPGCFLEVIPQQKIVMTSMLTADYRPAVSPFAM
FT                   TAIITFADEQGGCRYTATVLHADDETREQHEQMGFFEGWNIVIDQLNDLALTLR"
FT   gene            complement(416776..417369)
FT                   /gene="thiJ"
FT                   /locus_tag="KPN_00377"
FT   CDS_pept        complement(416776..417369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiJ"
FT                   /locus_tag="KPN_00377"
FT                   /product="4-methyl-5(beta-hydroxyethyl)-thiazole
FT                   monophosphate biosynthesis enzyme (thiamine biosynthesis)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00377"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75829"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006287"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5F8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002818"
FT                   /protein_id="ABR75829.1"
FT                   /translation="MSASALICLAPGSEETEAVTTIDLLVRGGVKVTTASVASDGSLTI
FT                   VCSRGAKLLADAPLVEVADGDFDIIVLPGGIKGAECFRDSTLLVETVRQFHLSGRIVAA
FT                   ICAAPATVLVPHNLFPIGNMTGFPALKEHIPAEQWQDKRVVWDPRVNLLTSQGPGTSID
FT                   FALKMIDLLVGREKAYEVASQLVMAAGIYNYYEA"
FT   gene            complement(417332..418243)
FT                   /gene="apbA"
FT                   /locus_tag="KPN_00378"
FT   CDS_pept        complement(417332..418243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apbA"
FT                   /locus_tag="KPN_00378"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00378"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75830"
FT                   /db_xref="GOA:A6T5F9"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5F9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003710"
FT                   /protein_id="ABR75830.1"
FT                   /translation="MKVTVLGCGALGQLWLTALYKQGHEVQGWLRVPQPFCSVNVIETD
FT                   GSVFNESLTANDPDFLASSELLIVTLKAWQVSNAVKHLAGILSDTTPIVLIHNGMGTVE
FT                   ELRGVKQPLLLASTTQAARRDGNVIIHVAQGTTHIGPAKSYEGDYSYLAEVLQSVLPDV
FT                   AWHNNIHSAIWRKLAVNCVINPLTALKGCKNGDLRDYTQEVAAICREVAAVMEREGIHT
FT                   SAENLLFYVEQVIESTAENISSMLQDVRAQRHTEIDYITGFLLNRARAHGVAVPENARL
FT                   FELIKRKENEYERVGTDLPRPW"
FT   gene            418435..418926
FT                   /gene="yajQ"
FT                   /locus_tag="KPN_00379"
FT   CDS_pept        418435..418926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajQ"
FT                   /locus_tag="KPN_00379"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00379"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75831"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T5G0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR007551"
FT                   /protein_id="ABR75831.1"
FT                   /translation="MPSFDIVSEVDLQEARNAVDNASREVESRFDFRGVEATFELNDAN
FT                   KTIKVLSESDFQVNQLLDILRAKLLKRGIEGTSLDVPEDIVHSGKTWFVEAKLKQGIES
FT                   AVQKKIVKMIKDSKLKVQAQIQGEEIRVTGKSRDDLQSVMALVRGGDLGQPFQFKNFRD
FT                   "
FT   gene            complement(418970..420334)
FT                   /gene="yajR"
FT                   /locus_tag="KPN_00380"
FT   CDS_pept        complement(418970..420334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajR"
FT                   /locus_tag="KPN_00380"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00380"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75832"
FT                   /db_xref="GOA:A6T5G1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5G1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR005828"
FT                   /protein_id="ABR75832.1"
FT                   /translation="MNDNKMTPGELRATWGLGTVFSLRMLGMFMVLPVLTTYGMALQGA
FT                   SEALIGLAIGIYGLAQAVFQIPFGLLSDRIGRKPLIVGGLLIFVLGSVIAALTDSIWGI
FT                   ILGRALQGSGAIAAAVMALLSDLTREQNRTKAMAFIGVSFGVTFAIAMVLGPIVTHQLG
FT                   LHALFWMIAILATVGILLTLWVVPNSHNHVLNRESGMVKGCFSKVLAEPRLLKLNFGIM
FT                   CLHIMLMSTFVALPGQLEAAGFPAAEHWKIYLVTMVISFISVVPFIIYAEVKRKMKRVF
FT                   LLCVAILLIAEIVLWGAGGYFWELVAGVQLFFLAFNLLEALLPSLISKESPAGYKGTAM
FT                   GVYSTSQFLGVAIGGALGGWVDGFFDSQTVFLLGALLAMLWLLVASTMSEPPYVSSLRV
FT                   EVPDGVVVDSALQARLLSASGVHQALVVPEERSVYIKIDSKVTNRFEIEQLIKGV"
FT   gene            complement(420494..421672)
FT                   /locus_tag="KPN_00381"
FT   CDS_pept        complement(420494..421672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00381"
FT                   /product="Oxidoreductase"
FT                   /note="Oxidoreductase, N-terminal; Oxidoreductase,
FT                   C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00381"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75833"
FT                   /db_xref="GOA:A6T5G2"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5G2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000683"
FT                   /inference="protein motif:Pfam:IPR004104"
FT                   /protein_id="ABR75833.1"
FT                   /translation="MLNGLKPLSRSLRWGMVGGGGTSQIGYSHRCAALRDNVYTLLAGA
FT                   LDVDAERGRAFGEQLGIAPERCYADYQTLFREEAQRPDGIEVVSVTTPNNTHFAITKAA
FT                   LEAGLHVICEKPLCFTAEEARELVDLSKKQNKIVGVTYGYAGYQMIQQARQMIADGLLG
FT                   EIRIVNMQFAHGFHNQAVELQAESTRWRVTPKFAGPSYVLGDLATHPLFVAETMAPQLN
FT                   IKRLMCSRQSFVPSRAPLEDNAFVLMEYDNGAVGSMWTSAVNSGAMHSQKVRIVGEKAS
FT                   IEWWDEHPNQLSYEVQGEPARILERGMPYLSPNALADDRIGGGHPEGLFEAWANLYRRY
FT                   AQAIDATDRDDRAFLQDFWYPDVEAGLHGVYWVEQCVKSADAGSQWVDFTLP"
FT   gene            complement(422003..423367)
FT                   /locus_tag="KPN_00382"
FT   CDS_pept        complement(422003..423367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00382"
FT                   /product="General substrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00382"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75834"
FT                   /db_xref="GOA:A6T5G3"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5G3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR005828"
FT                   /protein_id="ABR75834.1"
FT                   /translation="MTQTQRLDVRELINRNPLSRFQKLIIFLGFCVIALDGFDIAIMGF
FT                   IAPTLKLEWGVSNHQLGLVISAALIGLALGAIFSGPLADWLGRKKIIINSVFFFGFWTI
FT                   ATAFSHNVEQMMFFRFMTGLGLGAAMPNIGTLVSEYAPERQRSFIITVIFCGFTFGAAA
FT                   GGFSASWLIPQFGWHSLMALGGILPLLFAPLLIWLLPESVRFLVIKQAPAARIRAILNR
FT                   LYPGQISDNVRFILPAQPAAGNAMRIVLSRQYGFGSLMLWLVYFMGLFLVYILGSWLPT
FT                   LVKAVGMTVSQAAIMTAIYQAGGTLGSLFAGWLMDRINPHRALGIIYAVGGLFTMAMGY
FT                   AAGSFALLCMLAFISGACLNGANTGMNALSARYYPTQARATGSSWMHGVGRIGAILSAF
FT                   AGAEMMALNLPFESVFLILGIPAALTVAGLAAKGIFAAGHPPVASTSPASVRGAS"
FT   gene            complement(423378..424196)
FT                   /locus_tag="KPN_00383"
FT   CDS_pept        complement(423378..424196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00383"
FT                   /product="Xylose isomerase-like TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00383"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75835"
FT                   /db_xref="GOA:A6T5G4"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5G4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR012307"
FT                   /protein_id="ABR75835.1"
FT                   /translation="MNKRTLSLAALTLLDVPPPEQVRIAARTGFTHVGLRLLPATPTDP
FT                   DYDMLGDTPAVRATLAALMETGIRVSDVEIVRLTPGFTLDDRLQRFMETAARLGAGQVL
FT                   VAGNDDNLQRSADNLAILAAAGRPFGLTMNLEPMPWTQLRNIAAAQALIAASGREDIGI
FT                   LVDALHFWRAGESLAALSSLPAHHLNYMQLCDGAAQRPESEQELIRQARSARNVPGEGG
FT                   LDLHGLMSALPATLPVSLEVPLDGEQGALPPLQRAQLLFDAAQPYLRACA"
FT   gene            complement(424271..425950)
FT                   /locus_tag="KPN_00384"
FT   CDS_pept        complement(424271..425950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00384"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00384"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75836"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5G5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75836.1"
FT                   /translation="MSGPVKVDVLVVGSGAAGLSAAVTAAMHGASVMVAEKASVLGGTS
FT                   AWSGGWLWIPRNPLARAEGIDEAADAPLTYLQHGMGGEAADIRLQTFLRYGPEMVEFFH
FT                   QRTAVQFLSGSAMPDFHPSPGAANGGRSVTAQPYDGRLLGDWLHRLRPPLETISLGGMG
FT                   IAGGADMAHFFNATRSPRSALYAARRLLRHGWQRLRAGRGQHLVNGNALVARLLRSALD
FT                   AGVRFQLNAPVVRLLQGPPGVSGAVLRSDGGEIHVEAGAVVLACGGFPHDRQRLAQVVP
FT                   HAAEGYGHFSAAPPDNQGEGIRLGESVGGQFDTSLRHPLAWAPVSRVTLASGQQLMFPH
FT                   LVERAKPGVIAVLPNGKRFVNEADSYHDFIAALLAATPAGDTPQAWLLADRRALRRYGL
FT                   GHARPFPFTPTAWLRTGYLQRGNTLAELAKQCAIDANALAETVERFNHFASAGEDVDFH
FT                   RGASAYNRAQGDHQVTLGPLREGPFYAVRILPGSLGTFSGLQTDEHARVLDEQQLPIPG
FT                   LYAIGNDMSSVMRGYYPSGGITLGPAMTFGYLVGKGLTKKQI"
FT   gene            complement(425961..426281)
FT                   /locus_tag="KPN_00385"
FT   CDS_pept        complement(425961..426281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00385"
FT                   /product="NIPSNAP"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00385"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75837"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5G6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR012577"
FT                   /protein_id="ABR75837.1"
FT                   /translation="MIYEKRTYTINPLKMADWLALYQSDALAVQTDHLGQLIGFFFTEI
FT                   GVVNQVVHIWAYESLDDRLVRRARMAQDERWQTFSRKNRELAAVERLESVLMRPTAFSP
FT                   LQ"
FT   gene            complement(426295..427971)
FT                   /locus_tag="KPN_00386"
FT   CDS_pept        complement(426295..427971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00386"
FT                   /product="putative electron transfer
FT                   flavoprotein-NAD/FAD/quinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00386"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75838"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5G7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75838.1"
FT                   /translation="MKSWDVIVIGSGAAGFAAAVTACCKGLSVLMLEKAGQFGGTSAIS
FT                   GGAVWLHDTDQARAEGKSGSAEAMKTYLRTIIGEGQYREDLAEAFVSAGREVLAFLERE
FT                   GAVKYSLRPLSPDYYPDEPGAVDVGRALEVVEYDGRELGDAFRDLRSPPPGMLLFGGMM
FT                   VNRVDIQHFLDMRRSLRSLAHCTRLLLRYARDRVKYPRGTRLAMGNALIARMATTALRK
FT                   GMNLRLNVNVLTLCEAQGAVRGVEIEYQGQRETLHARRGVVLAAGGFAAGALAARYRPH
FT                   TREHFTMSPPANDGAALHLAAAFNAREGADRASNFFWAPVSVLTRADGSEERFPHLVTD
FT                   RAKPGVIAVNQRAVRFVNESSSYHHFASAMQDAAENAPCFLLCDAQAMKRYGLGLARPA
FT                   PVNNDALVAAGYLHKADTLAALAQQLGLDAQTLSETVARYNRDAAQGVDREFAKGGNSY
FT                   NRAMGDPGHQPDACNAPLLSAPFYAIKLYTGDLGTSRGLVTTADAQVVNTQGNPIPGLY
FT                   AVGNDMDSLMAGTYPGPGITLGPGLTFGYLAACHLAQHSTH"
FT   gene            complement(427968..428801)
FT                   /locus_tag="KPN_00387"
FT   CDS_pept        complement(427968..428801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00387"
FT                   /product="Shikimate/quinate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00387"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75839"
FT                   /db_xref="GOA:A6T5G8"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5G8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR006151"
FT                   /protein_id="ABR75839.1"
FT                   /translation="MRFEMVSGTTQVVAVIGHPIAQVKSPDNFNRYFAEQHMDSIMIPV
FT                   DIVPDAVAAYLNALRGWQNMTGVLVTVPHKQRAAALVDDLTPRARRLNAVNVIRKLADG
FT                   RLQGDMLDGVGFQLAAEAQGFQPAGKQAMLSGCGGVGSAIAWGLCEAGIRRLALHDQTP
FT                   ATRQRLHDLLAEAFPAVQLSALPDTLYGLDLLVNGSPAGMAGFDELPLPQALLDTLDST
FT                   THVADVVTAPVMTPLLTFAAARGCKVQTGPEMALAQMRLMGQFIGAIPQAQGAAA"
FT   gene            428942..429700
FT                   /locus_tag="KPN_00388"
FT   CDS_pept        428942..429700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00388"
FT                   /product="Bacterial regulatory proteins, IclR"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00388"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75840"
FT                   /db_xref="GOA:A6T5G9"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5G9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR005471"
FT                   /protein_id="ABR75840.1"
FT                   /translation="MQNTIHPRDLIVGLQKGLALIQLFSKTCPKLTVAQTAKMSGLTQS
FT                   AARRFLLTLLHERYLQTDGRYYWLTPKTLRLGQAYVDSAQFPRMVRPIVEYIASRTEEH
FT                   ASVGVVDEDELVYIARSRHTPFNSTSVRLGERVPIFCTAGGRLWLASLPEAECETVLQR
FT                   ITREQRTPYTVTDIASLMEKIAQVRRQGYATIEQEFEIGMLVLAVPLTDREGTWWGALS
FT                   LTSHQSRTSLEALCRDHLDLLYSAQAMLVG"
FT   gene            complement(429740..430072)
FT                   /locus_tag="KPN_00389"
FT   CDS_pept        complement(429740..430072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00389"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00389"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75841"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5H0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75841.1"
FT                   /translation="MKELTLNEMEYISGGFNLFGAASGFASFVANSGVGFTSFVLTSGT
FT                   AFASFVGDSAMAFGSFLTGQSNWETFVTAGKENWGSFVNTAGNSWNTFVNNAASDWNTF
FT                   LTKASA"
FT   gene            complement(430322..431209)
FT                   /gene="cyoE"
FT                   /locus_tag="KPN_00390"
FT   CDS_pept        complement(430322..431209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoE"
FT                   /locus_tag="KPN_00390"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00390"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75842"
FT                   /db_xref="GOA:A6T5H1"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T5H1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000537"
FT                   /protein_id="ABR75842.1"
FT                   /translation="MFKQYLQVTKPGIIFGNLISVIGGFLLASKGHIDYPLFVWTLLGV
FT                   SLVVASGCVFNNYIDRDIDRKMERTKNRVLVKGLISPEASLVYATLLGIAGFMLLWFGA
FT                   NPLACWLGVMGFVVYVGVYSLYMKRHSVYGTLIGSLSGAAPPVIGYCAVTGDFDSGAAI
FT                   LLAIFSLWQMPHSYAIAIFRFKDYQAANIPVLPVVKGISVAKNHITLYIVAFAVATLML
FT                   SLGGYAGYKYLVVAAAVSVWWLGMALRGYKVADDKVWARKLFVFSIVAITALSVMMSVD
FT                   FMVPDSHSLLAYVR"
FT   gene            complement(431221..431550)
FT                   /gene="cyoD"
FT                   /locus_tag="KPN_00391"
FT   CDS_pept        complement(431221..431550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoD"
FT                   /locus_tag="KPN_00391"
FT                   /product="cytochrome o ubiquinol oxidase subunit IV"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00391"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75843"
FT                   /db_xref="GOA:A6T5H2"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR014210"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5H2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR005171"
FT                   /protein_id="ABR75843.1"
FT                   /translation="MSHSTDHSGASHGSVKSYMTGFILSIILTVIPFAMVMSGSASHAV
FT                   ILGTILVTAVVQIVVHLVYFLHMNSKSDEGWNLTAFIFTVIIIAIVVVGSIWIMWNLNY
FT                   NMMMH"
FT   gene            complement(431550..432161)
FT                   /gene="cyoC"
FT                   /locus_tag="KPN_00392"
FT   CDS_pept        complement(431550..432161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoC"
FT                   /locus_tag="KPN_00392"
FT                   /product="cytochrome o ubiquinol oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00392"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75844"
FT                   /db_xref="GOA:A6T5H3"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014206"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033946"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5H3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000298"
FT                   /protein_id="ABR75844.1"
FT                   /translation="MATDTLAHTAHAHEHGHHDTGPMKVFGFWIYLMSDCIIFATLFAT
FT                   YAVLVNGTAGGPTGKDIFELPFVLVETALLLFSSITYGMAAIAMYKNNKSQVVSWLALT
FT                   WLFGAGFIGMEIYEFHHLIMEGFGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMFQV
FT                   SRRGLTSTNRTRILCLSLFWHFLDVVWICVFSVVYLMGAM"
FT   gene            complement(432151..434142)
FT                   /gene="cyoB"
FT                   /locus_tag="KPN_00393"
FT   CDS_pept        complement(432151..434142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoB"
FT                   /locus_tag="KPN_00393"
FT                   /product="cytochrome o ubiquinol oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00393"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75845"
FT                   /db_xref="GOA:A6T5H4"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014207"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5H4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000883"
FT                   /protein_id="ABR75845.1"
FT                   /translation="MFGKLTLDAVPYHEPIIVVTVAAIIIGGLALLAAITYFGKWSYLW
FT                   NEWLTSVDHKRLGIMYVIVAIVMLLRGFADAIMMRSQQVLASAGEAGFLPPHHYDQIFT
FT                   AHGVIMIFFVAMPFVIGLMNLVVPLQLGARDVAFPFLNNLSFWFTVVGVILVNLSLGVG
FT                   EFAQTGWLAYPPLSGIEYSPGVGVDYWIWALQLSGIGTTLTGINFFVTIIKMRAPGMTM
FT                   FKMPVFSWASLCANILIIASFPILTVTIALLTLDRYLGTHFFTNDMGGNMMMYINLIWA
FT                   WGHPEVYILVLPVFGVFSEIAATFSRKRLFGYTSLVWATVCITVLSFIVWLHHFFTMGA
FT                   GANVNAFFGITTMIIAIPTGVKIFNWLFTMYQGRIVFNSAMMWTIGFIVTFSVGGMTGV
FT                   LLAVPGADFVLHNSLFLIAHFHNVIIGGVVFGCFAGLTYWWPKAFGFTLNETWGKRAFW
FT                   FWIIGFFVAFMPLYVLGFMGMTRRLSQQIDPQFHPMLVIAACGAALIACGILCQLIQFY
FT                   VSIRDRDQNRDLTGDPWGGRTLEWATSSPPPFYNFAIVPQVHERDAFWEMKEKGEAYKQ
FT                   PAHYEEIHMPKNSGAGIVIAAFATVFGFAMIWHIWWMAIASFIGIVATWIIKSFDEDVD
FT                   YYVPVAEVEKLEKQHFDEINKAGLKNGN"
FT   gene            complement(434162..435070)
FT                   /gene="cyoA"
FT                   /locus_tag="KPN_00394"
FT   CDS_pept        complement(434162..435070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoA"
FT                   /locus_tag="KPN_00394"
FT                   /product="cytochrome o ubiquinol oxidase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00394"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75846"
FT                   /db_xref="GOA:A6T5H5"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006333"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR010514"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR034227"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5H5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR010514"
FT                   /protein_id="ABR75846.1"
FT                   /translation="MSLIAGTVLLSGCDSALLDPKGQIGLEQRSLILTAFGLMMIVVIP
FT                   AVLMAVGFAWKYRASNKDAKYSPNWSHSNKVEAVVWTVPILIILFLAVLTWKTTHALEP
FT                   SKPLVHDEKPITIEVVSMDWKWFFIYPEQGIATVNEIAFPANVPVHFKVTSNSVMNSFF
FT                   IPRLGSQIYAMAGMQTQLHLIADEAGTYDGISASYSGPGFSGMKFKAIATPDRATFDQW
FT                   VAKAKQSPNSMDSMAAFEKVAVPSEYNKVEYFSNVKPDLFKDVVNKFMSHESMNMSKPE
FT                   GEHAAHDGMEGMDMSHAETAH"
FT   unsure          435070
FT                   /note="Unresolved bases"
FT   gene            complement(435586..437061)
FT                   /gene="ampG"
FT                   /locus_tag="KPN_00395"
FT   CDS_pept        complement(435586..437061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampG"
FT                   /locus_tag="KPN_00395"
FT                   /product="muropeptide transport protein (MFS family)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00395"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75847"
FT                   /db_xref="GOA:A6T5H6"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5H6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75847.1"
FT                   /translation="MSSHYLRIFQQPKSAILLILGFASGLPLALTSGTLQAWMTVENID
FT                   LKTIGFFSLVGQAYVFKFLWSPLMDRYTPPFLGRRRGWLLTTQVLLLLAIAAMGFLEPV
FT                   TQLRWMAALAVVIAFCSASQDIVFDAWKTDVLPAEERGAGAAISVLGYRLGMLVSGGLA
FT                   LWLADRYLGWQGMYWLMAALLVPCIIATLLAPEPSDVIPVPRSLEQAVAEPLRDFFGRN
FT                   NAWLILLLIVLYKLGDAFAMSLTTTFLIRGVGFDAGEVGMVNKTLGLFATILGALYGGV
FT                   LMQRLTLFRALLIFGLLQGVSNAGYWLLSITDKHLYSMATAVFFENLCGGMGTAAFVAL
FT                   LMTLCNKSFSATQFALLSALSAVGRVYVGPIAGWFVEAHGWSTFYLFSVVAAVPGIALL
FT                   LLCRQTLEHTQRTASFMPRSEFPQAYALALGILTLGCLLLAVWLALLILNALDYTSFSF
FT                   LSGLLEVAALTAVGGILFGGLLDYLALRKTRLI"
FT   gene            complement(437105..437650)
FT                   /gene="yajG"
FT                   /locus_tag="KPN_00396"
FT   CDS_pept        complement(437105..437650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajG"
FT                   /locus_tag="KPN_00396"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00396"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75848"
FT                   /db_xref="InterPro:IPR005619"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5H7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR005619"
FT                   /protein_id="ABR75848.1"
FT                   /translation="MFMLAGCATPPTTIEVSPKITLPQQDPSLMGVTVSINGADQRPDQ
FT                   ALAKVTRDNQLVTLTASRDLRFLLQEVLEKQMTSRGYMIGPNGAVDLQIIVNKLYADVS
FT                   QGNVRYNIATKADIAIIATAANGTKMTKNYRASYSVEGAFQASNKNIADAVNSVLTDTI
FT                   ADMAQDTSIHDFIKQNAR"
FT   gene            437986..438303
FT                   /gene="bolA"
FT                   /locus_tag="KPN_00397"
FT   CDS_pept        437986..438303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bolA"
FT                   /locus_tag="KPN_00397"
FT                   /product="possible regulator of murein genes"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00397"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75849"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5H8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002634"
FT                   /protein_id="ABR75849.1"
FT                   /translation="MMIREQIEAKLRAAFDPMYLEVVDESYRHNVPAGSESHFKVVLVS
FT                   DRFTGERFLNRHRMIYGTLTEELSNTVHALALHTYTIKEWEALQDTVFASPPCRGAGSI
FT                   A"
FT   gene            438649..439947
FT                   /gene="tig"
FT                   /locus_tag="KPN_00398"
FT   CDS_pept        438649..439947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="KPN_00398"
FT                   /product="trigger factor"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00398"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75850"
FT                   /db_xref="GOA:A6T5H9"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T5H9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001179"
FT                   /inference="protein motif:Pfam:IPR008880"
FT                   /inference="protein motif:Pfam:IPR008881"
FT                   /protein_id="ABR75850.1"
FT                   /translation="MQVSVETTQGLGRRVTITIAADSIENAVKSELVNVAKKVRIDGFR
FT                   KGKVPMNIVAQRYGASVRQDVLGDLMSRHFVDAIIKEKINPAGAPNYVPGEYKLGEDFT
FT                   YAVEFEVYPEVELQGLDAIEVEKPVVEVTDADVDTMLETLRKQQATWKEKEGAVDAEDR
FT                   VTIDFTGSVDGEEFEGGKASDFVLAMGQGRMIPGFEDGIKGHKAGEEFTIDVTFPEEYH
FT                   AENLKGKAAKFVINLKKVEERELPELTEEFIKRFGVEDGSVAGLRAEVRKNMERELKGA
FT                   VRNRVKSQAIEGLVKANEIDVPAALIDSEIDVLRRQAAQRFGGNEKQALELPRELFEEQ
FT                   AKRRVVVGLLLGEVIRTNELKADEERVKALIEEMASAYEDPSEVVEFYSKNKELMDNMR
FT                   NVALEEQAVEAVLAKAKVSEKATSFNELMNQQA"
FT   gene            440295..440879
FT                   /gene="clpP"
FT                   /locus_tag="KPN_00399"
FT   CDS_pept        440295..440879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="KPN_00399"
FT                   /product="ATP-dependent Clp protease proteolytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00399"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75851"
FT                   /db_xref="GOA:A6T5I0"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5I0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001907"
FT                   /protein_id="ABR75851.1"
FT                   /translation="MALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIV
FT                   AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLL
FT                   TAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLE
FT                   QIERDTERDRFLSAAEAVEYGLVDSILTHRN"
FT   gene            441130..442404
FT                   /gene="clpX"
FT                   /locus_tag="KPN_00400"
FT   CDS_pept        441130..442404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /locus_tag="KPN_00400"
FT                   /product="ATP-dependent protease ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00400"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75852"
FT                   /db_xref="GOA:A6T5I1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T5I1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003959"
FT                   /inference="protein motif:Pfam:IPR010603"
FT                   /protein_id="ABR75852.1"
FT                   /translation="MTDKRKDGSGKLLYCSFCGKSQHEVRKLIAGPSVYICDECVDLCN
FT                   DIIREEIKEVAPHRERSALPTPHEIRHHLDDYVIGQEQAKKVLAVAVYNHYKRLRNGDT
FT                   SNGVELGKSNILLIGPTGSGKTLLAETLARLLDVPFTMADATTLTEAGYVGEDVENIIQ
FT                   KLLQKCDYDVQKAQRGIVYIDEIDKISRKSDNPSITRDVSGEGVQQALLKLIEGTVAAV
FT                   PPQGGRKHPQQEFLQVDTSKILFICGGAFAGLDKVISHRVETGSGIGFGATVKAKSDKA
FT                   SEGELLAQVEPEDLIKFGLIPEFIGRLPVVATLNELSEEALIQILKEPKNALTKQYQAL
FT                   FSLEGAELEFRDEALDAIAKKAMARKTGARGLRSIVEAALLDTMYDLPSMEDVEKVVID
FT                   ESVIAGQSKPLLIYGKPEAQQASGE"
FT   gene            442588..444942
FT                   /gene="lon"
FT                   /locus_tag="KPN_00401"
FT   CDS_pept        442588..444942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lon"
FT                   /locus_tag="KPN_00401"
FT                   /product="DNA-binding ATP-dependent protease La; heat shock
FT                   K-protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00401"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75853"
FT                   /db_xref="GOA:A6T5I2"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5I2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003111"
FT                   /inference="protein motif:Pfam:IPR003959"
FT                   /inference="protein motif:Pfam:IPR008269"
FT                   /protein_id="ABR75853.1"
FT                   /translation="MNPERSERIEIPVLPLRDVVVYPHMVIPLFVGREKSIRCLEAAMD
FT                   HDKKIMLVAQKEASTDEPGVNDLFTVGTVASILQMLKLPDGTVKVLVEGLQRARISALS
FT                   DNGEHFSAKAEYLDSPAIDEREQEVLVRTAISQFEGYIKLNKKIPPEVLTSLNSIDDPA
FT                   RLADTIAAHMPLKLADKQSVLEMSDVNERLEYLMAMMESEIDLLQVEKRIRNRVKKQME
FT                   KSQREYYLNEQMKAIQKELGEMDDAPDENEALKRKIDAAKMPKEAKEKTEAELQKLKMM
FT                   SPMSAEATVVRGYIDWMVQVPWNARSKVKKDLRQAQEILDTDHYGLERVKDRILEYLAV
FT                   QSRVNKIKGPILCLVGPPGVGKTSLGQSIAKATGRKYVRMALGGVRDEAEIRGHRRTYI
FT                   GSMPGKLIQKMAKVGVKNPLFLLDEIDKMSSDMRGDPASALLEVLDPEQNVAFNDHYLE
FT                   VDYDLSDVMFVATSNSMNIPAPLLDRMEVIRLSGYTEDEKLNIAKRHLLPKQIERNALK
FT                   KGELTVDDSAIIGIIRYYTREAGVRSLEREISKLCRKAVKQLLLDKSLKHIEINGENLH
FT                   DYLGVQRFDYGRADSENRVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQ
FT                   ESIQAALTVVRSRADKLGINADFYEKRDIHVHVPEGATPKDGPSAGIAMCTALVSCLTG
FT                   NPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPDENKRDLEEIPDNVIA
FT                   DLDIHPVKRIEEVLTLALQNEPFGMQVVTAK"
FT   gene            445152..445424
FT                   /gene="hupB"
FT                   /locus_tag="KPN_00402"
FT   CDS_pept        445152..445424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupB"
FT                   /locus_tag="KPN_00402"
FT                   /product="DNA-binding protein HU-beta, NS1 (HU-1)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00402"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75854"
FT                   /db_xref="GOA:A6T5I3"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5I3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000119"
FT                   /protein_id="ABR75854.1"
FT                   /translation="MNKSQLIDKIAAGADISKAAAGRALDALIASVTESLQAGDDVALV
FT                   GFGTFAVKERAARTGRNPQTGKEITIAAAKVPGFRAGKALKDAVN"
FT   gene            445639..447513
FT                   /gene="ppiD"
FT                   /locus_tag="KPN_00403"
FT   CDS_pept        445639..447513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiD"
FT                   /locus_tag="KPN_00403"
FT                   /product="peptidyl-prolyl cis-trans isomerase D"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00403"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75855"
FT                   /db_xref="GOA:A6T5I4"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5I4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000297"
FT                   /protein_id="ABR75855.1"
FT                   /translation="MMDNLRTAANSVVLKIIFGIIIVSFILTGVSGYLIGGGKNYAAKV
FT                   NGQEIGRGQFENAVASERNRMQQQLGDQFSELAANENYMKTMRQQVLNRLIDESLLDQY
FT                   ARELGLSISDEQVKQAIFQTQAFQTNGKFDNQRFSGIVAQMGMTTDQYAQALRNQLTTQ
FT                   QLINAIAGTDFMLPGESDQLAALVSQQRVVREATINVNALAAKQTASDEEINAFWQQNQ
FT                   ARFMAPEQFRVSYIKMDAASMQESASDEEIQSWYDQHKDQFTQPQRNRYSVIQTKTEAD
FT                   AKAVLAELQKGADFATLAKEKSTDIISARNGGDMGWMEDASTVPELKDAGLKEKGQLSG
FT                   VIKSSVGFLVARLDDVQPAQVKPLADVRNDIAAKVKQEKALDAYYALQQKVSDAASNDN
FT                   ESLASAAQVAGLKVVETGWFGRDNLPEELNFKPVADAIFNGGLVGENGAPGSNSDIITV
FT                   DGDRAFVLRISEHKAEAVKPLAEVKAQVSDIVKHNKAEQQAKLEADKLLAALKDGKGDE
FT                   AMKAAGLSFGAPQTLSRTGQDPLSQLAFTLPLPQQGKPVYGVGSNMQGDVVLVALDEVK
FT                   AGSMPEEQKKAMVQGITQNNAQIAFEALMSNLRKAAKIKLGDSIDQQQ"
FT   gene            447686..448030
FT                   /gene="ybaV"
FT                   /locus_tag="KPN_00404"
FT   CDS_pept        447686..448030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaV"
FT                   /locus_tag="KPN_00404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00404"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75856"
FT                   /db_xref="GOA:A6T5I5"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004509"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5I5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000445"
FT                   /protein_id="ABR75856.1"
FT                   /translation="MAAGVLVFAVGVQGALAAPASGKAAVNKENVQASSSAKAEAVPGE
FT                   SDNGATKVSINRASAEQLAQALNGVGLKKAQAIVSYREEYGPFKTLDDLKQVPGMGSAL
FT                   VERNLAHLTL"
FT   gene            448142..448543
FT                   /gene="ybaW"
FT                   /locus_tag="KPN_00405"
FT   CDS_pept        448142..448543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaW"
FT                   /locus_tag="KPN_00405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00405"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75857"
FT                   /db_xref="GOA:A6T5I6"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5I6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR006683"
FT                   /protein_id="ABR75857.1"
FT                   /translation="MQTQIKVRGYHLDVYQHVNNARYLEFLEEARWDGLENSPAFQWMM
FT                   EKNIAFVVVNININYRRPAVLGDVLTVSSKLEQLNGKSGTLSQVVTLNPNGEVVADALI
FT                   TFVCIDLKTQKALPLEGELRAKLDQMNLR"
FT   gene            complement(448655..449356)
FT                   /gene="ybaX"
FT                   /locus_tag="KPN_00406"
FT   CDS_pept        complement(448655..449356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaX"
FT                   /locus_tag="KPN_00406"
FT                   /product="putative (aluminum) resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00406"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75858"
FT                   /db_xref="GOA:A6T5I7"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T5I7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004479"
FT                   /protein_id="ABR75858.1"
FT                   /translation="MKRAVVVFSGGQDSTTCLVQALQQYDEVHCVTFDYGQRHRAEIDV
FT                   ARELALKLGAVAHKVLDVTLLNELAVSSLTRDNIPVPDYQPDAEGIPNTFVPGRNILFL
FT                   TLTAIYAYQVKAEAIITGVCETDFSGYPDCRDEFVKALHHAVSLGMAKDIRFETPLMWL
FT                   NKAETWALADYWGQLDLVRRETLTCYNGIKGDGCGQCAACNLRANGLNQYLADKVGVMA
FT                   VMQQKTGLAQA"
FT   gene            complement(449423..451123)
FT                   /gene="ybaE"
FT                   /locus_tag="KPN_00407"
FT   CDS_pept        complement(449423..451123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaE"
FT                   /locus_tag="KPN_00407"
FT                   /product="putative transport protein (ABC superfamily,
FT                   peri_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00407"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75859"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR025370"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5I8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000914"
FT                   /protein_id="ABR75859.1"
FT                   /translation="MRLLHRLNQYQRLWQPSAGAPQQVTVGELAERCFCSERHVRTLLR
FT                   QAQEAGWLSWQASSGRGKRGQLSFHKTPESLRNEMMEQALNNGQQQTALELAQLAPVEL
FT                   KALLHPFLGGQWQNNTPTLRIPYYRPLEPLRPGFLPGRAEQHLAGQIYAGLTRFDEGDN
FT                   MPIGDLAHHWQVSPDGLRWHFYIRSTLCWHNGDTVETAQLRQRLLLLLELPALRTLFAS
FT                   ISRIDVTHAQCLTITLHRPDYWLPFRLASYCSVLAHPDDPAIGCGPFRLKRFSAELVRL
FT                   ENHPRYHLQHPLIQAVEYWITPQLFDRDLGTSCRHPVQITIGDREELHNLRQVSNRISL
FT                   GFCYLTLRHSPRLSKAQAQRLVSIIHHSSLLDTLPLEEDLITPSHEVLPGWSIPQGPAN
FT                   NAVPLPARLTLLYHLPVELHAMAEQLRQRLALLGCELTLLFHDAKNWEGCQHLGQADLM
FT                   MGDRLIGEAPEYALEQWLRCDMLWPNLLTGAQYAHLQATLDAVQSQPDARSRNDALRNV
FT                   FNSLMEDAIMTPLFKYNYRISAPPGVNGLRLNARGWFDFASAWLPASST"
FT   gene            451251..452069
FT                   /gene="cof"
FT                   /locus_tag="KPN_00408"
FT   CDS_pept        451251..452069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cof"
FT                   /locus_tag="KPN_00408"
FT                   /product="putative hydrolase, contains phophatase-like
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00408"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75860"
FT                   /db_xref="GOA:A6T5I9"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023938"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T5I9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR005834"
FT                   /protein_id="ABR75860.1"
FT                   /translation="MAKLAAFDMDGTLLMPDHRLGEKTLSALKRLRERDITLTFATGRH
FT                   VLEMHHVIGEFSLDAFLVTGNGTRIHSLEGEELYRQDLAPEAAEAVLHGKWDTQASMHV
FT                   FNDGGWFTGQARPELLQAHVFSGFHYQLCDLKRMSAQHVTKICFCGDHDDLRRLRIQLN
FT                   ETLGDRAFLCFSAMDCLEVLPVGCNKGAALAVLSQHLGFTLQECMAFGDAMNDREMLGS
FT                   VGRGFIMGNAMPQLKAELPHLPVIGDCRNQAVSHFLTHWLDNPDLPYSPE"
FT   gene            complement(452114..453166)
FT                   /locus_tag="KPN_00409"
FT   CDS_pept        complement(452114..453166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00409"
FT                   /product="putative cysteine synthase/cystathionine
FT                   beta-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00409"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75861"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5J0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001926"
FT                   /protein_id="ABR75861.1"
FT                   /translation="MNSAWVKHAISEINADYQRSADTHLIRLPLPAFPGIHLYLKDEST
FT                   HPTGSLKHRLARSLFLYGLCNGWIKEGTPIIESSSGSTAVSEAYFARLLGLPFIAVMPS
FT                   CTAKRKIEQIEFYGGRCHFVQSAGEIYAASETLARELNGHYMDQFTFAERATDWRGNNN
FT                   IADSIFRQMSHEPHPQPSWIVMSAGTGGTSATIGRYIRSQGYETQLMVVDPQNSVFLDY
FT                   WQTRDASLRSPVGSKIEGIGRPRVEPSFIPDVVDEMLRVPDAASVATALWLETQLGRKV
FT                   GASTGTNMWGVLQLATRMREEGRTGSIVTLLCDSGERYLESYYNPQWVADNIGDIAPWQ
FT                   AEIAGLVERR"
FT   gene            453282..453740
FT                   /gene="ybaO"
FT                   /locus_tag="KPN_00410"
FT   CDS_pept        453282..453740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaO"
FT                   /locus_tag="KPN_00410"
FT                   /product="putative LRP-like transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00410"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75862"
FT                   /db_xref="GOA:A6T5J1"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5J1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000485"
FT                   /protein_id="ABR75862.1"
FT                   /translation="MLDKIDRKLLALLQEDCTLSLQALADAVNLTTTPCWKRLKRLEDE
FT                   GILRGRVALLDAEKVGLGLTAFVLIKTQHHSSDWYCQFVSEVTQMAEVLGFWRMAGEYD
FT                   YLLRVQVADMKRYDDFYKRLVNSVPGLSDVTSSFAMEQIKYTTALPVE"
FT   gene            453784..455556
FT                   /gene="mdlA"
FT                   /locus_tag="KPN_00411"
FT   CDS_pept        453784..455556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdlA"
FT                   /locus_tag="KPN_00411"
FT                   /product="ATP-binding component of a transport system"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00411"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75863"
FT                   /db_xref="GOA:A6T5J2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5J2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001140"
FT                   /inference="protein motif:Pfam:IPR003439"
FT                   /protein_id="ABR75863.1"
FT                   /translation="MRLFAQLSWYFRREWRRYLGAIALLVIIAVLQLIPPKVVGIVVDG
FT                   VTQQHYTAEKVWMWIGALVLIAVMVYLLRYVWRVLLFGASYQLAVELREDFYRQLSRQH
FT                   PAFYLRHRTGDLIARATNDVDRVVFAAGEGVLTLVDSLVMGCAVLIVMSTQISWQLTLL
FT                   ALLPMPLMALAIKRNGDALHERFRVAQAAFSSLNDRTQESLTSIRMIKAFGLEDRQSAQ
FT                   FAADAADTGAKNMRVARIDARFDPTIYIAIGAANLLAIGGGSWMVIHGSLTLGQLTSFV
FT                   MYLGLMIWPMLALAWMFNIVERGSAAYGRIRTMLEEAPAVDDGTEAVPAGRGHLQVAIR
FT                   DFIYPQASKPSLEQVNFTLQPGQMLGICGPTGAGKSTILALLQRHFDVTHGEIRFHDLP
FT                   LPILQLDSWRARLAVVNQTPFLFSDTVANNIALGKPDATQAQIERVAQLASVHDDILRL
FT                   PQGYETEVGERGVMLSGGQKQRISIARALLLEAEILILDDALSAVDGRTEHQILHNLRQ
FT                   WGEGRTVIISAHRLSALTEASEILVLQHGHIAQRGRHEALAVQPGWYRDMYRYQQLEAA
FT                   LDEVPQTQEEALDA"
FT   gene            455549..457327
FT                   /gene="mdlB"
FT                   /locus_tag="KPN_00412"
FT   CDS_pept        455549..457327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdlB"
FT                   /locus_tag="KPN_00412"
FT                   /product="putative ATP-binding component of a transport
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00412"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75864"
FT                   /db_xref="GOA:A6T5J3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5J3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001140"
FT                   /inference="protein motif:Pfam:IPR003439"
FT                   /protein_id="ABR75864.1"
FT                   /translation="MRSFTELWPTLKRLLAYGSPWRKPLAIAVAMMWIAAAAEVSGPLL
FT                   ISYFIDNMVAKHTLPLKLVAGLAVAYIGLQLLAALLHYNQSLLFNRAAVGVVQQLRSDV
FT                   MDAALHQPLSEFDTQPVGQLISRVTNDTEVIRDLYVTVVATVLRSAALIGAMLVAMFSL
FT                   DWRMALVAIAIFPAVLIVMIIYQRYSTPIVRRVRAWLADINDGFNEVINGMGVIQQFRQ
FT                   QARFGERMREASYAHYLARMQTLRLDGFLLRPLLSLFSSLVLCGLLMLFGFSAVGTIEV
FT                   GVLYAFISYLGRLNEPLIELTTQQSMLQQAVVAGERVFELMDRPRQAWGRDDAPLSSGR
FT                   VEIDHLSFAYRGDRLVLQDITLDIPSRSFVALVGHTGSGKSTLASLMMGYYPLTHGEIR
FT                   IDGRPLASLSHSALRRGIAMVQQDPVVLADTFYANVALGRDISEAQVWEALEAVQLAAV
FT                   ARSMSDGLYTQLGEQGNNLSVGQKQLLALARVLVDTPQVLILDEATANIDSGTEQAIQQ
FT                   ALAKVRQHTTLVVIAHRLSTIVEADTILVLHRGQAVERGTHQQLLAAKGRYWQMYQLQL
FT                   AGEELAASAREESLSA"
FT   gene            457571..457909
FT                   /gene="glnK"
FT                   /locus_tag="KPN_00413"
FT   CDS_pept        457571..457909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnK"
FT                   /locus_tag="KPN_00413"
FT                   /product="nitrogen regulatory protein P-II 2"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00413"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75865"
FT                   /db_xref="GOA:A6T5J4"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5J4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002187"
FT                   /protein_id="ABR75865.1"
FT                   /translation="MKLVTVVIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAEL
FT                   YRGAEYSVNFLPKVKIDVAIADDQLDEVIDVISKAAYTGKIGDGKIFVAELQRVIRIRT
FT                   GEADEAAL"
FT   gene            457928..459229
FT                   /gene="amtB"
FT                   /locus_tag="KPN_00414"
FT   CDS_pept        457928..459229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amtB"
FT                   /locus_tag="KPN_00414"
FT                   /product="probable ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00414"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75866"
FT                   /db_xref="GOA:A6T5J5"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5J5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR010256"
FT                   /protein_id="ABR75866.1"
FT                   /translation="MGNETMKMATMKSGLGALALLPGLAMAAPAVADKADNAFMMICTA
FT                   LVLFMTIPGIALFYGGLIRGKNVLSMLTQVIVTFGLVCVLWVIYGYTLAFGTGGSFFGS
FT                   FDWVMLKNIELKALMGTFYQYIHVAFQGSFACITVGLIVGALAERIRFSAVLIFVVVWM
FT                   TLSYVPIAHMVWGGGLLATHGALDFAGGTVVHINAAVAGLVGAYMMGKRVGFGKEAFKP
FT                   HNLPMVFTGTAILYVGWFGFNAGSASAANEIAALAFVNTVVATAAAILAWTFGEWALRG
FT                   KPSLLGACSGAIAGLVGVTPACGYIGVGGALIVGIASGLAGIWGVTALKRWLRVDDPCD
FT                   VFGVHGVCGIVGCILTGIFAATSLGGVGYAEGVTMGHQLLVQLESIAITVVWSGVVAFI
FT                   GYKVADMTVGLRVPEEQEREGLDVNSHGENAYNA"
FT   gene            complement(459283..460146)
FT                   /gene="tesB"
FT                   /locus_tag="KPN_00415"
FT   CDS_pept        complement(459283..460146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tesB"
FT                   /locus_tag="KPN_00415"
FT                   /product="acyl-CoA thioesterase II"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00415"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75867"
FT                   /db_xref="GOA:A6T5J6"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5J6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003703"
FT                   /protein_id="ABR75867.1"
FT                   /translation="MSQALSNLLALLDLEKIEEGLFRGQSEDLGLRQVFGGQVVGQALY
FT                   AAKETVPVERLVHSFHSYFLRPGDSQKPIVYDVEVLRDGNSFSARRVAAIQNGKPIFYM
FT                   TASFQAPENGYEHQKAMPAAPSPDGLPSETDIARKLAHLLPPQVKDKFLCDKPLEIRPV
FT                   EFHNPMKGHIAEPVRQVWLRANGAVPDDLRIHQYLLGYASDFNFLPVALQPHGVGFLEP
FT                   GMQVATIDHSMWFHRPFNINEWLLYSVESTSASSARGFVRGEFYTQDGTLVASTVQEGV
FT                   MRNRNA"
FT   gene            460363..460854
FT                   /gene="ybaY"
FT                   /locus_tag="KPN_00416"
FT   CDS_pept        460363..460854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaY"
FT                   /locus_tag="KPN_00416"
FT                   /product="glycoprotein/polysaccharide metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00416"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75868"
FT                   /db_xref="InterPro:IPR039366"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5J7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75868.1"
FT                   /translation="MKFAYMFSALAVAATLTACANHHSNNSSTQAAAPDPYGIATLSVA
FT                   QQQPSVTGTINIRQRIALPPDAVLTVTLSDASLADAPARVLSQKAVRTEGKQAPFNFAL
FT                   PYNPADIQPNARILLSAAITVNGQLMFITDTVQTVINQGGTHADLTLVPVQQTAVPVAQ
FT                   "
FT   gene            complement(460892..461203)
FT                   /gene="ybaZ"
FT                   /locus_tag="KPN_00417"
FT   CDS_pept        complement(460892..461203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaZ"
FT                   /locus_tag="KPN_00417"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00417"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75869"
FT                   /db_xref="GOA:A6T5J8"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5J8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001497"
FT                   /protein_id="ABR75869.1"
FT                   /translation="MAPHDTFPQRVWHIVASIPEGYVTTYGEVARLAGSPRAARQVGGV
FT                   LKRLPEGSTLPWHRVVNRHGDISLTGPDLQRQRQALLAEGVQVSGSGHIDLQHYRWVY"
FT   gene            complement(461271..461678)
FT                   /locus_tag="KPN_00418"
FT   CDS_pept        complement(461271..461678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00418"
FT                   /product="putative dTDP-glucose pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00418"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75870"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5J9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75870.1"
FT                   /translation="MTDSSPQTITLPLPAIEGMTIAFQGVNYLRPEKMLDFATISPAPV
FT                   RAVTPLALLYSTVGVLRQVELRKLPVYISGRVVYPISSLTMPGLRARLIINATSQRLKF
FT                   LESLIASSASDNVHGMQILGLALTFTVEQAA"
FT   gene            462325..462582
FT                   /locus_tag="KPN_00419"
FT   CDS_pept        462325..462582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00419"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75871"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5K0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75871.1"
FT                   /translation="MTTVVLNVKIDAELKEKLRHYAEVNNENLGTATEKLLQLAFQLEE
FT                   SAGEAGVTEEDIDSQHTEEEATPLTPKEIKALRKLLKKKK"
FT   gene            462579..462794
FT                   /locus_tag="KPN_00420"
FT   CDS_pept        462579..462794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00420"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75872"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5K1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75872.1"
FT                   /translation="MKQQFSTASNYSEACDMLRSGYVKHVRLNWNIGSDEFFRIASDWC
FT                   DTGAKIKKDEDGFIISLKGFPIPRQH"
FT   gene            complement(462929..464356)
FT                   /locus_tag="KPN_00421"
FT   CDS_pept        complement(462929..464356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00421"
FT                   /product="putative transcriptional regulator (GntR family)"
FT                   /note="N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00421"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75873"
FT                   /db_xref="GOA:A6T5K2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5K2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000524"
FT                   /inference="protein motif:Pfam:IPR004839"
FT                   /protein_id="ABR75873.1"
FT                   /translation="MSARRFGTQSLVRLLGNWQETSSRTPLWRQLAEALRLLILDGRLT
FT                   LQTRLPGERELAAALNVSRTTIASALGQLREEGFLYSRQGSGSRIVLPERPADLPLPAG
FT                   ISSTLNLSTAALSAGPEVHQAFQHAMTLLPPYLAQTGYDQQGLPVLREAIARRYSERGL
FT                   PTRPDEVMVVNGALSAFALILRLFTGPGDRVVIDAPTYPMAISAIQGASCRPVGVSLPQ
FT                   QGWDCDGLAATIAQTAPRLAWLMPDFHNPTGRCMDAPTRQRVADIAARTRTTLVIDETM
FT                   ADLWYNAPPPPPLASFNPDAAVLTIGSAGKSFWGGLRIGWIRASARTIASLIQARDSLD
FT                   LGTPLLEQLACSWLLENAATLLPPRRDMLKARRDMCETLMAEYFPRWRFSPPEGGLSFW
FT                   VELPDMLATLFSARAESQGIHIGTGTRFGLEGAFDRYLRLPFTLPDEALRRAFSTLQPL
FT                   WQSLAEQKENTRLRKII"
FT   gene            464445..465059
FT                   /locus_tag="KPN_00422"
FT   CDS_pept        464445..465059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00422"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75874"
FT                   /db_xref="GOA:A6T5K3"
FT                   /db_xref="InterPro:IPR038750"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5K3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003740"
FT                   /protein_id="ABR75874.1"
FT                   /translation="MLRRLLQLYIGLVLYGVSTALFVHANLGADPWDVFHLGVAKQLGI
FT                   SFGTVIILTGAAVLLLWIPIRQMPGLGTVSNVIVLGLAADATLAVLPPLESMVARSALL
FT                   VGAIVLNAIATGMYIGAGFGPGPRDGLMTGLHARTGWSLRVIRTAIELSVLLIGWLLGG
FT                   KFGVGTVIYALSIGPLIQLCLPWFSQPVSRNAVSPPREIVS"
FT   gene            complement(465104..465967)
FT                   /locus_tag="KPN_00423"
FT   CDS_pept        complement(465104..465967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00423"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75875"
FT                   /db_xref="GOA:A6T5K4"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5K4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR011541"
FT                   /protein_id="ABR75875.1"
FT                   /translation="MNDFTSLLQQGNAWLFIPSAILLGALHGLEPGHSKTMMAAFIVAV
FT                   RGTLKQAVLLGLAATVSHTAVVWLIAMAGLWFGRGWNAQTSEPWFQLVSGIVVVLIACW
FT                   MLWRTWRESQPHTHHEHHHEHEHHHEHDHHHDHDHRHDHDHRHDHHHASSSAAPLVSEE
FT                   WQDAHQRAHAQEINRRFDGRQVTTGQIVLFGLTGGLIPCPASITVLLICLQLKKFSLGA
FT                   TLVLGFSVGLALTLVASGAIAALSLKHATRRWPWLNDLSRKAPWFSGLLIIVVGIYMML
FT                   HGLSGL"
FT   gene            466060..466404
FT                   /locus_tag="KPN_00424"
FT   CDS_pept        466060..466404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00424"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75876"
FT                   /db_xref="GOA:A6T5K5"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5K5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003735"
FT                   /protein_id="ABR75876.1"
FT                   /translation="MVCWQALLTTQVGNPGQNETVDRAMSHTVRHKKMLLTRLKKIQGQ
FT                   STALEKMLNREHECAEILQQLAAIRGAVNGMMLQVIQGHLTDHVVKEPDETQREADLET
FT                   VMQVIKSYLK"
FT   gene            complement(466439..467998)
FT                   /gene="ylaB"
FT                   /locus_tag="KPN_00425"
FT   CDS_pept        complement(466439..467998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylaB"
FT                   /locus_tag="KPN_00425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00425"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75877"
FT                   /db_xref="GOA:A6T5K6"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5K6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001633"
FT                   /protein_id="ABR75877.1"
FT                   /translation="MRTRHLMALFTGVLILAIILPISLSIWQAARQAKMQFYRELDDYS
FT                   NRIVVRTLQVADQAREALREADAHTAASCSPEHLLTLRRIAYTHRYIQEVLWLRDSVPQ
FT                   CSSLEDHSVAVTFPPPDHIAPDGYRTWLTSINDLGLDHQMTAMGSRQHMVMIDPVSFID
FT                   VVPASEEKIHTMLFGLDHQKMVISSQPLPAKVWQRIKDPHVDMLTLDNTVYRIQRIPEL
FT                   GSGIVTWSSTLPLQQHIRQQLFFWLPAGIFTSLLATWLLLRLLRHLRSPRNSMLDALNS
FT                   EAIQVHYQPIISLQDGKIAGAEALARWQQPDGTFLSPDIFIPLAEQTGLITQLTEDIVR
FT                   KIFADLGPWLRQRPEVHISINLSVDDLRSPTLPTLLHNQLQHWGIAAEQIILEITERGF
FT                   VDPETTMPVIAHYRQAGHRISIDDFGTGYSSLSYLQKLDVDTLKIDKSFVDTLEYRPLT
FT                   PHIIEMAKALNLATVAEGVETESQRDWLRQHGVQYAQGWLYSKALPKEQFILWAEHNLH
FT                   AH"
FT   gene            complement(468232..469347)
FT                   /locus_tag="KPN_00426"
FT   CDS_pept        complement(468232..469347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00426"
FT                   /product="ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00426"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75878"
FT                   /db_xref="GOA:A6T5K7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5K7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003439"
FT                   /inference="protein motif:Pfam:IPR005116"
FT                   /protein_id="ABR75878.1"
FT                   /translation="MWMSNIRLRNVTKRFGSTVTLHQVNLDIEDGEFAVFVGPSGCGKS
FT                   TLLRMIAGLEEVSEGEVLIGDEVMNDVVPARRGVAMVFQSYALYPHMTVAENMGYGLKV
FT                   NKVPKTEIRRQVEMVAKTLQLSHLLDRKPKQLSGGQRQRVAIGRAIVRNPRVFMFDEPL
FT                   SNLDAELRVDMRLHIARLHQELKTTMVYVTHDQVEAMTLADKIVVMNYGKVEQMGSPMA
FT                   LYYNPVNKFVAGFIGSPKMNFLPAIVSDWQPERLTVTLAQDHQLALNISTQPLKPGAAV
FT                   TLGIRPEHLTPEVTTGTVVEFQCEVVERLGNNTYLFGQCYGHDNVKVLLPGDVHFRPWQ
FT                   KIKLAFDERFCMVFDENDLRISADIPAPDAH"
FT   gene            469698..470930
FT                   /locus_tag="KPN_00427"
FT   CDS_pept        469698..470930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00427"
FT                   /product="periplasmic maltose-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00427"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75879"
FT                   /db_xref="GOA:A6T5K8"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5K8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR006059"
FT                   /protein_id="ABR75879.1"
FT                   /translation="MKKNTLAALILTTLAAGQLASLQAHAAGQLNVWEDIKKSAGIKTA
FT                   VSDFEKQYNVKVNLQEMPYAQQLEKLRLDGPAGIGPDVLVIPNDQLGGAVVQGLLSPLS
FT                   VDQAKQDAFTPASINAFRMDNALYGIPKAVETLVLIYNKDLIDKPLDSLQAWLDYSKTQ
FT                   REQNKYGLLAKFDQIYYSWGAIGPMGGYIFAKNDSGGFNPQQVGLNTPGAVEAVTFLKK
FT                   FYAEKVFPAGILGDNGLNAIDSLFTEKKAAAVINGPWAFQPYEAAGINYGVAPLPTLPD
FT                   GKPMSSFLGVKGYVVSTWSKDKALAQQFIEFINQPQYVKARYVATGEIPPLKAMIDDPV
FT                   IKNDQKASAVAIQSARAVAMPGIPEMGEVWGPANAALELSLTGKQAPQAALDNAVKQIT
FT                   MQIEAMQASNQ"
FT   gene            470993..472300
FT                   /locus_tag="KPN_00428"
FT   CDS_pept        470993..472300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00428"
FT                   /product="maltose transport protein (ABC superfamily,
FT                   membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00428"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75880"
FT                   /db_xref="GOA:A6T5K9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5K9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000515"
FT                   /protein_id="ABR75880.1"
FT                   /translation="MSIHSSENFSDARGPGRHAWCGLLLAIVPGFGQFYHRQWLKGLVF
FT                   LVLLSSFLGIFYDFLREGLWGLYTLGEEVPRDNSIFLLAEGIISVLIVAFGVLIYFLSL
FT                   RDAWLNGKKRDEGIALNSVRKQYQMLLSDGFPYLMITPGFILLVFVVIFPILFGFAIAF
FT                   TNYNLYHTPPAKLVDWVGLKNFINIFTLSIWRSTFLDVLQWTVVWTLLATTLQCTVGVL
FT                   LAILVNQKDLRFKPLIRTIFILPWAVPGFVTILVFAGMFNDSFGVINNAILSFFGISPK
FT                   AWLTDPFWTKTALIMMQTWLGFPFVFAMTTGVLQAIPDDLYEAATMDGASAFTRLRTIT
FT                   LPLVLYAIAPIIITQYTFNFNNFNIIYLFNNGGPAVAGSNAGGTDILVSWIYKLTMSSS
FT                   QYAIAATITILLSIFVVGLALWQFRATKSFKNDDMA"
FT   gene            472311..473162
FT                   /locus_tag="KPN_00429"
FT   CDS_pept        472311..473162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00429"
FT                   /product="putative binding-protein-dependent transport
FT                   systems inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00429"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75881"
FT                   /db_xref="GOA:A6T5L0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5L0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000515"
FT                   /protein_id="ABR75881.1"
FT                   /translation="MAQSPSIKREKWIRLSLTWLVVILVSVVIIYPLVWTVGASLNAGN
FT                   SLLSTSIIPENVSFQHYADLFNGNVNYLTWYWNSMKISFLTMVLTLISVSFTAYAFSRF
FT                   RFKGRQNGLMLFLLLQMIPQFSALIAIFVLSQLLGLINSHLALVLIYVGGMIPMNTWLM
FT                   KGYLDAIPKDLDESARMDGASSFRIFIEIIMPLSRPILAVVALFSFTGPLGDFILSSTI
FT                   LRTPDKYTLPIGLYNLVAQKMGASYTTYAAGAVLIAVPVAILYLALQKYFVSGLTSGST
FT                   KG"
FT   gene            473167..474369
FT                   /locus_tag="KPN_00430"
FT   CDS_pept        473167..474369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00430"
FT                   /product="putative galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00430"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75882"
FT                   /db_xref="GOA:A6T5L1"
FT                   /db_xref="InterPro:IPR011683"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5L1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR011683"
FT                   /protein_id="ABR75882.1"
FT                   /translation="MKRFTPAWLAVCLACSFSTSSLAADALATRAFQGMPADFIKGADI
FT                   STLLDAEKHGATFYDQNNQRKDPIAILKENGVNYVRLRLWVDPQSASGEDYGGGNNDLA
FT                   TTLALAKRAKAQGMKLLLDFHYSDFWTDPGKQFKPKAWEKLDYPQLKTAIHDYTRDTIA
FT                   RFKQAGVLPDMVQIGNEINGGILWPEGKSWGQGGGEFDRLAGLLNAAIAGLKENLRQGE
FT                   QVKIMLHLAEGTKNDTFRWWFDEIDKRHVPYDVIGLSMYTYWNGPISALKANMDDISKR
FT                   YNKDVIVVEAAYAYTLANCDNAENSFQAKEEKDGGYPASVQGQYNYIHDLMQAVVDVPD
FT                   QRGKGIFYWEPTWIAVPGNTWATPAGMKYIHDEWKEGNARENQALFDCQGKVLPSVKVF
FT                   N"
FT   gene            474401..476458
FT                   /locus_tag="KPN_00431"
FT   CDS_pept        474401..476458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00431"
FT                   /product="putative glycoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00431"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75883"
FT                   /db_xref="GOA:A6T5L2"
FT                   /db_xref="InterPro:IPR003476"
FT                   /db_xref="InterPro:IPR013529"
FT                   /db_xref="InterPro:IPR013738"
FT                   /db_xref="InterPro:IPR013739"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5L2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003476"
FT                   /protein_id="ABR75883.1"
FT                   /translation="MNKFAPLHPKVSTLLHGADYNPEQWENDPDIIDKDIAMMQQAKCN
FT                   VMSVGIFSWAKLEPREGVFNFAWLDIILDKLYAAGIHVFLATPSGARPAWMSQRYPQVL
FT                   RVGRDRVPALHGGRHNHCMSSPVYREKTLQINTLLAERYSSHPAVLGWHISNEYGGECH
FT                   CDLCQNRFRDWLKARYQTLENLNQAWWSTFWSHTYTDWSQIESPAPQGEMSIHGLNLDW
FT                   HRFNTAQVTDFCRHEIAPLKAANASLPVTTNFMEYFYDYDYWRLAEALDFISWDSYPMW
FT                   HRDKDETALACYTAMYHDMMRSLKGGKPFVLMESTPGATNWQPTSKLKKPGMHILSSLQ
FT                   AVAHGADSVQYFQWRKSRGSVEKFHGAVVDHVGHIDTRIGREVCQLGVILSKLPEVRGC
FT                   RTEAKVAIIFDQQNRWALDDAQGPRNLGMEYEKTVNEHYRPFWEQGIAVDVIDADVDLT
FT                   PYQLVIAPMLYMVRDGFAGRAEAFVANGGHLVTTYWTGIVNESDLCYLGGFPGPLRNLL
FT                   GIWAEEIDCLNDGEFNLVQGLAGNQCGLQGPYQVRHLCELIHIESAQALATYRDDFYAG
FT                   RPAVTVNAFGKGKAWHVASRNDLAFQRDFFTALSKELALPRAIATELPPGVVATARTDG
FT                   DNAFIFLQNYSAQNHTLTLPQGYWDCLTDAAVSAPLTLSAWDCRILRRHA"
FT   gene            476523..476837
FT                   /locus_tag="KPN_00432"
FT   CDS_pept        476523..476837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00432"
FT                   /product="putataive phosphotransferase system PTS"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00432"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75884"
FT                   /db_xref="GOA:A6T5L3"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5L3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001996"
FT                   /protein_id="ABR75884.1"
FT                   /translation="MVSLKSFLHYFSPARPAQPLSEAEKQQIEALIQAFGGEANITQVD
FT                   ACITRLRVSVRHLAAVDSEALQQQGALGVIILGQQVHAIFGKQSDALRQLLDEHFAARK
FT                   "
FT   gene            complement(476974..478245)
FT                   /locus_tag="KPN_00433"
FT   CDS_pept        complement(476974..478245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00433"
FT                   /product="maltoporin precursor"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00433"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75885"
FT                   /db_xref="GOA:A6T5L4"
FT                   /db_xref="InterPro:IPR003192"
FT                   /db_xref="InterPro:IPR023738"
FT                   /db_xref="InterPro:IPR036998"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T5L4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003192"
FT                   /protein_id="ABR75885.1"
FT                   /translation="MNTTLRALSVALAAALIAPSAFAATAAIPTIDFHGYMRAGVGVSG
FT                   DGSEAEWQKNKLGRLGNESDTYGELELGSEVYKKDDVSFYLDSMVSMVSDGSNDNETTL
FT                   NDDAQFGLRQLNLQIKGLIPGDPNAVIWGGKRYYQRHDLHIIDTKYWNISGSGAGVENY
FT                   TLGPGAVSLAWIRGDANDVDYRVDGDSNVNINYIDLRYAGWKPWAGSWTEFGIDYAMPN
FT                   TTKKQDSYGGLYDADNGVMLTGEISQDMLGGYNKTVLQYANKGLAQNMVSQGGGWYDMW
FT                   NYVNDATGYRVINTGLIPITEKFSINHVLTWGSADDITDYTDKTRMLSLVARGQYQFTD
FT                   YVRLIGEVGGFYQKDSYNNGTSYKQAGEKYTIALGLADGPDFMSRPELRIFASYLNDSE
FT                   DGKPFEDQTANNTWNFGVQVEAWW"
FT   gene            478516..479586
FT                   /locus_tag="KPN_00434"
FT   CDS_pept        478516..479586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00434"
FT                   /product="transcriptional repressor of lactose catabolism
FT                   (GalR/LacI family)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00434"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75886"
FT                   /db_xref="GOA:A6T5L5"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5L5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000843"
FT                   /inference="protein motif:Pfam:IPR001761"
FT                   /protein_id="ABR75886.1"
FT                   /translation="MKSKSATLEDVARHAGVSYQTVSRVLNKSANVSEATRRKVEKSIE
FT                   ALRYVPNRLAQQLVGKESQTVGLVTISLAWHAPSQVAAAVKRYANLEGYQVLISMIDES
FT                   VNQSIQDSINELKSQRVDKVIINVPLETEQAQKIAADNDDIVCLFLDVDPYSSVFNVSF
FT                   NPADGTRASVKYLYEMGHREIALLAGPDSSVSAKLRLKSWLETLDGYGLKPVTVLHGNW
FT                   DAQSGYAGALQMLRETPNFSAVLVGNDQMALGVLSAFHQHQVAVPGEKSVIGYDDTYES
FT                   SFFYPALSTVSLDLDLQGKEAVRRILASTSGAPHTSSILPARLVIRHSSGARIEQGKDL
FT                   QAIAEQLRAIAHRLAP"
FT   gene            479702..479965
FT                   /gene="rpmE2"
FT                   /locus_tag="KPN_00435"
FT   CDS_pept        479702..479965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE2"
FT                   /locus_tag="KPN_00435"
FT                   /product="putative 50S ribosomal protein L31 (second copy)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00435"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75887"
FT                   /db_xref="GOA:A6T5L6"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027493"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5L6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002150"
FT                   /protein_id="ABR75887.1"
FT                   /translation="MKAHIHPPYRTVVFHDTSANEYFKVGSTIRTDRVIELDGETFPYV
FT                   TIDVSSKSHPYYTGKQKTFANEGSAARFRQRFGGFIDAKRKA"
FT   gene            479962..480105
FT                   /gene="rpmJ2"
FT                   /locus_tag="KPN_00436"
FT   CDS_pept        479962..480105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ2"
FT                   /locus_tag="KPN_00436"
FT                   /product="putative 50S ribosomal protein L36 (second copy)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00436"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75888"
FT                   /db_xref="GOA:A6T5L7"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T5L7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000473"
FT                   /protein_id="ABR75888.1"
FT                   /translation="MMQVVNSLRSAKQRHPDCQLVKRKGRLYVICKSNPRFKAVQGRKK
FT                   RR"
FT   gene            complement(480102..480800)
FT                   /locus_tag="KPN_00437"
FT   CDS_pept        complement(480102..480800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00437"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00437"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75889"
FT                   /db_xref="GOA:A6T5L8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5L8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000182"
FT                   /protein_id="ABR75889.1"
FT                   /translation="MCEYNQFGQALGVALPDWQPRPWPTRQVLQGSRCRLEPLTLAHAS
FT                   DLFAAHQLAPDARSWTWLLREPESNLAEFSAWVEQVATLADPIHFAVVDQQRGKAVGSL
FT                   ALMRIDIAHGVVEVGHVHFSPLLSRTAMATEAHWLLMQYVFDTLGYRRYEWKCNSLNIP
FT                   SARAARRLGFQYEGRFRQALVSKGHNRDTDWFSVIDGEWPELDNAMRQWLAADNFTADG
FT                   QQRRSLESFR"
FT   gene            480901..482352
FT                   /locus_tag="KPN_00438"
FT   CDS_pept        480901..482352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00438"
FT                   /product="putative bacterial regulatory protein, GntR"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00438"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75890"
FT                   /db_xref="GOA:A6T5L9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5L9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000524"
FT                   /protein_id="ABR75890.1"
FT                   /translation="MNIPDEGFFTLLTQGMRNRTVETLQRALYHTLRDAILQGTLTARC
FT                   RLPGSRVMAERLHLSRNTVNAALEQLALEGYLTRSRQGTQVAPLASCRQEAGQMPPVVL
FT                   PERLQRLPAAMRRDSPTLAFTPGMPAVNYFPLPLWRRLMDNVLREDGSALLGYGEAAGD
FT                   PLLREAIARHLALSRGIRCDIRQIVITEGALEGVNLCASLLTNPGDSVWLEEPGYLGAW
FT                   SGFQRAGLRVRGMAVDDEGMCIANGVAEPPRLIFTSPSHQYPCGSIMSAGRRLALVEYA
FT                   RRHGAWIVEDDYDSEFRHSGEPIPAMLGMVPDAPVVYLGTFSKTLFPALRIGFMVMPPA
FT                   LADAAQDAIGALLRGGHRAEQRALASFIEKGHYARHLAAMRRLYRKRQQQLREALAQEI
FT                   TVPCDVLGGGGGMHLTVAMEGVNDRTLAQQARQFQLAPAALSHFYLDPQRARSGLVLGY
FT                   GNTSASRYLPALRTLNRLIAQHRRA"
FT   gene            complement(482327..482797)
FT                   /gene="ylaC"
FT                   /locus_tag="KPN_00439"
FT   CDS_pept        complement(482327..482797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylaC"
FT                   /locus_tag="KPN_00439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00439"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75891"
FT                   /db_xref="GOA:A6T5M0"
FT                   /db_xref="InterPro:IPR019713"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5M0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75891.1"
FT                   /translation="MTEIQRLLIHTIDELNVQEKRDNRPRFSISFIRNHPGLFVAMYAA
FT                   FLATLVVMLRSETLVDSVWLLVVLFILFNAFFFFDVYPRYRYEDIDVLDFRVCYNGEWY
FT                   NTRFVPRQLIDRILQSPDVDSEQKAQLKKMVATKGELSFYDVFTLTRAGAAQ"
FT   gene            complement(482930..483496)
FT                   /gene="maa"
FT                   /locus_tag="KPN_00440"
FT   CDS_pept        complement(482930..483496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maa"
FT                   /locus_tag="KPN_00440"
FT                   /product="maltose O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00440"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75892"
FT                   /db_xref="GOA:A6T5M1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5M1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001451"
FT                   /protein_id="ABR75892.1"
FT                   /translation="MSEEKRKMIAGELYLSGDPTLRADRLRARQLLHRYNHSAPDDQEQ
FT                   RQHILAELFARAGDAYIEPSFRCDYGYNIFLGAGFYANFDCVMLDVCPIHIGDNCMLAP
FT                   GVHIYTATHPLDADARNSGQEYGKPVTIGHNVWIGGRAVINPGVTIGDNAVIASGAVVT
FT                   KDVPACTVVGGNPAQIIKRLPPTNP"
FT   gene            complement(483655..483906)
FT                   /gene="hha"
FT                   /locus_tag="KPN_00441"
FT   CDS_pept        complement(483655..483906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hha"
FT                   /locus_tag="KPN_00441"
FT                   /product="haemolysin expression modulating protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00441"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75893"
FT                   /db_xref="InterPro:IPR007985"
FT                   /db_xref="InterPro:IPR036666"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5M2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR007985"
FT                   /protein_id="ABR75893.1"
FT                   /translation="MLELLQSKGGIMSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYE
FT                   LSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR"
FT   gene            complement(483900..484274)
FT                   /gene="ybaJ"
FT                   /locus_tag="KPN_00442"
FT   CDS_pept        complement(483900..484274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaJ"
FT                   /locus_tag="KPN_00442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00442"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75894"
FT                   /db_xref="InterPro:IPR019693"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5M3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75894.1"
FT                   /translation="MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVN
FT                   LQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYLDDTFTLFSNYGINSTDLQKWKKSG
FT                   NRLFRCFVNASRENPASLSC"
FT   gene            complement(484760..487906)
FT                   /gene="acrB"
FT                   /locus_tag="KPN_00443"
FT   CDS_pept        complement(484760..487906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrB"
FT                   /locus_tag="KPN_00443"
FT                   /product="acridine efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00443"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75895"
FT                   /db_xref="GOA:A6T5M4"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5M4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001036"
FT                   /protein_id="ABR75895.1"
FT                   /translation="MPNFFIDRPIFAWVIAIIIMLAGGLSILKLPVAQYPTIAPPAISI
FT                   TAMYPGADAETVQNTVTQVIEQNMNGIDHLMYMSSNGDSTGTATITLTFESGTDPDIAQ
FT                   VQVQNKLALATPLLPQEVQQQGISVEKASSSFLMVVGVINTNGTMNQDDISDYVAANMK
FT                   DPISRTSGVGDVQLFGSQYAMRIWMDPNKLNNFQLTPVDVISALKAQNAQVAAGQLGGT
FT                   PPVKGQQLNASIIAQTRLTNTEEFGNILLKVNQDGSQVRLRDVAKIELGGESYDVVAKF
FT                   NGQPASGLGIKLATGANALDTANAIRAELAKMEPFFPSGMKIVYPYDTTPFVKISIHEV
FT                   VKTLVEAIILVFLVMYLFLQNFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTMFGMV
FT                   LAIGLLVDDAIVVVENVERVMAEEGLPPKEATRKSMGQIQGALVGIAMVLSAVFIPMAF
FT                   FGGSTGAIYRQFSITIVSAMALSVLVALILTPALCATMLKPIQKGSHGATTGFFGWFNR
FT                   MFDKSTHHYTDSVGNILRSTGRYLVLYLIIVVGMAWLFVRLPSSFLPDEDQGVFLSMAQ
FT                   LPAGATQERTQKVLDEMTNYYLTKEKDNVESVFAVNGFGFAGRGQNTGIAFVSLKDWSQ
FT                   RPGEENKVEAITARAMGYFSQIKDAMVFAFNLPAIVELGTATGFDFELIDQGGLGHEKL
FT                   TQARNQLFGMVAQHPDVLTGVRPNGLEDTPQFKIDIDQEKAQALGVSISDINTTLGAAW
FT                   GGSYVNDFIDRGRVKKVYIMSEAKYRMLPEDIGKWYVRGSDGQMVPFSAFSTSRWEYGS
FT                   PRLERYNGLPSLEILGQAAPGKSTGEAMALMEELAGKLPSGIGYDWTGMSYQERLSGNQ
FT                   APALYAISLIVVFLCLAALYESWSIPFSVMLVVPLGVVGALLAATFRGLTNDVYFQVGL
FT                   LTTIGLSAKNAILIVEFAKDLMEKEGKGLIEATLEAVRMRLRPILMTSLAFILGVMPLV
FT                   ISSGAGSGAQNAVGTGVMGGMVTATILAIFFVPVFFVVVRRRFSKKSEDIEHSHQVEHH
FT                   "
FT   gene            complement(487929..489122)
FT                   /gene="acrA"
FT                   /locus_tag="KPN_00444"
FT   CDS_pept        complement(487929..489122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrA"
FT                   /locus_tag="KPN_00444"
FT                   /product="acridine efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00444"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75896"
FT                   /db_xref="GOA:A6T5M5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5M5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR006143"
FT                   /protein_id="ABR75896.1"
FT                   /translation="MNKNRGLTPLAVVLMLSGSLALTGCDDKPAQQGAQHMPEVGIVTL
FT                   KSAPLQITTELPGRTSAYRIAEVRPQVSGIILKRNFVEGSDIQAGVSLYQIDPATYQAS
FT                   YDSAKGDLAKAQAAANMDQLTVKRYQKLLGTKYISQQDYDTAVATAQQSNAAVVAAKAA
FT                   VETARINLAYTKVTSPISGRIGKSAVTEGALVQNGQTTALATVQQLDPIYVDVTQSSND
FT                   FLRLKQELADGRLKQENGKAKVELVTNDGLKYPQSGTLEFSDVTVDQTTGSITLRAIFP
FT                   NPDHTLLPGMFVRARLEEGINPDALLVPQQGVTRTPRGDASVMVVGEGDKVEVRQVTAS
FT                   QAIGDKWLVTDGLKSGDRVIVTGLQKIKPGVQVKAQEVASDDKQQAAGNAPSEQTKS"
FT   gene            489265..489915
FT                   /gene="acrR"
FT                   /locus_tag="KPN_00445"
FT   CDS_pept        489265..489915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrR"
FT                   /locus_tag="KPN_00445"
FT                   /product="acrAB operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00445"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75897"
FT                   /db_xref="GOA:A6T5M6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013572"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5M6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001647"
FT                   /protein_id="ABR75897.1"
FT                   /translation="MARKTKQQARETRQLILDVALRLFSQQGVSSTSLATIAKAAGVTR
FT                   GAIYWHFKNKSDLFNEIWELSDASISDLEIEYRAKFPNDPLSVIREILVYVLEATVTEE
FT                   RRRLMMEIIYHKCEFVGEMTVVQQAQRQLSLASYERIEQTLKECIAAKLLPANLLTRRA
FT                   AVLMRSYLSGLMENWLFAPDSFDLHAEARDYVAILLEMYQFCPTLRGPESLSA"
FT   gene            490045..493392
FT                   /gene="kefA"
FT                   /locus_tag="KPN_00446"
FT   CDS_pept        490045..493392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kefA"
FT                   /locus_tag="KPN_00446"
FT                   /product="component of the MscS mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00446"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75898"
FT                   /db_xref="GOA:A6T5M7"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR024393"
FT                   /db_xref="InterPro:IPR025692"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5M7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR006685"
FT                   /protein_id="ABR75898.1"
FT                   /translation="MLHTISRQRATFIFIITLLCFIGLFSPVQGRAADLPDRAEVQSQL
FT                   NTLNKQKELTPQDKLVQQDLTQTLETLDKIERIKSETAQLRQQVEQAPAKLRQAVESLN
FT                   NLSDVPNDDATRKTLSTLSLRQLESRVTQTLDDLQNAQNDLATYNSQLVSLQTQPERVQ
FT                   NAMFNASQQLQQIRNRLNGTSVGDETLRPTQQVLLQAQQALLNAQIEQQRKSLEGNTIL
FT                   QDTLQKQRDYVTAWSNRLEHQLQLLQEAVNSKRLTLTEKTAQEAVTPDETARIQANPLV
FT                   KQELDINHQLSEKLIQATENGNQLVQRNIQVKNWLDRALQSERDIKEQISVLRGSLLLS
FT                   RILYQQQQTLPSADELQDMTNRIADLRLEQFEVNQQRDALFQSDAFVAKLEEGHSSEVN
FT                   DEVHAALLEVIDMRRELLDQFNKQLGNQLMMAINLQINQQQLMSVSSSLKEILTQQIFW
FT                   VNSNKPMDWEWIKAFPEALKGQFKAMKITVNWEKAWPAVFVAFLAGLPLLLIAGLIRWR
FT                   LQWLKDYQAKLASQVGQLRNDTQLHTPKAILIDLIRALPVVLLILAIGLILLTMQLNIS
FT                   GLLWAYSKKLAMFWLVFGLCWKVLEKNGVAVNHFNMPAQLTSHWRRQIVRVSLALLPLN
FT                   FWSVISELSPLNLMDDVLGQLVIFFNLLLIAVLVWPMCRESWRDKESHSLRLLTITVLS
FT                   IVPVALMVLTATGYFYTTLRLAGRWIETVYLVMIWNLLYQTVLRGLSVAARRIAWRRAL
FT                   ARRQHLVKEGAEGAEPQEEPTIALEQVNQQTLRITMLVMVALFAVMFWAIWSDLITVFA
FT                   YLDSITLWHYNGTEAGASVVRSVTMGSLLFAIVASMVAWALIRNLPGLLEVLVLSRLNM
FT                   RQGTSYAITTILNYAIIAIGAMTVFGALGVSWDKLQWLAAALSVGLGFGLQEIFGNFVS
FT                   GLIILFERPVRIGDTVTIGTFSGTVSKIRIRATTITDFDRKEVIIPNKAFVTERLINWS
FT                   LSDTVTRVVIRLGVAYGSDLDKVKEVLLKAAHDHPKVMQEPAPAVFFTTFGASTLDHEL
FT                   RLYVRELRDRSYTVDELNRAIDRLCRENDINIAFNQLEVHLRNEKGDEVTEVKRDGKGD
FT                   DLAPTTAS"
FT   gene            complement(493428..494339)
FT                   /locus_tag="KPN_00447"
FT   CDS_pept        complement(493428..494339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00447"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00447"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75899"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5M8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR006842"
FT                   /protein_id="ABR75899.1"
FT                   /translation="MEKVSQTPHDAVFRQMLMHQAVAKDFLQLYLPAPFLAICELDSLQ
FT                   LVSGSFVEEDLRASYSDILYSLRTRHGPGYVYALIEHQSTPDKLMAFRLLRYALAAMQR
FT                   HLDAGHDTLPLVVPILFYHGKVSPWPWARNWQQLFADPALAKALYSNDFPLVDLTVMPD
FT                   NQIARHRRMAMLELLQKHIRHRDLAELQVPLIALMTQGYLTEAQLNTLLRYMLQAGTTE
FT                   HPGALIRTLAAQSPRHKELMMTIAEWLEEKGRKQGKQEGEQEGREAATRSIAARMLARG
FT                   LERQTVQELTGLSDEELAALAP"
FT   gene            complement(494407..494580)
FT                   /gene="ybaM"
FT                   /locus_tag="KPN_00448"
FT   CDS_pept        complement(494407..494580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaM"
FT                   /locus_tag="KPN_00448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00448"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75900"
FT                   /db_xref="InterPro:IPR019630"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5M9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75900.1"
FT                   /translation="MSLENASDEVKLAVDLIMLLESHQIPAQTVLSALEIVRRDYANKL
FT                   KNAESGSQNPEK"
FT   gene            complement(494593..495123)
FT                   /gene="priC"
FT                   /locus_tag="KPN_00449"
FT   CDS_pept        complement(494593..495123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priC"
FT                   /locus_tag="KPN_00449"
FT                   /product="primosomal replication protein N''"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00449"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75901"
FT                   /db_xref="InterPro:IPR010890"
FT                   /db_xref="InterPro:IPR038338"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5N0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR010890"
FT                   /protein_id="ABR75901.1"
FT                   /translation="MVKTAQLLQTLNDQLSELAALVAPLAEHATLSPRFDRQLFHTRST
FT                   LMQAYLAEAQHNFNQLRQAVERQQLPQVVWIAERLAAQIAALRRETATWSLRSWDHASP
FT                   TLSRWQRRRLQHQEYERRLLAMRDQRQRQLAQATSLDEQQRLGKEVEAYSGRLARCRQA
FT                   LDKIENVLARLTR"
FT   gene            495190..495567
FT                   /gene="ybaN"
FT                   /locus_tag="KPN_00450"
FT   CDS_pept        495190..495567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaN"
FT                   /locus_tag="KPN_00450"
FT                   /product="putative gene 58"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00450"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75902"
FT                   /db_xref="GOA:A6T5N1"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5N1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR007401"
FT                   /protein_id="ABR75902.1"
FT                   /translation="MPPVILTIIGWLAVALGTLGVFLPLLPTTPFILLAAWCFARSSPR
FT                   FHQWLLYRSWFGGYLRHWQQYRAMPRGAKPRAIAMIVVTFAISLWLVKLTWVRIMLLVI
FT                   LACLLIFMWRIPVVDAKQQKH"
FT   gene            495718..496269
FT                   /gene="apt"
FT                   /locus_tag="KPN_00451"
FT   CDS_pept        495718..496269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apt"
FT                   /locus_tag="KPN_00451"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00451"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75903"
FT                   /db_xref="GOA:A6T5N2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T5N2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000836"
FT                   /protein_id="ABR75903.1"
FT                   /translation="MTATAQQLEYLKNSIQSIEDYPKPGILFRDVTSLLEDPKAYALSI
FT                   ELLTERYKDAGITKVVGTEARGFLFGAPVALALGVGFVPVRKPRKLPRETIAETYELEY
FT                   GTDQLEIHVDAIKPGDKVLVVDDLLATGGTIDATVKLIRRLGGEVHDAAFIINLFDLGG
FT                   EQRLEKLGIHCYSLVPFPGH"
FT   gene            496362..498269
FT                   /gene="dnaX"
FT                   /locus_tag="KPN_00452"
FT   CDS_pept        496362..498269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="KPN_00452"
FT                   /product="DNA polymerase III subunits gamma and tau"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00452"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75904"
FT                   /db_xref="GOA:A6T5N3"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR021029"
FT                   /db_xref="InterPro:IPR022001"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038249"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5N3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003959"
FT                   /protein_id="ABR75904.1"
FT                   /translation="MSYQVLARKWRPQTFADVVGQEHVLTALANGLSLGRIHHAYLFSG
FT                   TRGVGKTSIARLLAKGLNCETGITATPCGVCDNCREIEQGRFVDLIEIDAASRTKVEDT
FT                   RDLLDNVQYAPARGRFKVYLIDEVHMLSRHSFNALLKTLEEPPAHVKFLLATTDPQKLP
FT                   VTILSRCLQFHLKALDVEQIRHQLEHILGEEQIAFEPRALQLLSRAADGSLRDALSLTD
FT                   QAIASGEGQLTAASVSTMLGTLDDDQALSLIEALVAADGERVMAGVNDAAARGVEWEAL
FT                   LVEMQSLLHRIAMVQLSPSALGADMAAVEVRMRELARTVPPGDVQLYYQTLLIGRKELP
FT                   YAPDRRMGVEMTLLRALAFHPRKPLPEPEVQPAQAAAPAPRQPVAPAAPPPQSPQSLPP
FT                   TTSQVLAARSHLQRSQGATTPKKSEPAAASRARPVNNAALERLSSITERVQARPAAAAL
FT                   EQAPAKKEAYRWKATTVVEETKVEVATPKALKKALEHEKTPELAAKLAEEAVERDSWAA
FT                   EVSQLAVPKLVEQVALNAWKEQEGSRVCLHLRPSQRHLNSASAQQKLAEALGVLYGTPV
FT                   ELTIVEDDNPAMRTPLEWRQAIYEEKLAQAREAIIADNNIQTLRRFFDADLDEESIRPI
FT                   "
FT   gene            498327..498659
FT                   /gene="ybaB"
FT                   /locus_tag="KPN_00453"
FT   CDS_pept        498327..498659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaB"
FT                   /locus_tag="KPN_00453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00453"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75905"
FT                   /db_xref="GOA:A6T5N4"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T5N4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004401"
FT                   /protein_id="ABR75905.1"
FT                   /translation="MFGGKGGLGNLMKQAQQMQEKMQKMQEEIAQLEVTGESGAGLVKV
FT                   TINGAHNCRRVEIDPSLLEDDKEMLEDLVAAAFNDAARRIEETQKEKMASVSAGMQLPP
FT                   GFKMPF"
FT   gene            498659..499264
FT                   /gene="recR"
FT                   /locus_tag="KPN_00454"
FT   CDS_pept        498659..499264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="KPN_00454"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00454"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75906"
FT                   /db_xref="GOA:A6T5N5"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T5N5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000093"
FT                   /inference="protein motif:Pfam:IPR006171"
FT                   /protein_id="ABR75906.1"
FT                   /translation="MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQ
FT                   ALTRAMSEIGHCADCRTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQYSGR
FT                   YFVLMGHLSPLDGIGPDDIGLDRLEQRLEAESITEVILATNPTVEGEATANYIAELCAQ
FT                   YGVDASRIAHGVPVGGELEMVDGTTLSHSLAGRHKITF"
FT   gene            499375..501249
FT                   /gene="htpG"
FT                   /locus_tag="KPN_00455"
FT   CDS_pept        499375..501249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpG"
FT                   /locus_tag="KPN_00455"
FT                   /product="heat shock protein 90"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00455"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75907"
FT                   /db_xref="GOA:A6T5N6"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T5N6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001404"
FT                   /inference="protein motif:Pfam:IPR003594"
FT                   /protein_id="ABR75907.1"
FT                   /translation="MKGQETRGFQSEVKQLLHLMIHSLYSNKEIFLRELISNASDAADK
FT                   LRFRALSQPDLYEGDGELRVRVSFDKDNRTLTIADNGIGMNREEVIDHLGTIAKSGTKA
FT                   FLESMGSDQAKDSQLIGQFGVGFYSAFIVADKVTVRTRAAGDKPENGVFWESAGEGEYT
FT                   VADITKADRGTEITLHLREGEDDFLNDWRVRSIISKYSDHIALPVEIEKREEKDGETVI
FT                   SWEKINKAQALWTRSKSEVNDDEYKEFYKHIAHDYSDPLTWSHNRVEGKQEYTSLLYIP
FT                   SQAPWDMWNRDHKHGLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSNDLPLNVSREILQ
FT                   DSSVTRNLRTALTKRALQMLDKLAKDDAEKYQTFWKQFGLVLKEGPAEDPSNQEAIAKL
FT                   LRFATTHTDSSAQTVSLEEYVSRMKEGQEKIYYITADSYAAAKSSPHLELLRKKGIEVL
FT                   LLSDRIDEWMMSYLTEFDGKAFQSVAKADESLDKLADEVDESTKEAEKALEPFVERVKN
FT                   LLGDRVKEVRLTHRLTDTPAIVTTDADEMSTQMAKLFAAAGQAAPEVKYIFELNPAHQL
FT                   VKRAADTQDDAQFGEWVELLLDQALLAERGTLEDPNQFIRRMNQLLAS"
FT   gene            501472..502116
FT                   /gene="adk"
FT                   /locus_tag="KPN_00456"
FT   CDS_pept        501472..502116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="KPN_00456"
FT                   /product="adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00456"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75908"
FT                   /db_xref="GOA:A6T5N7"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T5N7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000850"
FT                   /inference="protein motif:Pfam:IPR007862"
FT                   /protein_id="ABR75908.1"
FT                   /translation="MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSEL
FT                   GKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGITVD
FT                   YVLEFDVPDELIVDRIVGRRVHAASGRVYHIKFNPPKVEGKDDVTGEELTTRKDDQEET
FT                   VRKRLVEYHQMTAPLIGYYTKEAQAGNTKYAKVDGTKAVADVRAELEKILG"
FT   gene            502245..503203
FT                   /pseudo
FT                   /locus_tag="KPN_00457"
FT                   /note="Pseudogene compared to gi|16128459|ref|NP_415008.1|
FT                   ferrochelatase: final enzyme of heme biosynthesis
FT                   [Escherichia coli K12]"
FT   gene            503270..504574
FT                   /gene="gsk"
FT                   /locus_tag="KPN_00458"
FT   CDS_pept        503270..504574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsk"
FT                   /locus_tag="KPN_00458"
FT                   /product="inosine-guanosine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00458"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75909"
FT                   /db_xref="GOA:A6T5N8"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5N8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002173"
FT                   /protein_id="ABR75909.1"
FT                   /translation="MKFPGKRKSKHYFPVNARDPLLQQIQPENESSVSWVVGIDQTLVD
FT                   IEAKVDEAFIVRYGLSAGHSLVIEDDVAEALYQELVRNNLITHQFAGGTIGNTMHNYSV
FT                   LADDRSVLLGVMCSNIEIGGYAYRYLCNTSSRTDLNYLQGVDGAIGRCFTLIGDSGERT
FT                   FAISPGHMNKLRPESIPEAVIAGASALVLTSYLVRCKPGEPMPDATMKAIEYAKKHDVP
FT                   VVLTLGTKYVIADNPAWWQEFLQEHVSILAMNEEEGEALTGFADPLSAANKALDWVDLV
FT                   LCTAGPAGLYMAGFTEEEAKRKTQHPLLPGAIPEFNQFEFSRAMRHQDCVNPLRIYSHI
FT                   APYMGGPEKIMNTNGAGDGALAALLHDITANNYHRNNVPNSSKHKCKWLTYSSLAQVCK
FT                   YANRVSYQVLNQHSPRLTRGLPEREDSLEEAYWDR"
FT   gene            complement(504610..506286)
FT                   /gene="ybaL"
FT                   /locus_tag="KPN_00459"
FT   CDS_pept        complement(504610..506286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaL"
FT                   /locus_tag="KPN_00459"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00459"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75910"
FT                   /db_xref="GOA:A6T5N9"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5N9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003148"
FT                   /protein_id="ABR75910.1"
FT                   /translation="MHHATPLITTIVGGLVLAFILGMIANKLRISPLVGYLLAGVLAGP
FT                   FTPGFVADTKLAPELAELGVILLMFGVGLHFSLKDLMAVKSIAIPGAIAQIAVATLLGM
FT                   ALSAALGWSLMTGIVFGLCLSTASTVVLLRALEERQLIDSQRGQIAIGWLIVEDLVMVL
FT                   TLVLLPAIAGMAEKGNVGFASLALDLGITIGKVVAFIAIMMLVGRRLVPWIMSRSAATG
FT                   SRELFTLSVLALALGIAFGAVELFDVSFALGAFFAGMVLNESELSHRAAHDTLPLRDAF
FT                   AVLFFVSVGMLFDPMVLVQQPLAVLATLAIIIFGKSAAAFFLVRMFGHSPRTALTIAAS
FT                   LAQIGEFAFILAGLGMALNLLPQAGQNLVLAGAIISIMLNPVLFTLLEKYLDKTETLDE
FT                   QTLEEVLEDEKQVPVDICNHALLVGFGRVGSLLGEKLMAQGIPLVVVETSRTRVDELRE
FT                   RGISAVLGNAANEEIMELAHLDCARWLLLTIPNGYEAGEIVASAREKCPNIEIIARAHY
FT                   DDEVDYIIDRGANQVVMGEREIARAMLRLLETPPAGEVVTG"
FT   gene            complement(506512..507732)
FT                   /gene="fsr"
FT                   /locus_tag="KPN_00460"
FT   CDS_pept        complement(506512..507732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fsr"
FT                   /locus_tag="KPN_00460"
FT                   /product="fosmidomycin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00460"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75911"
FT                   /db_xref="GOA:A6T5P0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5P0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75911.1"
FT                   /translation="MAINQTAQPLSGPAAPPQKARTSFGILGAISLSHLLNDMIQSLIL
FT                   AIYPLLQAEFSLTFVQIGMITLTFQLTSSLFQPVIGYITDKRSMPWSLPVGMCFTLCGL
FT                   ILLALAGSFGMVLLAAALVGTGSSVFHPESSRVARMASGGRHGLAQSLFQVGGNFGSSL
FT                   GPLLAAVIIAPYGKGNVAWFVLAALLAIVVLSQISRWYAAQHRMNKGKPKPAIVNPLPR
FT                   KKVILAVGILLMLIFSKYFYMASISSYYTFYLMHKFGLTVQNAQLHLFAFLFAVAAGTV
FT                   IGGPVGDKIGRKYVIWGSILGVAPFTLVLPYASLEWTGILTVIIGFILASAFSAILVYA
FT                   QELLPGRIGMVSGLFFGFAFGMGGLGAAVLGLLADHTSIDLVYKICAFLPLLGFLTIFL
FT                   PDNRQKA"
FT   gene            508002..509654
FT                   /gene="ushA"
FT                   /locus_tag="KPN_00461"
FT   CDS_pept        508002..509654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ushA"
FT                   /locus_tag="KPN_00461"
FT                   /product="UDP-sugar hydrolase (5'-nucleotidase)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00461"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75912"
FT                   /db_xref="GOA:A6T5P1"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5P1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004843"
FT                   /inference="protein motif:Pfam:IPR008334"
FT                   /protein_id="ABR75912.1"
FT                   /translation="MHYFKHSVALALFAALSLGSLSAQAYEQDKTYKITILHTNDHHGH
FT                   FWRNDYGEYGLAAQKTLVDGIRKEVAAEGGSVLLLSGGDINTGVPESDLQDAEPDFRGM
FT                   NLIGYDAMAVGNHEFDNPLSVLRQQEKWAKFPFLSANIYQKSTGERLFKPWALFKRGGL
FT                   KIAVIGLTTDDTAKIGNPEYFTDIEFRKPAEEAKLVIQELQQNEKPDVILATTHMGHYD
FT                   NGNHGSNAPGDVEMARSLPAGSLAMIVGGHSQDPVCMAAENKKQVDYVPGTPCAPDRQN
FT                   GIWIVQAHEWGKYVGRADFEFRNGEMKLVHYQLIPVNLKKKVTYDNGQSERVLYTPQIA
FT                   ENPQMMSLLTPFQNKGKAQLQVKIGSVNGHLEGDRSKVRFVQTNMGHLLLAAQMARSNA
FT                   DFAVMSGGGIRDSIEAGDITYKDVMKVQPFGNVLTYVDMNGKEVVDYLTAVAQMKPDSG
FT                   AYPQFANVSFVAKDGKLNDLKIKGEPVDPAKTYRMATLSFNATGGDGYPNIADKPGYVN
FT                   TGFIDAEVLKEYIEKNSPLDAAAYEPKGEVSWQ"
FT   gene            complement(509760..510239)
FT                   /gene="ybaK"
FT                   /locus_tag="KPN_00462"
FT   CDS_pept        complement(509760..510239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaK"
FT                   /locus_tag="KPN_00462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00462"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75913"
FT                   /db_xref="GOA:A6T5P2"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5P2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR007214"
FT                   /protein_id="ABR75913.1"
FT                   /translation="MTPAVKLLEKNKISFQIHSYDHDPNETNFGDEVVRKLGLNADQVY
FT                   KTLLVAVNGDMKHLAVAVTPVAGQLDLKKVAKALGAKKVDMADPMVAQRITGYLVGGIS
FT                   PLGQKKRLPTVIDAPAQEFATIYISGGKRGLDIELAASDLAQLLDAKFADIARRD"
FT   gene            complement(510442..511212)
FT                   /gene="ybaP"
FT                   /locus_tag="KPN_00463"
FT   CDS_pept        complement(510442..511212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaP"
FT                   /locus_tag="KPN_00463"
FT                   /product="putative ligase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00463"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75914"
FT                   /db_xref="GOA:A6T5P3"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5P3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR010891"
FT                   /protein_id="ABR75914.1"
FT                   /translation="MLWRAAVGSSYSWPAMDIVLPGERYLHLVGSIHMGTRDMAPPPAK
FT                   LLKKIRQADALIVEADISGNETPFSNLPTYPPLAERLSDAQLSELEARAGELGLSVGLF
FT                   DSQPLWQVAMVLQATQAQKLGLRPDYGIDYQLLMAARESNIAVMELEGADSQIALLRDL
FT                   PDGGMALLEDTLTHWRTNARLLQVMIGWWLEQPPSRGAVSLPTTFSQSLYDVLMHQRNL
FT                   AWRETLLALPPGRYVVAVGALHLYGEGNLPDMLT"
FT   gene            complement(511368..513923)
FT                   /gene="copA"
FT                   /locus_tag="KPN_00464"
FT   CDS_pept        complement(511368..513923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="copA"
FT                   /locus_tag="KPN_00464"
FT                   /product="Cu(I)-translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00464"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75915"
FT                   /db_xref="GOA:A6T5P4"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5P4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR005834"
FT                   /inference="protein motif:Pfam:IPR006121"
FT                   /inference="protein motif:Pfam:IPR008250"
FT                   /protein_id="ABR75915.1"
FT                   /translation="MKEWVWSIVDRKIIQELFMSNTIDLTLDGLSCGHCVKRVKESLEQ
FT                   RPDVEQAEVTLTEAHVTGSASAQALIDTVKQAGYGAELSHPKAKPLAESSIPSEALTAA
FT                   TPELPAAHDEDDSQQLLINGMSCASCVSRVQNALAAVPGVSQARVNLAERTALVMGSAS
FT                   AAELVQAVEKAGYGAEAIEDDLQRRERQQETALATMKRFRWQAIVALLVGVPVMVWGMI
FT                   GDNMMVSDDNRSLWLVIGLVTLAVMVFAGGHFYRSAWKSLKNGTATMDTLVALGTGVAW
FT                   LYSMSVNLWPQWFPMEARHLYYEASAMIIGLINLGHMLEARARQRSSKALEKLLDLTPP
FT                   SARVVTPEGEKDLPLAEVQAGMTLRLTTGDRVPVDGMISQGEAWFDEAMLTGEPVPQQK
FT                   GDGDAIHAGTVVQDGSVLFTASAVGSQTTLARIIRMVRQAQSSKPEIGQLADKISAVFV
FT                   PAVVVIALISAAIWYFFGPAPQIVYTLVIATTVLIIACPCALGLATPMSIISGVGRAAE
FT                   YGVLVRDADALQRASELDTLVFDKTGTLTEGKPQVVAVKTFAGVDEHTALRLAAALEQG
FT                   SSHPLARAILDKAADGPLPEVSGFRTLRGLGVSGEAEGHRLLLGNQALLNEQHINTAEV
FT                   ESEMTAQASRGATPVLLAVDGQAAALFAIRDPLREDSVDALARLHRQGYRLVMLTGDNP
FT                   TTAKAIAKEAGIDEVIAGVLPDDKADAIKRLQSQGHKVAMVGDGINDAPALAQADVGIA
FT                   MGGGSDVAIETAAITLMRHSLHGVADALAISKATLRNMKQNLLGAFVYNSLGIPIAAGI
FT                   LWPLTGTLLDPVVAGAAMALSSITVVSNANRLLRFKPKE"
FT   gene            513976..514386
FT                   /gene="cueR"
FT                   /locus_tag="KPN_00465"
FT   CDS_pept        513976..514386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cueR"
FT                   /locus_tag="KPN_00465"
FT                   /product="copper responsive transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00465"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75916"
FT                   /db_xref="GOA:A6T5P5"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5P5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000551"
FT                   /protein_id="ABR75916.1"
FT                   /translation="MNISDVAKKTGLTSKAIRFYEEKGLVTPPLRSENGYRTYSQQHLD
FT                   ELTLLRQARQVGFNLEECRELVALFNDPSRHSADVKKRTLEKVADIENHIRELQNMRAH
FT                   LLALAESCPGDDSAECPIIDNLSGCCHRKAQA"
FT   gene            complement(514383..514841)
FT                   /gene="ybbJ"
FT                   /locus_tag="KPN_00466"
FT   CDS_pept        complement(514383..514841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbJ"
FT                   /locus_tag="KPN_00466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00466"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75917"
FT                   /db_xref="GOA:A6T5P6"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5P6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75917.1"
FT                   /translation="MIGMILTHPHLFWLSLGGLLLAAEMLGGSGYLLWSGVAGVVTGAL
FT                   TWLLPLSWEWQGTLFAVLTLLAAWLWSKWLRKRVKTQRPADAQLNQRGQQLVGRRLTLD
FT                   APLVNGRGHVRVGDSSWPVIADEDFAAGSKVEVIAVEGITLRIRPAVR"
FT   gene            complement(514838..515755)
FT                   /gene="ybbK"
FT                   /locus_tag="KPN_00467"
FT   CDS_pept        complement(514838..515755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbK"
FT                   /locus_tag="KPN_00467"
FT                   /product="putative protease"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00467"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75918"
FT                   /db_xref="GOA:A6T5P7"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR018080"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5P7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001107"
FT                   /protein_id="ABR75918.1"
FT                   /translation="MLIFIPILIFVALVIVAAAVKIVPQGYQWTVERFGRFTQTLQPGL
FT                   SLVVPFMDRIGRKVNMMEQVLDIPSQEVISRDNANVTIDAVCFIQVIDAPKAAYEVSNL
FT                   EQAIVNLTMTNIRTVLGSMELDEMLSQRDSINTRLLHIVDDATNPWGVKITRVEIRDVR
FT                   PPAELIASMNAQMKAERTKRAYILEAEGVRQAEILKAEGEKQSQILKAEGERQSAFLQA
FT                   EARERSAEAEARATQMVSSAIASGDIQAINYFVAQKYTDALQQIGAANNSKVVLMPLDA
FT                   SSLMGSIAGISELIKEGAGDRKKS"
FT   gene            515896..516573
FT                   /gene="ybbL"
FT                   /locus_tag="KPN_00468"
FT   CDS_pept        515896..516573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbL"
FT                   /locus_tag="KPN_00468"
FT                   /product="putative ATP-binding component of a transport
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00468"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75919"
FT                   /db_xref="GOA:A6T5P8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5P8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003439"
FT                   /protein_id="ABR75919.1"
FT                   /translation="MKENNALLRLDGVGFKTDDAVILHNINFQLRAGEFKLITGPSGCG
FT                   KSTLLKIIASLLSPTSGRLFFDDADVATLSPERYRQQVSYCAQTPALFGDSVYDNLIFP
FT                   WQIRNKQPDPQALLADLQRFGLDENMLEKSINELSGGEKQRVSLIRNLQFLPRVLLLDE
FT                   ITSALDESNKQNVNEIIHGYATEKQVAVLWVTHDRNEISHADEVITLQPAGGNMQEVQH
FT                   ERA"
FT   gene            516560..517342
FT                   /gene="ybbM"
FT                   /locus_tag="KPN_00469"
FT   CDS_pept        516560..517342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbM"
FT                   /locus_tag="KPN_00469"
FT                   /product="putative metal resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00469"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75920"
FT                   /db_xref="GOA:A6T5P9"
FT                   /db_xref="InterPro:IPR005226"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5P9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR005226"
FT                   /protein_id="ABR75920.1"
FT                   /translation="MNGHNITNESLALSMVLVLIAILVSYREKLALEKDIIWSICRAIV
FT                   QLIIVGYVLKYIFNVNHAVLTLLMVLFICFNAAWNAKKRSKYIDKAFISSFIAITTGAG
FT                   LTLAVLVFSGSIAFVPMQVIPIAGMVAGNAMVAVGLCYNNMGQRFSSEQQQIQEKLSLG
FT                   ATPKMASARLIRESIRASLIPTVDSAKTVGLVSLPGMMSGLIFAGIDPVKAIKYQIMVT
FT                   FMLLSTASLSTIIAGYLTYRKFFNARHQLVVTQLKKRP"
FT   gene            complement(517450..518304)
FT                   /gene="ybbN"
FT                   /locus_tag="KPN_00470"
FT   CDS_pept        complement(517450..518304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbN"
FT                   /locus_tag="KPN_00470"
FT                   /product="putative thioredoxin protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00470"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75921"
FT                   /db_xref="GOA:A6T5Q0"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5Q0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR006662"
FT                   /protein_id="ABR75921.1"
FT                   /translation="MSEQNIVNISEVNLQQTLQQSMNVPVLFYFWSARSQHCEQLTPVL
FT                   ERLAAQYNGQFTLAKVDCDAEQMLASQFGLRAIPTVYLFQNGQPVDGFEGPQPEEAIRA
FT                   LLDKVLPREEELKAQQALALMQEEKYADALPLLKEAWQLSNQESQIGLLLAETLIALHR
FT                   SDEAESVLKTIPLQDQDTHYQGLVAQIELLKQAADTPEIQQLQQQVEQNPEDAQLASQL
FT                   ALQLHQVGRNEEALALLFSHLQKDLGAGDGQARKMLQEILAALGTGDALAAKYRRQLYS
FT                   LLY"
FT   gene            complement(518363..519172)
FT                   /gene="ybbO"
FT                   /locus_tag="KPN_00471"
FT   CDS_pept        complement(518363..519172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbO"
FT                   /locus_tag="KPN_00471"
FT                   /product="short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00471"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75922"
FT                   /db_xref="GOA:A6T5Q1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5Q1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002198"
FT                   /protein_id="ABR75922.1"
FT                   /translation="MTPERQGSLTGKVMQKTVLVTGCSSGIGLESALDLTRQGFRVLAA
FT                   CRKAEDVARMQDLGLTGILLDLDDPQSVERAAAEVIALTDNRLYGLFNNAGYGVYGPLN
FT                   TISRQQMEQQFSANFFGAHQLTMLLLPAMTPHGEGRIVMTSSVMGLIASPGRGAYAASK
FT                   YALEAWSDALRMELRHSGIQVSLIEPGPIRTRFTDNVNQTQSDKPVENPGIAARFTLGP
FT                   EAVVEKVRNAFTSDKPKLRYPVTLVTHAVALLKRLLPARAMDKIIHG"
FT   gene            complement(519162..519755)
FT                   /gene="tesA"
FT                   /locus_tag="KPN_00472"
FT   CDS_pept        complement(519162..519755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tesA"
FT                   /locus_tag="KPN_00472"
FT                   /product="acyl-CoA thioesterase I"
FT                   /note="also functions as protease I"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00472"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75923"
FT                   /db_xref="GOA:A6T5Q2"
FT                   /db_xref="InterPro:IPR008265"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5Q2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001087"
FT                   /protein_id="ABR75923.1"
FT                   /translation="MPFLLLFLFTCRAMAADTLLILGDSLSAGYRMAANAAWPALLNEQ
FT                   WQAKTPVVNASISGDTSQQGLARLPALLKQHQPRWVLVELGGNDGLRGFPPQQTEQTLR
FT                   TIIKDIKAANAEPLLMQIHLPANYGRRYNEAFGAIYPALAKEFAIPLLPFFMEEVYLKP
FT                   QWMQDDGIHPNRDAQPFIADWMAKRLAPLVNHDS"
FT   gene            519756..520442
FT                   /gene="ybbA"
FT                   /locus_tag="KPN_00473"
FT   CDS_pept        519756..520442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbA"
FT                   /locus_tag="KPN_00473"
FT                   /product="putative ATP-binding component of a transport
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00473"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75924"
FT                   /db_xref="GOA:A6T5Q3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5Q3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003439"
FT                   /protein_id="ABR75924.1"
FT                   /translation="MPAENILEVHHLKKSVGQGEHQLSILTGVELVVKPRQTIALIGES
FT                   GSGKSTLLAILAGLDDGSSGEVSMLGKPLHRMDEEARAALRAQHVGFVFQSFMLIPTLN
FT                   ALENVELPALLRGASDSQSRGDARALLEQLGLGKRLHHLPAQLSGGEQQRVALARAFNG
FT                   RPAILFADEPTGNLDRQTGDKIADLLFSLNREHGTTLILVTHDPLLAARCDRRLRLVDG
FT                   QLREEA"
FT   gene            520439..522853
FT                   /gene="ybbP"
FT                   /locus_tag="KPN_00474"
FT   CDS_pept        520439..522853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbP"
FT                   /locus_tag="KPN_00474"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00474"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75925"
FT                   /db_xref="GOA:A6T5Q4"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5Q4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003838"
FT                   /protein_id="ABR75925.1"
FT                   /translation="MIARWFWREWRSPSLLIVWLALSLAVACVLALGSISDRMEKGLSQ
FT                   QSREFMAGDRTLRSSREVPAEWIAQARKSGLTVGEQLSFATMTFAGDTPQLADVKAVDD
FT                   RYPLYGTLETQPPGLKPQAGSVLLAPRLMALLNLKTGDTIDVGDATLRIAGEVIQEPDA
FT                   GFNPFQMAPRLMMNMADVAKTGAVQPGSRVAWRYKFAGDAEQLANYEQWLLPKLGPEHR
FT                   WIGLDQDDSALGKSLERSQQFLLLSALLTLLLAVAAVAVAMSHYCRSRYDLVAILKTLG
FT                   AGRSQLRKLIVGQWLLLLTLSVITGGVAGLALERLLLLVLKPVLPAALPAASGWPWLWA
FT                   IGATGVISLLVGLRPYRLLLATLPLRVLRQDVVANVWPLKIWIPAVSVVVVGLLAWLLG
FT                   GSPLLWSVLAGAVVLALLCGLVGWGLLWLLKRLTLKALPLRLAVNRLLRQPWSTLSQLA
FT                   AFSLSFMLLALLLVLRGDLLDRWQQQLPPQSPNYFLINIAPEQIVPVKTFLAEHQTRAA
FT                   EFYPIVRARLTQINGQSTDGNKDEALNRELNLTWSEQRPDHNPLVAGSWPPKPGEVSIE
FT                   EGLAQRLGIKIGDTVTFTGDTQEFSAKVSSVRKVDWESLRPNFFFIFPAGALDGQPQSW
FT                   LTSFRWDNGPAMLTQLNREFPTVSLLDIGAILRQVGQVLSQVSRALEVMVGLVTACGVL
FT                   LLLAQVQVGMRQRHQELVVWRTLGAGKSLLRATLWAEFALLGLVSGLVAAIGAEVALAM
FT                   LQTKVFDFPWAPDWRLWVLLPLTGAVLLSLCGGGLGLRLLKGKALFRQFSQ"
FT   gene            523035..524180
FT                   /locus_tag="KPN_00475"
FT   CDS_pept        523035..524180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00475"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00475"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75926"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5Q5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75926.1"
FT                   /translation="MAHTIKALAISIGAALALTSLPSHAEITLLKQDPQAGDPLSRLNF
FT                   TVGGSIRPQFNMMTGDGDKGSYKRNGFDGGTRFRFAADYYLFDDISWISYYELGVNIPA
FT                   LFDWDNHYAEGANNTTRRMLYTGLKSDTWGTLTYGQQNSIYYDVVGVKTDIWDYDMIGQ
FT                   APGNGINGDYDGSYRSRNMLKYKKTVGDVDLYGSYLFEDSEYLPGNGLRYKRKGGGSVG
FT                   ADYHIMKDLTWGTAWNYTRAEMRDPSSADSKTYDQNIVGTALSWTPDNWTFSFGGGWYQ
FT                   NFLTTKKTDVHNYFAGDAWGIEYFAGYKFPINQYAVKSIQPYFMGDRLEYVNGRNYQRI
FT                   DNGLGISFQLDYGFRVDYEHVFTSSTDNLGDMNLVRLRYDF"
FT   gene            complement(524288..525364)
FT                   /gene="ybbB"
FT                   /locus_tag="KPN_00476"
FT   CDS_pept        complement(524288..525364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbB"
FT                   /locus_tag="KPN_00476"
FT                   /product="putative capsule anchoring protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00476"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75927"
FT                   /db_xref="GOA:A6T5Q6"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR017582"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5Q6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75927.1"
FT                   /translation="MTNGTDYRAILASDTPLIDVRAPVEFSQSAMPAAINLPLMNDEER
FT                   AAVGTCYKRQGPEAALALGHKLVQGDLRASRTQAWLEACARYPHGYLCCARGGQRSHIV
FT                   QQWLKEAGVDYPLIVGGYKALRQAAIQATDELVQRPIVLIGGCTGNGKTQLVCSRPDGI
FT                   DLEGLAHHRGSSFGRTLQDQHPQATFENHLAVSLLKKAEQQTRWVLEDEGHMIGANHLP
FT                   ESLRLRMAQSPLAVVEDPFDVRLERLREEYFDRMYRDFIAVYGEEKGWQAYGEYLHHGL
FT                   FAIRRRLGLQRFAQLTERLDEALVQQQRTASTEAHFAWLVPLLEEYYDPMYRYQLGKKA
FT                   GKIVFRGSWQEVAAWLAK"
FT   gene            complement(525476..526543)
FT                   /gene="purK"
FT                   /locus_tag="KPN_00477"
FT   CDS_pept        complement(525476..526543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="KPN_00477"
FT                   /product="phosphoribosylaminoimidazole carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00477"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75928"
FT                   /db_xref="GOA:A6T5Q7"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5Q7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003135"
FT                   /protein_id="ABR75928.1"
FT                   /translation="MKQVCVLGNGQLGRMLRQAGEPLGIAVWPVGLEADPEAVPFQQSV
FT                   ITAEIERWPETALTRELARHPAFVNRDVFPIIADRLTQKQLFDKLGLATAPWQLLADKS
FT                   EWPAVFARLGELAIVKRRVGGYDGRGQWRLRENEIDQLPADNYGECIVEQGINFSGEVS
FT                   LVGARAHDGSTVFYPLTRNLHQDGILRASVAFPQANARQQEQAESMLTAIMNELNYVGV
FT                   MAMECFVTAEGLLINELAPRVHNSGHWTQNGASISQFELHLRAITGLPLPPPVVNSPSV
FT                   MINLIGTDLNYDWLKLPLVHLHWYDKEVRPGRKVGHLNLTDSDTDRLSATLEAIKPLLP
FT                   PEYTSGLFWAQSQLS"
FT   gene            complement(526540..527049)
FT                   /gene="purE"
FT                   /locus_tag="KPN_00478"
FT   CDS_pept        complement(526540..527049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="KPN_00478"
FT                   /product="phosphoribosylaminoimidazole carboxylase
FT                   catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00478"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75929"
FT                   /db_xref="GOA:A6T5Q8"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5Q8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000031"
FT                   /protein_id="ABR75929.1"
FT                   /translation="MSSRNNSARIAIVMGSKSDWATMQFTAEILDALNVPYHVEVVSAH
FT                   RTPDKLFSFAESAESHGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSL
FT                   YSIVQMPRGIPVGTLAIGKAGAANAGLLAAQILAQHDAELHQRLSAWRQAQTDEVLDNP
FT                   DPRGAA"
FT   gene            complement(527146..527454)
FT                   /gene="ybjC"
FT                   /locus_tag="KPN_00479"
FT   CDS_pept        complement(527146..527454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybjC"
FT                   /locus_tag="KPN_00479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00479"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75930"
FT                   /db_xref="GOA:A6T5Q9"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5Q9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75930.1"
FT                   /translation="MWGMIIAILNPLGVSYIALIGVVIGNTLTFVWCAMLAWAIYFYAI
FT                   YLLCTRPHDSRLVQIYLLLMGTLMLPWGLVLLITCIMREIKVNQAPTPSPPGETKDG"
FT   gene            complement(527592..528314)
FT                   /gene="ybbF"
FT                   /locus_tag="KPN_00480"
FT   CDS_pept        complement(527592..528314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbF"
FT                   /locus_tag="KPN_00480"
FT                   /product="UDP-2,3-diacylglucosamine hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00480"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75931"
FT                   /db_xref="GOA:A6T5R0"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR010138"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T5R0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004843"
FT                   /protein_id="ABR75931.1"
FT                   /translation="MATLFIADLHLQTEEPAITAGFLRFLQGEARQADALYILGDLFEA
FT                   WIGDDDPNPLHQQIASAIKAVVDAGVPCYFIHGNRDFLVGQRFARQSGMILLAEEERLD
FT                   LYGREVLIMHGDTLCTDDQGYLAFRAKVHTPWIQRLFLALPLFIRHRIAARMRADSKAA
FT                   NSSKSMEIMDVNPQAVVDAMERHHVQWLIHGHTHRPAVHELQANGQPAWRVVLGAWHSE
FT                   GSMVKVTPDDVELIHFPF"
FT   gene            complement(528318..528848)
FT                   /gene="ppiB"
FT                   /locus_tag="KPN_00481"
FT   CDS_pept        complement(528318..528848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiB"
FT                   /locus_tag="KPN_00481"
FT                   /product="peptidyl-prolyl cis-trans isomerase B (rotamase
FT                   B)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00481"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75932"
FT                   /db_xref="GOA:A6T5R1"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5R1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002130"
FT                   /protein_id="ABR75932.1"
FT                   /translation="MLAPHSSEQDAKMVTFHTNHGDIVIKTFDDKAPETVKNFLDYCRE
FT                   GFYDNTIFHRVINGFMIQGGGFEPGMKQKATKSPIQNEANNGLKNTRGTLAMARTQAPH
FT                   SATAQFFINVVDNDFLNFSGESLQGWGYCVFAEVVEGMDVVDKIKAVATGRSGMHQDVP
FT                   KDDVIIKSVTVSE"
FT   gene            528988..530373
FT                   /gene="cysS"
FT                   /locus_tag="KPN_00482"
FT   CDS_pept        528988..530373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="KPN_00482"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00482"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75933"
FT                   /db_xref="GOA:A6T5R2"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T5R2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002308"
FT                   /protein_id="ABR75933.1"
FT                   /translation="MLKIFNTLTRQKEEFKPIHAGEVGMYVCGITVYDLCHIGHGRTFV
FT                   SFDVVARYLRFLGYKLKYVRNITDIDDKIIKRANENGESFVALVDRMIAEMHKDFDALN
FT                   ILRPDSEPRATHHIAEIIEITEQLIAKGHAYVADNGDVMFDVPTDPNYGLLSRQDLDQL
FT                   QAGARVDVVDVKRNPMDFVLWKMSKEGEPSWPSPWGAGRPGWHIECSAMNCKQLGNHFD
FT                   IHGGGSDLMFPHHENEIAQSTCAHDGEYVNYWMHSGMVMVDREKMSKSLGNFFTVRDVL
FT                   KYYDAETIRYFLMSGHYRSQLNYSEENLKQARSALERLYTALRGTDKSVDAAGGEAFEA
FT                   RFIEAMDDDFNTPEAYSVLFDMAREVNRLKTEDAAAANAMAAHLRKLAAVLGLLEQEPE
FT                   AFLQSGAQVDDAEVAEIESLIQQRLDARKAKDWAAADAARDRLNEMGIVLEDGPQGTTW
FT                   RRK"
FT   gene            complement(530419..530631)
FT                   /gene="ybcJ"
FT                   /locus_tag="KPN_00483"
FT   CDS_pept        complement(530419..530631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcJ"
FT                   /locus_tag="KPN_00483"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00483"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75934"
FT                   /db_xref="GOA:A6T5R3"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5R3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75934.1"
FT                   /translation="MATFSLGKHPHVELCDLLKLEGWSESGAQAKIAIADGLVKVDGAV
FT                   ETRKRCKIVAGQTVSFEGQSVTVTA"
FT   gene            complement(530633..531499)
FT                   /gene="folD"
FT                   /locus_tag="KPN_00484"
FT   CDS_pept        complement(530633..531499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /locus_tag="KPN_00484"
FT                   /product="5,10-methylene-tetrahydrofolate dehydrogenase;
FT                   5,10-methylene-tetrahydrofolate cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00484"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75935"
FT                   /db_xref="GOA:A6T5R4"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T5R4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000672"
FT                   /protein_id="ABR75935.1"
FT                   /translation="MAAKIIDGKTIAQQVRSEVAEKVKARVAAGKRAPGLAVVLVGSNP
FT                   ASQIYVGSKRKACEEVGFVSRSYDLPETTSEAELLELIDTLNADKTIDGILVQLPLPAG
FT                   IDNVKVLERIAPDKDVDGFHPYNVGRLCQRAPRLRPCTPRGIVTLLERYNIDTYGLNAV
FT                   VIGASNIVGRPMSMELLLAGCTTTVTHRFTKNLRHHVENADLLIVAVGKPGFIPGEWIK
FT                   EGAIVVDVGINRLESGKVVGDVVYEDAAERASYITPVPGGVGPMTVATLIQNTLQACEE
FT                   YHDVEEA"
FT   gene            531637..531861
FT                   /locus_tag="KPN_00485"
FT   CDS_pept        531637..531861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00485"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75936"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5R5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75936.1"
FT                   /translation="MVIGALRLATESIYARIRPGGMLLVQLVEDISPASYKPRSFLAKW
FT                   IDSTDVDRIIPRVSLREALASQGALSSAG"
FT   gene            531839..531915
FT                   /locus_tag="KPN_00486"
FT                   /note="tRNA-Arg"
FT   tRNA            531839..531915
FT                   /locus_tag="KPN_00486"
FT                   /product="tRNA-Arg"
FT   gene            532378..532671
FT                   /locus_tag="KPN_00487"
FT   CDS_pept        532378..532671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00487"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75937"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5R6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75937.1"
FT                   /translation="MNIKFVAISVFAVVCVFASDISIAKSNSLSDDQVSQRIIDDSVAS
FT                   YPGTCACPFNTARNGSSCGGRSAWSKAGGYSPICYKKEVTKEMVKAWRQENQ"
FT   gene            533067..533468
FT                   /locus_tag="KPN_00488"
FT   CDS_pept        533067..533468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00488"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75938"
FT                   /db_xref="GOA:A6T5R7"
FT                   /db_xref="InterPro:IPR000895"
FT                   /db_xref="InterPro:IPR014306"
FT                   /db_xref="InterPro:IPR023416"
FT                   /db_xref="InterPro:IPR036817"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5R7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000895"
FT                   /protein_id="ABR75938.1"
FT                   /translation="MKLVIASVISLLSFSALAAPEGTLSVHILNQQTGLPSPGVQIELD
FT                   KQQGESWQHIATGKTDADGRIKSLYPQAENMEPGVYKVTFKTGDYFKSQNMNTFFPVIP
FT                   VIFNVTKQNQKLHIPLLLSQYGYSTYRGS"
FT   gene            534228..535532
FT                   /locus_tag="KPN_00489"
FT   CDS_pept        534228..535532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00489"
FT                   /product="putative citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00489"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75939"
FT                   /db_xref="GOA:A6T5R8"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR010953"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5R8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002020"
FT                   /protein_id="ABR75939.1"
FT                   /translation="MSTTPLTLSFAGQQPPIALPQVPGTRGPVGVDMRGLNQSGFCSYD
FT                   PGFANTAGCQSAISWIDTENSVLLHRGYPVDQLARQCDFLEVAYIMLNGDAPDEASYQT
FT                   FRETITRHTLVHEQIARMCSGFRRDSHPMALMCALVGALAAFYHDVLDVENPQHRALAA
FT                   TRLLSKMPTIAAMSYKYTIEQPAAYPRNDLSYAGNFLQMLFAIPAEKYVLNPVIEQAMN
FT                   QILVLHADHGQCASTTTVRAAGSSGANLFACVAAGLASLWGPMHGGANESSMRMLEEIE
FT                   SVDQVPAFLRQAKRDPQAFRRLGFGNSRYRHRDPRADILRETSHRVLAEVGMSDRLLQV
FT                   AMALEDVALTDPYFVDNGLSPSVDFYTAVILKAMNLPSSMFAVVTAVGRTVGWVAHWNE
FT                   MHQAPLTIYRPRQIYVGEGYRDYVSRRGERSAELR"
FT   gene            complement(535868..536530)
FT                   /locus_tag="KPN_00490"
FT   CDS_pept        complement(535868..536530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00490"
FT                   /product="response regulator (activator) in two-component
FT                   regulatory system wtih UhpB, regulates uhpT expression
FT                   (LuxR/UhpA family)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00490"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75940"
FT                   /db_xref="GOA:A6T5R9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5R9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75940.1"
FT                   /translation="MLICIADSEYFNIALKAYINEPNSKPLDIKEILCYPFSGQSEMFY
FT                   TFFATDAGARLSTILIDYSSVSIEVLQVALSLKSFNPLIRIFIFAKSGYPLSELERSLA
FT                   IVLGAEFITSFAGLSAALARGPRLTSPPADKLYIAIPDSYNLTRKETFLISLLMGGMPL
FT                   CHVASTMQLTIKRVYYYRSRVLSKLAVKNNVELMNKVQGMVLRHYRQETGHEIVSLR"
FT   gene            537022..537561
FT                   /locus_tag="KPN_00491"
FT   CDS_pept        537022..537561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00491"
FT                   /product="putative fimbrial-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00491"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75941"
FT                   /db_xref="GOA:A6T5S0"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="InterPro:IPR039458"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5S0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000259"
FT                   /protein_id="ABR75941.1"
FT                   /translation="MASFVVMMMLSPVAAQAADGKVTFNGEVIENTCTVVNKDKTVTLP
FT                   TVQRSALSSAGETAGVVPFTIDLTSCTPGADVSVYFEKDQYVSTEGRLKNTLSDGTEAE
FT                   NVDVELLNTRFTPINLAETPAVAADGTIARPDVIPVAVAEQDGSASLPFYARYYATDAA
FT                   TAGKVATYVNFTVVYP"
FT   gene            537620..538315
FT                   /locus_tag="KPN_00492"
FT   CDS_pept        537620..538315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00492"
FT                   /product="probable pilin chaperone"
FT                   /note="similar to PapD"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00492"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75942"
FT                   /db_xref="GOA:A6T5S1"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5S1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001829"
FT                   /protein_id="ABR75942.1"
FT                   /translation="MRRMVLALLLSSYLPSADASMVIDGTRIIFSGDKKEIAVRATNMG
FT                   ETPSLTQVWVDDGRVQNQPEKDAAPFIVLPPIVRIEPGKGQSWRLVFNGSRLPQDRESL
FT                   FWFNLLDIPPEPKNGKTDNYLQLAIRSRIKLFYRPAGVAAEKIAAEKALSWALAPTGNG
FT                   LRVSNASARYITIDSITLNGQKHAAGMVAPFSSLEIAPKGVALRTLPAKFSFTTINDYG
FT                   AVVNHNYPQ"
FT   gene            538326..540761
FT                   /locus_tag="KPN_00493"
FT   CDS_pept        538326..540761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00493"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00493"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75943"
FT                   /db_xref="GOA:A6T5S2"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5S2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000015"
FT                   /protein_id="ABR75943.1"
FT                   /translation="MKLREIKVGLMLLLPWQEAWAAEAFSFNRAHLHGAAQVDLQKYQY
FT                   VNPLHAGQYRSTLSVNGRDLGEETFVIQEHDGQLEPCISPSLFDALQLKDAQWPTAATC
FT                   LRFSQIDKAIGWEYDSGENVLRVNMPQALLQPHYRGAVNLKKVDSGVPAAVLRYQANSY
FT                   QSIVDGDSSSHHYLGLDASLRAFGWRLHHQSSYQAQEGNTHWDSIATWAERSVVNWAST
FT                   LRLGQGWTDGTFFDSVSFIGGRLATDVRMLPGSRRGFAPSVSGVARTNARVTVTQNGAL
FT                   LYEATVPPGKFTFDDLYPTNAGGDLQVTIHEADGSQDTFTVPYATLPGLVRAGAVYYDL
FT                   SLGYLDEDGIAGRPGFGEATLQYGFNDYISGYTGANATTDYYSTLVGSAFNTYWGALAV
FT                   DLSRSAAKGREHGWQEGYRWRVSASKSFTSDTRMLLSMSHSNDGNYRSIRDAAWEHDRH
FT                   PNDWREMTRYSATLSQQAGSGSLSFNGIWSEDVRHHRWRSYQLGYANRYGQLNYYLYAQ
FT                   QSQDIHHRNNQVVGVSFSLPFGQAGSLTTRFNHDKNYGSQLQSSYTGSAGEKNAFSYGL
FT                   TASYDMPRENPNEASVAANGSLRTDYAYLNASASAGRHQQQYSLGASGALVAHQGGMTA
FT                   TPELGETFAIVEAPGAVGARVANRPGQPINRQGFTIIPYLDPFTANWLDLDPQGLNDHV
FT                   EIVSSSTTVVPDSGAAVKVKFVTRTGYPWFAHVTLPDGAAPPLGAEVFDDNGRAVGAVG
FT                   QGGLLYARVPQDHGSVSVVWGERSGQRCRLAYVIRDDAVQQVSSGTPHQVCRPGIKEK"
FT   gene            540841..541788
FT                   /locus_tag="KPN_00494"
FT   CDS_pept        540841..541788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00494"
FT                   /product="putative fimbrial biogenesis outer membrane usher
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00494"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75944"
FT                   /db_xref="GOA:A6T5S3"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5S3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000259"
FT                   /protein_id="ABR75944.1"
FT                   /translation="MVSGKTIEYSVNVSQASINLDVSDLPIGSLLYSYGGMIITNNERW
FT                   EIACSGSEPGGFQSIGGSRVGPAGDGKPGDIYSIDRLPGIGYSFQMGEQDGINFDPLFT
FT                   AWPSAPVFSGQRAFQAENKKPTIYFWRIADNGGLPLPGEYCLNDYLGDIYLGGVQAMRF
FT                   SVSGLCIQVKSPTCKITDDSKNINVFLGRHNKTAFTGLNSTTAPVPFNINLTNCENVGS
FT                   VFMQFNATVDSAVAANEVIKIDDQPEGASGLGVQILSAGGSLVPLNQVSQVWSGKKGSQ
FT                   TNYRLSYQARYIQTQPAVTAGEANASVTFVVTYN"
FT   gene            complement(541811..542677)
FT                   /locus_tag="KPN_00495"
FT   CDS_pept        complement(541811..542677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00495"
FT                   /product="putative acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00495"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75945"
FT                   /db_xref="GOA:A6T5S4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5S4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000182"
FT                   /protein_id="ABR75945.1"
FT                   /translation="MNYQLVKQVRENNPLRKSFIDLAVKTFDLSFEEWYQQGYWTDAYI
FT                   PYAFVERNKVIANASANIIDLRWQGEPRRYIQIGTVMTEPDHRNKGLAGQLIHHILQDW
FT                   QQEADAFFLFANPTTVDFYPKFGFTRSEEYQYIMPVSPRAGDFRKLDMDSPDDVALLRH
FT                   YYEKSNPFSPLRVEHNFGLLMFYCSAFMKHFVYYSAKNEAVVIAMQNGPVLICFDLFCD
FT                   VGKSLSTLVNELADDHVYQAILGFTPSEDRLGEYEKIEGEDILFVYDQKENLFKDRKLM
FT                   FPLLAHA"
FT   gene            543188..544108
FT                   /locus_tag="KPN_00496"
FT   CDS_pept        543188..544108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00496"
FT                   /product="lipid A biosynthesis lauroyl acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00496"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75946"
FT                   /db_xref="GOA:A6T5S5"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR011920"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5S5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004960"
FT                   /protein_id="ABR75946.1"
FT                   /translation="MSNLPKFSRALLHPRYWLLWLGIGFLWLLVQLPYPVIYRLGTALG
FT                   RLAMRVMKSRARIARRNLELCFPEMSAADREALLVKNFESLGMGLMETGMAWFWPTHRV
FT                   ARWTETSGVNEVVELLEEKQGILLIGIHFLTLEMGARMYGMFTPGIGVYRPNDNPLIDW
FT                   LQTWGRLRSNKTMLDRKNLKGMVRALKEGEILWYAPDHDYGPASSVFAPLFAVEQAATT
FT                   TGTWMLAKMSGATIVPFVPRRKPNGMGYELISLTPERTPPLASAEVTAAWMNQIIEQCI
FT                   LMAPEQYMWLHRRFKTRPEGVPPRY"
FT   gene            544209..544481
FT                   /locus_tag="KPN_00497"
FT   CDS_pept        544209..544481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00497"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00497"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75947"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5S6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR010854"
FT                   /protein_id="ABR75947.1"
FT                   /translation="MKKVIVALALSAVAFGASAAQLITKEEVKHFKLTKVGPISVGPSG
FT                   GEFSSPSDLHDQLSKLADEKGGRYYVITAAREHGPNFEATAEVYK"
FT   gene            544775..546343
FT                   /gene="cadC"
FT                   /locus_tag="KPN_00498"
FT   CDS_pept        544775..546343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cadC"
FT                   /locus_tag="KPN_00498"
FT                   /product="transcriptional activator of cad operon"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00498"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75948"
FT                   /db_xref="GOA:A6T5S7"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="InterPro:IPR040970"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5S7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001867"
FT                   /protein_id="ABR75948.1"
FT                   /translation="MLQPVVRVGEWLVTPSVNQISRKGRQLTLEPRLIDLLVFFARHPG
FT                   EVLSRDELIENVWTRNVVTSHVVTQSISELRKSLKDGDDVSLEYIATVPKRGYKLTVPV
FT                   IWCTEEGEELAPSMEALTPSPSTAVPAPPAAGAPSDVSVPLPDAAAPPPAPTVASAPSG
FT                   RKRLTTALVWGLFLLALGTCVALVALSSMESRPPVNKARLLLNPRDIDIHLVNGNSCAN
FT                   WSSQHSYAVGLASLITTSLNTFSTFMVHDKTDYNINEPSSSGKTLTIEFVNQRHYRAQQ
FT                   CFMSVQLVDNADSSTMLDKRYFVTNDNQLTIQNDLMNSLSDALAQPWPARMQAMLRQYQ
FT                   PSQSVALTYFYQSHQLLMKGDVDSLSKASSLLDDVIKRAPDFIYAYAEKTLVDVLRHSQ
FT                   QPLDDKQLAALYSEVERVGAMPGIKDMAIYYQIKAVDSLGKGKVDEANTAINSAIDLEM
FT                   SWLNYVLLGKVYEMKGENRLAADSYITAFNLRPGEDTLYWIENGVFQTSVNRVVPYLDN
FT                   FLSSE"
FT   gene            546709..548043
FT                   /gene="cadB"
FT                   /locus_tag="KPN_00499"
FT   CDS_pept        546709..548043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cadB"
FT                   /locus_tag="KPN_00499"
FT                   /product="lysine/cadaverine transport protein (APC family)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00499"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75949"
FT                   /db_xref="GOA:A6T5S8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004754"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5S8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004841"
FT                   /protein_id="ABR75949.1"
FT                   /translation="MSSAKKIGLFACTGVVAGNMMGSGIALLPANLASIGGIAIWGWVI
FT                   SIIGAMSLAYVYARLATKNPQQGGPIAYAGEISPAFGFQTGVLYYHANWIGNLAIGITA
FT                   VSYLSTFFPILNNPVPAGIACIAIVWIFTFVNMLGGTWVSRLTTIGLVLVLIPVVMTAV
FT                   VGWHWFDVATYQANWNTSSTTDSHAVIKSILLCLWAFVGVESAAVSTGMVKNPKRTVPL
FT                   ATMLGTAMAGIVYIAATQVIAGMYPASQMAASGAPFAISASTILGGWAAPMVSAFTAFA
FT                   CLTSLGSWMMLVGQAGVRAANDGNFPKVYGEVDNNGIPKKGLLLAAVKMTALMVLITLM
FT                   NSAGGKASDLFGELTGIAVLLTMLPYFYSCVDLIRFEGINIRNFVSLICSVLGCVFCFI
FT                   ALMGASSFELAGTFIVSLIILMFYGRKMHQRQNNASDNNTTANAH"
FT   gene            548126..550273
FT                   /gene="cadA"
FT                   /locus_tag="KPN_00500"
FT   CDS_pept        548126..550273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cadA"
FT                   /locus_tag="KPN_00500"
FT                   /product="lysine decarboxylase 1"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00500"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75950"
FT                   /db_xref="GOA:A6T5S9"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5S9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000310"
FT                   /inference="protein motif:Pfam:IPR005308"
FT                   /inference="protein motif:Pfam:IPR008286"
FT                   /protein_id="ABR75950.1"
FT                   /translation="MNVIAIMNHMGVYFKEEPIRELHRALERLDFRIVYPNDRDDLLKL
FT                   IENNSRLCGVIFDWDKYNLELCEEISKMNEYMPLYAFANTYSTLDVSLNDLRMQVRFFE
FT                   YALGAAEDIANKIKQNTDEYIDTILPPLTKALFKYVREGKYTFCTPGHMGGTAFQKSPV
FT                   GSIFYDFFGSNTMKSDISISVSELGSLLDHSGPHKEAEEYIARVFNAERSYMVTNGTST
FT                   ANKIVGMYSAPAGSTVLIDRNCHKSLTHLMMMSDITPIYFRPTRNAYGILGGIPQSEFQ
FT                   HATIAKRVKETPNATWPVHAVITNSTYDGLLYNTDFIKKTLDVKSIHFDSAWVPYTNFS
FT                   PIYEGKCGMSGGRVEGKVIYETQSTHKLLAAFSQASMIHVKGDVNEETFNEAYMMHTTT
FT                   SPHYGIVASTETAAAMMKGNAGKRLIDGSIERSIKFRKEIKRLKGESDGWFFDVWQPEH
FT                   IDGPECWPLRSDSAWHGFKNIDNEHMYLDPIKVTLLTPGMKKDGTMDDFGIPASIVAKY
FT                   LDEHGIVVEKTGPYNLLFLFSIGIDKTKALSLLRALTDFKRAFDLNLRVKNMLPSLYRE
FT                   DPEFYENMRIQDLAQNIHKLIEHHNLPDLMFRAFEVLPSMVMTPYAAFQKELHGQTEEV
FT                   YLEEMVGRVNANMILPYPPGVPLVMPGEMITEESRPVLEFLQMLCEIGAHYPGFETDIH
FT                   GAYRQADGRYTVKVLKEENNK"
FT   gene            550333..551808
FT                   /gene="yjdL"
FT                   /locus_tag="KPN_00501"
FT   CDS_pept        550333..551808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjdL"
FT                   /locus_tag="KPN_00501"
FT                   /product="putative di-/tripeptide transport protein (POT
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00501"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75951"
FT                   /db_xref="GOA:A6T5T0"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5T0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000109"
FT                   /protein_id="ABR75951.1"
FT                   /translation="MKTPSQPRAIYYIVAIQIWEYFSFYGMRALLILYLTHQLGFDDSH
FT                   AISLFSAYASLVYVTPILGGWLADRLLGNRTAVIAGALLMTLGHVVLGVESTSAWSLYV
FT                   ALAIIICGYGLFKSNISCLLGELYAHDDPRRDGGFSLLYAAGNVGSIAAPIACGLAAQW
FT                   YGWHIGFALAGIGMFIGLMIFLSGSRHFRHTRGVDKPALRAVKFVLPTWGWLLVMLCLA
FT                   PVFFTLLLQNNWSGYLLAIVCLFAAQMVARIMIKAPEHRRALWQIVLLMLAGTLFWVLA
FT                   QQGGSSISLFIDHFVNRRLLNWDVPTALFQSVNAIAVMAAGVVLAWLMRPEGSVRSVLR
FT                   VWLKFSFGLLLMGGGFMLLALNARHGAADGQASMGMMVAGLAMMGFAELFIDPVAMAQI
FT                   TRLNMPGVTGVLTGIYMLATGAVANWLAGVVAQQTTESQISDTAIAAYQHFFAQMGEWT
FT                   LGCVAVMVIIAFAAACSVGKRRAAAGEITGGGA"
FT   gene            552140..553657
FT                   /gene="lysS"
FT                   /locus_tag="KPN_00502"
FT   CDS_pept        552140..553657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="KPN_00502"
FT                   /product="lysyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00502"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75952"
FT                   /db_xref="GOA:A6T5T1"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5T1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004364"
FT                   /inference="protein motif:Pfam:IPR004365"
FT                   /protein_id="ABR75952.1"
FT                   /translation="MSEQQAQGADEAIDLNNELKARREKLAALREQGVAFPNDFRRDHT
FT                   SDQLHAEFDAKDNDELASLNVEVAVAGRMMTRRVMGKASFVTLQDVGGRIQLYVARDDL
FT                   PEGVYNEQFKKWDLGDIIAARGKLFKTQTGELSIHCTELRLLTKALRPLPDKFHGLQDQ
FT                   EVRYRQRYLDLIANEESRHTFRIRSQILATMRQFMVARGFMEVETPMMQVIPGGASARP
FT                   FITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELY
FT                   MAYADYKDLIELTESLFRTLAQTVLGKTEVPYGDQVFDFGKPFEKLTMREAIKKHRPET
FT                   NMADLDNFDAAKALAESIGIQVEKSWGLGRIVTEIFDEVAEAHLIQPTFITEYPAEVSP
FT                   LARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAQRFQDQVNAKAAGDDEAMFYD
FT                   EDYVTALEYGLPPTAGLGIGIDRMVMLFTNSHTIRDVILFPAMRPQK"
FT   gene            complement(553734..554159)
FT                   /locus_tag="KPN_00503"
FT   CDS_pept        complement(553734..554159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00503"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75953"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5T2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75953.1"
FT                   /translation="MNKTWLFTTLTLALVAAAPAHAISAKYREQLERSGCTQMTDGITC
FT                   DIHKTKAENAAAAQHADSGFGPWVGTWYVYTEYGDKIDEITVTAKTVKTHGHLVEAAKA
FT                   SQGKLTFRVKSSAFTLNDAFNGVWANGSQRGTLQKVL"
FT   gene            554731..555651
FT                   /locus_tag="KPN_00504"
FT   CDS_pept        554731..555651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00504"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00504"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75954"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR030823"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5T3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR010717"
FT                   /protein_id="ABR75954.1"
FT                   /translation="MATEQLRWGVSPLCWTNDVLEDLGGDIPLDTCLREAREAGYQGIE
FT                   LGRKFPRQAATLGSMLAAADLRLASGWYSGMLADRSVEAELEAVREHAQLLRQLGAKVM
FT                   VYGECGQLPGETPLDEPISLSPPLSRVSLAAYCHKLNTFADLLLRDYGLQLAYHHHLMM
FT                   LVEHDDELERFLSHTHNNVGLAFDTGHAFVAGVEIPRVLHKYGHRIRHLHLKDVRPQVL
FT                   GRLYRENLSFNEAVRAGLFTIPGDGCIDYAPILDFVRDSDYRGWLIIEAEQDPAMAPPL
FT                   ATASRAYAWLAHHLSSPSSSEEYAS"
FT   gene            555648..556820
FT                   /locus_tag="KPN_00505"
FT   CDS_pept        555648..556820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00505"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00505"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75955"
FT                   /db_xref="GOA:A6T5T4"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5T4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000683"
FT                   /inference="protein motif:Pfam:IPR004104"
FT                   /protein_id="ABR75955.1"
FT                   /translation="MSARLNIGLIGSGFMGQAHADAYRRAAMFYPDLPKRPHLYALADQ
FT                   DQAMAERHAAKLGAEKAYGDWRELVNDPQVDVVDITSPNHLHYTMAMAAIAAGKHVYCE
FT                   KPLAVNEQQAQEMAQAARRVGVKTMVAFNNIKTPAALLAKQIIARGDIGEPVRFRGTFD
FT                   QGFYNDPNLPWSWRCSKTLGGSGALGDLGAHTLSVAQFLLGGIREVTASAQTCLRQRPV
FT                   PQRDAGYASRVAADAEWREVENDDQVQCLVNFDSGAAGVIEASRIAAGRIFGVFWEVSG
FT                   TEGTLYMDGERFNELQVYRFNDDKHDRGFKTLYAGSQIPAYAGFFGFDFGGGGLGYFDV
FT                   KVIEVHDLVQGICGEGDCYPNFEFGLQNQRVLSAIEASMASRRWVNVVKD"
FT   gene            556830..557861
FT                   /locus_tag="KPN_00506"
FT   CDS_pept        556830..557861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00506"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00506"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75956"
FT                   /db_xref="GOA:A6T5T5"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5T5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000683"
FT                   /protein_id="ABR75956.1"
FT                   /translation="MFPSHLPTPRRPAAQSIPILRWGIIGPGWIAERFVHSLKTYSRQQ
FT                   VVAVASRSQAKADRVAAEWGIPQAYGQVEEMLARPDIDAVYIATPHNHHFPDGMQALKA
FT                   GKHVLIEKPFALNLGEGRELQAEAARQEKLALEAMWCDYAPKYDVIRQLLEDGALGDLH
FT                   TLLADHGEYFTRDHRIFNADLAGGPMMDLGSYVTSFALMVGGMPQEIVARGSATAEGLN
FT                   GQTSMLFSWQNGMQGLLNTTLFSNTPGGAVVAGRQATLTIDGQFYAPGGFTLAASQGGQ
FT                   VLRWEEPRNRYDQLFWQAEHFAWCIGQGLQDSPLRPLSRVLQNLQVMDEVRRQVGAVFN
FT                   EER"
FT   gene            complement(558667..559674)
FT                   /locus_tag="KPN_00507"
FT   CDS_pept        complement(558667..559674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00507"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00507"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75957"
FT                   /db_xref="GOA:A6T5T6"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5T6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000683"
FT                   /inference="protein motif:Pfam:IPR004104"
FT                   /protein_id="ABR75957.1"
FT                   /translation="MICKRFALVGSGFIGQVHAASLARHEGSALTMVADAAPERAQALA
FT                   ARYGARAVTVSEAIHSDAIDAVLIASSTPSHAELLEAAARAGKAVYCEKPIDLSLARAR
FT                   EVVERVLPLNVPVTVGFNRRFDSSHQQLRRQLEQGLIGRVELVQMVCRASSMPPLDYLR
FT                   SSGGQMRDQAIHFFDLLRFLTGDEVRTVAAMGAALALPDIAEFGDVDTSILMMQMRGGA
FT                   LAQLDNTRRTGHGYDERITLLGAEGALESGSQSPAGPTLWRGNQRIEPGLWPDWFSRVQ
FT                   GSYYQHLDAFIRSLNGETVADLPGLLDGLQAQAIAEAAVQSLQHGQFVAVDDCR"
FT   gene            559776..560795
FT                   /locus_tag="KPN_00508"
FT   CDS_pept        559776..560795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00508"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75958"
FT                   /db_xref="GOA:A6T5T7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5T7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75958.1"
FT                   /translation="MKNISLAMLARQIGVGVATVDRVLNERGGVSPQTTRKVLQAAREA
FT                   GLKRILPEEHRFPWQIEVFLSSNDSFFFPQLAQDFAAVADSLGYRRLTLHRTFVPESQP
FT                   TTLARRIARSCQQRQGIIVFGNDHPAVHDALRRCREAGVPAITLATDLPGADRLCHVGI
FT                   NQLQAGRTAGLMLGRMTPRPGEVLMVSGRQDYSAHRLRIQGFREVLSQRFPHLQLSDVL
FT                   AGEERREQITRLVEQALCRSRNIVGIYNTGLGNTQIAEALARHRREGDVCWITHERYNT
FT                   TRQQLAKGSLALTLDQNTRQHAQLAIDLMLRHLESGYQPQTYADGKVDFILYSAENVD"
FT   gene            561225..562148
FT                   /locus_tag="KPN_00509"
FT   CDS_pept        561225..562148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00509"
FT                   /product="putative periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00509"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75959"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5T8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001761"
FT                   /protein_id="ABR75959.1"
FT                   /translation="MNIKKTIVASLLACMLPAVVMAKDVSIGVSMALFDDNFLTILRTS
FT                   MQKEMKKDGVKSQIEDAKGDVSQQLQQVQNFIGQGVDAIIVNPVDTNAVKPIMDQATKA
FT                   GIPLVFVNRRPQAELTDKMAYVGSDSILAGRLQMEALAKAMNGKGNVAILLGDLANEST
FT                   RDRTKGVEEVVAKYPNIKIVQKQTAKFTRNDAVDVVSNWMTSGEDIQAIASNNDEMAIG
FT                   ALQALGKNPNHILIAGVDGTPDALQMLKSGKMIATIFQDAKGQGEGAVDAAIKLANGEK
FT                   VEKIIDVPYQLITKENMAEFTNRNQK"
FT   gene            562181..563665
FT                   /locus_tag="KPN_00510"
FT   CDS_pept        562181..563665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00510"
FT                   /product="putative ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00510"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75960"
FT                   /db_xref="GOA:A6T5T9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5T9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003439"
FT                   /protein_id="ABR75960.1"
FT                   /translation="MNAFALEAEGISKFFPGVKALDNVSLRVRPGTVHALMGENGAGKS
FT                   TLMKCLIGIYRPDKGSIRVKGEPVEFTDTMDALRSGISMIHQELNLVPHMTVAENIWLG
FT                   REPMKYGFVDHGQLTRQTQALLDKLNIRLTADRLVGDLSIAAQQMVEIAKAVSWNADIV
FT                   IMDEPTSALTEGEVAHLFTIIRDLRAQGKAIIYISHKMDEIFAITDEISVFRDGTWVGS
FT                   KNTTEFTRQSLITQMVGRELTQLFPKFNNTIGEEVLTVRNLTRQGVFHDVSFSVRRGEI
FT                   LGVAGLVGAGRSEVMESLFGMERFDSGEVLIDGAPVTIDSPSVAIEKGMALLTEDRKKS
FT                   GLFLVLSVLENMSIVKMPEYIGKSGFVQHVKMAEDCMEQIRRLNIKTPTMDQIINNLSG
FT                   GNQQKVLIARWLLAQPKILILDEPTRGIDVGAKAEIYHLISELANRGVAVIMVSSELPE
FT                   ILGMSDRVMVMHEGRITGILEKDEADQETILSLASH"
FT   gene            563685..564707
FT                   /locus_tag="KPN_00511"
FT   CDS_pept        563685..564707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00511"
FT                   /product="putatiive bacterial inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00511"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75961"
FT                   /db_xref="GOA:A6T5U0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5U0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001851"
FT                   /protein_id="ABR75961.1"
FT                   /translation="MKLTAAPASEGSSFFANLRHKMPKDTGIFVVMLVIALTFEIAGWY
FT                   VRDQSFLLNTNRLVLIVLQVAIIGIIAVGVTQVIITTGIDLSSGSVIALAAVVAASLAQ
FT                   TSDSLSPMFPALVNLPAVIPICAGIGVGLLCGLTNGFLVTRTGIPPFIATLGMMVSARG
FT                   LAQYYTQGNPISFLSDSFTAIGQGAMPVIIFFVIAAVFHIALKHTRYGKYVYAIGGNMT
FT                   SAKVSGINVNKYLVIVYTIAGALSGLAGVVLAARVSSGQSSMGMSYELDAIAAAVIGGS
FT                   SLMGGVGRITGTLIGAMILGLIKSGFTFVGVDAYVQDIIKGIIIVAAVTIDMRRNRKKH
FT                   "
FT   gene            complement(565547..566551)
FT                   /locus_tag="KPN_00512"
FT   CDS_pept        complement(565547..566551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00512"
FT                   /product="putative bacterial regulatory protein, LacI"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00512"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75962"
FT                   /db_xref="GOA:A6T5U1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR012781"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5U1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000843"
FT                   /inference="protein motif:Pfam:IPR001761"
FT                   /protein_id="ABR75962.1"
FT                   /translation="MKTKRVTIKDIAELAGVSKATASLVLNGRGKELRVAQETRERVLA
FT                   IAREQHYQPSIHARSLRDNRSHTIGLVVPEITNYGFAVFSHELETLCREAGVQLLISCT
FT                   DENPGQESVVVNNMIARQVDGLIVASCMHSDADYQKLSEQLPVVLFDRSPSDSALPLVM
FT                   TDSVTPTAELISRIAPQHADEFWFLGGQPRLSPSRDRLAGFTQGLAQAGITLRPEWVIN
FT                   GNYHPSSGYEMFAALCARLGRPPKALFTAACGLLEGVLRYMSQHHLLDSNIHLASFDDH
FT                   YLYDSLSLRIDTVQQDNRQLAWHCYDLLSQLIDGQAPEPLQRYLPATLQIRHP"
FT   gene            complement(566581..567981)
FT                   /locus_tag="KPN_00513"
FT   CDS_pept        complement(566581..567981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00513"
FT                   /product="beta-fructofuranosidase; sucrose-6-phosphate
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00513"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75963"
FT                   /db_xref="GOA:A6T5U2"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR006232"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR013189"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018053"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5U2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001362"
FT                   /protein_id="ABR75963.1"
FT                   /translation="MSLPSRLPAILQAVMQGQPQALADSHYPQWHLAPVNGLLNDPNGF
FT                   CQVAGRYHLFYQWNPLACDHTYKCWGHWSSADLLHWRHEPIALMPDEEYDRNGCYSGSA
FT                   VEFEGALTLCYTGNVKFPDGGRTAWQCLATENADGTFRKLGPVLPLPEGYTGHVRDPKV
FT                   WRQDGRWYMVLGAQDVQQRGKVLLFTASDLREWRLVGEIAGHDVNGLANAGYMWECPDL
FT                   FPLADTHLLICCPQGLAREAQRFLNTYPAVWMAGRFDAERGIFDHGPLHELDSGFEFYA
FT                   PQTMQADDGRRLLVGWMGVPDGDEMHQPTRAQGWIHQMTCVRELEWQAGTLYQRPLREL
FT                   VALRGEAQGWCGQTLPLAPMELAFDIAPNSTLGLDFAGALQLTVNRDGLRLSRRGLQTA
FT                   ELHHRYWRGEARRLRIFIDRSSVEIFINDGEGVMSSRFFPGYPGQLIFSGATPVAFCRW
FT                   LLRPCMVE"
FT   gene            complement(567981..569351)
FT                   /locus_tag="KPN_00514"
FT   CDS_pept        complement(567981..569351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00514"
FT                   /product="sucrose-specific enzyme II"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00514"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75964"
FT                   /db_xref="GOA:A6T5U3"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004719"
FT                   /db_xref="InterPro:IPR010973"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5U3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001996"
FT                   /inference="protein motif:Pfam:IPR003352"
FT                   /protein_id="ABR75964.1"
FT                   /translation="MDFEQISRSLLPLLGGKENIASAAHCATRLRLVLVDDALADQQAI
FT                   GKIDGVKGCFRNAGQMQIIFGTGVVNKVYAAFIQAAGISESSKSEAADLAAKKLNPFQR
FT                   IARLLSNIFVPIIPAIVASGLLMGLLGMVKTYGWVDPSNALYIMLDMCSSAAFIILPIL
FT                   IGFTAAREFGGNPYLGATLGGILTHPALTNAWGVAAGFHTMNFFGIEVAMIGYQGTVFP
FT                   VLLAVWFMSMVEKRLRRVIPDALDLILTPFLTVIISGFIALLLIGPAGRALGDGISFIL
FT                   STLISHAGWLAGLLFGGLYSVIVITGIHHSFHAIEAGLLGNPSIGVNFLLPIWAMANVA
FT                   QGGACFAVWFKTKDAKIKAITLPSAFSAMLGITEAAIFGINLRFVKPFIAALVGGAAGG
FT                   AWVVSMHVYMTAVGLTAIPGMAIVQASSLLNYIIGMAIAFAVAFALSLTLKYKTDAE"
FT   gene            complement(569456..570973)
FT                   /locus_tag="KPN_00515"
FT   CDS_pept        complement(569456..570973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00515"
FT                   /product="sucrose porin"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00515"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75965"
FT                   /db_xref="GOA:A6T5U4"
FT                   /db_xref="InterPro:IPR003192"
FT                   /db_xref="InterPro:IPR021570"
FT                   /db_xref="InterPro:IPR036998"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5U4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003192"
FT                   /protein_id="ABR75965.1"
FT                   /translation="MYKKRKLAILIALLTGTAAAHGQTDLNSIEARLAALEKRLQDAET
FT                   RASTAESRAASAEQKVQQLTQQQQQTQATTQQVARRTTQLEEKAERPGGFEFHGYARSG
FT                   VIMNDSAASTKSGAYMTPAGETGGAIGRLGNQADTYVEMNLEHKQTLDNGATTRFKVMV
FT                   ADGQTTYNDWTASSSDLNVRQAFVELGNLPTFEGPFKGSTLWAGKRFDRDNFDIHWIDS
FT                   DVVFLAGTGGGIYDVKWNDSLRSNFSLYGRNFGDIADSSNSVQNYIVSMNNFAGPVQMM
FT                   VSGMRAKDNDDRQDANGNLVKGDAANTGVHALLGLHNESFYGLRDGTSKTALLYGHGLG
FT                   AEVKGIGSDGALRPGANTWRFASYGTTPLSDRWFIAPAVLAQSSKDRYVDGDSYQWATL
FT                   NLRLIQEVTQNFALAWEGSYQYMDLQPEGYNDRHAVNGSFYKLTFAPTFKVGSIGDFFS
FT                   RPEIRFYTSWMDWSKKLDNYANDDALGSNGFKSGGEWSFGMQMETWF"
FT   gene            complement(571138..572061)
FT                   /locus_tag="KPN_00516"
FT   CDS_pept        complement(571138..572061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00516"
FT                   /product="fructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00516"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75966"
FT                   /db_xref="GOA:A6T5U5"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5U5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002173"
FT                   /protein_id="ABR75966.1"
FT                   /translation="MNGKIWVLGDAVVDLLPDGEGRLLQCPGGAPANVAVGVARLGGDS
FT                   GFIGRVGDDPFGRFMRHTLAQEQVDVNYMRLDAAQRTSTVVVDLDSHGERTFTFMVRPS
FT                   ADLFLQPEDLPPFAAGQWLHVCSIALSAEPSRSTTFAAMEAIKRAGGYVSFDPNIRSDL
FT                   WQDPQDLRDCLDRALALADAIKLSEEELAFISGSDDIVSGTARLNARFQPTLLLVTQGK
FT                   AGVQAALRGQVSHFPARPVVAVDTTGAGDAFVAGLLAGLAAHGIPDNLAALAPDLALAQ
FT                   TCGALATTAKGAMTALPYRDDLQRSL"
FT   gene            573421..574563
FT                   /locus_tag="KPN_00517"
FT   CDS_pept        573421..574563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00517"
FT                   /product="putative secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00517"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75967"
FT                   /db_xref="GOA:A6T5U6"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5U6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR006143"
FT                   /protein_id="ABR75967.1"
FT                   /translation="METLMLLTYAALCIVVFKVFRIPLNKWTVPTAVLGGIALIGAVIF
FT                   GMNYNFPYTDVGNQVFRTVPIVSQVRGRVQSVPVKPNQMLHKGDVLFTLDPTPFQAKVD
FT                   DLQAQIKAASQDALSLNAALSQAQAELSRAVAQRDQSRREYARYRKGHAQGAFSDQMVD
FT                   TRLQTWKADEASVSAAQAKVVQARNALDSVVKGKNTTVASLLAQLQKAQFQLENTVVRA
FT                   PEDGYVSTVGLRPGTMSTALGMIPLMTFVPVEGAASREYVAAFRQNALQRLRKGEPAEL
FT                   MFPAIPGTVFRGEVADVLPAIGESQFQGQGKLLTTDALNTHGRALVVLKVTDPRFAEYA
FT                   LPQGATLEAAVYSDHLKELSLIRKILIRMKSWENYIYLDH"
FT   gene            complement(574604..575401)
FT                   /locus_tag="KPN_00518"
FT   CDS_pept        complement(574604..575401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00518"
FT                   /product="putative ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00518"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75968"
FT                   /db_xref="GOA:A6T5U7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5U7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003439"
FT                   /protein_id="ABR75968.1"
FT                   /translation="MSDQTLSGLSLSHFSAGYPRRKVIENLTVPHLPRGKITALLGPNG
FT                   SGKSTLMRAMAGLGPCGGELLLEGENLLTQPFSRRAEQVVYLPQTLPAGVHLHVLESII
FT                   VAQRAAGGRHSPQRQEEVMALLRQLGIAHLAMSYLDQLSGGQKQLVGLAQSLIRQPRLL
FT                   LLDEPLSALDLNYQFHVMDLVRRETRRRNIVTLVVVHDINIALRHADHVLMLKAGQLLG
FT                   DGTPAAVITPETLAAVYGVRGRIEPCSQGVRQVIIDGLVDSEA"
FT   gene            complement(575398..576480)
FT                   /locus_tag="KPN_00519"
FT   CDS_pept        complement(575398..576480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00519"
FT                   /product="putative ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00519"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75969"
FT                   /db_xref="GOA:A6T5U8"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5U8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000522"
FT                   /protein_id="ABR75969.1"
FT                   /translation="MRLTSDSVLDGLPAGTSGVMDDYRRIVRRRLLLILLLALLIVASL
FT                   LLDFMLGPSGLPLQSLWQTLTDPASADPGTRAIVWDIRLPYAVMAIIVGLALGLAGAEM
FT                   QTILNNPLASPFTLGVSSAAAFGAALAIVLGIGLPGIPGQWFISANAFIFALLAALLLD
FT                   GITRWTQVATSGVILFGIALVFTFNALVSMLQFIANEDTLQGLVFWTMGSIDRASWSKV
FT                   AILLVALALVMPLSLRSAWKLTALRLGEDRAISFGINVRRLRLTTLLRISILSALSVAF
FT                   VGPIGFIGLVAPHIARMLFGEDHRFYLPASALIGALVLSLASIASKNLIPGAIIPVGIV
FT                   TSLVGVPFFLSIILRHRGQV"
FT   gene            complement(576488..577606)
FT                   /locus_tag="KPN_00520"
FT   CDS_pept        complement(576488..577606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00520"
FT                   /product="putative periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00520"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75970"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5U9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002491"
FT                   /protein_id="ABR75970.1"
FT                   /translation="MARKSVRSLLLTALLATPLLSYATQYPLTVTDLDGRQVTLAKEPQ
FT                   RIILQDGRDIMTLALLDRDNPFKRLVAWNNLAKKQDVATWQMLKTTWPQSATILDMGFS
FT                   DKGNVDLESVIARQPDLMIAQLRARPALMESGVIDKLSALHVPVLFVDYEIAPAKDTAP
FT                   SIDLLGKVLNRESQAKAFTDYYRQQLQSIRQKTATITPKANVFVEALAGNSDACCFTHG
FT                   HSGWGGLVEAVGANNIGSQLLPGASGFVSLEKIISMKPDAWIMTGSKRGNSQVLPLGYA
FT                   VKPEAVKAQAQTLLARPGVSQIPAVQEKRAYGVYHHFYNHPWNIVGMEYLAKDIYPQAF
FT                   GDLNPDETYHYIVRHFTDLPDQPFVFSWQQSE"
FT   gene            577878..578267
FT                   /locus_tag="KPN_00521"
FT   CDS_pept        577878..578267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00521"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75971"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5V0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75971.1"
FT                   /translation="MKKAMIALSAILVAAPVFAATTHATDDTVAAANANANTAKEKLHQ
FT                   AQHEGEEQQLKAKHAAEGKQDSVGSQVSEGAQKTWNKTKEGTEKGWDKTKEVSEKGWNA
FT                   TKSGAEKGWDKTKTGAEELKNKVTE"
FT   gene            complement(578967..579092)
FT                   /locus_tag="KPN_00522"
FT   CDS_pept        complement(578967..579092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00522"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75972"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5V1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75972.1"
FT                   /translation="MASDTASLSSKVNVYHLTEKELSTQATINGYKYWPDAALDP"
FT   gene            579408..580586
FT                   /locus_tag="KPN_00523"
FT   CDS_pept        579408..580586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00523"
FT                   /product="aminobenzoyl-glutamate utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00523"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75973"
FT                   /db_xref="GOA:A6T5V2"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5V2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002933"
FT                   /protein_id="ABR75973.1"
FT                   /translation="MSDYVIPEIKATEAEMISIRHYLHANPELSLEEFNTSELVASKLT
FT                   EWGYQVTRGLGKTGVVGSLSKGDSPRTIGLRADMDALPIEETTGLPWASTAPGKMHACG
FT                   HDGHTTILLAAAKYIASPACQFNGTVHMIFQPAEEAIGGADLMIKDGLFEQFPCERIFG
FT                   LHNMPGLPVGKLGFYAGNFMASADTVKITITGYGGHGAHPERTVDPIVAGAALVMALQS
FT                   IVARNVPPGETAVVSVGTFQAGIASNVIPESAVMELSVRAMKPEIRDLLIKRIHELADF
FT                   TAKSYGASSVVEVYDSYPVLTNSPEETDFARALALEVFGREGVLESVSPMNASEDFAFM
FT                   LRERPGSYFLLGNGEKGEKGGCMVHNPGYDFNDDIITIGATLFARLVEKHCR"
FT   gene            580639..581382
FT                   /locus_tag="KPN_00524"
FT   CDS_pept        580639..581382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00524"
FT                   /product="putative bacterial extracellular solute-binding
FT                   protein, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00524"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75974"
FT                   /db_xref="GOA:A6T5V3"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR005768"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5V3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001638"
FT                   /protein_id="ABR75974.1"
FT                   /translation="MASTSALAEGGKEIRFGVDPTFAPFEWKDPQGKLAGFDIDLGNAI
FT                   CQQLQAKCVWVESNFDGIIPALKARKFDAILSGMYMTEKRKAQIAFSDKLYNGPVFLVA
FT                   RKNTLQGNTPEQLKGKTIGVEQGSAQETYVNQHWRPQGINIVAYQGADSVVRDLESGRI
FT                   DGAVLSGMMADYSFLQQPQGKEFAFVGGHLQDDTLFGAGAAIGLRKDDEALRQEINGAI
FT                   AKILADGTYKKLAGKYFSFDVYSGT"
FT   gene            581511..582464
FT                   /locus_tag="KPN_00525"
FT   CDS_pept        581511..582464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00525"
FT                   /product="putative aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00525"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75975"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5V4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001395"
FT                   /protein_id="ABR75975.1"
FT                   /translation="MMTRPLGKTGFSIAPLVFGGNVFGWTIDEKTSFALLDAFVDHGFD
FT                   AIDTADVYSRWAEGNQGGESETIIGRWLQARPGMRDKVKIFTKVGSDLGLPGHKGLSKA
FT                   WIQQAVDDSLRRLNTDYIDLYFSHWPDPQTPVAETLEAFHSLQQAGKIRAMGASNLDAM
FT                   QLAGALEVARKGGLPAWQVLQPEYNLYHRSAFEGALCDLCVSRDIGVVTYYSLASGFLT
FT                   GKYRQPSDLTQSQRGSGIGKYLNPRGMRIIDTLAAVADEQGAKPAEVALAWLIGREGVT
FT                   APIASATSVAQVESFARAAALSLSAEQVARLDGASA"
FT   gene            complement(584069..584845)
FT                   /locus_tag="KPN_00526"
FT   CDS_pept        complement(584069..584845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00526"
FT                   /product="putative 3-ketoacyl-(acyl-carrier-protein)
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00526"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75976"
FT                   /db_xref="GOA:A6T5V5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5V5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002198"
FT                   /protein_id="ABR75976.1"
FT                   /translation="MARVVVITGGGTGIGAACARLMRAAGDRVFITGRREAPLQAVANE
FT                   TGATALVGDAADGEVWRQRLLPAILDQTGGIDVLICSAGGMGNSPAAETSDRQWREALD
FT                   GNLTSAFASVRACLPSLIARRGNVLFVASIASLAAGPQACGYVTAKHALIGLMRSVARD
FT                   YGPKGVRANAVCPGWVTTPMADEEMHPLMQAEGLSLAEAYQRVCRDVPLRRPASPEEIA
FT                   QACQFLCSPQAAIISGATLVADGGASIVDVPTLAFA"
FT   gene            complement(584933..586651)
FT                   /locus_tag="KPN_00527"
FT   CDS_pept        complement(584933..586651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00527"
FT                   /product="putative arylsulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00527"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75977"
FT                   /db_xref="GOA:A6T5V6"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5V6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000917"
FT                   /protein_id="ABR75977.1"
FT                   /translation="MAAAVSMILAGGAHAAQQERPNVIVIIADDMGYSDISPFGGEIPT
FT                   PNLQAMAEQGMRMSQYYTSPMSAPARSMLLTGNSNQQAGMGGMWWYDSTIGKEGYELRL
FT                   TDRVTTMAERFKDAGYNTLMAGKWHLGFVPGATPKDRGFNHAFAFMGGGTSHFNDAIPL
FT                   GTVEAFHTYYTRDGERVSLPDDFYSSEAYARQMNSWIKATPKEQPVFAWLAFTAPHDPL
FT                   QAPDEWIKRFKGQYEQGYAEVYRQRIARLKALGIIHDDTPLPHLELDKEWEALTPEQQK
FT                   YTAKVMQVYAAMIANMDAQIGTLMETLKQTGRDKNTLLVFLTDNGANPAQGFYYESTPE
FT                   FWKQFDNSYDNVGRKGSFVSYGPHWANVSNAPYANYHKTTSAQGGINTDFMISGPGITR
FT                   HGKIDASTMAVYDVAPTLYEFAGIDPNKSLAKKPVLPMIGVSFKRYLTGEVQEPPRGNY
FT                   GVELHHQAAWVDGEWKLRRLVPRGLTAGDAPWQLFNLHDDPLETHDVAAEHPDRVKAMS
FT                   EAYEAFAKRTMVTKAQGKMIDYVGIDSKTGRYLAVDPATMKPVPAPQAIPVSEIH"
FT   gene            complement(586711..587898)
FT                   /locus_tag="KPN_00528"
FT   CDS_pept        complement(586711..587898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00528"
FT                   /product="putative iron-sulfur modifier protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00528"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75978"
FT                   /db_xref="GOA:A6T5V7"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR034491"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5V7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR007197"
FT                   /protein_id="ABR75978.1"
FT                   /translation="MLNIAALRQQQIPLAAEPRSPVPFHILMKPIGPACNLACRYCYYP
FT                   QDETSVNKMDDARLEQFIRRYIAAQPAGAREINFVWQGGEPLLAGLSFYKKALALQARY
FT                   APDGVTISNSLQTNGTLINDAWCRLFREHGFIIGLSLEGNEALQDYHRPDKRGRSTWSA
FT                   ALRGIDLLHQHQVDFNLLVVVHNEMAAHAAAIYDRLVSLGARYLQFQPLMSEGAALREG
FT                   YQLSADNWGRFMVGIWRQWRKRCDRGRVFVINIEQAWAQYFTHTSGSCVHSARCGSNLV
FT                   MELDGQLYACDHLINAEHRLGRLDEQTLAAAVDASVQLPFGQQKSLRRECQTCSVKMVC
FT                   QGGCPAHLNAAGNNRLCGGYYRFFSDILAPLRPFSRDLNGLKAWRAAFVGTAHTA"
FT   gene            588459..589007
FT                   /locus_tag="KPN_00529"
FT   CDS_pept        588459..589007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00529"
FT                   /product="putative bacterial regulatory protein, LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00529"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75979"
FT                   /db_xref="GOA:A6T5V8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5V8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000792"
FT                   /protein_id="ABR75979.1"
FT                   /translation="MHNISDNTHQQYLENFQPLDPLLPSHFSHQNTTVAAMTPRLCDRN
FT                   RHYYHEFMLPNNVRDMTEIFIRRERRIVAGISLMRDVPFSSEERQRAQAVLPLVELAIR
FT                   DCLQEEDDLPAILTAKEREIVGMVREGASNKLIARQLDISLSTVKTHLRNIFAKTEVVN
FT                   RTELVSRTWMPAAQRTLHL"
FT   gene            590348..591463
FT                   /locus_tag="KPN_00530"
FT   CDS_pept        590348..591463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00530"
FT                   /product="putative deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00530"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75980"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5V9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000286"
FT                   /protein_id="ABR75980.1"
FT                   /translation="MKRKTGFFFDERCFWHSTGLHAVTLPVGGWVQPPAGGGHAESPET
FT                   KRRMKNLMDVSGLTPQLALRSAAPASLEDLRRIHPDSYLERFKAISDNGGGMLGKEAPL
FT                   GPGSYEIACLSAGLACAAVEAVLKGELDNAYSLSRPPGHHCLPDQSMGFCFLANIPIAV
FT                   ERAKAQLGLGKVAIIDWDVHHGNGTQHIYLQRDDVLTISLHQDGCFPPGYAGEDDRGVG
FT                   AGEGYNINIPLLAGAGDDSWRYALETIVIPALARFEPELIIIACGYDANAMDPLARMQL
FT                   HSDSFRAMTEQVQQAADRLCGGKLVMVHEGGYAESYVPFCGLAVMEALSGIRTEVQDPL
FT                   LEFIQQQQPRAAFAQFQREAIDRLAQQFGLL"
FT   gene            complement(591470..592063)
FT                   /locus_tag="KPN_00531"
FT   CDS_pept        complement(591470..592063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00531"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75981"
FT                   /db_xref="InterPro:IPR021500"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5W0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75981.1"
FT                   /translation="MSSVPWFETPLMNAVQRDLAGWPSEKLSERSALLRLNDATAVTFS
FT                   VRQKRLFMASIHSCEFVVEGPVTRPARGKIRAHQSGWWKRQPIRFIGGKGSEELAGYLN
FT                   GFPNLQQTLSELDYRRFSLTFDSSGWRCSIEPWAASEVVCKMPPLRRYLRLEAQQRMLL
FT                   LSVLAMVNQAVSQWMRGEIAEEKALTSPPSPRGS"
FT   gene            complement(592041..593540)
FT                   /locus_tag="KPN_00532"
FT   CDS_pept        complement(592041..593540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00532"
FT                   /product="putative amino acid/amine transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00532"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75982"
FT                   /db_xref="GOA:A6T5W1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5W1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004841"
FT                   /protein_id="ABR75982.1"
FT                   /translation="MFSNRLASHLERGVVGFPTTLASSVGLIMASPVILTVTSGFGMGG
FT                   DTFALAVLLAFIMMQAQVTTFAEAATLIPTTGSVYDYISCGMGRFFAITGALCAYLIVH
FT                   IFAGTAETILAGIMALVNFESINAQMAAHQNTWMVGVGMVVIFGLLNAIGVEIFGKVEV
FT                   VLTFGMWTTLTIFGLCGIFMAPVTHLSGWFGTPLNVSDINGLFGYIGMAMFMFVGCELV
FT                   TPMAPEIKQAHRTIPRAMALGLLGVASCMFIYGAAINRQVENTVLDAANNVHLLDTPMA
FT                   IPAFAERVMGHAGQYWLGVGLLLAGCATINTLMAAVPRIIYGMALDGALPRFLTWLHPR
FT                   FKTPVIAIAIGVAIPCLHAWYLNGDLDRIVPLILAAVCAWGVAYLLVTLSVVMLRIRRP
FT                   DLPRAYRSPWFPLPQIISSVGIIIAIVNITPPGMDSRQVLVPFGIMLGLTAAYALFWTV
FT                   CVQRVNPFKPLVVEEVVERAINNYEKQTRGEMTPDVLRPLV"
FT   gene            complement(593917..594282)
FT                   /locus_tag="KPN_00533"
FT   CDS_pept        complement(593917..594282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00533"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00533"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75983"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5W2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR008579"
FT                   /protein_id="ABR75983.1"
FT                   /translation="MHAFKLKHPVPDLQPIGSVSLLGATPTAGDPQVAGAMIYGEPQDA
FT                   FTCGLFSSTEGSFTMTYPFTEHATVLEGEVELTVAGGEPQRFAPGDSWFVKQGTEVEWK
FT                   ILTPRFVKHYLANVETR"
FT   gene            complement(594296..595597)
FT                   /locus_tag="KPN_00534"
FT   CDS_pept        complement(594296..595597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00534"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00534"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75984"
FT                   /db_xref="GOA:A6T5W3"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5W3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75984.1"
FT                   /translation="MNIKIDALNYYGATKKYHLHFPALREDIEADVVIIGGGFSGINTA
FT                   LELAEQGITNVVVLEARHLGYGGTGRNGGQVMAGIGHDIEAVKKHVGKEGLETLFKIAN
FT                   LGAGIIRERIRKYNIDADFVPGYGYLAYNQRQLKTLRQWEKEFKAATPDEEIELYTGKE
FT                   VQQVVGSEVYCGALKHMGGGQIHSLNMLLGSAQAAHSLGVKIFESSPVVEVNYGKQVRV
FT                   RTAMGSVKAAKLLWACDSFLNNMEPEIYNKTLVTYSYQVSTEPLSDELIERISPLRGAF
FT                   SDIRPVINYYRVTRENRLLFGSATRFVEYTPNDFAAWNRTLLAEVFPYLRDVKIDFAWG
FT                   GPMACSANLFPQIGTLRDHNNVFYVQGYSGFGVTPSHIVCKILAEGINGGSDRYRLLSS
FT                   IPHATIHGRDSLRLLLVTAGKLMHQTAGFWKGRS"
FT   gene            595756..597240
FT                   /locus_tag="KPN_00535"
FT   CDS_pept        595756..597240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00535"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00535"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75985"
FT                   /db_xref="GOA:A6T5W4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5W4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002086"
FT                   /protein_id="ABR75985.1"
FT                   /translation="MSEITLLAEVTAFLRQPHGQFIAGQREAGRGAPFAVINPATGRAI
FT                   AEVTAADSDQADRAMESARQAFSQWREMPTLARGALLLKLADTLAEHREALAQLESLCS
FT                   GKTITLARMLELDQSVAFLRYFAGWAGKVTGETLDVSLPSMAGEKYTAFTRRQPLGVVV
FT                   GIVPWNFSIMIAIWKLAAALVCGCTIVLKPSEYTPLTLLRVAELAKAVGIPDGVINVVN
FT                   GAGGEIAQRLITHPACAKVSFTGSVATGEKVQQSASASGKRVTLELGGKNAALFLDDLT
FT                   PEAMVNGIIEAGYLNQGQICAAAERFYLPQGKLDAVLALLKDKLSAFAPGSPLDERTLM
FT                   GPLANRQQYDKVLRLIQTARDEGDTIVCGGEALPGEGYFLQPTAVKVRSEESTLMREET
FT                   FGPVCSFIGYRSEEEALARINASPYGLAASVWSDNIRQALRYSEAIEAGIVWVNMHTFL
FT                   DPAVPFGGMKGSGIGREFGSAFIDDYTELKSVMVRY"
FT   gene            598764..600974
FT                   /locus_tag="KPN_00536"
FT   CDS_pept        598764..600974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00536"
FT                   /product="putative TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00536"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75986"
FT                   /db_xref="GOA:A6T5W5"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR030149"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5W5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000531"
FT                   /protein_id="ABR75986.1"
FT                   /translation="MGQIMHTTHYSSFPLRKTLLALAIGAASQTAMAADAAAAKQPGEE
FT                   TLIVEANETSDFKSGGDLVVPAFLDGQIAHGGRLGMLGEQKAMDVPFNVIGYTSKLIQD
FT                   QQAKTIADVVSNDAGVQAVQGYGNFAETYRIRGFKLDGDDMTMGGLAGVVPRQVMDTQM
FT                   LERVEIFKGANSLLNGAASSGVGGMINLEPKRAEDLPTARVGVDYTSDSQVGGTLDLGR
FT                   RFGDNNQFGARVNLVHREGEGAIDNDKRRTTLASLGLDYRGDRFRSSLDFGYQKKTFHG
FT                   GTMGVNISGVDFIPALPDNSKNYSQKWGYSDIESEFGMAKAEYDLTDSWTVYSALGGQH
FT                   SHEIGTYSAPKLLNKNGDATVGRLDTNRIIDAISGMGGVRGDFNTGAISHKVNLGYAAQ
FT                   VHTDATAWRMSARNPTTNIYDNHDVAMPDNAYFGGNYHDPLITSRSRTQGWLLSDTLGF
FT                   FNDKVLFTAAARHQKVVVRNYSNATGLEDTSSRYTQSRWMPTFGLVYKPWEQLSLYANH
FT                   TEALQPGSVAPTTAANAGQSTGIAHSKQDEVGVKIDYGTIGGSLALFEIKKPNAISDTA
FT                   GNYGLDGEQRNRGVEMNVFGEPMLGLRLNASTVWLDAKQTKTAEGATDGKDAIGVANFY
FT                   AVLGAEYDIKPVEGLTATARVNHSGSQYADAANTKKLDSYTTLDLGLRYRMRLNADQNE
FT                   MIWRVGVTNVTNEKYWSGIDDTGTYLFEGDPRTVRVSMSYDF"
FT   gene            601082..602458
FT                   /locus_tag="KPN_00537"
FT   CDS_pept        601082..602458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00537"
FT                   /product="putative phenylalanine-specific permease"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00537"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75987"
FT                   /db_xref="GOA:A6T5W6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5W6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004841"
FT                   /protein_id="ABR75987.1"
FT                   /translation="MKDASTSSETVTESGPTLHRGLQNRHIQLIALGGAIGTGLFLGIG
FT                   PAIQMAGPAVLLGYAVAGIVAFLIMRQLGEMVVEEPVSGSFAHFAYKYWGPFAGFLSGW
FT                   NYWVMFVLVGMAELTAAGIYMQYWLPDVPTWVWAAAFFIIINAVNLVNVRLYGEAEFWF
FT                   ALIKVLAIIGMIAFGLWMLFGGHGGSKAGFDNLWKHGGFLATGWHGLILSLAVIMFSFG
FT                   GLELIGITAAEAQNPEKSIPKAVNQVVYRILLFYIGSLVVLLALYPWVEIKSDSSPFVM
FT                   IFHNLDSNLVASALNFVILVASLSVYNSGVYSNSRMLFGLSVQGNAPKFLARVSKRGVP
FT                   VNSLLLSGIITSLVVVLNYLLPHEALGLLMALVVATLLLNWIMICMAHLKFRAAQRRKG
FT                   RESKFKALLAPASNYFCIAFLGLILALMCTIDGMRLSAILLPVWILFLFIAFKLLRRPA
FT                   "
FT   gene            602610..603851
FT                   /locus_tag="KPN_00538"
FT   CDS_pept        602610..603851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00538"
FT                   /product="putative nucleoside H+ symporter"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00538"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75988"
FT                   /db_xref="GOA:A6T5W7"
FT                   /db_xref="InterPro:IPR004740"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5W7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004740"
FT                   /protein_id="ABR75988.1"
FT                   /translation="MVTTTEGRESARVSHRFLVPRLSLMMFMQFFIWGSWSVTLGLVMT
FT                   RYEMSLLIGDAFSAGPIASILSPFVLGMLVDRFFASQKVMAVMHLAGAAILWFVPQALV
FT                   AQNGALLIGLLFGYTLCYMPTLALTNNIAFHSLANVDKTFPVVRVFGTIGWIIAGICIG
FT                   VTGISDTTGIFTLAALCSVALALYSLTLPHTPAPAKGMPVQFRDLLCADAFALLKTRHF
FT                   LIFSLCATLISVPLGTYYAYTASYLADAGVKDVSTAMSFGQMSEIVFMLVIPLLFRRLG
FT                   VKYMLLIGMAAWFVRYAFFALGVSEEGRFLLYLGILLHGVCYDFFFVVGFIYTDRVAGE
FT                   KVKGQAQSMIVMFTYGIGMLLGSQISGALYNHLVAGQSVPQAWVTFWWIPAVAAAVIAL
FT                   IFLFSFQYNEKEPH"
FT   gene            603868..604890
FT                   /locus_tag="KPN_00539"
FT   CDS_pept        603868..604890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00539"
FT                   /product="putative xylose isomerase-like TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00539"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75989"
FT                   /db_xref="GOA:A6T5W8"
FT                   /db_xref="InterPro:IPR011418"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5W8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR011418"
FT                   /inference="protein motif:Pfam:IPR012307"
FT                   /protein_id="ABR75989.1"
FT                   /translation="MKTIKGPGIFLAQFIGTQAPFNTLAGIAQWAAGLGYKALQIPCNH
FT                   PAIFDVERAAASQTYCDEVSGILAEHGLVISELSTHLEGQLVAVHPAYDAAFDAFAPAA
FT                   LHGDPQARQRWAVEKVRQAAVASGRLGLQAHATFSGALAWPFFYPWPPHNQPLLDEAFA
FT                   ELARRWRPLLDLFDEQGVDVCYEIHPGEDLHDGVTFERFLALVDNHPRCNMLYDPSHLH
FT                   LQQMDYLAYIDIYHARIKAFHVKDAEFRRNGRNGVYGGYQPWQQRAGRFRSPGDGQIDF
FT                   KGVFSKLTEYDFAGWAVLEWECCLKDSETGAREGSEFIRRHIIPVAGRAFDDFAAGGRE
FT                   "
FT   gene            604862..606043
FT                   /locus_tag="KPN_00540"
FT   CDS_pept        604862..606043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00540"
FT                   /product="putative NADH-dependent dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00540"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75990"
FT                   /db_xref="GOA:A6T5W9"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5W9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000683"
FT                   /protein_id="ABR75990.1"
FT                   /translation="MTLPPAGGNNMIQVAIIGAGFIGPAHLEALRRLGDVEVVALCDSR
FT                   LEAAQRKARALNIAHAYDSVEALLAHPGLQVVHNCTPNHLHAQINRQILAAGLHVFSEK
FT                   PLCMTAGEARELVALAARAGVVHGVSFVYRQFAMVQQAAAMIRHGEVGRIFAAHGSYLQ
FT                   DWMLLETDYNWRVDSAQGGASRTVADIGSHWCDTVQFMTGRRIVEVMADLSIVWPTRKA
FT                   PVNGKATFSAVHEAQAYETRPVDTEDFGSVLLRFDDGSKGSFMVSQVSAGRKNRLAVEI
FT                   NGSLCSLAWDQEVPQRLWIGHREQPDRLLSDDPSLLRPEIADSAHYPGGHIEGWPDAFK
FT                   NMMGHFYQAVRAGKMPAAGARRFAAFDDGADVMYIIEAIVKSHQEQRWVSVER"
FT   gene            complement(606063..606500)
FT                   /locus_tag="KPN_00541"
FT   CDS_pept        complement(606063..606500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00541"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75991"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5X0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75991.1"
FT                   /translation="MIKDDIPMRLSTAVLALSCALATITGCTSSKSSPERHAYAFVAHR
FT                   SDFVGGNFTVNRQENYRLNLPTFTAMYARGQQDKAAGMSESDARRTAEAIKQQAAQGTR
FT                   TEHAFTGNASDKWDNAMENKDAVLFGNELSGAYLDGYLGVK"
FT   gene            606728..607708
FT                   /locus_tag="KPN_00542"
FT   CDS_pept        606728..607708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00542"
FT                   /product="putative bacterial regulatory protein, LacI"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00542"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75992"
FT                   /db_xref="GOA:A6T5X1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5X1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000843"
FT                   /inference="protein motif:Pfam:IPR001761"
FT                   /protein_id="ABR75992.1"
FT                   /translation="MSIQKIARLAGVSVATVSRVLNNSDTVKAKNRERVLQAIKESNYQ
FT                   PNLLARQLRTARSNMILVMVSNIANPFCAEVVKGIEEEAEKNGYRILLCNSGSDLARST
FT                   SGLQLLSGKIVDGIITMNALSSLPELTTMIGDAPWVQCAEYADTGSISCVGINDVEAAQ
FT                   GAVSRLADSGRRRIALINHDLSYRYARLRERGYKSVLHVHGLAYQQVTYAQDLSAAAGK
FT                   RAMEQLLSQDEKPDAVFAVSDSLAAGALRAIAQAGLRVPEDIAVIGFDGTELAEVVSPQ
FT                   LTTVEQPSRAIGRTAVSLLMKRIDDPDAAVERVMMDWRVIDRASV"
FT   gene            complement(607712..608956)
FT                   /gene="ybdG"
FT                   /locus_tag="KPN_00543"
FT   CDS_pept        complement(607712..608956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdG"
FT                   /locus_tag="KPN_00543"
FT                   /product="putative transport"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00543"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75993"
FT                   /db_xref="GOA:A6T5X2"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR030192"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5X2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR006685"
FT                   /protein_id="ABR75993.1"
FT                   /translation="MQELISQIAALGIEITPTRSLMIIFGIILFTAVVVHLILHKVVLR
FT                   AFEKRALASSHLWLQIITQNKLFHRLAFTLQGIIVNVQAVLWLQKGSEAAEILTTVAQL
FT                   WVMIYAMLSFFSLLDVILKLAQKFPAASQLPLKGIFQGIKLVTAIIIGILIISLLIGQS
FT                   PAILISGLGAMAAVLMLVFKDPILGLVAGIQLSANDMLKLGDWLEMPKYGADGAVIDIG
FT                   LTTVKVRNWDNTITTIPTWSLVSDSFKNWSGMSASGGRRIKRSLNIDTTSIHFLDEQEQ
FT                   QRLIRAKLLKPYMDSRHEEISAWNQQYAGEQSILNERRMTNVGTFRAYLQEYLRHHPRI
FT                   RQDMTLMVRQLAPDANGLPIEIYCFTNTVVWAEYEGIQADIFDHVFAVVDEFGLRIHQT
FT                   PTGNDIRALTGAFSR"
FT   gene            610563..611429
FT                   /locus_tag="KPN_00544"
FT   CDS_pept        610563..611429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00544"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75994"
FT                   /db_xref="GOA:A6T5X3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5X3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75994.1"
FT                   /translation="MTTMPQRESTIAVPDDRRKQLGAFLRARRESLDPQRLGLPRVGRR
FT                   RTPGLRREEVAMLADVGVTWYTWLEQGREVNPSEAVLVGVANALQCSPLETRHLFVLAG
FT                   LTPPEATQVTVCEGISPGTRRMLDSLMPQPASIQKPNFDIVAWNDSFCRLMGIDFATLP
FT                   EEDRNCIYLYLTHETWRSRIENRDVLPTFVSYFRAAMAEHRGDPAWENKLARFFAASSE
FT                   FEALWHQRYEVRGVENQIKHFNHPQLGRFSLQQMYWYSAPRNGSRLLVYLPMDEAGEQA
FT                   LAWLDQH"
FT   gene            612096..613130
FT                   /locus_tag="KPN_00545"
FT   CDS_pept        612096..613130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00545"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00545"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75995"
FT                   /db_xref="GOA:A6T5X4"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5X4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR75995.1"
FT                   /translation="MNVTRKEQRIIQRALNAWQASGELTPSDSQRLAQTMRVSPFDWRR
FT                   LSRYAFWTALACVLISLGSLFADSELVAWLLSLFSHSALMRILLPALLAVACYGWGFRR
FT                   QRRETQWHYSTEAILFLGVVFTAVALWQLGERLDNGSGHIAPLFLAGCVIYGAIGYIAR
FT                   SGLVWLFFLLALGNWFGAETGYVSGWGAYWLGMNYPIRFVLFGGALLALCYGAQSLLRQ
FT                   RQLFTVSKAMGLTYLFIALWIMSIFGNYDADNWYQVSQARLLPWGLLFAVAAGVCIFIS
FT                   LKTDDGMLRGFGLTFLAINLYTRFFEFFWNGMHKVLFFLILAVSLAVIGRYAERIWHAG
FT                   NVKP"
FT   gene            613227..615956
FT                   /locus_tag="KPN_00546"
FT   CDS_pept        613227..615956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00546"
FT                   /product="putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00546"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75996"
FT                   /db_xref="GOA:A6T5X5"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5X5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001550"
FT                   /inference="protein motif:Pfam:IPR002078"
FT                   /protein_id="ABR75996.1"
FT                   /translation="MNKESIFRQLEQRIAGRALTAEALGEFNAMAIADSLKQKRSIISH
FT                   HLNNLHREQRVVKVNGRPVLFLPVTVLRDHHRLAVRHGEYASIQALCADRQDSLAQLIG
FT                   AQGSLQEALRQCKAAISYPGAGLPLLLRGPTGTGKSFLARQLWHYAIDEGILPADAPFT
FT                   VFNCAEYANNPELLTSKLFGHAKGAFTGADKAVPGLIETSNGGVLFIDEVHRLPPEGQE
FT                   KLFHFMDNGSWRRLGESADERSATVRLIFASTEDLEKHFLATFIRRIPVIVKILPIAER
FT                   GQFERLAFIHHFFRREAQRLNHDLELDGEIVSQLMRETLEGNVGGLENLIRNICASAWT
FT                   FGERDSGLLHIKAGLLPDRLLADAPFTLQQNSERVMIYRDGDAQPLFSGRHHEYQRLTE
FT                   NICSLCEELAQDNISVRTFEKLIYQNVTLYLDALMNQESTVSLQDKRLRFIEDVGKAIA
FT                   VNYDLQLNVEFAYLTGRYLTSLPLAPRSVAEPVRLVMQRWLDSSAGLAQRIAEKLLDVV
FT                   NNKYDLLIDTLDRLAITAIVSNAIDATSGGKVKALIIAHGYSTASSIAGVANRLIGEKI
FT                   YQAMDMPMEVAFNDVSRAVVDYLQHTDTRAGVMVLIDMGYTKEIADALLSVINGPLVVV
FT                   DNVTTRMALNVASEIALGKNIEQIAEEIVPLNQSRWDVFWPAEKKERVLLVTCITGIGT
FT                   AFKFKNLMEKSLLNDFDINIIACEYTRLKNSRTAVSLLHQYEVIAVVGTHDPQLAGVPW
FT                   VGIEELLGEQGHRHLSQLLSGYLNEKQIALINKNMVREFSLHNVVNSLTILNAGKTMGH
FT                   IETIIAEWQNTLGFHFNNNLIISLYVHLSCMIERLVMRNEISHYKDLEQFTRQHGEFIA
FT                   MVNHSFQRLKILYNVALPVAEIGYIHDIFELRIEDFSW"
FT   gene            complement(616009..616995)
FT                   /locus_tag="KPN_00547"
FT   CDS_pept        complement(616009..616995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00547"
FT                   /product="putative phosphosugar isomerases"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00547"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75997"
FT                   /db_xref="GOA:A6T5X6"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR024713"
FT                   /db_xref="InterPro:IPR035488"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5X6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001347"
FT                   /protein_id="ABR75997.1"
FT                   /translation="MSIAHQNAHTIIRDILSKQHIERVWFVGCGGSLTGFWPGKYFLDC
FT                   EAKKLAVGYVTSNEFVHATPNALGKNSVVILASQQGNTAETVEAARIARQKGAATIGLV
FT                   YTPGTPLCEHSDYTIKYCWARYPETVDPTQQKAAYSLWLALEVLAQTEGYAHYDEMVSA
FT                   FASFESVVRGAQQQVQADARHFAEAWKTEKVIYMMGSGPSFGAAHQESICILLEMQWIN
FT                   SASIHSGEYFHGPFEITETGTPFILLKSSGRTRPLDDRAIRFIERYQGKLQIIDVEKVG
FT                   INALHASVREYFCGLLHNCVLDVYNLALATARNHPLTTRRYMWKVEY"
FT   gene            complement(617060..618121)
FT                   /locus_tag="KPN_00548"
FT   CDS_pept        complement(617060..618121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00548"
FT                   /product="putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00548"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75998"
FT                   /db_xref="GOA:A6T5X7"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5X7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001347"
FT                   /protein_id="ABR75998.1"
FT                   /translation="MHVEDYMNETPACLLAMLTQTREDLWQAAKALTERGVTRIILTGS
FT                   GTSYHGALTARSFMQQWCGLPVDVYWPFLLDDSALTLSDKALVIGISQGGGSLSTLAAM
FT                   ERARAAGHLTASMAGEAPAVIDRAADLVLTVPCGEERAGAKTKGYHCTILNLMLLGLAV
FT                   ASRQRRLSDEERKALLIRMDTTFNHLPTLIEASQAWVLNHARPLIDSADIRLTGPARLF
FT                   GTVQEGALKMLETLRCPVAGYEFEEFIHGIYNAFDERSTLIMLDPFPDERQDRLAEILG
FT                   GWTQHIYRIGPQVENNGKNMPFAFINDPDFAVFEYIIPLQMVCARLPPVKGIDPAIPKD
FT                   PQFHQKMKSKQLN"
FT   gene            complement(618139..618993)
FT                   /locus_tag="KPN_00549"
FT   CDS_pept        complement(618139..618993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00549"
FT                   /product="putative transport protein, PTS system"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00549"
FT                   /db_xref="EnsemblGenomes-Tr:ABR75999"
FT                   /db_xref="GOA:A6T5X8"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5X8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004704"
FT                   /protein_id="ABR75999.1"
FT                   /translation="MSEMTQTVTGATQPQSDDASRITARDLRSVFWRSFTLQGSWNYER
FT                   QQHMGYAFAMSPALKRIYQDPTELGRALQRHLVLFNTTPHLSTFIFGLSIAMEEENQRN
FT                   PEFNEESINAIKTSLMGPLAGIGDSIFWGSLKVIAAGMGIYFAQQGSLLGPILALLVYN
FT                   LPHLLCRWYGLKLGYRAGTTWLMRIYQSGLMDRVTYIASIVGLMVVGAMTASMIDITTP
FT                   LSFTAGQTTMKAQEFIDKILPSLLPLLFTLGMYKLIRKGVNINWILLGTVAFGMAASAL
FT                   GLL"
FT   gene            complement(618996..619739)
FT                   /locus_tag="KPN_00550"
FT   CDS_pept        complement(618996..619739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00550"
FT                   /product="putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00550"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76000"
FT                   /db_xref="GOA:A6T5X9"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5X9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004700"
FT                   /protein_id="ABR76000.1"
FT                   /translation="MLLTATLLGLIAALGILDGRLLGVSMIDRPLVMCALTGLVCGNLH
FT                   EGILIGATLELIFLGNVAIGAAHPPDIVTGSVLATAFSIMSGRGPEAALTIAIPVSMLA
FT                   QTLGILVRVVNARFGHLADRYAAQGNTRMVGLMHLAGPTLLYFLNGFLPVFFAILLGSS
FT                   AVSWFLEAIPPVITNGLIVASKILPALGFALLISMMLSSKLMPYLGLGFLIAAYTKLDI
FT                   IAIALFAVVLAFIISQFLNLKQQES"
FT   gene            complement(619754..620224)
FT                   /locus_tag="KPN_00551"
FT   CDS_pept        complement(619754..620224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00551"
FT                   /product="putative transport protein, PTS system"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00551"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76001"
FT                   /db_xref="GOA:A6T5Y0"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5Y0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004720"
FT                   /protein_id="ABR76001.1"
FT                   /translation="MIKLVRIDYRLLHGQVVFAWTRALDIDHIIVANAKAAADAFITMS
FT                   LNLAKPAGVTLDIATVEQAAEKLNSGKLDHKKVMVVLGNTAETLALVEKVPGISAINYG
FT                   GLPQKEGARQFGKAIYLTEEEIAHSRVLKEKGIRLEMRQVPAHSAELLNDQL"
FT   gene            complement(620217..620651)
FT                   /locus_tag="KPN_00552"
FT   CDS_pept        complement(620217..620651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00552"
FT                   /product="putative transport protein, PTS system"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00552"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76002"
FT                   /db_xref="GOA:A6T5Y1"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5Y1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004701"
FT                   /protein_id="ABR76002.1"
FT                   /translation="MKHIYVASHGHFARGLVNSLSLLIGDEHGVIPVCAYDEDIVTTEQ
FT                   LEQTLEHLIVQANGDEVVIFTDLLGGSINNSAVSVLMRHRNVFVVAGINLTLLLEFLLC
FT                   EEATTEAAIIYATSAARESIVFINPLITQPSSDPQGESHD"
FT   gene            complement(620899..621552)
FT                   /gene="nfnB"
FT                   /locus_tag="KPN_00553"
FT   CDS_pept        complement(620899..621552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nfnB"
FT                   /locus_tag="KPN_00553"
FT                   /product="dihydropteridine reductase/oxygen-insensitive
FT                   NAD(P)H nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00553"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76003"
FT                   /db_xref="GOA:A6T5Y2"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR033878"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5Y2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000415"
FT                   /protein_id="ABR76003.1"
FT                   /translation="MDIVSVALKRYSTKAFDATKKLTAGEAEQLKTLLQYSPSSTNSQP
FT                   WHFIVASTDEGKARVAKAASGTYVFNERKILDASHVVVFCAKTAMDDAWLQRVVDQEEA
FT                   DGRFATPDAKAANHKGRTFFADMHRKELKDDDQWMAKQVYLNVGNFLLGVAAMGLDAVP
FT                   IEGVDFAILDEEFDLKAQGYTSLVVVPVGHHSAEDFNATLPKSRLPQSTTITEI"
FT   gene            complement(621672..622040)
FT                   /gene="ybdF"
FT                   /locus_tag="KPN_00554"
FT   CDS_pept        complement(621672..622040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdF"
FT                   /locus_tag="KPN_00554"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00554"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76004"
FT                   /db_xref="InterPro:IPR007351"
FT                   /db_xref="InterPro:IPR038056"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5Y3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR007351"
FT                   /protein_id="ABR76004.1"
FT                   /translation="MTPETLHPCAHRIALTYPFTEHCWPFGPEYDVFKVDGRIFMITMT
FT                   IRGRALVNLKAEPQKSLLNQQIYRSIEPGYHMNKKHWITVVPGEDISEDLLAELIDDSW
FT                   HQVVNKLSKKAQQRLRPR"
FT   gene            complement(622040..622621)
FT                   /locus_tag="KPN_00555"
FT   CDS_pept        complement(622040..622621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00555"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00555"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76005"
FT                   /db_xref="GOA:A6T5Y4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5Y4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001647"
FT                   /protein_id="ABR76005.1"
FT                   /translation="MARPKSEDKKQALLEAATAAFAQSGIAASTSAIARSAGVAEGTLF
FT                   RYFATKDELLNELYLAIKLRLVRTMIAGLDPDEKRPKENARNIWNSYIDWGVRNPMEHK
FT                   AIRRMALSERITDETRRQVKESFPELNEMCQLSVKEIFLSEAYRAFGDALFLSLAETTI
FT                   EFASHDPQRAREIIALGFEAMWHALHEADA"
FT   gene            623947..624288
FT                   /locus_tag="KPN_00556"
FT   CDS_pept        623947..624288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00556"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00556"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76006"
FT                   /db_xref="GOA:A6T5Y5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5Y5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000005"
FT                   /protein_id="ABR76006.1"
FT                   /translation="MTISAQVIDTIVEWIDDNLHQPLRIDDIARHAGYSKWHLQRLFLQ
FT                   YKGESLGRYIRERKLLLAARDLRDTDQRVYDICLKYGFDSQQTFTRVFTRTFNQPPGAY
FT                   RKENHSRAH"
FT   gene            complement(624306..624554)
FT                   /gene="ybdJ"
FT                   /locus_tag="KPN_00557"
FT   CDS_pept        complement(624306..624554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdJ"
FT                   /locus_tag="KPN_00557"
FT                   /product="putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00557"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76007"
FT                   /db_xref="GOA:A6T5Y6"
FT                   /db_xref="InterPro:IPR010590"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5Y6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR010590"
FT                   /protein_id="ABR76007.1"
FT                   /translation="MKHPLETLLSAAGILLLALLSCLLLPAPSLGLTLAQKLVETFHMM
FT                   DLNQLYTVLFCLWFLALGAIEYLVLRWVWRRWFSLER"
FT   gene            complement(624744..624854)
FT                   /locus_tag="KPN_00558"
FT   CDS_pept        complement(624744..624854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00558"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76008"
FT                   /db_xref="GOA:A6T5Y7"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5Y7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR76008.1"
FT                   /translation="MFGIYRGRRLALYIALAIIIATLVGYSTYSFVKALA"
FT   gene            625066..627780
FT                   /locus_tag="KPN_00559"
FT   CDS_pept        625066..627780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00559"
FT                   /product="Mg2+ transport ATPase, P-type 1"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00559"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76009"
FT                   /db_xref="GOA:A6T5Y8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5Y8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004014"
FT                   /inference="protein motif:Pfam:IPR005834"
FT                   /inference="protein motif:Pfam:IPR006068"
FT                   /inference="protein motif:Pfam:IPR008250"
FT                   /protein_id="ABR76009.1"
FT                   /translation="MNNPKFTTPSGDTAPRQVWQQTVDAVLAQTKSQAAGLSSADAAER
FT                   LNTCGPNALPEKKGKPGWLRFLAHFNDVLIYVLLAAAALTAIMGHWVDTLVILGVTVIN
FT                   ALIGHIQESNAEKSLQGIRNMLSSDARVQRNGKHETIPTRDLVPGDIVILRAGDRVPAD
FT                   MRLIETHNLRVEEAILTGESTVVDKITDALEGDLPLGDRVNMVFSGTTVSAGGGVGVVT
FT                   ATGAQTELGHINQMMAGIEKHRTPLLVQMDKLGKAIFAIILAMMVALFIFSLALRDIPM
FT                   GELLLSLISLAVAAVPEGLPAIISIILSLGVQTMARKRAIIRKLPTVETLGAMTVVCSD
FT                   KTGTLTMNEMTVKAIITADCCYRVEGDSYEPQGRIFLEGSDEPVQVQPGTVLETWLRTI
FT                   DLCNDSQLTQDERGLWGITGGPTEGALKVLAAKAQLPAVEARLVAKIPFDSQYKYMSTL
FT                   QHIDGNARVLITGAPDVIFAMCREQMSRHGAVPFEAQYWEEEMARFARQGLRMVAAACK
FT                   PASLDATTLNHEDLQEGLIFLGIAGMMDPPRPEAIDAIHACQTAGIRVKMITGDHPQTA
FT                   MSIGQMLGITNSSQAMTGYQLEHMDDAALAKAAVEYDIFARTSPEHKLRLVKALQDNGE
FT                   VVGMTGDGVNDAPALRQADVGIAMGIKGTEVTKEAADMVLTDDNFATIASSVKEGRRVY
FT                   DNLKKTILFIMPTNLAQGLLIIIALLAGNIIPLTPVLILWMNMATSATLSFGLAFEAAE
FT                   RNVMNRPPRKTGQHVMDGFAVWRVAFVGSMIAIAAFILEAWLAPRGHSPEFIRTVLLQM
FT                   LVTAQWVYMINCRSSDSFSLSMGLLRNKGIWLVTGVLLLMQLVIIYVPLMQSMFGTEAL
FT                   PLRYWFVTLVIGVAMFLVVEIEKRLTRRFRKTA"
FT   gene            627833..628912
FT                   /locus_tag="KPN_00560"
FT   CDS_pept        627833..628912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00560"
FT                   /product="putative secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00560"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76010"
FT                   /db_xref="GOA:A6T5Y9"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5Y9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR006143"
FT                   /protein_id="ABR76010.1"
FT                   /translation="MIKTFRFALLACGLVGGALTATAAPAVPVRVATVELAPHAEERAI
FT                   PGRVEAIRAVDIRARTEGVIVQRHFQDGQYVTEGDLLFTLDDAQPRAALALAQAELKSA
FT                   EASLRQSQQLLTRYERLINNHSISRNDVDTARMQRDVAAAAVQQAKARVEAQQIVLSYT
FT                   RIAAPVTGRVGHSAFHVGTLVNSSSGVLVDIVQLDPVRVSFALDEAAFFSKTGQHADIH
FT                   ALKQAWLAQIEVDGKRRDGVLTSIDNRIDARTGSVAVRAEFANPQHRLLPGGSVTILFR
FT                   PQELPSRVMVPAAAVQQDPQGFFSWVLKPDHTAGQRRLTLAGQQGQQFAVEKGLQAGEQ
FT                   VITDGAQRLREGAAVQVLN"
FT   gene            628926..632018
FT                   /locus_tag="KPN_00561"
FT   CDS_pept        628926..632018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00561"
FT                   /product="putative acridine efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00561"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76011"
FT                   /db_xref="GOA:A6T5Z0"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5Z0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001036"
FT                   /protein_id="ABR76011.1"
FT                   /translation="MLTFFIRRPRFAMVIALLLTFVGAVSLKLIPVEQYPAITPPVVNV
FT                   SASWPGASASDVAEAIAAPLETQLNGVDHMLYMESTSSDEGTYRLSITFAAGTDADLAA
FT                   IDVQNRVAQALAQLPAEVQQNGVQVRKRASNLLMGVSLYSPLGTLSPLFVSNYASTQVR
FT                   EALARLPGVGEVQMFGARDYSMRIWLRPDRMNALNITTDDVAQALREQNVQGAAGQVGT
FT                   PPVFNGQQQTLTINGLGRLNEAASFGEIIIRRGAQGQLVRLADVATIELGARSYSSGAQ
FT                   LNGKASAYLGIYPTPTANALQVASAVRAELNRLHTRFPADLTWEVKFDTTRFVAATIKE
FT                   IGVSLALTLLAVVVVVSLFLQSWRATLIVVLAIPVSLIGTFAVLYLLGYSANTLSLFAI
FT                   ILALTMVVDDAIVVVENVETKMAEGLDRLQATAQALRQIAGPVIATTLVLLAVFVPVAL
FT                   LPGIVGELYRQFAVTLSTAVALSSLVALTLTPALCALLLRPRPARPAAVWRAFNRLLDG
FT                   TRDGYGRLVGWMNRRPWLALAATVAAGALVAFSFTSMPKGFLPQEDQGYLFASVQLPEA
FT                   ASLERTEAVMAQARKLLMANPAVEDVIQVSGFNILNGTSASNGGFISVMLKDWHQRPPL
FT                   DAVMADIQRQLLSLPEATIMTFAPPTLPGLGNASGFDLRILAQAGQSSAELEQVTREIL
FT                   QLANQYPQLSRVFTTWSSNVPQLTLTVHRDRAALLDVPVAQIFSSLQTAFGGTRAGDFS
FT                   RNNRVYHVVMQNEMQWRERAEQISELYVRSRDGERVRLSNLVTITPTVGAPFIQQYNQF
FT                   PSVSVSGSAAEGVSSRTAMAAMEQILQAHLPPGYDYAWSGISWQEQQTGNQAVWIVLAA
FT                   VAMAWLFLVAQYESWTLPASVMLSVLFAIGGALLWLWTAGYANDVYVQIGLVLLIALAA
FT                   KNAILIVEFARSRREEGLSIVDAAREGATRRFRAVMMTAVSFIIGIMPMMLATGAGAQS
FT                   RRIIGTTVFSGMLVATMVGILFIPSLYVLFQRMREWAHRRG"
FT   gene            complement(632367..633086)
FT                   /locus_tag="KPN_00562"
FT   CDS_pept        complement(632367..633086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00562"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76012"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5Z1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR76012.1"
FT                   /translation="MLLRCLLPLALLPLAAVASAACTLTDPTLTLQSYRVDAQKERIAM
FT                   YWQDRHGKAWGSLRSLLAGIDGDGRVQMAMNGGIYDKAYAPLGLYIEDGKRLTPVNRSA
FT                   GGGNFFIRPGGVFLVENGRAKIVPLPAYKPSPAIRYAVQAGPMLIENGVINWRLKPSAS
FT                   SRKLRNGVGIDKQGRVVFMLSDRETNFYDFACYAQSKLGVRQMLYLDGTLSKMYRKGGS
FT                   VPWQYHPFVTMITVERK"
FT   gene            complement(633134..634249)
FT                   /locus_tag="KPN_00563"
FT   CDS_pept        complement(633134..634249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00563"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76013"
FT                   /db_xref="GOA:A6T5Z2"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T5Z2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR006336"
FT                   /protein_id="ABR76013.1"
FT                   /translation="MPLADFHRSDPFTLGIELELQVVNPPGYDLSQDASTLIADVQHEL
FT                   TVGEAKHDITESMLEIATGVCRDISHAQIQLSAIQQAVQRAALRHHLQICGGGSHPFHA
FT                   WQRQQISDNPRYVKTVEHFGYLAQQATVFGQHVHVGCQSGDDAIYLLHGLSRFVPHFIA
FT                   LNAASPWFDSTDSRFACSRLNRFSSYPDNGPMPWVADWQGFRRLFRQLSYTSMIDSMKD
FT                   LHWDIRPSPQFGTVEVRVMDTPLTLAQAIHIAGFIQTLACWLLTERPFKHQPDDYLLYP
FT                   FNRYQACRYGLDGTLTDVRSGEQRSIRQEILQLADRLAPFAHQLKATAALEAVVRQAKS
FT                   PHSEAQQMRDFIANGGSLSGLVQKHCEIWAA"
FT   gene            634576..636243
FT                   /locus_tag="KPN_00564"
FT   CDS_pept        634576..636243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00564"
FT                   /product="putative bacterial extracellular solute-binding
FT                   protein, family 5"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00564"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76014"
FT                   /db_xref="GOA:A6T5Z3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5Z3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000914"
FT                   /protein_id="ABR76014.1"
FT                   /translation="MHKKTLFSRAGRLAVAVSGALALAGAALPANASTLRIAMTAADIP
FT                   LTLGQPDQGYEGNRFTGIPLYDALVEWDLSQGEKPSGLVPGLATEWHIDPQNTSRWIFT
FT                   LRPGVKFHDGTEVNADAIVWNVDKVLNKAAPQYAPGQIGNTLSRMPTLTGAEKIDDHTV
FT                   ALTTSEPDALLPYNITNLFIVSPTAWQKQYDAVPASVGDSAARSKQAWTAFAAHAVGSG
FT                   PFKLEKLVPRQQLILDKNPDYWNKDRIPRVDKVVLIPLPEANARTAALLSKQVDWIEAP
FT                   APDAIDQIKSQGFHLYANTQPHLWPWQFSFEKGSPWQDIRVRKAANLCLNRAELKSYLG
FT                   GYMTEATGVYEADSPWHGKPTFQIKYDPDVARQLMTEAGYSASKPLHVTVATSASGSGQ
FT                   MQPLPMNEYIQQSLKSCFFNVDIKVVEWNTLFTNWRLGARDPSAKGIDAINVSAAVNDP
FT                   YFGLIRFSTAKAFPPVATNWGYFSTPETEKLAAAVKHAFTPAEMNKAAGELHAALVDQV
FT                   PFLFVAHDVGPRAISPAVTGVVQPQSWFIDLSLVSKKE"
FT   gene            636262..637215
FT                   /locus_tag="KPN_00565"
FT   CDS_pept        636262..637215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00565"
FT                   /product="putative binding-protein-dependent transport
FT                   systems inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00565"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76015"
FT                   /db_xref="GOA:A6T5Z4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5Z4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000515"
FT                   /protein_id="ABR76015.1"
FT                   /translation="MINTLLYRILLAIPTMLGVAVICFMLVQIAPGDPLVSVMPPDASE
FT                   ALRQTLMQAYGFDKPLPLQFIHWLWRALHGDLGMSVATGRPVIDEVMTAVAYSLRLALL
FT                   ATAIGFVLGSLFGFVAGYFRNSVIDRLASVLSVFGVSVPHYWLGMLLVILCSVKFALLP
FT                   ATGGGPIGEVGWQWDWAHLQFMLLPALTLSVIPTGIIARTVRSQVADILSQEFIVGLRA
FT                   RGLNESRIFVHVMKNAAPTALAVMGLQVGYLMGGSILVETVFSWPGTGLLLNTAIFQRD
FT                   LPLLQGTIWVLALFFVLLNLLVDILQTTLDPRIKRS"
FT   gene            637218..638111
FT                   /locus_tag="KPN_00566"
FT   CDS_pept        637218..638111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00566"
FT                   /product="putative binding-protein-dependent transport
FT                   systems inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00566"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76016"
FT                   /db_xref="GOA:A6T5Z5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5Z5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000515"
FT                   /protein_id="ABR76016.1"
FT                   /translation="MVDTATTKAVPAAAAHATRQGYWRGVLRRLLRDPGGVVVGVVILL
FT                   LLALALFGPWLIVKDPYQTSMFLRLKPIGSDGFPLGSDELGRDMLSRLILGTRLSLFMG
FT                   IVPVVFAFFIGGAIGIIAGYTGGKTNTVIMRTVDVFYAFPSVLLAIALSGALGAGIGNA
FT                   LLSLTLVFVPQVARIAESVTAQVRHMDYIDAARATGASALTIIRVQVLGNVLGPIFVFS
FT                   TGLISVCMILASGLSFLGLGVRPPEPEWGLMLNTLRTAIYTQPWVAALPGLMIFITSIS
FT                   FNILADRLRAAMAIKE"
FT   gene            638115..639152
FT                   /locus_tag="KPN_00567"
FT   CDS_pept        638115..639152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00567"
FT                   /product="putative ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00567"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76017"
FT                   /db_xref="GOA:A6T5Z6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5Z6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003439"
FT                   /protein_id="ABR76017.1"
FT                   /translation="MQPFINIDLGGPAQPQLKVNHLLKYFRGGKGREVVQAVDDISFTV
FT                   MKGETLGVVGESGCGKSTTARLLMQLLTQDSGELIFDGQGVGSSRLPLKAYRRQVQMVF
FT                   QDSYASLNPRLTMEESIAFGQRVHGVSAREASEYARYLLAHVGLEPARFADRYPHALSG
FT                   GQRQRVNIARALAMKPRLVILDEAVSALDKSVEAQVLQLLQELKRTLELTYVFISHDLH
FT                   VVRWLSDRILVMYLGEVVEIGPAEQLFTASAHPYTRALLSSMPSMDPENRTLTSPLSGD
FT                   PPSPIAPPSGCRFHTRCPHAKAVCAEVKPQLEAVGEGHQSACLMAQPASPWHQSIPLKE
FT                   VSHVG"
FT   gene            639142..640152
FT                   /locus_tag="KPN_00568"
FT   CDS_pept        639142..640152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00568"
FT                   /product="putative ABC transport system ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00568"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76018"
FT                   /db_xref="GOA:A6T5Z7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5Z7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003439"
FT                   /protein_id="ABR76018.1"
FT                   /translation="MSDNAFVHVRDLRVVFRRDGQTINAVNGVSFEVQKGEVMALIGES
FT                   GSGKSVTLRALMRLHPPGSSELSGTLQVGDDEVLTMSASQLRRYRGGRCAMIFQEPLLA
FT                   FDPVYTVGQQIIEGLRRHEGLSRQAARDRALEALRQVRIPSPERRLDAYPHEMSGGMRQ
FT                   RAMIALALSCNPQLLLADEPTTALDATVQIQILILLREQQKQRGLSIVFVTHDIGAAVE
FT                   IADRVAVMYAGRIVEEASMSEILRHPRHPYTQVLLGSRPKEGLKKGDALHCIPGAPPDL
FT                   ARLPPGCAFAERCPHRRPVCEQSLPPTESVAERHAVSCHRWRELAIDANAQALAV"
FT   gene            640250..641518
FT                   /locus_tag="KPN_00569"
FT   CDS_pept        640250..641518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00569"
FT                   /product="putative amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00569"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76019"
FT                   /db_xref="GOA:A6T5Z8"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5Z8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002933"
FT                   /protein_id="ABR76019.1"
FT                   /translation="MSSDVLFTPATDTTGWRINGDRLWASLMDLAQIGATPKGGCRRLT
FT                   LTDLDRQGRDKVIGWAREAGMSVTIDKIGNVFMRREGRNPGLPPIVSGSHIDTQPTGGK
FT                   FDGNYGVLAALEVVRTLNDLQIDTDAPIEVVFWTNEEGSRFVPVMMGSGVFAGVFPLEE
FT                   TWAVTDKEGVSVGEALAQIGYIGEQTPGDHPIGAYFEAHIEQGPILEDEAKTIGIVQGV
FT                   LGIRWYDCVVTGQASHAGPTPMRLRQDALQVATRIMQEVVAIAGRSEEGRGTVGSVQVW
FT                   PNSRNVVPGEVTFSIDMRNLSDALVDEMDRQLRAFIAEVERESGLQVALKQVSHYPAAP
FT                   FDAECQQAIADAAQRLGYPARPIVSGAGHDAVYMSYLAPTGMIFIPCKDGISHNEIEYA
FT                   SPEHVAAGANVLLQVMLQYARPV"
FT   gene            642655..643989
FT                   /locus_tag="KPN_00570"
FT   CDS_pept        642655..643989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00570"
FT                   /product="putative aminotransferase, putative regulator
FT                   domain in N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00570"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76020"
FT                   /db_xref="GOA:A6T5Z9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6T5Z9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000524"
FT                   /inference="protein motif:Pfam:IPR004839"
FT                   /protein_id="ABR76020.1"
FT                   /translation="MKARYKAVVDRYAQAIRSGQLPAGSRLPTHRTLAAGERISLATAT
FT                   RVYRELEEMGLVSGETGRGTFVRDLSLPPGHGVDQQVVAADVVDLNFNYPSLPEQGDAL
FT                   REALRQLAMAGDIDSHLRYQPHAGRLAERDIIARHLTCQHFAPDAENVLIVNGAQHGLA
FT                   VTVMGLLRPGDVVAVDALTYSGFKALAALYHLELAAIPCRPEGPDLQALHTLCQQRRVR
FT                   AVYTMPTLHNPLGWVLNTGQRQALADLARQHDLLIIEDAAYARLVSHPPPPVVSYAPER
FT                   TVYVTGFSKNIATGLRVGVVISPPRYRPEIERAIRATTWNTPTLISSLICAWIEDGTVA
FT                   RFETQKRQDARQRQQVAREVLCGLPVVSHPDSYFVWLPLGEESRADRLANALMERRISV
FT                   STAEPFCVSATIPQALRIALGSVPFDSLRPALLSVRDAVEYEQYR"
FT   gene            complement(643986..645545)
FT                   /locus_tag="KPN_00571"
FT   CDS_pept        complement(643986..645545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00571"
FT                   /product="putative bacterial regulatory protein, GntR"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00571"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76021"
FT                   /db_xref="GOA:A6T600"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6T600"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000524"
FT                   /protein_id="ABR76021.1"
FT                   /translation="MNRIAVSDGGRVVWNLLSVTGGRNALLPEEPRMIRHLLHVDFQPG
FT                   RGLQEQVRETLVNAILSGIFAADTPLPSCRQLASQLRVSRNTTALVFESLVNEGYLISR
FT                   PRSGYYLHPDYHEASPAAVESAPQREAAAPRWGDRLQMTPSQQESILKPAGWMHYRYPF
FT                   IYGQPDTRQFPLATWRSAANWLHGGVRDPAWVIDHIDQDVPMLIEQIRTRVLPKRGIVA
FT                   APDEILITLGSQNALYLLTRLLLSSTTRIGVENPCFREAINTFLLADAEVVPHPVDEEG
FT                   IVLNERPCDYYYVTPGHQVPTGVTMSSARRRQLLEHAARHDAVIIEDDYDSESNFTLNP
FT                   LPALKASDRSGRVVYVSSLSKALSPGLRLGFMVADPDLIDEARALRRLVYRHPPTNIQY
FT                   QMAHFLAQGHYETHLRRYHFDSAQRWERLHAALQRYLPSCRALAGSEHANAFWLQTPAQ
FT                   INTQQLTWRAAHAGVLIEPGARHFLSAAPPDNYFRMGFHAINPDAIAQGVEVLRGQLEQ
FT                   MG"
FT   gene            645712..646542
FT                   /locus_tag="KPN_00572"
FT   CDS_pept        645712..646542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00572"
FT                   /product="glutamine ABC transporter periplasmic-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00572"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76022"
FT                   /db_xref="GOA:A6T601"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A6T601"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001638"
FT                   /protein_id="ABR76022.1"
FT                   /translation="MCLSAVLTVAFSYHAVAADLPEIEKSGTLKVATEDDYAPFNFMNN
FT                   GQADGFNKDMLEELRKYAKFHVDQSILPWTGLLAAVSTGQYDMALTGAVITDERLKVFD
FT                   FTPPWASAQHYFVKRAGDTSLNTIADLSGKKVGVQAGSALLARLPELKAMLEKTGGKLG
FT                   PVVEYPSYPEAYADLANKRLDYVINVVISVNDLAKAKPKVFAKGLAVSGPGYMAWPIPK
FT                   NSPQLLAYMTRFMNHMKETGKLAELQKKWFGETYDNLPTEAITSPEQFHKLAGL"
FT   gene            646590..647231
FT                   /locus_tag="KPN_00573"
FT   CDS_pept        646590..647231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00573"
FT                   /product="putative binding-protein-dependent transport
FT                   systems inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00573"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76023"
FT                   /db_xref="GOA:A6T602"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6T602"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000515"
FT                   /protein_id="ABR76023.1"
FT                   /translation="MDAISWQLLIEGAWTTLWISAIAIAFGVVAGLLIALVRMLRLPVI
FT                   DQLLVVYISLARATPLVTLVLFLFLSLPTMGINLDKNVAAIVALTLNTSAFNAEIWRNA
FT                   FRTFPREQREAAESVGMRRWTYFRYIMLPQMWIESLPALVNEMSFLIKGSPAIAVIGVV
FT                   DLTRVTNRISSVTYEPLSPILAAGLLYVAIIGCLLKLQGIAERKARRLAR"
FT   gene            647246..647911
FT                   /locus_tag="KPN_00574"
FT   CDS_pept        647246..647911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00574"
FT                   /product="putative binding-protein-dependent transport
FT                   systems inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00574"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76024"
FT                   /db_xref="GOA:A6T603"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6T603"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000515"
FT                   /protein_id="ABR76024.1"
FT                   /translation="MNQWGVIWSVRDSFIAGLFATLELFITAALAALIIGIALCYFSEY
FT                   QKKVINRIIIGFVSLMRAIPFLILAYLLYYGLPQLGISMEPWTAGLLALIIYHGAYFFE
FT                   ILRSQRRVFSGGYIEAAIAQGFSRYAIFRRIILPNIVSSALPLIGNQLIICLKDTAFLS
FT                   IITVQEITAAANSVQATYFIPFNAFIVAIGLYWAISILLELLIKRLTAWGAKRGMSHA"
FT   gene            647904..648665
FT                   /locus_tag="KPN_00575"
FT   CDS_pept        647904..648665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00575"
FT                   /product="putative ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00575"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76025"
FT                   /db_xref="GOA:A6T604"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A6T604"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003439"
FT                   /protein_id="ABR76025.1"
FT                   /translation="MPESIAVSVKNVSKQFDNVEVLRDINLTVEKGTVVSILGSSGSGK
FT                   STLLRCMNWLEQPDRGEIHIGGQRLGIDEQRGRAMSHRQLAKIRERVGMVFQSFNLWPH
FT                   LTVQQNVSEALLRVKGMKRDEAKAMAMQQLEKVGMAHKADVYPITLSGGQKQRVAIARS
FT                   LAMSPEVILFDEPTSALDPELVNEVLGVMKALAAEGYTMVVVTHEMDFARQVSNEVVFL
FT                   EKGLLIEKAPPEKFFTQPDSERVRQFLQSSR"
FT   gene            complement(648719..649483)
FT                   /locus_tag="KPN_00576"
FT   CDS_pept        complement(648719..649483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00576"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00576"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76026"
FT                   /db_xref="GOA:A6T605"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6T605"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002198"
FT                   /protein_id="ABR76026.1"
FT                   /translation="MATSNVVFITGATSGFGEAAAQVFADAGWSLVLSGRRYPRLKALQ
FT                   DRLAARVPVHIIELDVRDSEAVAAAVASLPADFADITTLINNAGLALSPLPAQEVALED
FT                   WKTMIDTNVTGLVTVTHALLPTLIRHGAGASIINIGSIAGQWPYPGSHVYGASKAFVKQ
FT                   FSYNLRCDLLGTGVRVTDLAPGIAETEFTLVRTKGDQAASDKLYRGTTPLSARDIAEQM
FT                   FYIATLPAHMNINRVEVMPVRQAWQPFAIDRD"
FT   gene            649664..651001
FT                   /locus_tag="KPN_00577"
FT   CDS_pept        649664..651001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00577"
FT                   /product="4-aminobutyrate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00577"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76027"
FT                   /db_xref="GOA:A6T606"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A6T606"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR005814"
FT                   /protein_id="ABR76027.1"
FT                   /translation="MKLAIHNEVAVSNDEVRQLDRAYVFHSWSMQGNLNPLVIAGAQGC
FT                   ELWDYEGNTWLDFSSQLVNVNIGYQHPRVLAAMKSQLETLVTIAPATANLARGEAAKRI
FT                   VDLAPAGFSKVFFTNAGADANENAIRMARLYTGRDKVLSAYRSYHGNTGSAIAATGDWR
FT                   RVPNEFSRGHVHFFNPYLYRSEFNAATEEEECQRALAHLRRIIECEGPTAIAAILLESI
FT                   PGTAGILVPPAGYMQGVRALADEFGIVLILDEVMAGFGRTGSWFAFEQDGVVPDLVTFA
FT                   KGVNAGYVPAGGVLISEPIARYFDDHFFAGGLTYSGHPLAMAAIVATIDAMKEEKVVEN
FT                   AASIGNEVLRPGLEALAEKHAIIGEVRGRGLFQALELVSSREQKTPLTAADMAAIKGAL
FT                   TEAGLLAFVVENRIHVVPPCTITAEQVAQGLAIFDAVFARFASLAK"
FT   gene            complement(651248..651952)
FT                   /locus_tag="KPN_00578"
FT   CDS_pept        complement(651248..651952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00578"
FT                   /product="putative ATP-binding component of a transport
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00578"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76028"
FT                   /db_xref="GOA:A6T607"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6T607"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003439"
FT                   /protein_id="ABR76028.1"
FT                   /translation="MAIVNLQDLQVTFGAKTAVSAASFRVDAGETFSLIGASGCGKSTI
FT                   LRVLAGLQREWRGSVDLLGQAIMPGARFQGDLRRNVQMVFQDPYASLHPNHTLWRTLAE
FT                   PLQIHGIRDVAPRVTTALEQVGLAADAVRRYPHQLSGGQRQRVAIARALLLRPQILLLD
FT                   EPTSALDMSVQAEILNLLNRLKQEHGMTYLLVSHDADVIAHMSDRAAFMAEGVIQRFFD
FT                   REALVNGEHRMR"
FT   gene            complement(651939..652775)
FT                   /locus_tag="KPN_00579"
FT   CDS_pept        complement(651939..652775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00579"
FT                   /product="putative ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00579"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76029"
FT                   /db_xref="GOA:A6T608"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6T608"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003439"
FT                   /protein_id="ABR76029.1"
FT                   /translation="MTDIRLTVQGLAVDYPTARVVDNVSFTLGNERLALVGESGSGKSM
FT                   TARALMGLVRKPGVVSAERLEVLGRDVLTLSARGWRTLRGNDIAMVLQDPRYALNPVQT
FT                   IQTQLEEALTLHQRLSRRARAEAVKDAIAAVGLDLPVLSRYPGELSGGMGQRVMIALAL
FT                   LNNPKVLIADEPTSALDARLRNQILELLVEQSAQRQMAMLLISHDLPLVAAHCDRVLVM
FT                   YQGRQVDEMPARALPSATHPYTRTLWTCRPNAHTYGQMLPTLDRTQDFTETAHGDR"
FT   gene            complement(652768..653601)
FT                   /locus_tag="KPN_00580"
FT   CDS_pept        complement(652768..653601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00580"
FT                   /product="putative ABC transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00580"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76030"
FT                   /db_xref="GOA:A6T609"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6T609"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000515"
FT                   /protein_id="ABR76030.1"
FT                   /translation="MPTYLFLRRLRRSPAAFSGLTLVILLVLTALFAPWLAPHDPNWQD
FT                   AAARLQGPGAGHWLGTDSYGRDLLSRLLYGARPALGLVALVTAITLPVGLLVGILSGYY
FT                   GGWLERILMRFTDVVMSMPRLILAFAFVAMLGPGLVNGALALALTTWPAYARQARSEIQ
FT                   RLRHSDYLAAAEMLGIRGGRLLVGHILPLCLPSAIVRLALDLAGIILAAAGLGFLGLGA
FT                   RPPMAEWGAMIADGMQVIFDQWWIAAIPGAAILLASLAFNLLGDGLRDILEPQHD"
FT   gene            complement(653601..654623)
FT                   /locus_tag="KPN_00581"
FT   CDS_pept        complement(653601..654623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00581"
FT                   /product="putative ABC transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00581"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76031"
FT                   /db_xref="GOA:A6T610"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6T610"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000515"
FT                   /protein_id="ABR76031.1"
FT                   /translation="MPSFSTHLTRLLQGLFTLLLTLFGLLLVTFSLSALSPVDRVLQIV
FT                   GDHASQSTYDQVRHQLGLDQPLPVQFWHYLVNLAHGDLGIASATGQPVLHDLLAVFPAT
FT                   LELATLALIVGAVLGIVAGVLCARYAGSPWDLAVRTFTLLGNSVPIFWLGLLMLALFYA
FT                   RLQWAPGPGRLDDIYQYTVEPRSGFALIDTWLSGDTAAFKNAIGHLALPVLVLAYYSLA
FT                   SITRLTRSACLSEMNKEYILLARAKGAGEMTILLRHVLPNIRGTLLTVTALAWTSMLEG
FT                   AVLTETVFSWPGIGRYLTTALFAGDTTAIMGGTLLIGVSFVLINNLTDLLVRLTDPRVR
FT                   "
FT   gene            complement(654743..656311)
FT                   /locus_tag="KPN_00582"
FT   CDS_pept        complement(654743..656311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00582"
FT                   /product="putative ABC transport system periplasmic binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00582"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76032"
FT                   /db_xref="GOA:A6T611"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A6T611"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000914"
FT                   /protein_id="ABR76032.1"
FT                   /translation="MTKKLLPLLLLSALSAAAHAATPPNTLVVAQGLDDIVSLDPAEAN
FT                   ELSSIQTVPSLYQRLVQPDRNNPEKIVPILAESWQADPAAKTLTIKLKPDAKFASGNPL
FT                   RPEDVIFSYTRAVTLNKSPAFILNVLGWQPDNIASQLKKVDDHTLTLHWTADVSPAVAL
FT                   NILSTPIASIVDEKQVAPNAKNNDFGNDWLKMHSAGSGAYKMRVYQPHQAIVLEANASS
FT                   PTGAPKIKSIIIKNVPDPASRRLLIQQGDADVARDLGADQIAALQDKPGVKVLSIPSAE
FT                   QNYLVFNTANSANPLLNNPAFWEAARWLVDYEGITKNLLKGQYFIHQSFLPAGLPGALE
FT                   TNPFTFDPQKAKAILDKAGIKDAHFTLDVENKPPFITIAQSLQASFAQGGVKVDLLPAA
FT                   GSQVYARVRAKQHQAAIRLWIPDYFDAHSNASAFAWNDGKSSTVAGLNGWQIPELNKAT
FT                   LAAVAEPDPAKRLGLYKTMQETLLQHSPYVFIDQGKTQIVVRDNVKGYQQGLNADMVWY
FT                   DNVTK"
FT   gene            656511..657212
FT                   /locus_tag="KPN_00583"
FT   CDS_pept        656511..657212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00583"
FT                   /product="putative GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00583"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76033"
FT                   /db_xref="GOA:A6T612"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A6T612"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000182"
FT                   /protein_id="ABR76033.1"
FT                   /translation="MGVPEINEYGQQVNDLVPGWQGAQVLRRTALNGRFCRLEPLDVDR
FT                   HAADLFAAYALGDNSDWTWLASTRPESVTATAHWIAGKVNDDVLVPYAVVDLRSEQAVG
FT                   IVSYMAIEREMGTVEIGHVTWSRRMKNTPLGTEAVWLLLKNGFDHGYRRLEWKCDSMNV
FT                   ASRRAAERLGFSWEGRLRQRLVRKGRTRDSDMLSIIDGEWPARDAALRAWLAAENFTAD
FT                   GQQIKRLEAFR"
FT   gene            complement(657333..658997)
FT                   /locus_tag="KPN_00584"
FT   CDS_pept        complement(657333..658997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00584"
FT                   /product="choline dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00584"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76034"
FT                   /db_xref="GOA:A6T613"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR011533"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6T613"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000172"
FT                   /inference="protein motif:Pfam:IPR007867"
FT                   /protein_id="ABR76034.1"
FT                   /translation="MQFDYIIIGAGSAGNVLATRLTEDPNTTVLLLEAGGPDYRFDFRT
FT                   QMPAALAYPLQGKRYNWAYETEPEPYMNNRRMECGRGKGLGGSSLINGMCYIRGNAMDL
FT                   DNWAKEPGLEHWSYLDCLPYYRKAETRDIGPNDYHGGDGPVSVTTPKPGNNPLFEAMVE
FT                   AGVQAGYPRTDDLNGYQQEGFGPMDRTVTPQGRRASTARGYLDQARGRPNLTIRTHALT
FT                   DHIIFAGKRAVGVEWLEGESTIPSKATANKEVLLCAGAIASPQILQRSGVGNPELLRQF
FT                   DIPVVHDLPGVGENLQDHLEMYLQYECKEPVSLYPALQWWNQPKIGAEWLFGGTGIGAS
FT                   NQFEAGGFIRSRAEFAWPNIQYHFLPVAINYNGSNAVKEHGFQCHVGSMRSPSRGHVRL
FT                   KSRDPHAHPAILFNYMSHEQDWQEFRDAIRITREIMNQPALDKYRGREISPGIECQSDA
FT                   ELDEFVRNHAETAFHPCGTCKMGYDEMAVVDGEGRVHGLEGLRVVDASIMPQIITGNLN
FT                   ATTIMIGEKMADAIRGRQPLPRSTATYYVAGDAPVRR"
FT   gene            complement(659011..660474)
FT                   /locus_tag="KPN_00585"
FT   CDS_pept        complement(659011..660474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00585"
FT                   /product="NAD+-dependent betaine aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00585"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76035"
FT                   /db_xref="GOA:A6T614"
FT                   /db_xref="InterPro:IPR011264"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A6T614"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR002086"
FT                   /protein_id="ABR76035.1"
FT                   /translation="MAEQQLYINGGYTSATSGRTFETINPATGEVLATVQAAGREDVDR
FT                   AVESAQRGQKIWAAMTAMERSRILRRAVDLLRQRNDELARLETLDTGKPLSETAAVDIV
FT                   TGADVLEYYAGLIPALEGSQIPLRDSSFVYTRREPLGVVAGIGAWNYPIQIALWKSAPA
FT                   LAAGNAMIFKPSEVTPLTALKLAEIYSEAGLPDGVFNVLPGIGAETGQYLTEHPDIAKI
FT                   SFTGGVASGKKVMANSAASSLKEVTMELGGKSPLIIADDADLDLAADIAMMANFYSSGQ
FT                   VCTNGTRVFVPAKQKAEFEHKILERVARIRAGDLFADDTNFGPLVSFPHRDNVLRYIES
FT                   GKREGARLLCGGEALKGDGFDNGAWVAPTVFTDCSDEMTIVREEIFGPVMSILSYADEA
FT                   EVIRRANATEYGLAAGVVTPNLNRAHRIIHQLEAGICWINSWGESPAEMPVGGYKHSGI
FT                   GRENGVMTLQSYTQVKSIQVEMGKFQSIF"
FT   gene            complement(660497..661102)
FT                   /locus_tag="KPN_00586"
FT   CDS_pept        complement(660497..661102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00586"
FT                   /product="transcriptional regulator BetI"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00586"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76036"
FT                   /db_xref="GOA:A6T615"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017757"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:A6T615"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001647"
FT                   /protein_id="ABR76036.1"
FT                   /translation="MNGVAKMPKLGMQPIRRRQLIDATLDAINEVGMHDATIAQIARRA
FT                   GVSTGIISHYFKDKNGLLEATMRDITSQLRDAVLNRLHALPDGSASQRLQAIVGGNFDE
FT                   TQISSAAMKAWLAFWASSMHQPMLYRLQQVSSRRLLSNLVYEFRRELPREQAQEAGYGL
FT                   AALIDGLWLRAALSGKPLDKTLAQSLTSHFIRQHLPNP"
FT   gene            661213..663246
FT                   /locus_tag="KPN_00587"
FT   CDS_pept        661213..663246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00587"
FT                   /product="high-affinity choline transport"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00587"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76037"
FT                   /db_xref="GOA:A6T616"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:A6T616"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000060"
FT                   /protein_id="ABR76037.1"
FT                   /translation="MTDLSQSREKDKINPVVFYTSAGLILLFSLMTIFFRDFSAEWIGR
FT                   TLDWVSKTFGWYYLLAATLYIVFVVCIACSRFGSVKLGPEQSKPEFSLLSWAAMLFAAG
FT                   IGIDLMFFSVAEPVTQYMQPPEGAGQTIEAARQAMVWTLFHYGLTGWSMYALMGMALGY
FT                   FSYRYNLPLTIRSALYPIFGKRINGPIGHSVDIAAVIGTIFGIATTLGIGVVQLNYGLS
FT                   VLFDIPDSLAAKAALIALSVIIATISVTSGVDKGIRVLSELNVALALGLILFVLFMGDT
FT                   SFLLNALVLNVGDYVNRFMGMTLNSFAFDRPVEWMNNWTLFFWAWWVAWSPFVGLFLAR
FT                   ISRGRTIRQFVMGTLIIPFTFTLLWLSVFGNSALYEIIHGDAAFAQEAMAHPERGFYSL
FT                   LAQYPAFTFSASVATITGLLFYVTSADSGALVLGNFTSKLKDINSDAPNWLRIFWSVAI
FT                   GLLTLGMLMTNGISALQNTTVIMGLPFSFVIFFVMAGLYKSLKVEDYRRVSASRDTAPR
FT                   PMGLQDRLSWKKRLSRLMNYPGTRYTKLMMETVCYPAMEEVAQELRLRGAAVELKSLPP
FT                   EEGENLGHLDLLVHMGDEQNFIYKIWPQQYSVPGFTYRARSGKSTYYRLETFLLEGSQG
FT                   NDLMDYSKEQVITDILDQYERHLNFIHLHREAPGNSVMFPDG"
FT   gene            663963..665219
FT                   /locus_tag="KPN_00588"
FT   CDS_pept        663963..665219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00588"
FT                   /product="putative transport"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00588"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76038"
FT                   /db_xref="GOA:A6T617"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR030192"
FT                   /db_xref="UniProtKB/TrEMBL:A6T617"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR006685"
FT                   /protein_id="ABR76038.1"
FT                   /translation="MAYVNHLLTFIESNPALAVGFNLILLLLSGIFAHLLCKFLLIKVV
FT                   RKVFFSSHKQDVPLEKDRRIAEKLSNFIPVIIVYYVLQFMPAMPASLVTAINTICGILF
FT                   FIFMSVFFNEMLDIVNSSYLRKTKRKNHSIKGYIQIGKILVHILAAIMILAVMSNKSPI
FT                   IIISSLGAVAAVLMIVFQHTLLSLVANVQLSSNDVLQLGDWIEMPDKNLSGEVTDIALH
FT                   TITIRNWDNTISRIPTKNFLTETYTNWQAMFSSGARRIMRSIAIDQHSVRFLDQEMLSS
FT                   MLTIRGVSEPLATLLDGRDPGGVADRWFVDNGLTNLTLFRHYLMHYLAERPDIIKEMYI
FT                   VARTLKPSPSGIPLEIYCFTTSTLWKDYENTQSAIFEYITAVAGQFSLRLYQYPAGHDF
FT                   WRLSQEHAARTGLPPSAEG"
FT   gene            complement(665216..666109)
FT                   /locus_tag="KPN_00589"
FT   CDS_pept        complement(665216..666109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00589"
FT                   /product="putative bacterial regulatory protein, LysR"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00589"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76039"
FT                   /db_xref="GOA:A6T618"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6T618"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000847"
FT                   /inference="protein motif:Pfam:IPR005119"
FT                   /protein_id="ABR76039.1"
FT                   /translation="MADFPPVASLRSFEAVARLGSVTQAAHEMSVTHSAVSQHIKQLEA
FT                   LVGVTLFIRHGRGVRITEEGRLYALQIREALQHIADATRMVQIKPRTLEVTLATIPSFG
FT                   CHWLLPRLARFQARHPQIAVRLLTSLAVVNLQQEGIDLAIRMGQGDWEGMESRHLFADE
FT                   QLVVAAPGYRGGNLPTTPQAIAASDIIFSMESWHAWCSQAGLEKPIVPAGLRLNDSNLV
FT                   LEAVRLGAGVALERRSLVAGAIARGELVQLTAVTVPYPWHYWLTVSPQAENRPEVARFI
FT                   AWLEEEIALWRQQISA"
FT   gene            666364..666969
FT                   /locus_tag="KPN_00590"
FT   CDS_pept        666364..666969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00590"
FT                   /product="putative S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00590"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76040"
FT                   /db_xref="GOA:A6T619"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A6T619"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004045"
FT                   /protein_id="ABR76040.1"
FT                   /translation="MKLIGMMDSPYVRRVAVSLALYGVEFESLPLSVFSGFDEFSRINP
FT                   VVKAPTVVLDNGTQLMDSTLILHYFETTNPAGRRLLPAHPEALARDLHLLGVILAACEK
FT                   AVQHVYEHRLRPEEKQHQPWIARVTGQLLAACREWDARLADRAAAAQPDQVLVTSTVVW
FT                   SFIQLMIPAVVSAAAFPHIRALAEKGEALPAFQQYPLG"
FT   gene            complement(667028..668527)
FT                   /locus_tag="KPN_00591"
FT   CDS_pept        complement(667028..668527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00591"
FT                   /product="putative carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00591"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76041"
FT                   /db_xref="GOA:A6T620"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="InterPro:IPR042016"
FT                   /db_xref="UniProtKB/TrEMBL:A6T620"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR000577"
FT                   /protein_id="ABR76041.1"
FT                   /translation="MSVNKDIIIALDEGTTNAKAVAFDSHGRVIAQFSRALEIATPQEG
FT                   WVEQSAELLLAASLEVISRAVAAVGAERVAALAISNQRETVVGWYRETGEAIAPALSWQ
FT                   CARTAAFCHMLREQGHEPQIKAVTGLPVAPLFSASKMRWLLDHTPDGLNRAKNGEICLG
FT                   TVDSWLLWHLTQGQHFCCDYANASRTQLMNLHTADWDTDMLALFGIPRAALPVIKPSSG
FT                   LFGYTAGLATLPDGIPVMAMIGDSHAALFAHGLGAAGCVKATYGTGTSVMAPVDSVAFH
FT                   VSNLATTVAWHDGEKLVYALEGNIPHTGDAVAWMADSTGLSERSPAELAQALNALPRSV
FT                   DSTLGVFFVPALTGMGAPWWDDKARGLIHGLSRGVKRAHLIRAALESITYQIADVITAM
FT                   RAHHGFTLNTLLVDGGPTKNDWLMQYQADLLGCPVMRSDVAELSATGAALLARKALHKL
FT                   TVAELQPFLPEHITYAPDLIRHHRLVQRWQSWQHAVTLARR"
FT   gene            complement(668542..669933)
FT                   /locus_tag="KPN_00592"
FT   CDS_pept        complement(668542..669933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00592"
FT                   /product="putative L-fucose isomerase, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00592"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76042"
FT                   /db_xref="GOA:A6T621"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR015888"
FT                   /db_xref="UniProtKB/TrEMBL:A6T621"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR004216"
FT                   /protein_id="ABR76042.1"
FT                   /translation="MGVIIGNRGFFPSYLVAEAREQAVALFSRLGINTIMLDPSQTELG
FT                   GVETRQDAKICAELFRSHRDNIHGVVVLLPNFGDEKAIAETLRLSGLNVPVLIQAEEDN
FT                   LDKMGLSTRRDSFCGKISLCNNLRQYGIPFTLTTQHVCALSGEVFEQDLRRFTQICRVV
FT                   NSMRGVRVGAIGARPAGFNTVRYSEKLLERLGIAVETLDLSEVFTRIKALRDDDIRVDE
FT                   KRRLLIDNADASGIPADKLVTMAKLFVVLSEWIVANDIDTTAIQCWTSLQENLGINVCS
FT                   IMSVMSGQLMPSACEVDVMGALSMYALASSNLSPASIADWNNNFGDDRDKCVLFHCGNF
FT                   ASASLESPHMGTADIIGTTVGKENTCGAVHGRMKSGALTYFRLSTDDLTGEIKAYVGEG
FT                   QSVDDPLDTVGCRAVIQVPHLENLLSWICRNGFEHHVAMNHSASAAILHEAFTRYLGVS
FT                   TYLHQ"
FT   gene            complement(669995..670945)
FT                   /locus_tag="KPN_00593"
FT   CDS_pept        complement(669995..670945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00593"
FT                   /product="putative transketolase C-terminal section"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00593"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76043"
FT                   /db_xref="GOA:A6T622"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A6T622"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR005475"
FT                   /inference="protein motif:Pfam:IPR005476"
FT                   /protein_id="ABR76043.1"
FT                   /translation="MSNSEHLATVMVNAFIDAVDRGVDLVPVVADSTSTAKIAPFIKRF
FT                   PGRLVNVGIAEQTLVGAAAGLALGGKVAVTCNAAPFLISRANEQIKVDVCYNNTNVKLF
FT                   GLNAGASYGPLASTHHSIDDIAILRGFGNIEIYAPSSPGECRQIIDYALAHVGPVYIRL
FT                   DGKALPELHDERYRFVPGNIDVLRLGRDIALVAMGSTVHEIVEAAAQLAAEGIDATVIS
FT                   VPSIRPCDTQALLAAIQSCPAAITVEEHNVNGGVGSLVAEVLAEAGCAIPLRRLGIPDG
FT                   QYAIAADRAATRARHEIDAAGVVKHARKLHIKKAS"
FT   gene            complement(670938..671768)
FT                   /locus_tag="KPN_00594"
FT   CDS_pept        complement(670938..671768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00594"
FT                   /product="putative transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00594"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76044"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A6T623"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR005474"
FT                   /protein_id="ABR76044.1"
FT                   /translation="MNPFSLSVKELEQKARAIRRRIIVLNAESPAGGHTGADLSQVELL
FT                   TALYFRILNCSPARKESDDRDIYIQSKGHAVGGYYCVLAEAGFIPVDWLATYQHADSAL
FT                   PGHPVKHKTPGIELNTGALGHGLPVAVGIALAAKRDNNPRRVFVVTGDGELAEGSNWEA
FT                   ALVAAHYQLDNLIIINDKNNLQLAGATKEIMNTDPLDEKWRAFGMEVTQCNGNDMAEVV
FT                   ATLEGLQPNGKPHVVIANTTKGAGISFIQGRPEWHHRVPKGEEIELALEELKDE"
FT   gene            672038..673030
FT                   /locus_tag="KPN_00595"
FT   CDS_pept        672038..673030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00595"
FT                   /product="putative sugar-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00595"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76045"
FT                   /db_xref="GOA:A6T624"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A6T624"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR007324"
FT                   /protein_id="ABR76045.1"
FT                   /translation="MMHKNNEQKTEGNAMSKQDEQRLLVKIATLYYSENKKQSEIASLL
FT                   HLSQSFVSRALTRCQKEGLVKITVVQPTNIFVDLEKAIEERFGIRQAIVVDVGENASYS
FT                   QVKHAIGSAAAHYVETRLRPEDLVGISSWSSTIRCMVDEMHPQNIRAAGVIQLLGGVGP
FT                   NGNVQATILTQQLAAHLGCPAWLLPSQSIEHSVEERSRLVNSPDVAAVVAKFAEVDVAI
FT                   VGIGELEPSQLLKNSGNYYNETMLQLLAARGAVGDICLHYYNAAGKPVLSQDEDPVIGM
FT                   ELDQIRRCPQVIALAGGVDKENAIRGALQGDYIDVLITDFPTARALIKG"
FT   gene            complement(673027..673989)
FT                   /locus_tag="KPN_00596"
FT   CDS_pept        complement(673027..673989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00596"
FT                   /product="Putative transposase, YhgA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00596"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76046"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:A6T625"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR006842"
FT                   /protein_id="ABR76046.1"
FT                   /translation="MKKHPHSTPHDSLFKRFLRDSETARDFLDIHLPPALRQLCDLSTL
FT                   HLESGSFVEDNLRASYSDILYSLHTSKGEGYIYVVIEHQSTPDSHMAFRLLRYALAAMQ
FT                   QHLDRGHKALPLVIPMLFYHGSISPYPFSLCWLDEFPPDSPAKQLYLGAFPLVDVTDIP
FT                   DDAILQHRRIALLELVQKHIRQRDLSHILQQLVEVVLMGYTDHQQFKTLFTYMSLHGNS
FT                   ADPENFIDQLVERLPQYEDTLMTIAEYLKQKGREEGKQRWLQEGLNEGLQAGEHREACR
FT                   IALMMLENGMDTETVLRMTRLSADELATLARQARQSPPA"
FT   gene            complement(674145..675233)
FT                   /locus_tag="KPN_00597"
FT   CDS_pept        complement(674145..675233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00597"
FT                   /product="putative bacterial inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00597"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76047"
FT                   /db_xref="GOA:A6T626"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A6T626"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR001851"
FT                   /protein_id="ABR76047.1"
FT                   /translation="MKMTQSVALAPRGGASLSRENILLLLLKLRTFIALFLIVGFFTMT
FT                   VPGFLSAGSMVIMIKHIAINAFLALGITFVIITAGIDLSIGATLGLCGMIAGWLITKGI
FT                   VLPMFGIAIFPSVWVIVPLVLLIGALIGAVNGWIITRYNVAPFICTLGTMYVLRGAAML
FT                   TSDGQTFPGLAGNPQLGNTGFDEIGAGALFGIPWAIWLMILLALIIAYIARRLPFGRHV
FT                   YAIGDNERAAELSGVKVKQIKVLVYTLSGFCAAIAGIVVSAQLLASHPANGTAFEMNAI
FT                   AAVVLGGTSLAGGRGTILGTLIGAFVIGFLADGLVMMGVSEFWQMVIKGIVIIVAVIID
FT                   QMQNRMQQKAAVVAQKAVMENK"
FT   gene            complement(675235..676761)
FT                   /locus_tag="KPN_00598"
FT   CDS_pept        complement(675235..676761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00598"
FT                   /product="putative ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00598"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76048"
FT                   /db_xref="GOA:A6T627"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6T627"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /inference="protein motif:Pfam:IPR003439"
FT                   /protein_id="ABR76048.1"
FT                   /translation="MASSPAEEIILRTRGISMLFPGTVALDNVDYNVWRGKVNVIIGEN
FT                   GAGKSTLMKILAGVQQPSLGEMELNGNIVHFSSTREAAAHGIGMVHQELNLFENLSVAE
FT                   NIFLGRELQRGLTPINEAEQERQAAELLQRLDQPISPRELVGNLKVGQQQLVEIAKALA
FT                   ENADILILDEPTSALSKTEVDILFRVIRELTRQGVSIIYISHRLEELMAIGDVITILRD
FT                   GKFQAEARVSEIDVPWIVREMLGSDPVSHFLPPNRRFGAPLLEVENLTCVNAAGNTVVD
FT                   NVSFKAHAGEIIGIYGLMGAGRTELFECLLGTARHYFGKIWLDSKPVPQRLTTAERIRM
FT                   GMSLVPEDRKRTGIFPISSVASNLTIASLWRRLQRGVTIANKEEEAVVASTIGNLSIKV
FT                   SSPEVEIQALSGGNQQKVVIGRSLLTNPKVLFLDEPTRGIDIGAKGDVFRMMVQLSQQG
FT                   MAVVFSTSDLKEIMAVSDRILVMSGGKLTADIVRDQAEESALVSASAQGF"
FT   gene            complement(676761..677372)
FT                   /locus_tag="KPN_00599"
FT   CDS_pept        complement(676761..677372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00599"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00599"
FT                   /db_xref="EnsemblGenomes-Tr:ABR76049"
FT                   /db_xref="InterPro:IPR014582"
FT                   /db_xref="InterPro:IPR036215"
FT                   /db_xref="UniProtKB/TrEMBL:A6T628"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR76049.1"
FT                   /translation="MMRLKQWGAVLMGCAALLLTACTVVDLDENGKPVLPADPNAKPSF
FT                   DHLTPQQIAQQTWQSRVIDAANQHALDATALEKVRQASGATPQSVFVRLNSEVTGTDVS
FT                   NPREQKLTLTLLGQPLVVQLGPVMRGNAIRDASGFKFEDFTNQVQFAQLSRAYNREAIK
FT                   SLPKVDASWTGKPIDILFAVTVVNGSLQDAAALELKQEAR"
FT   gene            complement(677380..678282)
FT                   /locus_tag="KPN_00600"
FT   CDS_pept        complement(677380..678282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_00600"
FT                   /product="D-ribose periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_00600"
FT