(data stored in SCRATCH zone)

EMBL: CP000648

ID   CP000648; SV 1; circular; genomic DNA; STD; PRO; 175879 BP.
XX
AC   CP000648;
XX
PR   Project:PRJNA31;
XX
DT   06-JUL-2007 (Rel. 92, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Klebsiella pneumoniae subsp. pneumoniae MGH 78578 plasmid pKPN3, complete
DE   sequence.
XX
KW   .
XX
OS   Klebsiella pneumoniae subsp. pneumoniae MGH 78578
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Klebsiella.
OG   Plasmid pKPN3
XX
RN   [1]
RP   1-175879
RG   The Klebsiella pneumonia Genome Sequencing Project
RA   McClelland M., Sanderson E.K., Spieth J., Clifton W.S., Latreille P.,
RA   Sabo A., Pepin K., Bhonagiri V., Porwollik S., Ali J., Wilson R.K.;
RT   ;
RL   Submitted (06-SEP-2006) to the INSDC.
RL   Genetics, Genome Sequencing Center, 4444 Forest Park Parkway, St. Louis, MO
RL   63108, USA
XX
RN   [2]
RC   Protein update by submitter
RP   1-175879
RG   The Klebsiella pneumonia Genome Sequencing Project
RA   McClelland M., Sanderson E.K., Spieth J., Clifton W.S., Latreille P.,
RA   Sabo A., Pepin K., Bhonagiri V., Porwollik S., Ali J., Wilson R.K.;
RT   ;
RL   Submitted (09-JUL-2007) to the INSDC.
RL   Genetics, Genome Sequencing Center, 4444 Forest Park Parkway, St. Louis, MO
RL   63108, USA
XX
DR   MD5; 82cfd573e9d8ca4160140a1e2750be7a.
DR   BioSample; SAMN02603941.
DR   EnsemblGenomes-Gn; EBG00001179959.
DR   EnsemblGenomes-Gn; EBG00001179960.
DR   EnsemblGenomes-Gn; EBG00001179961.
DR   EnsemblGenomes-Tr; EBT00001758486.
DR   EnsemblGenomes-Tr; EBT00001758488.
DR   EnsemblGenomes-Tr; EBT00001758489.
DR   EuropePMC; PMC2764197; 19620323.
DR   EuropePMC; PMC3318348; 22252815.
DR   EuropePMC; PMC3553734; 23229477.
DR   EuropePMC; PMC3591897; 23295924.
DR   EuropePMC; PMC3811314; 23979739.
DR   EuropePMC; PMC4106114; 25105122.
DR   EuropePMC; PMC4349654; 25738592.
DR   EuropePMC; PMC4394812; 25691645.
DR   EuropePMC; PMC4505248; 26014954.
DR   EuropePMC; PMC4549013; 26303940.
DR   EuropePMC; PMC5634883; 29017452.
DR   EuropePMC; PMC5923091; 29507071.
DR   EuropePMC; PMC6153814; 30012771.
DR   RFAM; RF00042; CopA.
DR   RFAM; RF00107; FinP.
DR   RFAM; RF00243; traJ_5.
DR   RFAM; RF01794; sok.
DR   RFAM; RF02005; group-II-D1D4-6.
DR   RFAM; RF02012; group-II-D1D4-7.
DR   StrainInfo; 118395; 0.
XX
CC   Coding sequences below are predicted from manually evaluated
CC   computer analysis, using similarity information and the program
CC   GeneMark (version 2.3). This sequence was finished as follows
CC   unless otherwise noted: all regions were double stranded, sequenced
CC   with an alternate chemistries or covered by high quality data
CC   (i.e., phred quality >=30);an attempt was made to resolve all
CC   sequencing problems, such as compressions and repeats; all regions
CC   were covered by sequence from more than one m13 subclone.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..175879
FT                   /organism="Klebsiella pneumoniae subsp. pneumoniae MGH
FT                   78578"
FT                   /plasmid="pKPN3"
FT                   /sub_species="pneumoniae"
FT                   /strain="ATCC 700721; MGH 78578"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:272620"
FT   gene            1..348
FT                   /locus_tag="KPN_pKPN3p05859"
FT   CDS_pept        1..348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05859"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05859"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80238"
FT                   /db_xref="GOA:A6TI17"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI17"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80238.1"
FT                   /translation="MDFEARKQKALAIMASCKMWKSNYAPLLIRLLWRLGINIPPLPFA
FT                   PFWQVFGVMAGSFSVGYGLWMYWMVWRAQGMPPLFACKISLIAGVLFGLTMALFHLWRR
FT                   KVNKLPDWKDL"
FT   gene            complement(563..1108)
FT                   /locus_tag="KPN_pKPN3p05860"
FT   CDS_pept        complement(563..1108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05860"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05860"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80239"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI18"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80239.1"
FT                   /translation="MPLPERMKPARVTRKQMKELVSQLNGILDHIDNGMDENNEELKQM
FT                   MADWNAQVVIPCGFSDFRDFSSWTSALDFTRMALNQEKYLDDFTWTELNDVINFIRKAE
FT                   GSASDHSYALQLLEINFRANPLDLIYHPDCWFNDEALFHARLTTEEIGGYLMKKSGRWL
FT                   NDAPDIQLVYAIPQDIYD"
FT   gene            1465..3786
FT                   /locus_tag="KPN_pKPN3p05861"
FT   CDS_pept        1465..3786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05861"
FT                   /product="klebicin B"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05861"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80240"
FT                   /db_xref="GOA:A6TI19"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR016128"
FT                   /db_xref="InterPro:IPR036302"
FT                   /db_xref="InterPro:IPR037146"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI19"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80240.1"
FT                   /translation="MIGGFNYNGEGATSSGLSSPSASDVANQFNSFGGTQIRASDVSNI
FT                   RSDGNGGYMADIRGQIHTVSSEEGSTTVSGFDGVRSSSTGNGGSQGGQGPQGQSLVMHN
FT                   GQMGYWENRSSGAGNNEHTTRAFVAVGPSEAEKAARAEKVAKEKQQAEEAAKAFAAKTA
FT                   AASAAAEKERQNAISAAAAAGQHQTVPDARNNLNQATAEASRLKTVADNALNTAKNKRK
FT                   EAIDAVPVATQAEKKYQDLQQSIKGLTLNNNGQYGTQKWEVISSNKEHDHWGYRFYPSG
FT                   ITKAQVDAAQNDAVNKRNAATSLASQATAAEQASLQASAAYNAAETRRQAAQAALASAE
FT                   QAAAAERKRQEAEAAAAAAAEKKRQADAAAKAAEEARAIAEKAKALQARCTAADKLKSS
FT                   EIQAVRGIPATAAPFAIPLTWSTASRGGFTLSADAAASLGAFISEALATLSVAVVANPV
FT                   ALTIAGLVLSKSVGVGSDMVPGRDISSMMPGDAFGLPDTAALNKAADQKTSVSMPVRGR
FT                   LVMNDSGILDVQLVKTNTAGAVKVARAVLDKETGYWGYTLPAVADVPAQTIFVSPADAL
FT                   GANGPLTLSGPVPLPERILHTGDQISAPQATDKTVTPVADDLDFDDIILVFPPESGLKP
FT                   LYVMYRSPRNMPGTVSGKGQNVGNNWMGGASTGDGAPVPSQIADKLRGKTFGSFDSSRR
FT                   AFWKAVADDSALSKQFSEADINQMKAGRAPTADFLESVGKRVKIELHHEKEISQGGAVM
FT                   DVDNIKALTPKNHIETHKGK"
FT   gene            3764..4066
FT                   /locus_tag="KPN_pKPN3p05862"
FT   CDS_pept        3764..4066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05862"
FT                   /product="klebicin B immunity"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05862"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80241"
FT                   /db_xref="GOA:A6TI20"
FT                   /db_xref="InterPro:IPR000290"
FT                   /db_xref="InterPro:IPR035900"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI20"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80241.1"
FT                   /translation="MRHIKENKMAGNKISDFTEEEFTAFVSKIIAADFPTDKENDDAIY
FT                   SFAQLTEHPAGWNLIFKPKVGEDSSAKGIVKTVKEWRAANGKPGFKNRDWMCGFR"
FT   gene            4335..4886
FT                   /locus_tag="KPN_pKPN3p05863"
FT   CDS_pept        4335..4886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05863"
FT                   /product="endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05863"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80242"
FT                   /db_xref="GOA:A6TI21"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI21"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80242.1"
FT                   /translation="MNRTLHKCCLSGLISLALCAPVPAVYAASIETGYSPEGTALQLVL
FT                   KTIDSAQQEIRLMGYSFTSPEVAGALVRAKRRGVDVKVVLDWKANTGKQNQASLAAMNL
FT                   LVNAGIPVRTVSQYKIMHDKVIIADGRNIEVGSFNYTRAADRVNSENVLVVWDDPVVAQ
FT                   RYLQHWLTRWSQGTDWKRAY"
FT   gene            5207..5485
FT                   /gene="repB"
FT                   /locus_tag="KPN_pKPN3p05864"
FT   CDS_pept        5207..5485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repB"
FT                   /locus_tag="KPN_pKPN3p05864"
FT                   /product="DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05864"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80243"
FT                   /db_xref="GOA:A6TI22"
FT                   /db_xref="InterPro:IPR019661"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI22"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80243.1"
FT                   /translation="MSRSADKTTSSTNAKRAYRKGKPMSASERQLAAIARKRETHKEVK
FT                   VFVKNPLKDVMIAVCEEEGLTQAQFIEKLLERELTERGLIDVKTSHS"
FT   gene            5772..6629
FT                   /gene="repA"
FT                   /locus_tag="KPN_pKPN3p05865"
FT   CDS_pept        5772..6629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repA"
FT                   /locus_tag="KPN_pKPN3p05865"
FT                   /product="DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05865"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80244"
FT                   /db_xref="GOA:A6TI23"
FT                   /db_xref="InterPro:IPR003446"
FT                   /db_xref="InterPro:IPR017837"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI23"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80244.1"
FT                   /translation="MTDILQNHYSQVKNPNPVFTPREGKKTLPFCRKLMAKAEGFTSRF
FT                   DFSIHVAFLRSLGKRHRMPPLLRRRAIDALLQAMCFHYDPLANRVQRSITNMAIECGLA
FT                   TESRSGNLSVSRATRALKFLAELGLITYQTEYDPQIGCNIPTDITFTPALFSALDVSEV
FT                   AVVAARRSRVEWENLQRKKQKLKPLEMDELIAKAWRFVRERFRSYQAERKSHGRKRDTA
FT                   RRDASRQRHDIETRVRQQLTREYATGRFMGDKEALKREVERRVQERMLLSRGNNYTRLA
FT                   TVPL"
FT   gene            complement(8076..10271)
FT                   /locus_tag="KPN_pKPN3p05866"
FT   CDS_pept        complement(8076..10271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05866"
FT                   /product="hypothetical ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05866"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80245"
FT                   /db_xref="GOA:A6TI24"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI24"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80245.1"
FT                   /translation="MSSAYDSLDPRVRKWVYKQGWSTLRPLQESSIPAILARDRDVLIS
FT                   AGTAAGKTEAFFLPACSAVADLTNGFGIVYISPLKALINDQYRRLGSLGDALEMPVTPW
FT                   HGDVPQSKKKKARTNPAGILLITPESLESLLINSMGWLKQAFSSVAYIVIDEFHAFIGS
FT                   ERGVQLLSLLNRIDHVLGCQVNPIPRVALSATLGELEKVPEMLRPDKRLPCVTVTDSNS
FT                   MATLQVQVKGYLERVIQNEEELQSSAEHDVCADIFRLCRGDSHLVFANSRKRTESIAAT
FT                   LSDMCEEQIVPNEFFPHHGSLAKELREVLESRLQKGNLPTTAVCTMTLELGIDIGKVKS
FT                   VIQVTPPHSVSSLRQRMGRSGRRDSPSVLRMLITENELTVSSSIVDHLRLQLVQSMAMI
FT                   RLMISKQWFEPADSRQMHYSTLLHQILAITAQWGGVRADQLWSQLCQTGPFRNVDLNDF
FT                   KSLLKHMGACGLLTQLASGEMVVGAEGEKLTNHYTFYAVFNTPEEFRIITGNRTLGTVP
FT                   VDSPLLPDQHIIFGGRRWKVTEIETEKKVIYVEATKGGQPPQFSGGGMSVHDAVRQEML
FT                   AIYREGDYRIAIGSKKVDYADTAARNLFAEGCSNFQRFKLQNECFITSGQHCYVIPWMG
FT                   DKVVNTITALLIRCGFKANSFAGVIEIDNSSVASVQHALKEMLLSGLPSAFDLATDVPE
FT                   KYLDKYDEYLPESLLAKGYGAKAYETEGTRIWLQKHL"
FT   gene            complement(10268..11584)
FT                   /locus_tag="KPN_pKPN3p05867"
FT   CDS_pept        complement(10268..11584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05867"
FT                   /product="hypothetical biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05867"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80246"
FT                   /db_xref="InterPro:IPR021228"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI25"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80246.1"
FT                   /translation="MSVTRIRVKERDAIIQSLKSGVTPRIGIQHIQVGRVNEITALHQD
FT                   IERIADGGASFRLIIGEYGSGKTFFLSVVRSIALEKKLVSVSADLSPDRRIHSSGGQAR
FT                   NLYSELMKNMSTRNKPDGNALLSVVERFVTEARKEADTDGSEVSSVIHKRLAALSDMVG
FT                   GYDFAKVIDAFWRGHEQDNETLKSNAIRWLRGEYTTKTDARHDLDVRTIISDASFYDSL
FT                   KLMSLFVRQAGYAGLLVSLDEMVNLLKLNNTQARTANYEQILRILNDCLQGSAENIGFI
FT                   LGGTPEFLFDPRKGLYSYEALQSRLAENRFAQKAGVIDYSSPTLHLASLTPEELYILLR
FT                   NLRHVYAGGDPENYLVPDEALTGFLHHCSKTIGDAYFRTPRNTIKGFLDMLAVLEQNRT
FT                   MNWQTLIEGVAIEEDRPSDMDDTTTEESDDDDGLANFKL"
FT   gene            complement(11588..13897)
FT                   /locus_tag="KPN_pKPN3p05868"
FT   CDS_pept        complement(11588..13897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05868"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05868"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80247"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR025266"
FT                   /db_xref="InterPro:IPR028932"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI26"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80247.1"
FT                   /translation="MELLNFLAAIFVIYLLFFRKKKRKSPKSYASDPVKAPPKEWLADI
FT                   KKKEAVVRNDDSEDDNLATFTLSGGRGVELRVTTNHYRNTSKSAGALARWVLPGEMITV
FT                   AGVAISGGHIYVGQRMKPSGQESGGYYDDGSEASLIDDTCKIKPTSYLYEDSSLGYWPS
FT                   FSSLSPEARGAYVSWLASDRSDPSCPIGYVFIYLYGLERKALVDSTDPKFPDAEFRNLF
FT                   NEVARLRSIFIENRSFRGYSTQLLEAMSILRPNMGLATELDSNSGFSNSMQFKLALAKT
FT                   VHEGVPVSAELALNWVINHTEYSLRTPARRCAKEFAALFKRRYTLKYGEGMVVKANKTR
FT                   LRLDYTPASPSLRGVRLPVPDLPDPSALKSPVQKIMALADICTDELDAYSRYLGRKGTS
FT                   VNDTAAIMLLPSEIVNESAEKILSSFKRWADEAILVKEGLVSVADFWAHMNASCPNKIN
FT                   KKEADLMQAFALKMGYGLAPDPYYHHVKADVDGTLVLFPAAEGGRFSPSPEFISAVMTL
FT                   RLGAMVALIDDSLDQAEQKVLENAINNNPGFTDDEKRSLHAYLTWQLHTPANMTGMKSR
FT                   IELMGAAEKAAVGKVIVSVACSDGTIAPAEIKQLEKIYSSLGLDPSSVSSNIHQHSATE
FT                   HDLVSSVPTDQPAAGFTLDANVLARHESATDDVRKLLNTIFTEEEPEEPESAPASSTEA
FT                   GGLDSAHSQLYRSLLEKEQWSRKEATELCGNLNLMLGGALEVINDWSYAVVDAPVLDDA
FT                   DDDIWVDLEIAKELEG"
FT   gene            complement(14542..15510)
FT                   /locus_tag="KPN_pKPN3p05869"
FT   CDS_pept        complement(14542..15510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05869"
FT                   /product="IS903D transposase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05869"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80248"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI27"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80248.1"
FT                   /translation="MKDQITYLPDNADRSVAKQKFKITNWPTYNKALINRGSITFWLDD
FT                   EAIQAWYESATPSSRGRPQRYSDLAITTVLVIKRVFRLTLRAAQGFIDSIFSLMNVPLR
FT                   CPDYSCVSRQAKSVNVSFKTPTRGEIAHLVIDSTGLKVFGEGEWKVKKHGQERRRIWRK
FT                   LHLAVDSKTHEIICADLSLNNVTDSEAFPGLIRQTHRKIRAASADGAYDTRLCHDELRR
FT                   KKISALIPPRKGAGYWPGEYADRNRAVANQRMTGSNARWKWTTDYNRRSIAETAMYRVK
FT                   QLFGGSLTLRDYDGQVAEAMALVRALNKMTKASMPESVRIA"
FT   gene            complement(15602..16855)
FT                   /gene="lacY"
FT                   /locus_tag="KPN_pKPN3p05870"
FT   CDS_pept        complement(15602..16855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacY"
FT                   /locus_tag="KPN_pKPN3p05870"
FT                   /product="galactoside permease (lactose permease, M
FT                   protein) (MFS family)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05870"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80249"
FT                   /db_xref="GOA:A6TI28"
FT                   /db_xref="InterPro:IPR000576"
FT                   /db_xref="InterPro:IPR018457"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI28"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80249.1"
FT                   /translation="MYYLKNTNFWMFGLFFFFYFFIMGAYFPFFPIWLHDINHISKSDT
FT                   GIIFAAISLFSLLFQPLFGLLSDKLGLRKYLLWIITGMLVMFAPFFIFIFGPLLQYNIL
FT                   VGSIVGGIYLGFCFNAGAPAVEAFIEKVSRRSNFEYGRARMFGCVGWALCASIVGIMFT
FT                   INNQFVFWLGSGCAFILAVLLFFAKTDAPSSATVANAVGANHSAFSLKLALELFRQPKL
FT                   WFLSLYVIGVSCTYDVFDQQFANFFTSFFATGEQGTRVFGYVTTMGELLNASIMFFAPL
FT                   IINRIGGKNALLLAGTIMSVRIIGSSFATSALEVVILKTLHMFEVPFLLVGCFKYITSQ
FT                   FEVRFSATIYLVCFCFFKQLAMIFMSILAGNMYESIGFQGAYLVLGLVALGFTLISVFT
FT                   LSGPGPLSLLRRQVNEVA"
FT   gene            complement(16907..19981)
FT                   /gene="lacZ"
FT                   /locus_tag="KPN_pKPN3p05871"
FT   CDS_pept        complement(16907..19981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacZ"
FT                   /locus_tag="KPN_pKPN3p05871"
FT                   /product="beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05871"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80250"
FT                   /db_xref="GOA:A6TI29"
FT                   /db_xref="InterPro:IPR004199"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023230"
FT                   /db_xref="InterPro:IPR023232"
FT                   /db_xref="InterPro:IPR023933"
FT                   /db_xref="InterPro:IPR032312"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6TI29"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80250.1"
FT                   /translation="MTMITDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEART
FT                   DRPSQESRSLNGEWRFAWFPAPEAVPESWLERDLPDADTVIVPSNWQMHGYDAPIYTNV
FT                   TYPIAVNPPYVPTENPTGCYSLTFNIDESWLQEGQTRIIFDGVNSAFHLWCNGRWVGYG
FT                   QDSRLPSEFDLSAFLHAGENRLAVMVLRWSDGSYLEDQDMWRMSGIFRDVSLLHKPSTQ
FT                   ISDFHVATHFNDDFSRAVLEADVQMYGELRDELRVTVSLWQGETQVASGTAPFGGEIID
FT                   ERGGYADHVTLRLNVENPKLWSAEIPNLYRAVVELHTADGTLIEAEACDVGFREVRIEN
FT                   GLLLLNGKPLLIRGVNRHEHHPLHGQVMDEQTMVQDILLMKQNNFNAVRCSHYPNHPLW
FT                   YTLCDHYGLYVVDEANIETHGMVPMNRLTDDPRWLPAMSERVTRMVQRDRNHPSVIIWS
FT                   LGNESGHGANHDALYRWIKSVDPSRPVQYEGGGADTFATDIICPMYARVDEDQPFPAVP
FT                   KWSIKKWLSLPGETRPLILCEYAHAMGNSLGGFAKYWQAFRQYPRLQGGFVWDWVDQSL
FT                   IKYDENGNPWSAYGGDFGDTPNDRQFCMNGLVFADRTPHPALTEAKHQQQFFQFSLSGR
FT                   TIEVTSEYLFRHSDNELLHWMVALDGKPLASGEVPLDVAPQGKQLIELPGLPQPKSAGQ
FT                   LWLTVHVVQPNATTWSAAGHISAWQQWRLAENLSVTLPSAPHAIPQLTTSETDFCIELD
FT                   NKRWQFNRQSGFLSQMWIGDKKQLLTPLRDQFTRAPLDNDIGVSEATRIDPNAWVERWK
FT                   AAGHYQAEAALLQCTADTLADAVLITTVHAWQHQGKTLFISRKTYRIDGSGQMAITVDV
FT                   EVASNTPHPARIGLTCQLAQVAERVNWLGLGPQENYPDRLTAACFDRWDLPLSDMYTPY
FT                   VFPSENGLRCGTRELNYGPHQWRGDFQFNISRYSQQQLMETSHRHLLHAEEGTWLNIDG
FT                   FHMGIGGDDSWSPSVSAEFQLSAGSYHYQLLWCQK"
FT   gene            complement(20103..21251)
FT                   /gene="lacI"
FT                   /locus_tag="KPN_pKPN3p05872"
FT   CDS_pept        complement(20103..21251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacI"
FT                   /locus_tag="KPN_pKPN3p05872"
FT                   /product="lactose operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05872"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80251"
FT                   /db_xref="GOA:A6TI30"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI30"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80251.1"
FT                   /translation="MAQNISWYGMIAPEESQFRVVNVKPVTLYDVAEYAGVSYQTVSRV
FT                   VNQASHVSAKTREKVEAAMAQLNYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAA
FT                   IKSRADQLGASVVVSMVERSSVEACKAAVHNLLAQRVSGLIINYPLDDEDAIAVEAACA
FT                   NVPALFLDVSDQTPINSIIFSHEDGTRLGVEHLIALGHQQIALLAGPLSSVSARLRLAD
FT                   WHKYLTRNQIHPIAEREGDWSAMSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITE
FT                   SGLRVGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGKTSVDRLLKLSQGQAVKSNQL
FT                   LPVSLVKRKTTLPPNTQTTSPRTLADSLMQLARQVSRLESGQ"
FT   gene            21646..22656
FT                   /locus_tag="KPN_pKPN3p05873"
FT   CDS_pept        21646..22656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05873"
FT                   /product="putative alginate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05873"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80252"
FT                   /db_xref="GOA:A6TI31"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014182"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI31"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80252.1"
FT                   /translation="MKAVGFWQPGESTSVIEDLSLPHPSMPKGRDLLIRVRAVAVNPRD
FT                   LKSRRNISPSAGNPVVMGYDASGVVEATGPDVTLFRPGDHVFYAGVLDRQGANAEFQLV
FT                   DERITGIKPAALSFEAAASVPLTGLTAWEMLFDRLQLSVNGDADQTLLMLGGAGGVPCM
FT                   AIQLARTLSRVNIIGTASRQESVRAVRGFGAHYVLDHSCALAPQVASLAGLPPITRIFS
FT                   TYTTPSAWENMAEIIAPQGRIGLIDDPEPLDLRLIKFKSVSVHWEAMFTRPMHATADMS
FT                   KQHDILNKLSCMLDSGKLKPPLLAEYGRLNAKALRRAHEDMENKNVNGKIVFSGF"
FT   gene            23060..24064
FT                   /locus_tag="KPN_pKPN3p05874"
FT   CDS_pept        23060..24064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05874"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05874"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80253"
FT                   /db_xref="GOA:A6TF77"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A6TF77"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80253.1"
FT                   /translation="MENIALIGIDLGKNSFHIHCQDHRGKAVYRKKFTRPKLIEFLATC
FT                   PATTIAMEACGGSHFMARKLEELGHFPKLISPQFVRPFVKSNKNDFVDAEAICEAASRP
FT                   SMRFVQPRTESQQAMRALHRVRESLVQDKVKTTNQMHAFLLEFGISVPRGAAVISRLST
FT                   LLEDSSLPLYLSQLLLKLQQHYHYLVEQIKDLESQLKRKLDEDEVGQRLLSIPCVGTLT
FT                   ASTISTEIGDGKQYASSRDFAAATGLVPRQYSTGGRTTLLGISKRGNKKIRTLLVQCAR
FT                   VFIQKLEHQSGKLADWVRELLCRKSNFVVTCALANKLARIAWALTARQQTYEA"
FT   gene            24362..25024
FT                   /locus_tag="KPN_pKPN3p05875"
FT   CDS_pept        24362..25024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05875"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05875"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80254"
FT                   /db_xref="GOA:A6TI33"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI33"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80254.1"
FT                   /translation="MWAVRWYCKYGISYRELQEMLAERGVNVDHSTIYRWVQRYAPEME
FT                   KRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSRGRTVDFYLSSRRNSKAAYRF
FT                   LGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCPSDVEHRQIKYRNNVIECDHG
FT                   KLKRIIGATLGFKSMKTAYATIKGIEVMRALRKGQASAFYYGDPLGEMRLVSRVFEM"
FT   gene            25030..25584
FT                   /locus_tag="KPN_pKPN3p05876"
FT   CDS_pept        25030..25584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05876"
FT                   /product="rmpB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05876"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80255"
FT                   /db_xref="GOA:A6TI34"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI34"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80255.1"
FT                   /translation="MNKTKGCLIANFATVPIYSTKPLEDAENGLSSRMRRTIAELYDLF
FT                   NDLERRIHFFDKEIETVFRQSEACQRIAKVKGIGPKTATAVVAAIGKGTEFKNGRHFAA
FT                   WLGLVPRQHSSGDKHLRTLFIHGARAVVRVATNNNDGHMNQWVNQLKERRGFNKTTVAV
FT                   ANKNARIIWSMLRNETEYQVV"
FT   gene            26193..27146
FT                   /locus_tag="KPN_pKPN3p05877"
FT   CDS_pept        26193..27146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05877"
FT                   /product="Predicted Co/Zn/Cd cation transporter"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05877"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80256"
FT                   /db_xref="GOA:A6TI35"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI35"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80256.1"
FT                   /translation="MQVNKFTDDIDISSHERFIAARKSTWVSVLVNCFLTSGQVITGIF
FT                   SGSQGLIADGIHSLSDLVSDFVVLIANHKSKKNPDDDHHYGHHRYENGASLILGTILFI
FT                   VGIGMLWSAVNKMKQPDDIPQVHIVALWVALAALVIKELLFRYMLAVATRVKSTMLVAN
FT                   AWHARSDAASSLVVAIGIIGNLSGFKLLDPVAAMVVGLIVTRMGYSFMSDSLHDLMDRS
FT                   VDIETENKIKTTLLSTPGVEGIHDLKTRKMGDLVVVDVHLEINGNLSVKVGHDIAVLAR
FT                   KSVLDNHHVLNVMTHVDPFFKEVSGLDYGSVNNHKQ"
FT   gene            27258..27632
FT                   /locus_tag="KPN_pKPN3p05878"
FT   CDS_pept        27258..27632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05878"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05878"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80257"
FT                   /db_xref="GOA:A6TI36"
FT                   /db_xref="InterPro:IPR009155"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI36"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80257.1"
FT                   /translation="MRKIMHSVIIGTALVLSTSVIAGSDGVEHAMKMMNKSYRAALKEE
FT                   DVTSFRKDMQDLKSTAESILNGPVEGYDRETYVAGMSLLIDEVTAVESTAEKEGLDAGK
FT                   IAAQKLGSMMRKYHNKLGVD"
FT   gene            28070..28651
FT                   /locus_tag="KPN_pKPN3p05879"
FT   CDS_pept        28070..28651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05879"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05879"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80258"
FT                   /db_xref="GOA:A6TI37"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI37"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80258.1"
FT                   /translation="MNENLRNALPHKDTPFLRVLHIILAVLILLQIVSSNLTESDALSD
FT                   YTLTGFVTWFHVITGLSLIVLGLIMLAWMLTQRGFHYYFAWLTLDFRGVVEDIKMLMSF
FT                   RLPEAHAGGIAALVQGLGVLALLGVASCGGFWFALNTIPGMSPVLTESVLNLHKFLTVF
FT                   IETYFWAHGSMGLLHIFLTIRSQMKNSVTE"
FT   gene            28769..29476
FT                   /locus_tag="KPN_pKPN3p05880"
FT   CDS_pept        28769..29476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05880"
FT                   /product="nodulin 21-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05880"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80259"
FT                   /db_xref="GOA:A6TI38"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI38"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80259.1"
FT                   /translation="MKGSKDMHLERHSIEKVGWLRAAVLGANDGIVSTASLVLGVASAN
FT                   TSSSGVLLAGVAGLVSGAMSMATGEYVSVSSQADTENAALAQEKRELETDYEGEMQELT
FT                   SLYIQRGLDPVLAYRVAEQLMARNALDAHAREELGLTDTNSAQPLQAAVFSALSFSAGA
FT                   VLPLIVAWLSPPKQVFLFIILSTLFSLVVLGYISSVAGKAPPVRAIIRIMFWSTLAMFL
FT                   SMGIGHFAGQVLL"
FT   gene            complement(29619..29930)
FT                   /locus_tag="KPN_pKPN3p05881"
FT   CDS_pept        complement(29619..29930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05881"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05881"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80260"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI39"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80260.1"
FT                   /translation="MVTGKIKKIGTVTFSKNPLVTLYISGSNEGLKFIFENTDYNNDKV
FT                   AKLNVGDTVIIAGWNARPGTFEGIFLDDSQIMTGMISKKKRQMLAVNGGVYDREICLK"
FT   gene            30076..30471
FT                   /locus_tag="KPN_pKPN3p05882"
FT   CDS_pept        30076..30471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05882"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05882"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80261"
FT                   /db_xref="GOA:A6TI40"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI40"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80261.1"
FT                   /translation="MSNTNANFEMTGILLGQEARKRKTPQEKIAIIQQTMEPGMNVSHV
FT                   ARLHGIQPSLLFKWKKQYQEGSLTAVAAGEEVVPASELTAALKQVRELQRLLGKKTMEV
FT                   EILKEAVEYGQSRKWIAHAPLLPKDGE"
FT   gene            30429..30650
FT                   /locus_tag="KPN_pKPN3p05883"
FT   CDS_pept        30429..30650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05883"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05883"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80262"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI41"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80262.1"
FT                   /translation="MDSARALVAKGRGIALVSRTMGVSRAQLSLRINRSADWQDKRCNR
FT                   RNDEADEEILSAILDIMGSVWETANIVR"
FT   gene            complement(31079..32083)
FT                   /locus_tag="KPN_pKPN3p05884"
FT   CDS_pept        complement(31079..32083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05884"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05884"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80263"
FT                   /db_xref="GOA:A6TF77"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A6TF77"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80263.1"
FT                   /translation="MENIALIGIDLGKNSFHIHCQDHRGKAVYRKKFTRPKLIEFLATC
FT                   PATTIAMEACGGSHFMARKLEELGHFPKLISPQFVRPFVKSNKNDFVDAEAICEAASRP
FT                   SMRFVQPRTESQQAMRALHRVRESLVQDKVKTTNQMHAFLLEFGISVPRGAAVISRLST
FT                   LLEDSSLPLYLSQLLLKLQQHYHYLVEQIKDLESQLKRKLDEDEVGQRLLSIPCVGTLT
FT                   ASTISTEIGDGKQYASSRDFAAATGLVPRQYSTGGRTTLLGISKRGNKKIRTLLVQCAR
FT                   VFIQKLEHQSGKLADWVRELLCRKSNFVVTCALANKLARIAWALTARQQTYEA"
FT   gene            complement(32162..33427)
FT                   /locus_tag="KPN_pKPN3p05885"
FT   CDS_pept        complement(32162..33427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05885"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05885"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80264"
FT                   /db_xref="GOA:A6TI43"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI43"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80264.1"
FT                   /translation="MGSCAAPSAKGDDKFITTDYLQQCQNNHVRPKDRKLLLTTILADG
FT                   INLGLTKMAESCPGTTKSSLEGIQAWYIRDETYSAALAELVNAQKKSPLAAFWGDGTTS
FT                   SSDGQNFRVGSHGRYAGQVNLKYGQDPSVQIYTHISDQYSPFYTKVISRVRDSTHVLDG
FT                   LLYHETDLEITEHYTDTAGFTEHVFALMHLLGFAFAPRIRDLHDKRLFIHGKAELYQGL
FT                   QSIISTTSLNLKEIETHWHEVLRLASSIKQGTVTASLMMKKLASYPKQNGLAKALREIG
FT                   RIERSLFMLDWFRDPLLRRRVQAGLNKGEARNALARAVFMHRLGEIRDRGLENQSYRAS
FT                   GLTLLTAAISLWNTVYIERAIDSLRRKGIPINEQLITHLSPLGWEHINLSGDYVWRTNL
FT                   KLGQGKYRALRSVNSNMYKKQA"
FT   gene            complement(33313..33945)
FT                   /locus_tag="KPN_pKPN3p05887"
FT   CDS_pept        complement(33313..33945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05887"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05887"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80266"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI44"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80266.1"
FT                   /translation="MIAFNHVVPVLNLSVFNVRRAPAFAFEQSKRATIGGRFIRVDESR
FT                   DLPLLHVVEDFTQKPVCSFAVTTGGEIKIDSAAPAVDGPVQIRPAAIDLHVGFIHVPRA
FT                   KIGRVTPVPAQPFFHFRRITLNPAVNRGVIDIHSAFSQHLLQLTVTDAVFAVPAYGPPN
FT                   DVTLKMPAFEWVHVQLHQQKGMISLSPPTICNSAKTITSDLKTESCY"
FT   gene            33406..34122
FT                   /locus_tag="KPN_pKPN3p05886"
FT   CDS_pept        33406..34122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05886"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05886"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80265"
FT                   /db_xref="GOA:A6TI45"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI45"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80265.1"
FT                   /translation="MELHMNPFKGRHFQRDIIRWAVRWYCKYGISYRELQEMLAERGVN
FT                   VDHSTIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSRGR
FT                   TVDFYLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCPSD
FT                   VEHRQIKYRNNVIECDHGKLKRIIGATLGFKSMKTAYATIKGIEVMRALRKGQASAFYY
FT                   GDPLGEMRLVSRVFEM"
FT   gene            complement(34316..34636)
FT                   /locus_tag="KPN_pKPN3p05888"
FT   CDS_pept        complement(34316..34636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05888"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05888"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80267"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI46"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80267.1"
FT                   /translation="MKQMTFADAEYAGKRKQTRKELFLIEMDRVVPWKGLIALIEPHYP
FT                   KGEGGRPAYPLMAMLRVHLLQNWFGYSDPAMEEALYETTILRQFAGLNLERIPDETTIC
FT                   WR"
FT   gene            34978..35805
FT                   /gene="ptxA"
FT                   /locus_tag="KPN_pKPN3p05889"
FT   CDS_pept        34978..35805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptxA"
FT                   /locus_tag="KPN_pKPN3p05889"
FT                   /product="ATP-binding protein of phosphonate ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05889"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80268"
FT                   /db_xref="GOA:A6TI47"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012693"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI47"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80268.1"
FT                   /translation="MMPHPIQDAVLRVDRLSVVYPGGVTALRDTSIAFRRGEFTVLLGL
FT                   SGAGKSTLLRSLNRLVTPTGGSVTSELGELGSGSALRQHRRRTAMIFQHHQLIERQSAL
FT                   ANVLTGRLAFHNTLRSLFPLPRADQEIALSCLARVGLADKALSRVDKLSGGQQQRVGIA
FT                   RALAQQPAIILADEPVASLDPATSVRVLGLLRDICKEDGITAIVSLHQLEYARRFADRV
FT                   VGLADSQIVFDAAPSELTDAQLERIYAGRSTTQPANTPAEPPVMLEPSLEMSR"
FT   gene            35802..36665
FT                   /gene="ptxB"
FT                   /locus_tag="KPN_pKPN3p05890"
FT   CDS_pept        35802..36665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptxB"
FT                   /locus_tag="KPN_pKPN3p05890"
FT                   /product="ABC-type phosphate/phosphonate transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05890"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80269"
FT                   /db_xref="GOA:A6TI48"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI48"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80269.1"
FT                   /translation="MKRLSALLLTCLLSAVSSLSALAADADPDVLKVALLPDENASELI
FT                   KRNQPLKDYLEEHLDKKVQLIVTTDYSSMIEAMRFGRIDLAYFGPLSYVMAKSKSDIEP
FT                   FAVTVIDGKPTYRSVIIANVASGVNEYADLKGKKMAYGDRASTSSHLIPKTVLLETAGL
FT                   TGGRDYEEYFVGTHDAVAVNVANGNADAGGLSEVIFNHVVERGLIDPSKVKVLGYSGEY
FT                   PQYPWAMRSNLSPELKTKVRDVFVGIDDPEVLRNFKAEAFAPITDADYDVIRKMGSLLG
FT                   LDFATM"
FT   gene            36662..37501
FT                   /gene="ptxC"
FT                   /locus_tag="KPN_pKPN3p05891"
FT   CDS_pept        36662..37501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptxC"
FT                   /locus_tag="KPN_pKPN3p05891"
FT                   /product="Phosphite transport system permease protein ptxC"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05891"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80270"
FT                   /db_xref="GOA:A6TI49"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005769"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI49"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80270.1"
FT                   /translation="MSTDMSTHYDVQALPAEQREHILRGFGLGWWRQLGQVAIVFGVVL
FT                   LACWYVGLLDATTLLNGLPSIATLAGEAMPPDFSGYRSWIRPLIDTLAMSIAGTAIAVV
FT                   FSLVVAFVAARNTAPHPLVFGVARVLLNALRSVPELIMGIIFVAAVGFGALPGVLALGL
FT                   HSVGMVSKFFAEAIEHVDEAPVEAARAAGATPMQVLLHAVLPQVTPQFADVAIYRWEYN
FT                   FRASTVMGMVGAGGIGFELMGSLRIMQYQEVAAILLVILAMVTLVDAFSGVLRKRFK"
FT   gene            37510..38520
FT                   /locus_tag="KPN_pKPN3p05892"
FT   CDS_pept        37510..38520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05892"
FT                   /product="Phosphonate dehydrogenase (NAD-dependent
FT                   phosphite dehydrogenase)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05892"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80271"
FT                   /db_xref="GOA:A6TI50"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI50"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80271.1"
FT                   /translation="MLPKLVITHRVHDEILQLLAPHCELVTNQTDSTLTREEILRRCRD
FT                   AQAMMAFMPDRVDADFLQACPELRVVGCALKGFDNFDVDACTARGVWLTFVPDLLTVPT
FT                   AELAIGLAVGLGRHLRAADAFVRSGEFQGWQPQFYGTGLDNATVGILGMGAIGLAMAER
FT                   LQGWGATLQYHEAKALDTQTEQRLGLRQVACSELFASSDFILLALPLNADTQHLVNAEL
FT                   LALVRPGALLVNPCRGSVVDEAAVLAALERGQLGGYAADVFEMEDWARADRPRLIDPAL
FT                   LAHPNTLFTPHIGSAVRAVRLEIERCAAQNIIQVLAGARPINAANRLPKAEPAAC"
FT   gene            38514..39383
FT                   /gene="ptxE"
FT                   /locus_tag="KPN_pKPN3p05893"
FT   CDS_pept        38514..39383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptxE"
FT                   /locus_tag="KPN_pKPN3p05893"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05893"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80272"
FT                   /db_xref="GOA:A6TI51"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI51"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80272.1"
FT                   /translation="MLNPVWLKSLVAIVQTGSFQSAARALGLAQPTVSQHLQKLEEQVG
FT                   VTLVQRSRSGCQPTTRALAFMPHATALLDMHARALEALHGNRERVGASTNIGTYLLQPF
FT                   VRNYLTTANERGEVDLRIAANPDVADQLLAGQLDAAIMEWWLPHPDFEHRLWRVEPLVL
FT                   IVSPDHALAEAGCIERDRLVDLPMLGGEPGSGTGRLLTEYFGELGVPRSGMQLGSTEAV
FT                   KQAVRAGLGVSLVMASAVQDEVRSGALVALPIPGLEKRLQLIWRKPPGNLHPPGFVRHL
FT                   LEEADLAG"
FT   gene            39491..40126
FT                   /locus_tag="KPN_pKPN3p05894"
FT   CDS_pept        39491..40126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05894"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05894"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80273"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI52"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80273.1"
FT                   /translation="MKQMTFADAEYAGKRKQTRKELFLIEMDRVVPWKGLIALIEPHYP
FT                   KGEGGRPAYPLMAMLRVHLLQNWFGYSDPAMEEALYETTILRQFAGLNLERIPDETTIL
FT                   NFRRLLEKHELAAGILAVINGSGRPRPVAAPGHHRRCNADQCAQFDQEQGRQARPGNAP
FT                   DQEGKPVLFRQCDLKVAWVSVPQVNARRNRLFHHSFPTQTGVAGNSRV"
FT   gene            complement(40592..41572)
FT                   /locus_tag="KPN_pKPN3p05895"
FT   CDS_pept        complement(40592..41572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05895"
FT                   /product="IS5 transposase"
FT                   /note="IS5 protein 11"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05895"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80274"
FT                   /db_xref="GOA:A6T555"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:A6T555"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80274.1"
FT                   /translation="MSHQLTFADSEFSTKRRQTRKEIFLSRMEQILPWQNMVEVIEPFY
FT                   PKAGNGRRPYPLETMLRIHCMQHWYNLSDGAMEDALYEIASMRLFARLSLDSALPDRTT
FT                   IMNFRHLLEQHQLARQLFKTINRWLAEAGVMMTQGTLVDATIIEAPSSTKNKEQQRDPE
FT                   MHQTKKGNQWHFGMKAHIGVDAKSGLTHSLVTTAANEHDLNQLGNLLHGEEQFVSADAG
FT                   YQGAPQREELAEVDVDWLIAERPGKVKTLKQHPRKNKTAINIEYMKASIRARVEHPFRI
FT                   IKRQFGFVKARYKGLLKNDNQLAMLFTLANLFRVDQMIRQWERSQ"
FT   gene            complement(41831..42334)
FT                   /locus_tag="KPN_pKPN3p05896"
FT   CDS_pept        complement(41831..42334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05896"
FT                   /product="IS1 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05896"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80275"
FT                   /db_xref="GOA:A6TI54"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI54"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80275.1"
FT                   /translation="MPGNRPHYGRWPQHDFTSLKKLRPQSVTSRIQPGSDVIVCAEMDE
FT                   QWGYVGAKSRQRWLFYAYDRIRRTVVAHVFGERTLSTLERLLGLLSAFEVVVWMTDGWP
FT                   LYESRLKGELHVISKRYTQRIERHNLNLRQHLARLGRKSLSFSKSVELHDKVIGHYLNI
FT                   KHYQ"
FT   gene            complement(42774..43037)
FT                   /locus_tag="KPN_pKPN3p05897"
FT   CDS_pept        complement(42774..43037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05897"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05897"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80276"
FT                   /db_xref="GOA:A6TI55"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI55"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80276.1"
FT                   /translation="MRPQRRTYSKSFKAQVIQECSEPGASIANIALGYSLNANLDHKWI
FT                   RLPTQKTTAIQPAFIPLPSQMLGVGSHTQARCCDHEFDPVGP"
FT   gene            43875..44444
FT                   /locus_tag="KPN_pKPN3p05898"
FT   CDS_pept        43875..44444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05898"
FT                   /product="Molecular chaperone (small heat shock protein)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05898"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80277"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI56"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80277.1"
FT                   /translation="MDIDFKKLAPWNWFKNEQQEQQTVSSLPVQRNDLPAASGPVSPIL
FT                   QLHREIDRLFDDAFRGFGFPALNMPQWPSDWSGMLKPALDIQETDKQYKIALEVPGVEE
FT                   KDIQITLDNDVLMVRGEKRQEQEKKEGGFHRVERSYGSFQRALNLPDDANQDSIKASFK
FT                   NGVLTVTIDKREVSAPKQGRSIPING"
FT   gene            44559..47354
FT                   /locus_tag="KPN_pKPN3p05899"
FT   CDS_pept        44559..47354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05899"
FT                   /product="ATPase with chaperone activity, ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05899"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80278"
FT                   /db_xref="GOA:A6TI57"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI57"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80278.1"
FT                   /translation="MARKQCQVCGQPATVRVEANLNGRHSTMLLCDDHYRQLVRQQKRT
FT                   VSPLEALFGSRSGLFEDFLGSDFFRIGDDATPVAADTDDVVDASFGEPAAAGSGAPRRR
FT                   GSGLASRISEQSEALLQEAAKHAAEFGRSEVDTEHLLLALADSDVVKTILGQFKIKVDD
FT                   LKRQIESEAKRGDKPFEGEIGVSPRVKDALSRAFVASNELGHSYVGPEHFLIGLAEEGE
FT                   GLAANLLRRYGLTPQALRQQVSKVVGKGAEDGRAETPTNTPELDKYSRDLTKMARDGKL
FT                   DPVIGRAQEIETTIEVLARRKKNNPVLIGEPGVGKTAIVEGLAQRMVAGEVPETLRDKR
FT                   LVELNINAMVAGAKYRGEFEERVQKVLKEVTEHQGELILFIDEVHTIVGAGQGGGEGGL
FT                   DVANVFKPMMARGELNLIGATTLNEYQKYIEKDAALERRFQPVTVPEPTVAQAIMILRG
FT                   LRDTFEAHHKVSISEDAIIAAAELSDRYITARFLPDKAIDLLDQAAARVKLSATARPVA
FT                   VQELESELHQLRREQDYVAARKQYDQAAELGKRIEAKEAELKKLVEDWERERASGSAEV
FT                   KAEHVAQIVSRLTGIPVNELTVEEREKLLHLEQRLHERLVGQDEAVRAVADAVRLSRAG
FT                   LREGSKPVATFLFLGPTGVGKTELAKALAESIYGDEHALLRIDMSEYGERHTVARLVGA
FT                   PPGYVGYDEGGQLTEKVRRKPYSVLLLDEIEKAHPDVYNILLQVFDDGRLTDGKGRVVD
FT                   FTNTIIIATSNLGSDIIQRRLKARGAAGEEYEKTKAGVMDVLRGHFRPEFLNRIDEIIV
FT                   FHALGKEEIRHIVGLQLDRVARSAASQGVTLTFDQTLIDHFAEEGYKPEFGARELKRLI
FT                   RSELETALAREMLGGGIGKGDHASARWDDKAERVVFERKEPPQTPAEPEQPDAAKASDA
FT                   S"
FT   gene            47354..47551
FT                   /locus_tag="KPN_pKPN3p05900"
FT   CDS_pept        47354..47551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05900"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05900"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80279"
FT                   /db_xref="GOA:A6TI58"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI58"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80279.1"
FT                   /translation="MAGEAAVSDPIGLALAWAASLASIAVAVVAAGHAGVYKRDEQSAT
FT                   PWGLLISGGTALPLAGHPFA"
FT   gene            47789..48538
FT                   /locus_tag="KPN_pKPN3p05901"
FT   CDS_pept        47789..48538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05901"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05901"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80280"
FT                   /db_xref="GOA:A6TI59"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI59"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80280.1"
FT                   /translation="MLLEAASIEGAQVWAERFRQDTAATAVVCGEVSISYSASMGGALL
FT                   DPRLHSVEQVMLQADSALYQAKKTRVQPSCGRTSISELRGVAMKEKQADPIKTFRAQWA
FT                   VMTFYERFEQVIALALSAIIAVIIVVSLLQLISIVFSLLIIDAFNPLDHKVFQTVFGMI
FT                   MTLLIAMEFKHSIVRVALRRDSIIQVKTVILIGLIALARKFVILDPETGPAKVAALAGA
FT                   TLALGATYWLLRERDDRTAGESSDDQS"
FT   gene            48525..48731
FT                   /locus_tag="KPN_pKPN3p05902"
FT   CDS_pept        48525..48731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05902"
FT                   /product="Zn-dependent protease with chaperone function"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05902"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80281"
FT                   /db_xref="GOA:A6TI60"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI60"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80281.1"
FT                   /translation="MISRDLRHAQNVGARHRWHNRLQTVLLVLTLLGIAAVAGSLLLGD
FT                   GGLWLALAAAGFTLLLEPAAAPG"
FT   gene            48734..49486
FT                   /locus_tag="KPN_pKPN3p05903"
FT   CDS_pept        48734..49486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05903"
FT                   /product="Zn-dependent protease with chaperone function"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05903"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80282"
FT                   /db_xref="GOA:A6TI61"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI61"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80282.1"
FT                   /translation="MRLYGARPLHPDEAPDLWAVLRELAARAGLPTVPVPHYVPSGVVN
FT                   AFATGSKHHAAIALTDGLLRSLTPRELTGVLGHEIAHIANEDLRVMGLADSISRLTHLL
FT                   ALLGQLAIVLSLPTLLLGVTEVNWPALLLLAVAPQLALLAQLGLSRVREFDADRLAAEL
FT                   TGDPHGLASALAKIERVSRSWRAWLLPGWGNPEPSWLRTHPATAERIERLLELAPPPAM
FT                   PPFPSARFDPEVTVSPRPPRWRTGGLWR"
FT   gene            49801..50106
FT                   /locus_tag="KPN_pKPN3p05904"
FT   CDS_pept        49801..50106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05904"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05904"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80283"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI62"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80283.1"
FT                   /translation="MRKRKSAPQDKNQDALLGEIQRLRKQVHQLQLERDILTKANELIK
FT                   KDLGVSFLKLKNREKTLIVDALKKKYPVAELLSVLQLARSCYFYQNVCTISMRKYA"
FT   gene            50055..50828
FT                   /locus_tag="KPN_pKPN3p05905"
FT   CDS_pept        50055..50828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05905"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05905"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80284"
FT                   /db_xref="GOA:A6TI63"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI63"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80284.1"
FT                   /translation="MLFLPKRLYDKYAEIRVIMADIFEENYRCYDYRRLHAMLRGNNRV
FT                   ISEKVVRRLMAEEQLVVKRTRRRRYNSYCGEIGPAPENLLARDFSSCRPNEKWLTDITE
FT                   FQLPAGKVYLSPVIDCFDGLVVSWSIGTRPDATLVNTMLDDALDTLNEHDKPVIHSDRG
FT                   GHYRWPGWLERINTSGLIRSMSRKGCSSDNAACEGFFGRIKNEMFYGRDWAGITLEKFI
FT                   CFLDRYIRWYNEKRIKLSLGAMSPVKYRQHLGITT"
FT   gene            complement(51329..52687)
FT                   /locus_tag="KPN_pKPN3p05906"
FT   CDS_pept        complement(51329..52687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05906"
FT                   /product="Sea24"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05906"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80285"
FT                   /db_xref="GOA:A6TI64"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI64"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80285.1"
FT                   /translation="MLVTMSDKELSRINIIQSVVEKRMRRRDAAHQLALTERQTQRLMN
FT                   RFRESGAAGLANLRRGRPGNHRLPESLKLRVLSLLHDHYSDFGPTLAAEKLRERHNITV
FT                   SVETLRKWMTADGLWVPYSRRRPRVHQPRYRRDCLGELVQIDGSPHDWFEGRAPKCCLL
FT                   VFIDDATGRLMHLRFGETESAFDYMMATRAYLEQHGKPLAFYSDKHGIFRVNNGGTTTT
FT                   GITQFGRVLSELGIELICANSPQAKGRVERANQTLQDRLIKEMRLEGISSIEDANAWLD
FT                   SFIIDFNRRFARPAKYPKDLHRPVLESSEDLDDIFAWQESRKLSKTLTFRYDKMIYLVE
FT                   PTEENTRIAGEKITVYDYPNGTLAFKYGYRSLNYQVFDKLECIDQGQIVDNKRLGAVLK
FT                   LAQDKMDELDREGKRDRSKKMPKRRAQARVQEQLRAINPVLANPEEFRASLKR"
FT   gene            52893..53537
FT                   /locus_tag="KPN_pKPN3p05907"
FT   CDS_pept        52893..53537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05907"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05907"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80286"
FT                   /db_xref="UniProtKB/TrEMBL:A6T973"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80286.1"
FT                   /translation="MIEPMLRYELTPNNAGFILWGDSEALNELHELIHYIVDESPLIKV
FT                   KDGFMLSLAYDIRKAREGNRRVEQHQYDQHDTYKLYGVELLWPLVLVQSSILRNSMGYI
FT                   QTDKNQLSVMYAFEYLIESALTESERTTSNDIMLTVKYASDSDFNFIEDNIDSRCCYFI
FT                   SLSPEQRKKQLISIVRSFHSLWGKYAREKQDIKMLNEMNNTSWVWPDNINW"
FT   gene            complement(53566..54969)
FT                   /locus_tag="KPN_pKPN3p05908"
FT   CDS_pept        complement(53566..54969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05908"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05908"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80287"
FT                   /db_xref="GOA:A6TI66"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI66"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80287.1"
FT                   /translation="MSAESSGVFTLKEINRIKIIQDVIERRITTRRAAEHLGISDRQCR
FT                   RLLARYREGGPLGMASRRCGMRGNRQLPPGLADQALELIKTRYADFGPTLAREKLEELH
FT                   GLFLGKETVRRIMVRAGLWVPRKQRAARIPQPRYRRPCTGELIQIDGCDHDWFEGRGPA
FT                   CTALVYVDDATSKLMELLFVKSESTFSYFEATRRYIDKHGKPLALYSDKAGVFRVNNKH
FT                   ATGGDGHTQFGRAMHELNIQTICAETSPAKGRVERAHLTLQDRLVKELRLQGICSMEAA
FT                   NDFAEAYMADYNRRFGKVPRHDFDVHRAVEHDEDLGLIFTVREKRKVSKSLTIQYDKML
FT                   YLIEDSELSRRAIGKYIDVYHYPDGRKELRLNGTLLPYSTYDRLSEIDQGAIVDNKRLG
FT                   RTLEFISLVQSKRDNTRSQSIPAGDGPSRRRPKQEGKKSQRSLDNDDMLEALKQLQSRS
FT                   EDIFGKRAR"
FT   gene            complement(55051..55173)
FT                   /locus_tag="KPN_pKPN3p05909"
FT   CDS_pept        complement(55051..55173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05909"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05909"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80288"
FT                   /db_xref="GOA:A6TI67"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI67"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80288.1"
FT                   /translation="MTGCWNGKVAGYRLNILIFMLFILIFNIIFVMRTCIVMAQ"
FT   gene            complement(55170..55652)
FT                   /locus_tag="KPN_pKPN3p05910"
FT   CDS_pept        complement(55170..55652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05910"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05910"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80289"
FT                   /db_xref="GOA:A6TI68"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI68"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80289.1"
FT                   /translation="MGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAART
FT                   FVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNMPDPIPVIILARLAVDVSLHGKGVG
FT                   ADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP"
FT   gene            complement(55640..55906)
FT                   /locus_tag="KPN_pKPN3p05911"
FT   CDS_pept        complement(55640..55906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05911"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05911"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80290"
FT                   /db_xref="GOA:A6TI69"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR014795"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI69"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80290.1"
FT                   /translation="MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENV
FT                   ILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLLARKPQWDV"
FT   gene            complement(56082..56336)
FT                   /locus_tag="KPN_pKPN3p05912"
FT   CDS_pept        complement(56082..56336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05912"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05912"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80291"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI70"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80291.1"
FT                   /translation="MTGRGINTVRIGDEVKHITELDALTLMHEWSKLKKENADLYDYNG
FT                   QVNRGWRGFILRMMGIHLPDNDRVRLQGINARKDSIYPE"
FT   gene            complement(56412..56669)
FT                   /locus_tag="KPN_pKPN3p05913"
FT   CDS_pept        complement(56412..56669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05913"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05913"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80292"
FT                   /db_xref="GOA:A6TI71"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI71"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80292.1"
FT                   /translation="MNMIFELIGLLLVVGCAFFTTFFLAAVAGTMVVIFGWGISIVTPK
FT                   LVTCTNDCITTVFDAKPFGWLLIVFSLTMMFFIIRGMIKR"
FT   gene            complement(56955..57287)
FT                   /locus_tag="KPN_pKPN3p05914"
FT   CDS_pept        complement(56955..57287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05914"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05914"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80293"
FT                   /db_xref="GOA:A6TI72"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI72"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80293.1"
FT                   /translation="MCFLLFTGWIFAFAQYAPYNGQEHAFSLTYLLNLFFLHVVMVPYY
FT                   EFFQTEIYSNVLMSLADESGQMIRFHHVVPVLGIYSLSALLTFVGYIIYAKWFTHNRLK
FT                   GNLLPK"
FT   gene            complement(57367..57861)
FT                   /locus_tag="KPN_pKPN3p05915"
FT   CDS_pept        complement(57367..57861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05915"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05915"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80294"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI73"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80294.1"
FT                   /translation="MKVTEPGLNTLIDNLNTLICEDSLLTRQERETLVRAVAAIGAMKA
FT                   RVSMKKGEAPTVARREKREKKDRQPDPRFPRAGHPWQEDEKTLLSDALEPVPDEEIGTH
FT                   LFWLSEKLGRTPFSVAFQIAAIRELQDGWEEQFREISDKIRLSGLSISDYLKQNGTGHN
FT                   A"
FT   gene            complement(57892..58467)
FT                   /locus_tag="KPN_pKPN3p05916"
FT   CDS_pept        complement(57892..58467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05916"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05916"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80295"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI74"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80295.1"
FT                   /translation="MAAVTTSRRPSPLQRRVLIVLAALDAKRPGPVATRDIERVLEQGG
FT                   DAPVYGPNLRASCRRMEAAGWLRTLRAPNLQLAVELTEAGRGIAEPLFQAEREAETARQ
FT                   RLTDVRRLPLRQTAAGDAVELQLGDGHYTIREAAYVIRLDGTTCLQLTDAGGIRRIKEG
FT                   DPLQVASWYQACFDAGLPVIVQVNESRD"
FT   gene            complement(58455..58724)
FT                   /locus_tag="KPN_pKPN3p05917"
FT   CDS_pept        complement(58455..58724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05917"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05917"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80296"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI75"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80296.1"
FT                   /translation="MDEKVFFHLSYETMLGDTEDFINACLERANRADCNDADAEIARAR
FT                   SAIELWYHLAMAGRAPEDVADRDHLRLTGMLLRAPTAEQRSWQQ"
FT   gene            59082..59432
FT                   /gene="arsR"
FT                   /locus_tag="KPN_pKPN3p05918"
FT   CDS_pept        59082..59432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsR"
FT                   /locus_tag="KPN_pKPN3p05918"
FT                   /product="arsR"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05918"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80297"
FT                   /db_xref="GOA:A6TI76"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI76"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80297.1"
FT                   /translation="MPLTALKLFKNLSDETRLGIVLLLRELGELCVCDFCTALDESQPK
FT                   ISRHLAMLRESGLLLDRKQGKWVHYRLSPHIPSWAAQVIEQAWLSQQDDVQAIARKLAS
FT                   ANCSGSGKAVCI"
FT   gene            59482..59844
FT                   /gene="arsD"
FT                   /locus_tag="KPN_pKPN3p05919"
FT   CDS_pept        59482..59844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsD"
FT                   /locus_tag="KPN_pKPN3p05919"
FT                   /product="ArsD"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05919"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80298"
FT                   /db_xref="GOA:A6TI77"
FT                   /db_xref="InterPro:IPR010712"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI77"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80298.1"
FT                   /translation="MKTLTVFDPAMCCSTGVCGSDVDQVLVDFSADMQWLKGRGVQVER
FT                   YNLAQQPMSFVHNEKAKAFLDASGAEGLPLLLLDGETVMAGRYPKRAELARWFGIPLEK
FT                   VGLAPTSCCGGNTSCC"
FT   gene            59862..61613
FT                   /gene="arsA"
FT                   /locus_tag="KPN_pKPN3p05920"
FT   CDS_pept        59862..61613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsA"
FT                   /locus_tag="KPN_pKPN3p05920"
FT                   /product="Arsenical pump-driving ATPase
FT                   (Arsenite-translocating ATPase)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05920"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80299"
FT                   /db_xref="GOA:A6TI78"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027541"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI78"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80299.1"
FT                   /translation="MKLLQNIPPYLFFTGKGGVGKTSISCATAIHLAEQGKRVLLVSTD
FT                   PASNVGQVFDLAIGNTIRPVTAVPGLSALEIDPQEAARQYRARIVDPIKGLLPDDVVNS
FT                   ISEQLSGACTTEIAAFDEFTGLLTDASLLTRFDHIIFDTAPTGHTIRLLQLPGAWSSFI
FT                   ESNPDGASCLGPMAGLEKQREQYAHAVEALSDPERTRLVLVARLQNSTLQEVARTHEEL
FT                   AEIGLKNQYLVINGVLPEAEAEHDALAAAIWQREQEALANLPAGLSELPTDTLLLQPVN
FT                   MVGVSALKGLLATRSEALPLPVTNILYTPENLSLSGLVDDIARSEHGLIMLMGKGGVGK
FT                   TTMAAAIAVRLADMGFDVHLTTSDPAAHLSTTLNGSLKNLQVSRINPHDETERYRQHVL
FT                   ETKGRDLDEAGKRLLEEDLRSPCTEEIAVFQAFSRVIREAGKRFVVMDTAPTGHTLLLL
FT                   DATGAYHREIAKKMGSKGHFTTPMMQLQDPDRTKVLLVTLPETTPVLEAANLQADLERA
FT                   GIHPWGWIINNSLSIADTRSPLLCQRAQQELPQIEAVKNQHADRIALVPVLASEPAGIE
FT                   KLRELMS"
FT   gene            61661..62950
FT                   /gene="arsB"
FT                   /locus_tag="KPN_pKPN3p05921"
FT   CDS_pept        61661..62950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsB"
FT                   /locus_tag="KPN_pKPN3p05921"
FT                   /product="ArsB"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05921"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80300"
FT                   /db_xref="GOA:A6TI79"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI79"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80300.1"
FT                   /translation="MLLAGAIFVLTIVLVIWQPKGLGIGWSAMLGAGLALISGVVHVGD
FT                   IPVVWNIVWNATATFIAVIIISLLLDESGFFEWAALHVSRWGNGRGRLLFTYIVLLGAA
FT                   VAALFANDGAALILTPIVIAMLLALGFSKGTTLAFVMAAGFIADTASLPLIVSNLVNIV
FT                   SADFFGLGFTEYASVMVPVDIAAIVATLVMLHLFFRKDIPPTYDLALLKAPAKAIKDLA
FT                   TFRTGWIVLILLLVGFFVLEPLGIPVSAIAAVGAVILFAVAKRGHAIKTGKVLRGAPWQ
FT                   IVIFSLGMYLVVYGLRNAGLTEYLSGVLNVLADKGLWAATLGTGFLTAFLSSIMNNMPT
FT                   VLVGALSIDGSTATGVIKEAMIYANVIGCDLGPKITPIGSLATLLWLHVLSQKNMTITW
FT                   GYYFRTGIVMTLPVLFVTLAALALRLSFTL"
FT   gene            62963..63388
FT                   /gene="arsC"
FT                   /locus_tag="KPN_pKPN3p05922"
FT   CDS_pept        62963..63388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsC"
FT                   /locus_tag="KPN_pKPN3p05922"
FT                   /product="Arsenate reductase (Arsenical pump modifier)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05922"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80301"
FT                   /db_xref="GOA:A6TI80"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI80"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80301.1"
FT                   /translation="MSNITIYHNPACGTSRNTLEMIRNSGNEPTVIHYLENPPSRDELV
FT                   KLIADMGISVRALLRKNVEPYEELGLEEDKFTDDQLIDFMLQHPILINRPIVVTPLGTR
FT                   LCRPSEVVLDILPDAQKGAFAKEDGEKVVDEAGKRLK"
FT   gene            complement(63421..63957)
FT                   /locus_tag="KPN_pKPN3p05923"
FT   CDS_pept        complement(63421..63957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05923"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05923"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80302"
FT                   /db_xref="GOA:A6TI81"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI81"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80302.1"
FT                   /translation="MHIINAEEQHIPAIRRIYAHHVLHGTGSFETEPPDTQEMLARVKN
FT                   VQSRGFPWYIALQGETVIGYCYLSRYRERHAYRFTVENSVYIDPAYQRQGGGKALLDHA
FT                   LTWARSQGYRQMIAVVGDSANVASVALHLRAGFTEIGTLKDIGFKHGRWLDTVLLQRQL
FT                   GKGSCTLPDSPVPGR"
FT   gene            complement(65854..66216)
FT                   /gene="arsD"
FT                   /locus_tag="KPN_pKPN3p05924"
FT   CDS_pept        complement(65854..66216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsD"
FT                   /locus_tag="KPN_pKPN3p05924"
FT                   /product="ABC-type phosphate/phosphonate transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05924"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80303"
FT                   /db_xref="GOA:A6TI82"
FT                   /db_xref="InterPro:IPR010712"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI82"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80303.1"
FT                   /translation="MSKIEIFEAAGCCATSSVVVSDEAVKWNASAEWAKKHGVNIQRYS
FT                   LAKNPQQFLNTPVIRAFLNTSGMESLPATLLDGQLVMAGKLPSREDIARWAGISLTQDW
FT                   NEDSTQPRCCSIPRMP"
FT   gene            complement(66292..66849)
FT                   /locus_tag="KPN_pKPN3p05925"
FT   CDS_pept        complement(66292..66849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05925"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05925"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80304"
FT                   /db_xref="GOA:A6TI83"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI83"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80304.1"
FT                   /translation="MRAGMSDVTAFNNCMSVFWQQHEAELSRFLASRTGDREQAADLLQ
FT                   EVFLRARACADRFCEMENPRAWLYRTARNLLTDEYRAARDVVVLEDEIPLPDAFHEAVS
FT                   TLEICLPETLQALPDEERWLIEEADLNRRPQQRLADELGITLTAFKSRLLRARKHLKKT
FT                   MTELCQVEVDDASSVCCHKKMD"
FT   gene            complement(66846..67559)
FT                   /gene="arsH"
FT                   /locus_tag="KPN_pKPN3p05926"
FT   CDS_pept        complement(66846..67559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsH"
FT                   /locus_tag="KPN_pKPN3p05926"
FT                   /product="arsH"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05926"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80305"
FT                   /db_xref="GOA:A6TI84"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR014063"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI84"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80305.1"
FT                   /translation="MIAELKNVVPELFDTGRTGVRLGVKTVDHPPRILMLYGSVRERSY
FT                   SRLATEEAARLLTAMGADVRIFNPSGLPLPDDAADTHPRVMELREMVRWSEGMVWCSPE
FT                   RHGAMTGIMKAQIDWIPLSEGAVRPSQGKTLAVMQVCGGSQSFNAVNQMRILGRWMRMI
FT                   TIPNQSSVAKAWQEFDEDGRMKPSPYYDRIVDVMEELMKFTLLTREYAAYLVDRYSERK
FT                   ESAEALSRRVNQSKI"
FT   gene            complement(67556..67882)
FT                   /locus_tag="KPN_pKPN3p05927"
FT   CDS_pept        complement(67556..67882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05927"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05927"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80306"
FT                   /db_xref="GOA:A6TI85"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI85"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80306.1"
FT                   /translation="MELKIAAMVLKELGHTTRLDIYKTLVKAGRQGLPVGELQQHLAIP
FT                   ASTLSHHLSSLISVSLVRQERQGRTLFCHACYDNLAALIAFLTEECCADEYAPPGFMSP
FT                   PEKK"
FT   gene            68184..68711
FT                   /locus_tag="KPN_pKPN3p05928"
FT   CDS_pept        68184..68711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05928"
FT                   /product="N-acetyltransferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05928"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80307"
FT                   /db_xref="GOA:A6TI86"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI86"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80307.1"
FT                   /translation="MNTANIRYREMAEIIIRKMHEEDWCAVREIYQEGIATGNATFQTA
FT                   APEWLEWNEGHLQDCRYVATVDNRVVGWAALSPFSRRHAYRGVAELSIYVSTHFQGKGA
FT                   GRALLSGLIKGSESAGFWTLLAGIFPENQASVALHRSQGFREVGCRENVGEMNGKWRDV
FT                   LILERRSRTVGC"
FT   gene            complement(68761..69165)
FT                   /locus_tag="KPN_pKPN3p05929"
FT   CDS_pept        complement(68761..69165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05929"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05929"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80308"
FT                   /db_xref="GOA:A6TI87"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR034294"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI87"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80308.1"
FT                   /translation="MNYIVAQLLGAGAAALCLKAVFGHSLLAGVTRVHMGVSLYNAFFI
FT                   EGVMTFILIMSILTTRNPAIISIAVFLDAFIGGPLTGASMNPARSFGPALAMGYWDNQW
FT                   LYWAAPLSGGLAAVACCQLFMPQLKSPSPE"
FT   gene            69332..70147
FT                   /locus_tag="KPN_pKPN3p05930"
FT   CDS_pept        69332..70147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05930"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05930"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80309"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI88"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80309.1"
FT                   /translation="MYNKMASLKRLLQLPRGWQTCRQITGTDGITLHLRATRKTASCPE
FT                   CLTHSHSVHSCRRRRVQHLPCSGQALWLVFAIRHWYCRNPSCSRKIFAESLAPFAGPQQ
FT                   QSSALLKNLQHQLGLIAGGEAGRRAAVASGIQISADTLLRRVVQAPEQTENRTRHVGID
FT                   EWAWHRGHRYGTLIVNLDTHRPLVLLPGREQRTLAAWFKKYPEIQVVSRDRGGIYALAA
FT                   RDGAPQAIQVADRWHLLKNIGDALERMMYRHMPLIRLVATELSPQKTEC"
FT   gene            70155..70952
FT                   /locus_tag="KPN_pKPN3p05931"
FT   CDS_pept        70155..70952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05931"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05931"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80310"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI89"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80310.1"
FT                   /translation="MVPTSTLRRPERIKREQRDKRYQRWAEVDSLHKKGCGIREISRIT
FT                   GLSRVTVRRWIQSKAFPEISTKPPRPGLLEPWQEWLEEQRINGNHNAGQLWREMVNAGF
FT                   TGSETTVRDAVAKWRKQVNSPVIAPVRLPSASRVSRWLMPWRMIRGEENYASRFIESMC
FT                   QKEPQLKMAQQLSLDFYRMLKTKNKSQLNQWFSDVSQSGLIDLQRVAAGMEADATAIHE
FT                   AISSRWSNGVVEGHVNRLKMLKRQMYGRAGFELLRRRVMSPLA"
FT   gene            71013..71192
FT                   /locus_tag="KPN_pKPN3p05932"
FT   CDS_pept        71013..71192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05932"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05932"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80311"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI90"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80311.1"
FT                   /translation="MFDVLAMHDIGTHRAELGDNICSLPVEQHMIYFVSSHSVVTIIRI
FT                   LSQSQDTARHEPWI"
FT   gene            complement(71424..71858)
FT                   /locus_tag="KPN_pKPN3p05933"
FT   CDS_pept        complement(71424..71858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05933"
FT                   /product="probable copper-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05933"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80312"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI91"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80312.1"
FT                   /translation="MKKILVSFVAIMAVASSAMAAETMNMHDQVNNAQAPAHQMQSTSE
FT                   KSAVQGDSMTMMDMSGHDQAAMTHEMMQNGNASAHQDMAEMHKKMMKSKPAASNETAKS
FT                   FSEMNEHEKAAVVHEKANNGQSSVIHQQQAEKHRSQITQN"
FT   gene            complement(72075..74252)
FT                   /pseudo
FT                   /gene="pcoS"
FT                   /locus_tag="KPN_pKPN3p05934"
FT                   /note="interrupted by a transposon; copper resistant sensor
FT                   kinase PcoS"
FT   gene            73403..73906
FT                   /locus_tag="KPN_pKPN3p05935"
FT   CDS_pept        73403..73906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05935"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05935"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80314"
FT                   /db_xref="GOA:A6TI92"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI92"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80314.1"
FT                   /translation="MPCHRTTNGRGPQHHFAPFKKLRPQSVTSRIQPGSDVIVCAEMDE
FT                   QWGYVGAKSRQRWLFYAYDRIRRAVVAHVFGERTMATLERLLSLLSVFDVVVWMTDGWP
FT                   MYESRLKGKLHVISKRYTQRIERHNLNLRQHLARLGRKSLSFSKSVELHDKVIGHYLNI
FT                   KHYQ"
FT   gene            complement(74249..74929)
FT                   /gene="pcoR"
FT                   /locus_tag="KPN_pKPN3p05937"
FT   CDS_pept        complement(74249..74929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcoR"
FT                   /locus_tag="KPN_pKPN3p05937"
FT                   /product="transcriptional regulatory protein PcoR"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05937"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80316"
FT                   /db_xref="GOA:A6TI93"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006291"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI93"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80316.1"
FT                   /translation="MQRILIVEDEQKTGRYLQQGLVEEGYQADLFNNGRDGLGAASKGQ
FT                   YDLIILDVMLPFLDGWQIISALRESGHEEPVLFLTAKDNVRDKVKGLELGADDYLIKPF
FT                   DFTELVARVRTLLRRARSQAATVCTIADMTVDMVRRTVIRSGKKIHLTGKEYVLLELLL
FT                   QRTGEVLPRSLISSLVWNMNFDSDTNVIDVAVRRLRSKIDDDFEPKLIHTVRGAGYVLE
FT                   IREE"
FT   gene            complement(74984..75913)
FT                   /gene="pcoD"
FT                   /locus_tag="KPN_pKPN3p05938"
FT   CDS_pept        complement(74984..75913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcoD"
FT                   /locus_tag="KPN_pKPN3p05938"
FT                   /product="copper resistant protein PcoD"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05938"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80317"
FT                   /db_xref="GOA:A6TI94"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI94"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80317.1"
FT                   /translation="MNDLIMIVIRFLLYLDLMVIFGLPFFQIYGISGVRHETYNLTNFR
FT                   SFITFAVVTGIILTGINMLLVSNAMSGVTDLRELSIHVIEMVIEETDVGISWIVRLCAL
FT                   FTTLGALFLYTNKRVLSCLLMTMSGGVALATLAWGGHAVMHDGLHYYLHLLSDLTHLGA
FT                   AGAWTGALVAFAILLMRRNEHNAQSVIVISDSLAKFATAGTVIVVALILSALVNYLYIA
FT                   EGNLTPLFNSSWGRILLAKTALFVLMLLLAAANRFHLGPRLEVMVREGNYDRSVALMRN
FT                   SILTEFVVAIIILGAVAWLGMLAPSQIS"
FT   gene            complement(75918..76298)
FT                   /gene="pcoC"
FT                   /locus_tag="KPN_pKPN3p05939"
FT   CDS_pept        complement(75918..76298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcoC"
FT                   /locus_tag="KPN_pKPN3p05939"
FT                   /product="copper resistant protein PcoC"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05939"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80318"
FT                   /db_xref="GOA:A6TI95"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI95"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80318.1"
FT                   /translation="MSILNKAILTGGLVMGVAFSAMAHPELKSSVPQADSAVAAPEKIQ
FT                   LNFSENLTVKFSGAKLTMTGMKGMSSHSPMPVAAKVAPGADPKSMVIIPREPLPAGTYR
FT                   VDWRAVSSDTHPITGNYTFTVK"
FT   gene            complement(76338..77237)
FT                   /gene="pcoB"
FT                   /locus_tag="KPN_pKPN3p05940"
FT   CDS_pept        complement(76338..77237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcoB"
FT                   /locus_tag="KPN_pKPN3p05940"
FT                   /product="copper resistant protein PcoB"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05940"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80319"
FT                   /db_xref="GOA:A6TI96"
FT                   /db_xref="InterPro:IPR007939"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI96"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80319.1"
FT                   /translation="MMRMKRNLKAIPVLVAGLFTSQLSIAAGSVSADPHAGHDMSAMQM
FT                   PADENFTEMTSMEPIVTESRTPIPPVTDADRKAAFGNLQGHAIHDSAINYLVLLDQLEW
FT                   QRSDNTNNFSWSVNSWIGGDTDRIWLKSEGERSNGETEAAEAQLLWGHAVGPWWDLVAG
FT                   VRQDFRPASARTWAAVGFQGLALYNFESEITGFVSNGGKAALRLGGEYDVLLTNRLILQ
FT                   PSYEVNFYSQDDESRGRGRGLTDTELGLRLRYEIRREFAPYIGVSWNQLYGKTSDMAKR
FT                   EGEKDHQVVFLAGARIWF"
FT   gene            complement(77234..79051)
FT                   /gene="pcoA"
FT                   /locus_tag="KPN_pKPN3p05941"
FT   CDS_pept        complement(77234..79051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcoA"
FT                   /locus_tag="KPN_pKPN3p05941"
FT                   /product="copper resistant protein PcoA"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05941"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80320"
FT                   /db_xref="GOA:A6TI97"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006376"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="InterPro:IPR034279"
FT                   /db_xref="InterPro:IPR034282"
FT                   /db_xref="InterPro:IPR034284"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI97"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80320.1"
FT                   /translation="MLLKTSRRTFLKGLTLSGVAGSLGVWSFNARSSLSLPVAASLQGT
FT                   QFDLTIGETAVNITGSERQAKTINGGLPGPVLRWKEGDTITLKVKNRLNEQTSIHWHGI
FT                   ILPANMDGVPGLSFMGIEPDDTYVYTFKVKQNGTYWYHSHSGLQEQEGVYGAIIIDARE
FT                   PEPFAYDREHVVMLSDWTDENPHSLLKKLKKQSDYYNFNKPTVGSFFRDVNTRGLSATI
FT                   ADRKMWAEMKMNPTDLADVSGYTYTYLMNGQAPLKNWTGLFRPGEKIRLRFINGSAMTY
FT                   FDIRIPGLKMTVVAADGQYVNPVTVDEFRIAVAETYDVIVEPQGEAYTIFAQSMDRTGY
FT                   ARGTLATREGLSAAVPPLDPRPLLTMEDMGMGGMGHDMAGMDHSQMGGMDNSGEMMSMD
FT                   GADLPDSGTSSAPMDHSSMAGMDHSRMAGMPGMQSHPASETDNPLVDMQAMSVSPKLND
FT                   PGIGLRNNGRKVLTYADLKSRFEDPDGREPGRTIELHLTGHMEKFAWSFNGIKFSDAAP
FT                   VLLKYGERLRITLINDTMMTHPIHLHGMWSDLEDENGNFMVRKHTIDVPPGTKRSYRVT
FT                   ADALGRWAYHCHLLYHMEMGMFREVRVEE"
FT   gene            79285..79734
FT                   /gene="pcoE"
FT                   /locus_tag="KPN_pKPN3p05942"
FT   CDS_pept        79285..79734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcoE"
FT                   /locus_tag="KPN_pKPN3p05942"
FT                   /product="copper resistant protein PcoE"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05942"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80321"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI98"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80321.1"
FT                   /translation="MNILITTTAFTALFCGAAFAQSSDIAHEAHRFVNNASAVSHVNSS
FT                   THENLPDRVNKNNTPSFSEMNEHERAIVAHSFMNNSASYAHQKMIEEHKKMLSGSDANS
FT                   KTSSSSFNELNAGEKAALVHEQVNNAGAEAHQTQARKLRGLYSTR"
FT   gene            80023..80760
FT                   /locus_tag="KPN_pKPN3p05943"
FT   CDS_pept        80023..80760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05943"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05943"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80322"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI99"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80322.1"
FT                   /translation="MYSTDVVKENAYLSATRSGLESNEIATLQRSLPSRFNLRHLKKNE
FT                   SLKLVLQKKAGKSRVVAYKFTSGSFNYTAYRISDKKFYNLSDTSGKGSLDYPLPATARL
FT                   SSPFNPARLNPVSGKVSPHNGIDYSMPMNTKIVSVIDGKITRAEYNSTMGYFVEVTGKA
FT                   GVKTRYLHLNKILVTKGARVTRGDAIALSGNSGRSSGPHLHYELVINNNPVNSLAFRAA
FT                   APADNKLEQHAFAHARDYERYLD"
FT   gene            complement(80794..80991)
FT                   /locus_tag="KPN_pKPN3p05944"
FT   CDS_pept        complement(80794..80991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05944"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05944"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80323"
FT                   /db_xref="GOA:A6TIA0"
FT                   /db_xref="InterPro:IPR021682"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIA0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80323.1"
FT                   /translation="MKSTTYALIAVAAIAAFALLREHWSHVAGYWPYLLLLVCPLMHLF
FT                   HGHGGHGDHQHQGSENDKKN"
FT   gene            complement(81032..83521)
FT                   /gene="silP"
FT                   /locus_tag="KPN_pKPN3p05945"
FT   CDS_pept        complement(81032..83521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="silP"
FT                   /locus_tag="KPN_pKPN3p05945"
FT                   /product="putative cation transporting P-type ATPase
FT                   (silver resistance)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05945"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80324"
FT                   /db_xref="GOA:A6TIA1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIA1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80324.1"
FT                   /translation="MKTEDASVCIRRVTVKNDNAVQHNNQTASEQTLSPDEGHVLHKVR
FT                   DPVCGMAILPDRAHSSIRYQDHQLYFCSASCESKFKAHPDRYLTEDASEHSHHHHHDHH
FT                   EVSPDQIKQPHNQAEKENSEGVWTCPMHPEIRRSGPGSCPVCGMALEPLVATASTGPSD
FT                   ELHDMTRRFWLGLLLAFPVLVLEMGSHLFPDLRNTVPPQYNTWLQLLLASPVVLWCGWP
FT                   FFARAGMSLRNRSLNMFTLVAMGTGVAWVYSVIATVFPSWFPASFRNMDGLVAVYFEAA
FT                   AVITVLVLLGQVLELRAREQTSGAITALLNLAPKTARRLDHDGHETDINAEDVLPGDKL
FT                   RIRPGESIPVDGIVIEGKTTVDESMVTGESMPVTKTKGDPVIGGTINQTGSLIIRAEKV
FT                   GDETMLSRIVQMVADAQRSRAPIQRMADSVSGWFVPLVILIAVVAFLIWSVWGPEPRMA
FT                   HGLIAAVSVLIIACPCALGLATPMSIMVGVGKGAQAGVLIKNAEALERLEKVDTLVVDK
FT                   TGTLTEGSPTVTGIISLSPGGEISLLRVTAAVEKGSQHPLGMAVVRAAHEKGIVIPAVS
FT                   NFNAPSGKGVSGDVEGQRVVIGNELAMQENSIVIDNQKAVADTLRMEGATVIYVATDGN
FT                   LAGLIAISDPVKATTPDALKALRQAGIRIVMLTGDNQLTAEAVARKLGIDEVEAGILPD
FT                   GKKAVITRLKASGHVVAMAGDGVNDAPALAAADVGIAMGTGTDVAIESAGVTLLKGDLM
FT                   ILNRARHLSEITMKNIRQNLFFAFIYNALGVPVAAGLLYPVYGILLSPVIAAAAMALSS
FT                   VSVIANALRLKSVRLGK"
FT   gene            complement(83606..84046)
FT                   /locus_tag="KPN_pKPN3p05946"
FT   CDS_pept        complement(83606..84046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05946"
FT                   /product="exported protein (silver resistance)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05946"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80325"
FT                   /db_xref="InterPro:IPR007332"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIA2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80325.1"
FT                   /translation="MKKVVLMALALGLSLPAMASEKVIDMYKSENCGCCSLWGKAMEKD
FT                   GFEVRTHVMNDQALSALKEKHAIPAGLRSCHTAVAGNLIIEGHVPATTIHKAMQSGSGI
FT                   YGLATPGMPAGSPGMEMGARKEAYDVIAFSPDGSKKVFQRIE"
FT   gene            complement(87289..88581)
FT                   /gene="silB"
FT                   /locus_tag="KPN_pKPN3p05947"
FT   CDS_pept        complement(87289..88581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="silB"
FT                   /locus_tag="KPN_pKPN3p05947"
FT                   /product="putative membrane fusion protein SilB"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05947"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80326"
FT                   /db_xref="GOA:A6TIA3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIA3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80326.1"
FT                   /translation="MASLKIKYAAIIISSLIAGGLISVTAWQYVNSSQKTVQTEQKAPE
FT                   RKVLFWYDPMKPDTKFDKPGKSPFMDMDLVPKYADESGDESSGGIRIDPTQVQNLGLKT
FT                   QKVTRGMLNYSQTIPANVSYNEYQFVIVQARSDGFVEKVYPLTIGDHVKKGTPLIDITI
FT                   PEWVEAQSEFLLLSGTGGTSTQIKGVLERLRLAGMPEEDIQRLRSTRTIQTRFTIKAPI
FT                   DGVITAFDLRTGMNISKDKVVAQIQGMDPVWISAAVPESIAYLLKDTSQFEISVPAYPD
FT                   KTFHVEKWNILPSVDQTTRTLQVRLQVSNKDEFLKPGMNAYLKLNTKSQEMLLIPSQAV
FT                   IDTGKEQRVITVDDEGKFVPKQIHVLHESQQQSGIGSGLNEGDTVVVSGLFLIDSEANI
FT                   TGALERMRHPEKTESSMPAMSDQPVNMHSGH"
FT   gene            complement(88695..89048)
FT                   /locus_tag="KPN_pKPN3p05948"
FT   CDS_pept        complement(88695..89048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05948"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05948"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80327"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIA4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80327.1"
FT                   /translation="MRNSLKAVLFGAFSVMFSAGLHAETHQHGDMNAASDASVQQVIKG
FT                   TGVVKDIDMNSKKITISHEAIPAVGWPAMTMRFTFVNADDAINALKTGNHVDFSFIQQG
FT                   NISLLKSINVTQS"
FT   gene            complement(89077..90618)
FT                   /gene="silC"
FT                   /locus_tag="KPN_pKPN3p05949"
FT   CDS_pept        complement(89077..90618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="silC"
FT                   /locus_tag="KPN_pKPN3p05949"
FT                   /product="putative outer membrane protein SilC"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05949"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80328"
FT                   /db_xref="GOA:A6TIA5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIA5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80328.1"
FT                   /translation="MRPRSLSTDYSKNDNIVIILSPGKQRAFGKVSLSILWISFEPFTR
FT                   SACTRSVMFKLKLLSISTIFILAGCVSLAPEYQRPPAPVPQQFSLSKNSLTPAVNSYQD
FT                   TGWRNFFVDPQVSRLIGEALNNNRDLRMAALKVEEARAQFNVTDADRYPQLNASSGITY
FT                   NGGLKGDKPTTQEYDAGLELSYELDFFGKLKNMSEADRQNYFASEEARRAVHILLVSNV
FT                   SQSYFSQQLAYEQLRIARETLKNYEQSYAFVEQQLVTGSTNVLALEQARGQIESTRAEI
FT                   AKREGDLAQANNALQLVLGTYRALPSEKGMKGGEIAPVKLPPNLSSQILLQRPDIMEAE
FT                   YQLKAADANIGAARAAFFPSITLTSGLSASSTELSSLFTSGSGMWNFIPKIEIPIFNAG
FT                   RNKANLKLAEIRQQQSVVNYEQKIQSAFKDVSDTLALRDSLSQQLESQQRYLDSLQITL
FT                   QRARGLYASGAVSYIEVLDAERSLFATQQTILDLTYSRQVNEINLFTALGGGWVE"
FT   gene            90649..91332
FT                   /gene="silR"
FT                   /locus_tag="KPN_pKPN3p05950"
FT   CDS_pept        90649..91332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="silR"
FT                   /locus_tag="KPN_pKPN3p05950"
FT                   /product="probable transcriptional regulatory
FT                   protein(silver resistance)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05950"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80329"
FT                   /db_xref="GOA:A6TIA6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006291"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIA6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80329.1"
FT                   /translation="MMKILIVEDEIKTGEYLSKGLTEAGFVVDHADNGLTGYHLAMTAE
FT                   YDLVILDIMLPDVNGWDIIRMLRSAGKGMPVLLLTALGTIEHRVKGLELGADDYLVKPF
FT                   AFAELLARVRTLLRRGNTMITESQLKVADLSVDLVSRKVSRAGNRIVLTSKEFSLLEFF
FT                   IRHQGEVLPRSLIASQVWDMNFDSDTNAIDVAVKRLRAKIDNDYGTKLIQTVRGVGYML
FT                   EIPDA"
FT   gene            91325..92671
FT                   /gene="silS"
FT                   /locus_tag="KPN_pKPN3p05951"
FT   CDS_pept        91325..92671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="silS"
FT                   /locus_tag="KPN_pKPN3p05951"
FT                   /product="probable sensor kinase (silver resistance)"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05951"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80330"
FT                   /db_xref="GOA:A6TIA7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIA7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80330.1"
FT                   /translation="MHSKPSRRPFSLALRLTFFISLSTILAFIAFTWFMLHSVEKHFAE
FT                   QDVSDLQQISTTLSRILQSPADPDEKKVSKIKESIASYRNVALLLLNPRGEVLFSSAQG
FT                   AALRPAVNSADFSEHSRARDVFLWTVEDPAGPMDTGSEMKMETYRIIASSGQAIFQGKQ
FT                   QNYVMLTGLSINFHLHYLDALKKNLIAIAVVISLLIVLIIRIAVRQGHLPLRNVSNAIK
FT                   NITSENLDARLEPTRVPIELEQLVISFNHMIGKIEDVFTRQANFSADIAHEIRTPITNL
FT                   VTQTEIALSQDRTQRELEDVLYSSLEEYNRMTKMVSDMLFLAQADNNQLIPDRVMFDLR
FT                   AEVMKVFEFFEAWAEERNITLKFNGMPCLVEGDPQMFRRAINNLLSNALRYTPEGQAIT
FT                   VSIREQESFFDLVIENPGKPIPEEHLSRLFDRFYRVDPSRQRKGEALRL"
FT   gene            92921..93469
FT                   /gene="silE"
FT                   /locus_tag="KPN_pKPN3p05952"
FT   CDS_pept        92921..93469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="silE"
FT                   /locus_tag="KPN_pKPN3p05952"
FT                   /product="silver binding protein precursor SilE"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05952"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80331"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIA8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80331.1"
FT                   /translation="MNIQPSSGEINAAELVSVMELKTPVVLPRTSLIQKWRVIMKNIVL
FT                   ASLLGFGLISSAWATETVNIHDRVNNAQAPAHQMQSAEAPVGIQGTAPRMTGMDQHEQA
FT                   IIAHETMTNGSADAHQKMVESHQKMMGNNTVSTTVPSTSYAAMNEHERAAVAHEFMNNG
FT                   QSGPHQAMAEAHRRMINAG"
FT   gene            complement(93765..94169)
FT                   /locus_tag="KPN_pKPN3p05953"
FT   CDS_pept        complement(93765..94169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05953"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05953"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80332"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIA9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80332.1"
FT                   /translation="MAYDFKEAFFCIYDEPDKQSAQNAFEAWKNSLPPYGMEPFKKLVK
FT                   TVHNHYDDIFAYWDAPFSLTNGYTEGLNGLIKMSNRLGRGYSYEIIRAKTLYSKEARKV
FT                   GSGIRAGRGKVEYGPHIPTLLKQAEGGELD"
FT   gene            complement(94323..94700)
FT                   /locus_tag="KPN_pKPN3p05954"
FT   CDS_pept        complement(94323..94700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05954"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05954"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80333"
FT                   /db_xref="GOA:A6TIB0"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIB0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80333.1"
FT                   /translation="MDEQWGYVGAKSRQRWLFYAYDRIRRTVVAHVFGERTLATLERLL
FT                   SLLSAFEVVVWMTDGWPLYESRLKGKLHVNSKRYTQRIERHNLNLRQHLARLGRKSLSF
FT                   SKSVELHDKVIGHYLNIKHYQ"
FT   gene            94871..95266
FT                   /locus_tag="KPN_pKPN3p05955"
FT   CDS_pept        94871..95266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05955"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05955"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80334"
FT                   /db_xref="GOA:A6TI40"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI40"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80334.1"
FT                   /translation="MSNTNANFEMTGILLGQEARKRKTPQEKIAIIQQTMEPGMNVSHV
FT                   ARLHGIQPSLLFKWKKQYQEGSLTAVAAGEEVVPASELTAALKQVRELQRLLGKKTMEV
FT                   EILKEAVEYGQSRKWIAHAPLLPKDGE"
FT   gene            95224..96105
FT                   /locus_tag="KPN_pKPN3p05956"
FT   CDS_pept        95224..96105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05956"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05956"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80335"
FT                   /db_xref="GOA:A6TIB2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIB2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80335.1"
FT                   /translation="MDSARALVAKGRGIALVSRTMGVSRAQLSLRINRSADWQDKRCNR
FT                   RNDEADEEILSAILDIISDMPSYGYRRVWGILRKQRRTEGQPPVNAKRLYRIMSEHNLL
FT                   LLHDKPERPKREHKGKIAVAESDMRWCSDGFEFGCDNGEKLRVTFALDCCDREAIDWAA
FT                   STGGYDSSTVQDVMLRSVEKRFGDRLPDTAVQWLTDNGSAYTAYETWRFARELNLEPCT
FT                   TAVSSPQSNGMAERFVKTMKEDYIAFMPKPDVRTALRNLAVAFTHYNENHPHSALGYHS
FT                   PREYRRQRTSLT"
FT   gene            96490..96993
FT                   /locus_tag="KPN_pKPN3p05957"
FT   CDS_pept        96490..96993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05957"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05957"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80336"
FT                   /db_xref="GOA:A6TIB3"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIB3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80336.1"
FT                   /translation="MSRQCTHYGRWPQHGFTSLKKLRPQSVTSRIQPGSDVIVCAEMDE
FT                   QWGYVGAKSRQRWLFYAYDRIRRTVVAHVFGERTLATLERLLSLLSAFEVVVWMTDGWP
FT                   LYESRLKGKLHVISKRYTQRIERHNLNLRQHLARLGRKSLSFSKSVELYDKVIGHYLNI
FT                   KHYQ"
FT   gene            97139..99142
FT                   /gene="betU"
FT                   /locus_tag="KPN_pKPN3p05958"
FT   CDS_pept        97139..99142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betU"
FT                   /locus_tag="KPN_pKPN3p05958"
FT                   /product="secondary glycine betaine transporter BetU"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05958"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80337"
FT                   /db_xref="GOA:A6TIB4"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIB4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80337.1"
FT                   /translation="MIMSDNDTIPKKSTSQINKAVFFTSALLIFLLVAFAAVFPDVADK
FT                   NFKLLQQQIFTNASWFYILAVALILLSVTFLGLSRYGDIKLGPDHAQPDFSYHSWFAML
FT                   FSAGMGIGLMFFGVAEPVMHYLSPPVGTPETVAAAKEAMRLTFFHWGLHAWAIYAIVAL
FT                   ILAFFSYRHGLPLTLRSALYPIIGDRIYGPVGHAVDIFAVIGTVFGVATSLGYGVLQVN
FT                   AGLNHLFGVPINETVQVILIVVITGLATISVVSGLDKGIRILSELNLGLALLLLALVLC
FT                   LGPTVLLLKSFVENTGGYLSELVSKTFNLYAYEPKSSKWLGGWTLLYWGWWLSWSPFVG
FT                   MFIARVSRGRTIREFVTGVLFVPAGFTLMWMTVFGNSAIYLIMNQGATDLANTVQQDVA
FT                   LALFNFLEHFPFSSVLSFIAMAMVIVFFVTSADSGAMVVDTLATGGVANTPVWQRIFWA
FT                   SLMGIVAIALLLAGGLSALQTVTIASALPFSVILLISIYGLLKALRRDLTKRESLSMAT
FT                   IAPTAARNPIPWQRRLRNIAYLPKRSLVKRFMDDVIQPAMTLVQEELNKQGTISHISDA
FT                   VEDRIRLEVDLGNELNFIYEVRLRGYSSPTFALAAMDNNEQQTEQHRYYRAEVYLKEGG
FT                   QNYDVMGWNQEQLINDILDQYEKHLHFLHLVR"
FT   gene            99205..100482
FT                   /locus_tag="KPN_pKPN3p05959"
FT   CDS_pept        99205..100482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05959"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05959"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80338"
FT                   /db_xref="GOA:A6TIB5"
FT                   /db_xref="InterPro:IPR018723"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIB5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80338.1"
FT                   /translation="MISRWKWILKQTVKKLWFRATLFAIVAIITALLSILFKSMIPESV
FT                   SVKVGAEAVDNILNILASSMLAVTTFSLSIMVTAYGSATTNVTPRATRLVVEDVTTQNV
FT                   LATFIGSFLFSLVGIIALSMGAYGERGRVILFIVTLVVIALILITLLRWIQHLTSLGRV
FT                   GETTAKVEQAAIETFIARARNPCLGGYPWLENNEQPKGTVAVYPKKIGYVEYINMVKLS
FT                   KLLTNDPRHVYLVAQPGSFIHPSMPVLYLSQGQESSISADLLETIIVSDVRSFAQDPRF
FT                   CLSVMAEIACRALSPAVNDPGTAIDVIGRGVRILSTYAQNKSDEIEVKYPSVHVAPLQN
FT                   NDLLEDFFSPVARDGAGMREIQIRVLKGLSMLSKGWPGIFSEAAHNLAFETLEHAIRAD
FT                   HIDSDRCLIKSIYYNLFSGEDSNKKP"
FT   gene            complement(101334..101435)
FT                   /locus_tag="KPN_pKPN3p05960"
FT   CDS_pept        complement(101334..101435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05960"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05960"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80339"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIB6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80339.1"
FT                   /translation="MLADQLVEIEGQCNHLLLAQGKALLKSRSELLK"
FT   gene            complement(101465..102919)
FT                   /locus_tag="KPN_pKPN3p05961"
FT   CDS_pept        complement(101465..102919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05961"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05961"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80340"
FT                   /db_xref="GOA:A6TIB7"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIB7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80340.1"
FT                   /translation="MIFRDKIKDYTSDVLVRSESLLVQTESVKTAAKSHLNIGDSPCTN
FT                   ENILHLRVVVWPYPLIKDVGYIIKGELACSALWGSLRPTLSLEHFDKKWTSREGVWLFG
FT                   IKLMDDISVNGYISEGIMVTLSPFVFRRFETDMYSKNFSAVVGNSKHDRHYFNIGPDAP
FT                   LLDRHDSVPLRFRVFRACSLHYDLCVAGGGYFTGIFSEHWSIQMLLVTVSLLSGLMIYI
FT                   IIMNRAELNSSLSARFVKALKNEALSLVYQPIYRIEDGQICGFEALLRWKDERLGNISP
FT                   EVFIPLSEREGLQEDVTLFVINHAIREFIHTAIQNEIFLSVNINPSDLDSEKFRDKLLG
FT                   LISEYNIPYKTILLEITERQGGDFEGMKIHIDKYKNHGVRFAIDDFGTGYSNLNLVTAL
FT                   DVDEIKIDKSLTSAIGTESLRYDLLPGLHEMFRSIADKIVFEGVETQEQVNYLKTFWPQ
FT                   SYAQGWYYSRALPLEEARKLTIRELN"
FT   gene            103106..103501
FT                   /locus_tag="KPN_pKPN3p05962"
FT   CDS_pept        103106..103501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05962"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05962"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80341"
FT                   /db_xref="GOA:A6TI40"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A6TI40"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80341.1"
FT                   /translation="MSNTNANFEMTGILLGQEARKRKTPQEKIAIIQQTMEPGMNVSHV
FT                   ARLHGIQPSLLFKWKKQYQEGSLTAVAAGEEVVPASELTAALKQVRELQRLLGKKTMEV
FT                   EILKEAVEYGQSRKWIAHAPLLPKDGE"
FT   gene            103459..104340
FT                   /locus_tag="KPN_pKPN3p05963"
FT   CDS_pept        103459..104340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05963"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05963"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80342"
FT                   /db_xref="GOA:A6TIB2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIB2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80342.1"
FT                   /translation="MDSARALVAKGRGIALVSRTMGVSRAQLSLRINRSADWQDKRCNR
FT                   RNDEADEEILSAILDIISDMPSYGYRRVWGILRKQRRTEGQPPVNAKRLYRIMSEHNLL
FT                   LLHDKPERPKREHKGKIAVAESDMRWCSDGFEFGCDNGEKLRVTFALDCCDREAIDWAA
FT                   STGGYDSSTVQDVMLRSVEKRFGDRLPDTAVQWLTDNGSAYTAYETWRFARELNLEPCT
FT                   TAVSSPQSNGMAERFVKTMKEDYIAFMPKPDVRTALRNLAVAFTHYNENHPHSALGYHS
FT                   PREYRRQRTSLT"
FT   gene            104873..105130
FT                   /locus_tag="KPN_pKPN3p05964"
FT   CDS_pept        104873..105130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05964"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05964"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80343"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIC0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80343.1"
FT                   /translation="MDKKYDFSLSYEALTRVCENAICEHIRRAGSLEGLGFALEYTKAY
FT                   AILEVWSLLAAAGDTFPALIEKDRIYLLQLISGKNNIELH"
FT   gene            complement(105803..106771)
FT                   /locus_tag="KPN_pKPN3p05965"
FT   CDS_pept        complement(105803..106771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05965"
FT                   /product="IS903 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05965"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80344"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIC1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80344.1"
FT                   /translation="MKDQITYLPDNADRSVAKQKFKITNWPTYNKALINRGSITFWLDD
FT                   EAIQAWYESATPSSRGRPQRYSDLAITTVLVIKRVFRLTLRAAQGFIDSIFSLMNVPLR
FT                   CPDYSCVSRQAKSVNVSFKTPTRGEIAHLVIDSTGLKVFGEGEWKVKKHGQERRRIWRK
FT                   LHLAVDSKTHEIICADLSLNNVTDSEAFPGLIRQTHRKIRAASADGAYDTRLCHDELRR
FT                   KKISALIPPRKGAGYWPGEYADRNRAVANQQMTGSNARWKWTTDYNRRSIAETAMYRVK
FT                   QLFGGALTLRDYDGQVAEAMALVRALNKMTKAGMPESVRIA"
FT   gene            106932..107102
FT                   /locus_tag="KPN_pKPN3p05966"
FT   CDS_pept        106932..107102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05966"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05966"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80345"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIC2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80345.1"
FT                   /translation="MSLGKAFSLGIVAEGVENNEQFELLKNMNCDEFQGYYYSKPLSGD
FT                   QLIDFLRGQKK"
FT   gene            complement(107129..108085)
FT                   /locus_tag="KPN_pKPN3p05967"
FT   CDS_pept        complement(107129..108085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05967"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05967"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80346"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIC3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80346.1"
FT                   /translation="MKIMTNHKEENRLLSLYSMGILDTKYEERFDRLTRIATKLFDVPI
FT                   ALVSLIDRDRQWFKSCYGLKIKETDRSDSFCTIAVDLSEPLIVPDASLDPRFKENKLVK
FT                   NDPYIRFYAGHPVRLPDGEIAGTICIIDTEPRVLTRDDFLLLKDLAEIVEDEFRIINEA
FT                   TTDPLTGICNRRSFALMTDESLRKAKKKKKTFCVLIIDLDNFKPINDNFGHSEGNEVLC
FT                   NFADMLEDLSSSKSVVARLGGDEFGVLLPESTYKEAEEFLHKLRAGITSYNLNSQKKYN
FT                   IDFSAGIIEYDEKIHTECSAIMQDADERMYEIKKGKR"
FT   gene            109220..109960
FT                   /gene="int"
FT                   /locus_tag="KPN_pKPN3p05968"
FT   CDS_pept        109220..109960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="int"
FT                   /locus_tag="KPN_pKPN3p05968"
FT                   /product="integrase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05968"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80347"
FT                   /db_xref="GOA:A6TIC4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR016423"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIC4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80347.1"
FT                   /translation="MNSIIPLQNSPERVSLLPIAPGVDFATAVALRRMATSTGATPAYL
FT                   LAPEVSALLWYMPDQRHHMLFATMWNTGIRIGEARTLTPESFDLDGLRPFVRVLSEKVR
FT                   ARRGRPPKDEVRLVPLTDASFVRQMESWMVTTRPRRREPLWPVTDETMRNWLKQAVKRA
FT                   EADGVHFSIPVTPHTFRHSYIMHMLYHRQPRKVIQALAGHKDPRSMEVYTRVFALDMAA
FT                   TLAVPFTGDGRDAAEILRSLPPAG"
FT   gene            complement(110677..111687)
FT                   /gene="repA2"
FT                   /locus_tag="KPN_pKPN3p05969"
FT   CDS_pept        complement(110677..111687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repA2"
FT                   /locus_tag="KPN_pKPN3p05969"
FT                   /product="DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05969"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80348"
FT                   /db_xref="GOA:A6TIC5"
FT                   /db_xref="InterPro:IPR000525"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIC5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80348.1"
FT                   /translation="MTSENNSLLLNLQEVDKTTGEVVKLDVNSTSTVQPVALMRLGLFV
FT                   PTLKSTGKSKANRKNVTDATEELVQLSIAKSEGYTDVKITGSRLDMDTDFKVWLGIIRS
FT                   MSEYGVKSDTLELSFVEFVKMCGFNSRRSNKKMRDRISNSLFKLASVTLKFQSETKGWT
FT                   THLVQSAYYDITEDIVEIKAEPKLFELYHMDRRVLLRLKAIDALQRKESAQALYTYIES
FT                   LPQNPAPISMKRMRDRLNLTSNVYTQNHTVRKAMEQLRDIGYLDYTEFKRGRATYFSVH
FT                   YRNPKLISGPVKVPRKAEEEKAPEQNYDEVIKALKAAGIDPLKLAEALSAMKPEN"
FT   gene            112430..113605
FT                   /gene="sopA"
FT                   /locus_tag="KPN_pKPN3p05970"
FT   CDS_pept        112430..113605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sopA"
FT                   /locus_tag="KPN_pKPN3p05970"
FT                   /product="repFiA replicon essential function protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05970"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80349"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIC6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80349.1"
FT                   /translation="MFSMGLMDTLNQCISAGHEMTKAIAIAQFNDDSPEARKITRRWRI
FT                   GEAADLVGVSSQAIRDAEKAGRLPHPDMETRGRVEQRVGYTIEQINHMRDVFGTRLRRA
FT                   EDAFPPVIGVAAHKGGVYKTSVSVHLAQDLALKGLRVLLVEGNDPQGTASMYHGWVPDL
FT                   HIHAEDTLLPFYLGEKDDASYAIKPTCWPGLDIIPSCLALHRIETELMGKFDEGKLPTD
FT                   PHLMLRLAIETVAHDYDVIVIDSAPNLGIGTINVVCAADVLIVPTPAELFDYTSALQFF
FT                   DMLRDLLRNVDLKGFEPDVRILLTKYSNNNGSQSPWMEEQIRDAWGSMVLKNVVRETDE
FT                   VGKGQIRMRTVFEQAIDQRSSTGAWRNALSIWEPVCNEIFDRLIKPRWEIR"
FT   gene            113605..114576
FT                   /gene="sopB"
FT                   /locus_tag="KPN_pKPN3p05971"
FT   CDS_pept        113605..114576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sopB"
FT                   /locus_tag="KPN_pKPN3p05971"
FT                   /product="repFiA replicon essential function protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05971"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80350"
FT                   /db_xref="GOA:A6TIC7"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR040873"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIC7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80350.1"
FT                   /translation="MKRAPVIPRHTTHTQSTEDTSSPAPAAPMVDSLIARVGAMARGNA
FT                   ISLPVCGREVKFTLEVLRGDSVESASRVWSGNERDQELLTEDALDDLIPSFLLTGQQTP
FT                   AFGRRVSDVIEIADGSRRRKAAILTESDYRVLVGELDDEQMAALSRLGNDYRPTSAYER
FT                   GLRYTSRLQNEFAGNISALADAENISRKIITRCINTAKLPKSVVALFAHPGELSARSGE
FT                   ALQKAFADKEELLKQQAETLHDQKKAGLIFEAEEVISLLTSVLKQSPASRVNLSSRHQF
FT                   APGATALYKGDKMVLNLDKSRIPAECIEKIEAILKELEKPGV"
FT   gene            complement(117234..117389)
FT                   /locus_tag="KPN_pKPN3p05972"
FT   CDS_pept        complement(117234..117389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05972"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05972"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80351"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIC8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80351.1"
FT                   /translation="MATASAGGGYPVAIIDRNRPVFYCVPAALYEQMLDALDEKDLVQL
FT                   LTSSPP"
FT   gene            complement(117528..118799)
FT                   /locus_tag="KPN_pKPN3p05973"
FT   CDS_pept        complement(117528..118799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05973"
FT                   /product="umuDC operon protein-like protein"
FT                   /note="UV protection"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05973"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80352"
FT                   /db_xref="GOA:A6TIC9"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR025188"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIC9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80352.1"
FT                   /translation="MFALADVNSFYASCEKVFRPDLRGKPVVVLSNNDGCVIARSAEAK
FT                   LLGIKMGTPWFQLKEAQFPEKLYVFSSNYELYASLSNRVVALLEELSPRVEQYSIDECF
FT                   LDARGIGHCMDLEDFGRQLRGHVLSGTGLTIGVGFGATKTLAKSAQWASKEWPQFRGVL
FT                   ALSPENPRRTAKLLSLQPVEEIWGVGNRIAKKLHVMGITTALQLSLTNPTFIRKNFNVV
FT                   LERTVRELNGESCISLEEAPPPKQQIVCSRSFGQRITTYEEMRQAVCQYAERASEKLRG
FT                   ERQYCRHISTFIKTSPFAVNEPYYGNVATEKLNTPTRDTRDIIAAAVRSLDRIWLDGHR
FT                   YAKAGIMLNDFSPNGVAQLNLFDDVQPRPHSDALMKVLDGINHSGLGKVWFAGRGIAPD
FT                   WQMKREMLSPAYTTRWKELPVARF"
FT   gene            complement(118799..119224)
FT                   /locus_tag="KPN_pKPN3p05974"
FT   CDS_pept        complement(118799..119224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05974"
FT                   /product="umuDC operon protein-like protein"
FT                   /note="UV protection"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05974"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80353"
FT                   /db_xref="GOA:A6TID0"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:A6TID0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80353.1"
FT                   /translation="MKFIPAVSEASIVKIPLFTERCPAGFPSPASDYTESELDLNEYCI
FT                   HRRHSTYFVRAIGNSMTDIGLYSGDLLVVDKAEQPRHGDIVIAEIEGEFTVKRLLLTPR
FT                   PALQAMNPDFPSLYPDPETLQIFGVVTAFIHKTRRAD"
FT   gene            119843..121114
FT                   /locus_tag="KPN_pKPN3p05975"
FT   CDS_pept        119843..121114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05975"
FT                   /product="putative reverse transcriptase"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05975"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80354"
FT                   /db_xref="GOA:A6T7P4"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:A6T7P4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80354.1"
FT                   /translation="MFHLLTVEALEAAFLSLSRKAAAGVDGIRWMDYAGNMKNNITDLH
FT                   RRLHQGSYRAQPGRRHYIPKADGKQRPLGIASLEDKIVQYALVKILNAVYENDFMGFSY
FT                   GFRPGRSQHDALDALATGLVRTNVNWVLDADISQFFDRVSHEWLIRFTEHRIGDRRVIR
FT                   LIRKWLTAGTSEEGQWRATEEGTPQGAVISPLLANIYLHYVFDLWAHQWRRRYATGNVV
FT                   MVRYADDIVIGFDKRYDARRFRIAMQRRLREFGLTVHPEKTRLMEFGRFAAENRAIRGK
FT                   GKPETFNFLGFTHISGKDRNGRFMLIRKTRRDRMTATLKAIKDGLRRRWHYSIPEQGKW
FT                   LRRVVQGYLNYHSVPGNFPTMQKFRTHVTNLWRRALRRRSQKDDTTWTKANKLAAAWLP
FT                   RVRVLHPWPVERFTARHPRQEPGA"
FT   gene            121348..121578
FT                   /locus_tag="KPN_pKPN3p05976"
FT   CDS_pept        121348..121578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05976"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05976"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80355"
FT                   /db_xref="GOA:A6TID2"
FT                   /db_xref="UniProtKB/TrEMBL:A6TID2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80355.1"
FT                   /translation="MNTGLRQVLRYAGVPVDAAEPVRRQFGSRLILIVTVALLPLLIVD
FT                   VPLWLFVLSQIIWGSGMYIGISVASDKPDRR"
FT   gene            122045..122524
FT                   /locus_tag="KPN_pKPN3p05977"
FT   CDS_pept        122045..122524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05977"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05977"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80356"
FT                   /db_xref="InterPro:IPR004914"
FT                   /db_xref="InterPro:IPR042297"
FT                   /db_xref="UniProtKB/TrEMBL:A6TID3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80356.1"
FT                   /translation="MSARHNPVPQSYEPVEVAMYHARQTMLNVEESDRLSFLPDLFGND
FT                   FLAGEMQVYALAEKHITDYCGGFWHFIRIPEGGGYMMPDGDRFHLTNPDNWFDRSVSAD
FT                   AAGVIITALAINRRIWLHHERGDAALTRHLMLRESQLWNFIDSHDECAAIYAALD"
FT   gene            122761..123015
FT                   /locus_tag="KPN_pKPN3p05978"
FT   CDS_pept        122761..123015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05978"
FT                   /product="putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05978"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80357"
FT                   /db_xref="GOA:A6TID4"
FT                   /db_xref="InterPro:IPR009052"
FT                   /db_xref="InterPro:IPR036745"
FT                   /db_xref="UniProtKB/TrEMBL:A6TID4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80357.1"
FT                   /translation="MSQWNIASFSKEEQDKVAVDKVAADVAWQERMNKPVMPELVEREQ
FT                   PEHLREYFHERFRVHRLNSQQLPRANAPEYNKPGDDQQN"
FT   gene            123056..123367
FT                   /locus_tag="KPN_pKPN3p05979"
FT   CDS_pept        123056..123367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05979"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05979"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80358"
FT                   /db_xref="GOA:A6TID5"
FT                   /db_xref="UniProtKB/TrEMBL:A6TID5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80358.1"
FT                   /translation="MSLMFAAVTLLTGINLFFIPFQPVPALWGAILAVAFVLINVVADK
FT                   LRLWSGIAWIIVAGIIITLMLKGKEPGDEFRVLITVFAFLASIWYSVAQFRKENKLRS"
FT   gene            124149..124376
FT                   /locus_tag="KPN_pKPN3p05980"
FT   CDS_pept        124149..124376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05980"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05980"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80359"
FT                   /db_xref="UniProtKB/TrEMBL:A6TID6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80359.1"
FT                   /translation="MQDPSLRTYRIAFLGRNASGNLPMFTRVQATTGKRAIKAFIERCE
FT                   PVKGWFLGAPEDITDQVKKEEEEAGSKPQV"
FT   gene            124750..126105
FT                   /locus_tag="KPN_pKPN3p05981"
FT   CDS_pept        124750..126105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05981"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05981"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80360"
FT                   /db_xref="InterPro:IPR021944"
FT                   /db_xref="UniProtKB/TrEMBL:A6TID7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80360.1"
FT                   /translation="MTPTTAQIMTENTVSQTYRATYSPDDNKLRLYASLRLDEETYSLI
FT                   NKAGFRWAPKQELFVAPAWTPGREDVLLSLAGDIEDEDSTLFDRQEQRAGRFSDYSDRR
FT                   AVESEQALAHVDSLASAVPLGQPILVGHHSERRARRHAQKIENGMKRAVMLFERAEYWE
FT                   QRAQASLRHAKYKERPDVRYRRIKKIEAELRKSQKHITRSEEYMTMWRAQTLDLKMALL
FT                   VSNYDHIYACFTLDKYPRPAEKSQYEGSMSLHSALSEEIITFEQARDIAIRCHERTISH
FT                   QQRWVNHYQNRLAYERAMLNENGGVVTRTQEFEPGGQVLSRGEWLTILRVNRSKGEVSS
FT                   VETPGYRFLGYSGTMKLTPDRITDYKAPTAEEASDAKKAAKRPPIVNYPGEGFREMTKA
FT                   EWAKLPADYKGVRGAAETETHGAYRFRRCMTHGCTLVNVYITDMKTVEIPKK"
FT   gene            126153..126716
FT                   /locus_tag="KPN_pKPN3p05982"
FT   CDS_pept        126153..126716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05982"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05982"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80361"
FT                   /db_xref="GOA:A6TID8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A6TID8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80361.1"
FT                   /translation="MHHGLKHRIQAMRDKLEGRAPVAEIQGSSQLFVTPSPECRRLVEL
FT                   ADVRETDRILEPSAGTGAILQAIRDAVPRAKCDAVELHAGLARHLQAHFPEVRIWCGDF
FT                   LEYHPERRYTRIIMNPPFHRGDDIRHIRRALTLLEPGGILTGICLDGPRQQKALESLAD
FT                   VWEPLPRGTFTYTQVATAILRITV"
FT   gene            127492..128034
FT                   /gene="ssb"
FT                   /locus_tag="KPN_pKPN3p05983"
FT   CDS_pept        127492..128034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="KPN_pKPN3p05983"
FT                   /product="single-strand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05983"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80362"
FT                   /db_xref="GOA:A6TID9"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A6TID9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80362.1"
FT                   /translation="MAARGVNKVILVGHLGQDPEVRYMPNGGAVANLTLATSETWRDKQ
FT                   TGEMRENTEWHRVVMFGKLAEVAGEYLRKGAQAYIEGQLRTRNWQDDAGVTRYVTEVLV
FT                   GQNGTLQMLGGRRESGVPESAAQPQNPATPAQPAQAAAKSPKAKGGKKGRQDAAPSQQP
FT                   PQPLPNDFPPMDDDAPF"
FT   gene            128083..128331
FT                   /locus_tag="KPN_pKPN3p05984"
FT   CDS_pept        128083..128331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05984"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05984"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80363"
FT                   /db_xref="InterPro:IPR009253"
FT                   /db_xref="InterPro:IPR038612"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIE0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80363.1"
FT                   /translation="MDHNVLSPLVSLPDGTFTREQAQVVAAQYQNVAIEDDQGTHFRLV
FT                   VRHKDDGSMIWRVWNFEPGGEDIMNRYIRDYGVRKTK"
FT   gene            128401..130437
FT                   /locus_tag="KPN_pKPN3p05985"
FT   CDS_pept        128401..130437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05985"
FT                   /product="putative ParB-like nuclease domain"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05985"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80364"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIE1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80364.1"
FT                   /translation="MSATESKVKTAPKTSKKTLKSAEAEALKVALDAAQVEYVPVSALV
FT                   KSPLNVRTIPYPAEKVCSMADSIEAIGLLQNLVVHNLPDGRCGVAAGGRRLKALQLLQS
FT                   ENRIDAGYQVMVKKVPDELAVAASMAENEQQMAMHPSEQIAGFRTLAEQGKTPAQIGDL
FT                   LGFGTRHVQRMLKLTELAPEILAALAKDEITTEHCQALALESDQKRQVEVLESARKRSW
FT                   NNEVSVSSIRNLITSEEVSTNGDKFRFVGEAAFSPDEIRVDLFSSENRGYVKSASLDTA
FT                   LLEKLQNIAEHLREAEGWSWCDGRLDPISHYGKDTKIWRLHAVPPVEYTEAESERLAEL
FT                   EALEAKYEDENPSVNDDVVAGALEAVWEEQQTIAHRAKHRAWTDEMKQSAGVVVSWTGQ
FT                   EVKVQRGVVLCADEKMEEKDASTDQAPEKVDPLDAVSVPLLTRLSSERTLAVQAALLQQ
FT                   PQKAVALMVWKMCNSVFHTTTSVKEPFCISVSVSHYALTREAPDGENSVAFQAIQSEKE
FT                   RLEALLPENWRKDMTTFFTLDGATLMALMAFCTACSIDGVQGKDEFGRKHQSSLDGVEN
FT                   AIQFDLRDWWKPTADNLFSHMKLPHIVQALSQTGLAGAAQDAAKMKKKDAAEHAEHFLS
FT                   KIRWVPEWMTSADNQKQLAAKSELSLATSQNDTDVDAGDRHRP"
FT   gene            130504..130935
FT                   /locus_tag="KPN_pKPN3p05986"
FT   CDS_pept        130504..130935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05986"
FT                   /product="putative plasmid SOS inhibition protein B"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05986"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80365"
FT                   /db_xref="InterPro:IPR009385"
FT                   /db_xref="InterPro:IPR038131"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIE2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80365.1"
FT                   /translation="MKTLLTLDVLKTMSSDELEDYRAAGEDFRRELSHAVMRDLTSPSG
FT                   WSVNAEYRCEFGGFFPVQIRFTPPHGHFDVAVCSSGELNPRWIVVFVTRDGQPFSVVRV
FT                   MDAFNPELITHTLDLIECLDAGGYSFASIISTLSQEGAQ"
FT   gene            130932..131660
FT                   /locus_tag="KPN_pKPN3p05987"
FT   CDS_pept        130932..131660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05987"
FT                   /product="putative plasmid SOS inhibition protein A"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05987"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80366"
FT                   /db_xref="InterPro:IPR009713"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIE3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80366.1"
FT                   /translation="MIPSSSALVSLKPARQAALQAIMTVEEARQRGARLPSMPHVRTFL
FT                   RLLTGCSRINSDVARRIPGIHRDPKDRLSSLKQVEEALDMLISSHGEYCPLPLTMDVQA
FT                   ENFPEVLHTRTVRRLKRQDFAFTRKMRREARQVEQSWLLRQNLLGQAVTELNFQSPETV
FT                   CTWYTRWSDEFDAAELAAPFWRWQSRFASLKELDWLRISGEPLYAVMYEIPFIVRETPE
FT                   HIRVAERWQVPNKLADRSGV"
FT   gene            131657..131983
FT                   /locus_tag="KPN_pKPN3p05988"
FT   CDS_pept        131657..131983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05988"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05988"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80367"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIE4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80367.1"
FT                   /translation="MKWRYSLRWKLPHRPCPGPRELISVVVEAGQAAPEEVMSRWVAGS
FT                   GYAVCVDFLGQKQIQRWSDERKAAVRRRNMQARINRVAPLFADELIERELAARPEYFNG
FT                   KSAR"
FT   gene            132012..132413
FT                   /locus_tag="KPN_pKPN3p05989"
FT   CDS_pept        132012..132413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05989"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05989"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80368"
FT                   /db_xref="GOA:A6TIE5"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIE5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80368.1"
FT                   /translation="MAKYKESRTMRYWLLVILMNVLFYFIVKHVAPEWYGSPCYYAGQI
FT                   ICTLIAAVITWRDPPDWLDGILLGVIKFGVLIAGIIFFVWGIGYKLAFWGQHDPNTIYA
FT                   SANDVILPNLALGTGVLIAGWVYIRYLKR"
FT   gene            complement(132591..133670)
FT                   /locus_tag="KPN_pKPN3p05990"
FT   CDS_pept        complement(132591..133670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05990"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05990"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80369"
FT                   /db_xref="GOA:A6TIE6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIE6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80369.1"
FT                   /translation="MLMQHIGVGYFGYYRATAYAMKHSLMPEIAKLRMKALNFWDKHGI
FT                   RAAADAFDVSTRTLYWWRRLLRTGGPEALIPRSKAPLVRRSRHWHPDVLKEIRRLRTEL
FT                   PNLGKEQIFVRLKPWCEARHFTCPSTSTIGRIIAGAHDKMRMIPVRLSARGKARLIKKR
FT                   SVKPRRPKQYRPVKTGELIGMDAIELRMGDLRRYIITMIDEHSDYALALAVPSLNSDIT
FT                   SHFFSKATKLFPVAIRQVVTDNGKEFLGNFDKTLQEASIKHIWTYPYTPKMNATCERFN
FT                   RTLREQFIEFNELLLFEDLNLFNQRMAEYLVLYNSKRPHKSLELMTPVDYILRESKNCN
FT                   MWWTHTPPCKLHGKRPYWC"
FT   gene            134953..135222
FT                   /locus_tag="KPN_pKPN3p05991"
FT   CDS_pept        134953..135222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05991"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05991"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80370"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIE7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80370.1"
FT                   /translation="MTERLNNIFDRYAHLVRACALPLDDDETQVLLNVLNGSVVEPAFI
FT                   EYLAQEIRDSDDYLEGIPAAKSLYEKCQSATYPQLLATVERLER"
FT   gene            135858..136214
FT                   /locus_tag="KPN_pKPN3p05992"
FT   CDS_pept        135858..136214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05992"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05992"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80371"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIE8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80371.1"
FT                   /translation="MSTQNVNEKPSTKESTTLRTDGFVRNIHSRNPFDVIRADVVLERI
FT                   EKKAGRSCGMHYELYQAHLLGGALDYLDALPLKDRPVLMGAAAKRGYLLTLAEEERALE
FT                   ARDVLMSELAANDC"
FT   gene            136275..136487
FT                   /locus_tag="KPN_pKPN3p05993"
FT   CDS_pept        136275..136487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05993"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05993"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80372"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIE9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80372.1"
FT                   /translation="MKVYGHQHSSEAFFRETSPSCFEPKAEKVIAFHGKDASYAYNVLA
FT                   DLKAAGASYTRRNIIADMFRRLGVK"
FT   gene            136498..136722
FT                   /locus_tag="KPN_pKPN3p05994"
FT   CDS_pept        136498..136722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05994"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05994"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80373"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIF0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80373.1"
FT                   /translation="MEHVKGKIQQGAGNAYFAGMQWRGITLGHADAAALNQFDIDISKA
FT                   QAPEARTWLLQNKAEFIALILGIEVVKVG"
FT   gene            136803..137123
FT                   /locus_tag="KPN_pKPN3p05995"
FT   CDS_pept        136803..137123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05995"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05995"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80374"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIF1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80374.1"
FT                   /translation="MFTVIFHDEAEKEFTALPAAIRAKMARLLMKLEANPRQLREPDTK
FT                   PLGNGLFEIRTMGADIARGIWVYQSGERIFLLRIFIKKSPKTPPAEIDQALRRLEEMQN
FT                   EI"
FT   gene            137113..137391
FT                   /locus_tag="KPN_pKPN3p05996"
FT   CDS_pept        137113..137391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05996"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05996"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80375"
FT                   /db_xref="GOA:A6TIF2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIF2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80375.1"
FT                   /translation="MKYKTLSQVHTEAMNDHEYSAAFEAEEASELLRETLATWRKEAGL
FT                   TSAQVAERMGIKAPTISRMEKNASRMSIQTLVRYARACGVNFKIQQV"
FT   gene            137392..137805
FT                   /locus_tag="KPN_pKPN3p05997"
FT   CDS_pept        137392..137805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05997"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05997"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80376"
FT                   /db_xref="GOA:A6TIF3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039060"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIF3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80376.1"
FT                   /translation="MISDANKAVNDLASIVPLLGGSSSRKDYEEARKLVEYLLEHDPGS
FT                   PLVDMLTARIDAWEDNAVEFEEFNTRFEAGKNGVSLLRVLMQQYGLSQSDFENEIGNKS
FT                   LVSRFLSGERSLTFDHMRALANRFQIPVSMFVD"
FT   gene            138639..139460
FT                   /locus_tag="KPN_pKPN3p05998"
FT   CDS_pept        138639..139460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05998"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05998"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80377"
FT                   /db_xref="InterPro:IPR026325"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIF4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80377.1"
FT                   /translation="MRLASRFGLTHSIRQERPLTNDELVKVVPSVFSEEKHNSRSDRYT
FT                   YIPTITLLDKLREEGFQPFFACQSRVRDEDKRGHTKHMVRLRREGANKGTEVPEIILLN
FT                   SHDGSSSYQMIPGMFRFVCTNGLVCGTSFGEIRVPHKGDIVGRVIEGAYEVLGIFDKIT
FT                   EGVDVMKSITLTKEEQSLFGQAALTYRYEDENKSPVSIEQIIHPRRYEDKKYDIWTTYQ
FT                   RVQENLIKGGLPGRTEKGKRTTTRPVKAIDGDVKLNKALWLIAEKFRTLKG"
FT   gene            139493..139822
FT                   /locus_tag="KPN_pKPN3p05999"
FT   CDS_pept        139493..139822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p05999"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p05999"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80378"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIF5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80378.1"
FT                   /translation="MVGILMFEFKAVCISISHMEEGDIRVLQVLSSTTNYLTCDSYLEW
FT                   IHDTPYGCVIRMYDFKRHLLALKRGGVSKFLRKNLILMHREGGYLLFHFDSDADYYPGI
FT                   DAVDF"
FT   gene            complement(139855..140340)
FT                   /locus_tag="KPN_pKPN3p06000"
FT   CDS_pept        complement(139855..140340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p06000"
FT                   /product="lytic transglycosylase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p06000"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80379"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIF6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80379.1"
FT                   /translation="MKGAAFGIILSLIPLSSMAADCFDMAGRDYKIDPDLLRAISWQES
FT                   RFKIDAIGRNPVTGYGSGLMQIDSQHFNELSRYGIKPDHLLSDACLNIYTGAYYLAQAF
FT                   KKWGVSWDAVGAYNAGFKKTPRQAARRYEYAKKIHYYYTAIKASKRTSSKDQKIAMN"
FT   gene            140768..141166
FT                   /gene="traM"
FT                   /locus_tag="KPN_pKPN3p06001"
FT   CDS_pept        140768..141166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traM"
FT                   /locus_tag="KPN_pKPN3p06001"
FT                   /product="mating signal"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p06001"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80380"
FT                   /db_xref="GOA:A6TIF7"
FT                   /db_xref="InterPro:IPR007925"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR042073"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIF7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80380.1"
FT                   /translation="MDMAKIQAYVSDEVAEKINAIVEKRKAEGAREKDVSFSSVSTMLV
FT                   ELGLRVYEAQMERKESGFNQMAFNKVLLETVLKTQFATNKILGISCLSPHISGNQKFEW
FT                   RFMIDTILEDTKEVVDTFFPESEDGEEE"
FT   gene            141389..142075
FT                   /gene="traJ"
FT                   /locus_tag="KPN_pKPN3p06002"
FT   CDS_pept        141389..142075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traJ"
FT                   /locus_tag="KPN_pKPN3p06002"
FT                   /product="expression of the tra operon"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p06002"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80381"
FT                   /db_xref="GOA:A6TIF8"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIF8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80381.1"
FT                   /translation="MDRIENTNCSQLDFFREMQLTVNLSSHPACIRLRDGSFSHFNHSF
FT                   ATTFLHNINVNIWFNRLEISSSLRLSALDAEVYSGDRKMLIEENLPINGNRWDFIIERM
FT                   SFDGTEFTLWKFCHLQRGGFLLSPVRSGFIKKLNEFKNALGFLTDVQIETLALYSFGAS
FT                   HNQISEVLNIAVGTSKNRVNRILAALPIRTREEVFYFLFASGMAFSFCKVVTELIGSRV
FT                   NKLLTK"
FT   gene            142159..142530
FT                   /gene="traY"
FT                   /locus_tag="KPN_pKPN3p06003"
FT   CDS_pept        142159..142530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traY"
FT                   /locus_tag="KPN_pKPN3p06003"
FT                   /product="oriT nicking"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p06003"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80382"
FT                   /db_xref="GOA:A6TIF9"
FT                   /db_xref="InterPro:IPR008876"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIF9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80382.1"
FT                   /translation="MTTRPALGPCVSFKLDEDTHLKLVNAKERSGRSKAGEVVLRVKDH
FT                   LLRYPDFYPTVTYKSVSFGPVVMARFDEDTNKKLIAAKNKSNRSKSHEVYLRLKAHLFE
FT                   FPDFYSSEVEVIRRSVSET"
FT   gene            142644..142952
FT                   /gene="traA"
FT                   /locus_tag="KPN_pKPN3p06004"
FT   CDS_pept        142644..142952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traA"
FT                   /locus_tag="KPN_pKPN3p06004"
FT                   /product="F pilin subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p06004"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80383"
FT                   /db_xref="GOA:A6TIG0"
FT                   /db_xref="InterPro:IPR008873"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIG0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80383.1"
FT                   /translation="MSRVFNKKKALKAAKVALPVAAVAAFFPDAAMATTTATDLMKSGD
FT                   ATVKGTFGKQSSVVKWVVLAEVVAGGIMYMMTKNVKFLFGFAIISTFITIGMSVAGY"
FT   gene            142966..143271
FT                   /gene="traL"
FT                   /locus_tag="KPN_pKPN3p06005"
FT   CDS_pept        142966..143271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traL"
FT                   /locus_tag="KPN_pKPN3p06005"
FT                   /product="F pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p06005"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80384"
FT                   /db_xref="GOA:A6TIG1"
FT                   /db_xref="InterPro:IPR009838"
FT                   /db_xref="InterPro:IPR016382"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIG1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80384.1"
FT                   /translation="MTGDELKRYRFPETLTNQSRWFGLYLDELIPAVICLGWGFWTSKF
FT                   IFGMAAAALVFWGIKKLKKGRGSSWLRDLIYWYLPTSLLKGFFHDVPDSCFRQWIK"
FT   gene            143291..143857
FT                   /gene="traE"
FT                   /locus_tag="KPN_pKPN3p06006"
FT   CDS_pept        143291..143857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traE"
FT                   /locus_tag="KPN_pKPN3p06006"
FT                   /product="F pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p06006"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80385"
FT                   /db_xref="GOA:A6TIG2"
FT                   /db_xref="InterPro:IPR007973"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIG2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80385.1"
FT                   /translation="MEHGARQNTTRVIAVGFISLGTLLTLSLATNIIQGINNYRLQTEQ
FT                   KVAVTPMLFRAPFAVSQNQADASYIEQLGLSFVALRLNVTPETVDAQHQQLLRYVLPAA
FT                   QNSLKVQLAEDAKRIKDNNVNATFYMTSIRAWPAENRVDIRGELKTWIGDSKPYSEIKS
FT                   YVIQFSRVDGVSWLARFGEINNEKN"
FT   gene            143844..144584
FT                   /gene="traK"
FT                   /locus_tag="KPN_pKPN3p06007"
FT   CDS_pept        143844..144584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traK"
FT                   /locus_tag="KPN_pKPN3p06007"
FT                   /product="F pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p06007"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80386"
FT                   /db_xref="InterPro:IPR010563"
FT                   /db_xref="InterPro:IPR014126"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIG3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80386.1"
FT                   /translation="MKKINPLFISGCLLLVAPAMSATLSGTLAPTVVPLTNGGQANIAV
FT                   SNTDPNLFTVPGDRITAINSLDGGLTNQEQTDSGGAILATVSKKPFTFIVETERGLNFS
FT                   IRAVPRAGSGRTIQLVSELAGTPGPAKAWEESNPYESLLVSLNRAVRQGSVPDEYQSVP
FT                   VTSEVLQVPAGLRATADRVWVGHHLKVVRYSLDNVSLSARMVRESDFWQPGTRAVMFST
FT                   PAGLLTAGGRMQIWVTTSDEGVER"
FT   gene            144584..146008
FT                   /gene="traB"
FT                   /locus_tag="KPN_pKPN3p06008"
FT   CDS_pept        144584..146008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traB"
FT                   /locus_tag="KPN_pKPN3p06008"
FT                   /product="F pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p06008"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80387"
FT                   /db_xref="GOA:A6TIG4"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIG4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80387.1"
FT                   /translation="MANFNTLIKRKQYIWLGLILAGGAAAVGGGLYLSDLNMSSDEEAP
FT                   AQGEPAPDMTGVVDSSFNSKVEQHATTEMQATAADLNKRFDSLQGEVDLLSKARSADQI
FT                   RIDKLSSDNEAMQNQLKALGVKPAVSGGEPAPTPPSPPPGPEGEPQPASYPPQTGAAVP
FT                   PPTAFYPGNGMTPPPQVSYQSVPVPNQIQRKTFSYDKGKKAKSLPYIPSGSFAKSMLIE
FT                   GADANASVTGNESTVPMQLRITGRVEMPNSKTYDLTGCFVGLEAWGDVSSERAIVRTRN
FT                   ISCIKGDKTIDQPINGHVSFMGKNGVKGEVVMRNGKILGWAWGAGFVDGIGQGMERASQ
FT                   PAVGLGATASVGAGDVLKMGVGGGASKAAQTLSEYYIKRAEQYHPVIPIGAGNEVTVVF
FT                   QDGFQLKTIEELEAEKNGQQQAQNQEAEPAPQADAHHQSGGGMNGFNTDEMLKKLGKLD
FT                   PREFSPGAAPQGENNG"
FT   gene            146001..146597
FT                   /gene="traP"
FT                   /locus_tag="KPN_pKPN3p06009"
FT   CDS_pept        146001..146597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traP"
FT                   /locus_tag="KPN_pKPN3p06009"
FT                   /product="inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p06009"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80388"
FT                   /db_xref="GOA:A6TIG5"
FT                   /db_xref="InterPro:IPR009913"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIG5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80388.1"
FT                   /translation="MAKSLITAVLSVLRWAHWLVKCAVVYPLAMMMLLVVLVFRTGPYT
FT                   FGQTLVKTVESVQQEGYVIQDCTGPKELNSDAVNAPLPPLLQEDCTTVITDAAGYAAYI
FT                   DQSYTHNILWLWLLMAVVFTGIAVVFRRTPVRRGIIRKNGVVVGESVLGSSGLILARSD
FT                   VSQIKRVYDEMSPGEGDKFVRTIKENTQIRMNLKK"
FT   gene            146620..147189
FT                   /gene="traV"
FT                   /locus_tag="KPN_pKPN3p06010"
FT   CDS_pept        146620..147189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traV"
FT                   /locus_tag="KPN_pKPN3p06010"
FT                   /product="F pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p06010"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80389"
FT                   /db_xref="InterPro:IPR014118"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIG6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80389.1"
FT                   /translation="MKELMLLIPLGSALLLTGCAGTETEFQCNATTSDTCMTMEQANEK
FT                   AKLKEERSDAKPAAAGLPRLADGNFRTTSPNSYPLPPQPVINPGRNTAPSVTVSNKPGF
FT                   LNTVPVNYDDVLRTRTAPVYIRPVSLSTYTSPATIPGNYPRPLRNGEETTSLWIAPYVD
FT                   ADDVYHQPATVLFVVKPSAWGQPRLN"
FT   gene            147321..147731
FT                   /locus_tag="KPN_pKPN3p06011"
FT   CDS_pept        147321..147731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p06011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p06011"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80390"
FT                   /db_xref="GOA:A6TIG7"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIG7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80390.1"
FT                   /translation="MTDSMKYLWLLLREDSSYIFMLMLVIVTTVVMSFFLQRLFVSWWG
FT                   KSIILIMCIVVAITEVFGFLEPESTYKQIQTRKQDVIYTLKNCRISAFEAQQAGFLAKA
FT                   KDAWSCPDGVTRYMDVRYRDKAEINKLSTEGK"
FT   gene            147736..148026
FT                   /locus_tag="KPN_pKPN3p06012"
FT   CDS_pept        147736..148026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p06012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p06012"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80391"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIG8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80391.1"
FT                   /translation="MDELFKWLLALASLFLVYLFLFTSSNDPVPEALAHHWTHDCRLLE
FT                   TNIDKGFFSPAQNRLQCGDVIENVSKADYDRAISGDKQTTLAETMKEIFIR"
FT   gene            148050..148268
FT                   /locus_tag="KPN_pKPN3p06013"
FT   CDS_pept        148050..148268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p06013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p06013"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80392"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIG9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80392.1"
FT                   /translation="MHAFIFLVLMTPSSGGGIWDITPMPNTDVCIKMLRVLEARGGRGY
FT                   GSNTGECIEIKTREPLNSVMETLSEGG"
FT   gene            148269..148586
FT                   /locus_tag="KPN_pKPN3p06014"
FT   CDS_pept        148269..148586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p06014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p06014"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80393"
FT                   /db_xref="GOA:A6TIH0"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIH0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80393.1"
FT                   /translation="MAESLLSFDSDGYVRLFFAMAIIICGYGYVIMGVFIRDALAYILM
FT                   LFGLTGLSALFSFMVFMDKNMWAGSPDLTLSVITGFFTATVIFYMFYVLIYSFDQMGAG
FT                   E"
FT   gene            148653..149057
FT                   /locus_tag="KPN_pKPN3p06015"
FT   CDS_pept        148653..149057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p06015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p06015"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80394"
FT                   /db_xref="GOA:A6TIH1"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIH1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80394.1"
FT                   /translation="MKTYYILGHNVAWLNGICLILFVIGVVGALAMVAIPEKFNLGVNR
FT                   GDTFIYCALIAVVGFCGMFVISIHSFSMDELEAGRHWKNDCKTLEVNIPTGAFTSPVNK
FT                   LDCDGIIINVPGERYYAYIHQWELYQANKK"
FT   gene            149088..149345
FT                   /locus_tag="KPN_pKPN3p06016"
FT   CDS_pept        149088..149345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p06016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p06016"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80395"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIH2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80395.1"
FT                   /translation="MLTGPFHSFFWGGLLYLVYDDYRDNGTATEEQLLMISHAIPCAGE
FT                   DFRTALRNSQGPLTLRDAKKIAAKCNEKYKQLNSLNAISK"
FT   gene            149353..149751
FT                   /locus_tag="KPN_pKPN3p06017"
FT   CDS_pept        149353..149751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p06017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p06017"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80396"
FT                   /db_xref="GOA:A6TIH3"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIH3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80396.1"
FT                   /translation="MDMMLFFRKYGFLFIPPVYWLIYLGARLTYNGLAGEYSPDFFQGI
FT                   RHEGIYIICSLCIFYFFCLEVEVSDGEFSANILFLIVFFHVVLLFITLLICLWQGAMLL
FT                   DAIFMGQIIASMCLLFFIPVLSIIRRSF"
FT   gene            152461..152850
FT                   /gene="trbI"
FT                   /locus_tag="KPN_pKPN3p06018"
FT   CDS_pept        152461..152850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbI"
FT                   /locus_tag="KPN_pKPN3p06018"
FT                   /product="inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p06018"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80397"
FT                   /db_xref="GOA:A6TIH4"
FT                   /db_xref="InterPro:IPR014115"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIH4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80397.1"
FT                   /translation="MKNNTEQPVSTTSHTFRRISVIVALVLFALATSAFLSRVVLEYST
FT                   PRVVAFDMKKTLDSFMDSVSQKQLTEAQSKALSDRFNDALEKSLAEYQQQHHVVILVSP
FT                   AVVQGAPDVTRNIQHDIARRMKGEQ"
FT   gene            152850..153476
FT                   /gene="traW"
FT                   /locus_tag="KPN_pKPN3p06019"
FT   CDS_pept        152850..153476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traW"
FT                   /locus_tag="KPN_pKPN3p06019"
FT                   /product="F pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p06019"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80398"
FT                   /db_xref="InterPro:IPR014114"
FT                   /db_xref="InterPro:IPR025864"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIH5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80398.1"
FT                   /translation="MIRLKDCLLAACLVSPLTQAADLGTWGDLWPVREQDMLQLITQRL
FT                   QSLQSSGQWDQTMDAFKQRVIENSQRPAPVEGIKRAEKYEQRWFDPSIRLTEDLKDNEG
FT                   RVFARKGDVVNPLKTVPFVQTLYFINGDDADQLAWMKRQVPETLMSKIILVRGSIPDTS
FT                   AALDSRIYFDQNGVLSKRFGLTAVPARITPAPSGERLNIETFPVK"
FT   gene            153520..154479
FT                   /gene="traU"
FT                   /locus_tag="KPN_pKPN3p06020"
FT   CDS_pept        153520..154479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traU"
FT                   /locus_tag="KPN_pKPN3p06020"
FT                   /product="F pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p06020"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80399"
FT                   /db_xref="InterPro:IPR009649"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIH6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80399.1"
FT                   /translation="MLWGYSLSAAADPSCEGRFVNPITDVCWRCIFPLSLGSVQVGKGD
FT                   LPDTSNPGSPLQLCPAPPPIFVRPGLAIGYWEPMAMTDVSRSPGCMVNLGGFSINLGKT
FT                   GMGTARKDDKQVNGAFYHVHWYKYPLTYWLNIITSAGCLEGGDMDIAYLSEIDPTWVDS
FT                   SLTTILNPEAILFANPIAQGACAADAMASAFHMPLDILFWCAGSQGSMYPFSGWVSNES
FT                   SPLQSSLLVSERMAYKLHRQGQIMESIGKDKAVCYEYPSPIIPKERWRYQMVNMYPDSG
FT                   QCHPVGRSVMRWEAGKNPPNTRKNYGYLMWRKRNCVFL"
FT   gene            154501..155130
FT                   /gene="trbC"
FT                   /locus_tag="KPN_pKPN3p06021"
FT   CDS_pept        154501..155130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbC"
FT                   /locus_tag="KPN_pKPN3p06021"
FT                   /product="F pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p06021"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80400"
FT                   /db_xref="InterPro:IPR014113"
FT                   /db_xref="InterPro:IPR019106"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIH7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80400.1"
FT                   /translation="MNLFMVMLLLTGRAVLAETSSVTDREWLKQQETLSEQLRQHPDKQ
FT                   LQQELEAQINRNPLPKSDRQFIDNLVSQQKAANQEKPAEGALYFVSFSIPEEGLKRMLH
FT                   ETRQYGIPATLRGLVNNDMKTTTDAVLQLVKDGVTDGVQIDPTLYTQYSIRSVPSLVVR
FT                   CQAGYDVVRGNIHVKQALEKVAQTGDCAQVARQILDAPSNAAGSQP"
FT   gene            155189..157144
FT                   /gene="traN"
FT                   /locus_tag="KPN_pKPN3p06022"
FT   CDS_pept        155189..157144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traN"
FT                   /locus_tag="KPN_pKPN3p06022"
FT                   /product="aggregate stability"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p06022"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80401"
FT                   /db_xref="InterPro:IPR014121"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIH8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80401.1"
FT                   /translation="MKTVISVLTAHFFVLSAFIWLASPACADRGSDYKAGSDFAKQVQG
FT                   NGLNSLKNFSGEQNLPGYTDSPDQTKYYGGVTASGDSSLKSDSALEFSQGDTGKAITES
FT                   FTNRPPDQISQDAPFIQAAKDTESRADSIVGDTGQSCTAQVVNRSEFTNHTCERDLQVE
FT                   NFCTREATLKDNATTQKVNRTYQQVVTLNYARSTRQWSGNLTIPTNGRLLNASVDGEPL
FT                   VIPWIEECDSEGKVRDSCKSAVSESLTLFERTFPIDVINWPRSESMCSGGQNTHCTKYT
FT                   YDGKGKIHQSFGVDKAVTAGQNFSVSKTSRTVSSASQKPVQVTVTLVMEETETVYAPEV
FT                   VWVESCPFSKDEGKKTGEECISPGGTRTITLGGRDYSFTEACWKYKDTWLTQPADNGSC
FT                   ESLMKNTACTLSSRQCAFSSEEGTCLHEYATYSCETRTSGKQMICGGDVFCLDGECDKA
FT                   TSGKSNDFGQAVSELAALAAAGKDVAALNGVDVRAFTGKAKFCKKFAAGFSNCCKDSGW
FT                   GQDVGLARCSSEEKALAKAKKDKLTVSIGEFCSKKVLGICLEKKRSYCQFDSKLAQIVQ
FT                   QQGRNGQLHIGFGGASSPDCRGITVAELQGIDFNKLDFTNFMDDLMKNQKIPENDVLTN
FT                   KTRERIKEIMSQQSAQ"
FT   gene            157176..157430
FT                   /gene="trbE"
FT                   /locus_tag="KPN_pKPN3p06023"
FT   CDS_pept        157176..157430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbE"
FT                   /locus_tag="KPN_pKPN3p06023"
FT                   /product="inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p06023"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80402"
FT                   /db_xref="GOA:A6TIH9"
FT                   /db_xref="InterPro:IPR020150"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIH9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80402.1"
FT                   /translation="MKMSFHKKPVIDFVLRLTLTIIIISPVIYFSWDAVKGTSGSDYVE
FT                   SVVFILMAGFAMSVCYLFFSVLEKVINARKSKDESIYHD"
FT   gene            157408..157656
FT                   /locus_tag="KPN_pKPN3p06024"
FT   CDS_pept        157408..157656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p06024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p06024"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80403"
FT                   /db_xref="UniProtKB/TrEMBL:A6TII0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80403.1"
FT                   /translation="MNRYITIEKFIDILNEENLPQEHHVMVLAVLADISLHTDRFLINS
FT                   SELVQMAAQYSPAFQKLPADRQAFISSVLSMPLFLIM"
FT   gene            157669..157995
FT                   /locus_tag="KPN_pKPN3p06025"
FT   CDS_pept        157669..157995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p06025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p06025"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80404"
FT                   /db_xref="GOA:A6TII1"
FT                   /db_xref="UniProtKB/TrEMBL:A6TII1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80404.1"
FT                   /translation="MEEKKAYGLVMVFVGVFVFLLVSIMSYSLWRDRQVNAFMTTNRAW
FT                   GIQCDTVSQAAWVIRDGERVDLQINYLPLYCSGYRFEARDDAGKVQRQLDKYSVYQHLS
FT                   RQSH"
FT   gene            158016..158768
FT                   /gene="traF"
FT                   /locus_tag="KPN_pKPN3p06026"
FT   CDS_pept        158016..158768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traF"
FT                   /locus_tag="KPN_pKPN3p06026"
FT                   /product="F pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p06026"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80405"
FT                   /db_xref="InterPro:IPR014110"
FT                   /db_xref="InterPro:IPR039555"
FT                   /db_xref="UniProtKB/TrEMBL:A6TII2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80405.1"
FT                   /translation="MRTIHAAMLAGCLCCALMPAFAKDAGWQWYNEKLKPRDEDRKAVP
FT                   AAPPPQMDILEKLATLQAATKRSLYEAILYPSSENFVKYFRLQNYWTQQAGLFSMSAKK
FT                   AMLENPELDYNLQYSHYNGTVKNQLAADYAEQRQAISTLAQHYGVMFFYRGREAIDGQL
FT                   VQVIKNFRETYGLSVIPVSVDGVINPMLPDSRTDQGQAEQLGVKFFPAMMLVNPKSGQV
FT                   KPLSYGFISQDDLAKQFLYVSSDFKPNF"
FT   gene            158737..159018
FT                   /gene="traQ"
FT                   /locus_tag="KPN_pKPN3p06027"
FT   CDS_pept        158737..159018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traQ"
FT                   /locus_tag="KPN_pKPN3p06027"
FT                   /product="F pilin synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p06027"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80406"
FT                   /db_xref="GOA:A6TII3"
FT                   /db_xref="InterPro:IPR014112"
FT                   /db_xref="UniProtKB/TrEMBL:A6TII3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80406.1"
FT                   /translation="MSPATLNRISKECVMRNIRFPDLDITGMWVLAVGVFFHLIARLVR
FT                   KQPELAVQAGEIFGLGMVVFGGYRILNALIAEAEKEEKACEKQPDEPR"
FT   gene            158960..159547
FT                   /gene="trbB"
FT                   /locus_tag="KPN_pKPN3p06028"
FT   CDS_pept        158960..159547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbB"
FT                   /locus_tag="KPN_pKPN3p06028"
FT                   /product="inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p06028"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80407"
FT                   /db_xref="GOA:A6TII4"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR014109"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR039555"
FT                   /db_xref="UniProtKB/TrEMBL:A6TII4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80407.1"
FT                   /translation="MLKPKKRRKPVKNSLMNLAKTPLAALALSLALAGVAHAGTLDEVK
FT                   SLWDPRGISGTETASPQSDTPQAVSGASQPRWLRLSNGKQVDLRDWKVVLFMQGHCPYC
FT                   HKFDPVLKQLAGQYGFSVFSYTIDGQGDDAFPEALPAPPDVMQTFFPNIPVATPTTFLV
FT                   NVNTLAAYPILQGATDAQGFMARVDTVFQMMH"
FT   gene            159593..160036
FT                   /gene="trbF"
FT                   /locus_tag="KPN_pKPN3p06029"
FT   CDS_pept        159593..160036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbF"
FT                   /locus_tag="KPN_pKPN3p06029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p06029"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80408"
FT                   /db_xref="GOA:A6TII5"
FT                   /db_xref="UniProtKB/TrEMBL:A6TII5"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80408.1"
FT                   /translation="MNKYIRSTGLYAFLFPASLKDSGQTAAEKIEQLKPEFIHRERRLE
FT                   IYLELFIVFLTAGALLLWIMRFLFNLCVDDWIASGDLRVKDLWNIMMYAIPYALIAVGV
FT                   GFFVAGVTLAIRNFFSYHLKTLFILRNDRVKKNAVRNGGLDAN"
FT   gene            160014..161393
FT                   /gene="traH"
FT                   /locus_tag="KPN_pKPN3p06030"
FT   CDS_pept        160014..161393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traH"
FT                   /locus_tag="KPN_pKPN3p06030"
FT                   /product="F pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p06030"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80409"
FT                   /db_xref="InterPro:IPR010927"
FT                   /db_xref="UniProtKB/TrEMBL:A6TII6"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80409.1"
FT                   /translation="MEDWMRIKLLSLFCGAVLGLSFSAAADVNGDMNNFFNKLGFASNT
FT                   SQPQVWQGQAAGYASGGSLYARTQVKTIQLVSMTLPDINAGCGGIDAYLGSFSYINSEQ
FT                   LQRFAKQIMSNAAGYFFDLALQTTVPEIKTAKDFLQKMATDMNSMNLSSCQAAQGIVGG
FT                   LFPRTQVAQQKVCQDIAGESNIFSDWAASRQGCTVGGKMDSVQDKASDKDKERVMKNIN
FT                   IMWNALSKNRLFDGNKELKEFIMTLTGTLIFGENSEITPLPARTTDQDLIRAMMEGGTA
FT                   KIYHCNDSDKCLKVVADATVTITSNKALKSQISALLSSIQNKAVADEKLTDQEKGFISS
FT                   TTIPVFKYLVDPQMLGVSNSLIYQLTDYIGYDILLQYIQELIQQARAMISTGNYPQSTM
FT                   DMIMENLNQASVQIAAFQSRVQVQQDALLVVDRQMSYMRQQVSARMMTRYQNNYHFGGN
FT                   L"
FT   gene            161393..164242
FT                   /gene="traG"
FT                   /locus_tag="KPN_pKPN3p06031"
FT   CDS_pept        161393..164242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traG"
FT                   /locus_tag="KPN_pKPN3p06031"
FT                   /product="F pilus assembly and aggregate stability protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p06031"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80410"
FT                   /db_xref="GOA:A6TII7"
FT                   /db_xref="InterPro:IPR012931"
FT                   /db_xref="UniProtKB/TrEMBL:A6TII7"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80410.1"
FT                   /translation="MLEIYAIAGGDWLRGNLNAIAAFMGTSTWSTIEKMCIAISVLIVA
FT                   GNWVKKHNVMDLIGWVFSLTLVSMLVVIRTPVQIIDYSNVAQVYEVDNVPIGLAIPASL
FT                   TTRVGNALIQSYEMVFALPDSVTYSKTGMLFGSNLVAKSTDFLSQNPQITTLFSDYVQN
FT                   CVMGDIFLNHKYSFEELLNSPDPYTLIFANPSPLRGVFDKNNQFQTCEEASRDLKSALA
FT                   LDTQTGGKTWNYYVRQLFGGKPNPDLLFSQMIGDSYNYFYSSGQSAGQIIRQNVTMNAL
FT                   RSGIQSYAARSGDTASLVNIANTSSLEKQRLAQATMGHQALRTLPLMQTVIMGIMIGMF
FT                   PIMVMAAMFNMMTLQVLKGYVFALIWLQTWPLLFAILNSAMAYYAKQNGVPVVLSELSQ
FT                   VQLKNSDIATTAGYIAVMIPPLSWGIVKSMGAAFSSAYSHFSSSGLGATSQAASGVVDG
FT                   NYSFANMQMENVSGYSWGTNSTTSFGQMSRQLANGGMSTQTRDGSMVWDSGGAMSKLPV
FT                   DINVGRQIASAQQQMAREADVQAESALHGYNSSVTSAWNVLKQFGTNRGTSSSMTTGAD
FT                   NTESSQDTMAKSKMWNAVVANAKANNISNEQSFQNLMDESTRGTVTGEAHVGARWSSGD
FT                   QLAGKIGKLATGASVEGGIKGSISGSGSTGSTDTVGQSGRHSSDSRHDISSQAAKDFRE
FT                   ASDYLVSHKTNTSGNITDNNASSRVDQFAASLSSAKNSYDQYTTSRTRSHEYSEMASRT
FT                   ESLTGQMSENLTQQFANFVQHRAPQDAEAILTNTSSPEIAAQREMLAREFVKAQVEPRI
FT                   DSSFEQGRNDIGNGMASVSGTPGDQTVVSDFGKHSGDIESMSRNSGIKENVRNQVDSMV
FT                   EDNTRINNAGKINIKEQGEGIKQQNADFEMLHKKEGNDFNERYNKELNGQVNNPLSNTT
FT                   EEFRKKAEESARKMDGKLP"
FT   gene            164255..164803
FT                   /gene="traS"
FT                   /locus_tag="KPN_pKPN3p06032"
FT   CDS_pept        164255..164803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traS"
FT                   /locus_tag="KPN_pKPN3p06032"
FT                   /product="surface exclusion"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p06032"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80411"
FT                   /db_xref="GOA:A6TII8"
FT                   /db_xref="UniProtKB/TrEMBL:A6TII8"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80411.1"
FT                   /translation="MITNKQILTEVEQLSRLFKDGEADIPSMWNCFWPGLAAMFWLLLW
FT                   PIAMFSYKLFFVELPNAAQMGIAASVLVAFVAGLFMMLYIVNFRALYLSIPDTYRKQSA
FT                   LCQFIVGKAKFYCRVYLLTYVFLIISCTYPVYGAIYSTVLFICFSFCLMQIVNVDLSRY
FT                   QLTALTSLLETFKTSKSEK"
FT   gene            164963..165718
FT                   /gene="traT"
FT                   /locus_tag="KPN_pKPN3p06033"
FT   CDS_pept        164963..165718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traT"
FT                   /locus_tag="KPN_pKPN3p06033"
FT                   /product="surface exclusion"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p06033"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80412"
FT                   /db_xref="GOA:A6TII9"
FT                   /db_xref="InterPro:IPR008874"
FT                   /db_xref="UniProtKB/TrEMBL:A6TII9"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80412.1"
FT                   /translation="MIMVQGICMQFNKLMTVMVVSSALALSGCSAMGTAIKKRNLEVKT
FT                   QMSETIWLEPSNNKTVYLQIKNTSDKDMSGLQAKIASAVTSKGYQVVSNPDTAGYWIQA
FT                   NVLKADKMDLRESQGWLSRGYEGAVTGAALGAGITAYNSSSAGATLGVGLAAGLVGMAA
FT                   DAMVEDVNYTMITDVQIAERTKTQVQTDNVAVLRQGTSGAKVQTSTETGNQHKYQTRVV
FT                   SNANKVNLKFPEAQPVLEDQLAKSIANIL"
FT   gene            166216..166599
FT                   /locus_tag="KPN_pKPN3p06034"
FT   CDS_pept        166216..166599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPN_pKPN3p06034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p06034"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80413"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIJ0"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80413.1"
FT                   /translation="MEGPASTDDSALSSLASRVVREAENLYIPGVNRRDSADDVFAWSV
FT                   QTQFPSDRLFGTRIFPSTGWFERPDMIKPPVKCYCVCLQYTAETLPSTLHALVDEAGRQ
FT                   VAKSYIKGGHCPGSEGYSFCITS"
FT   gene            166728..169040
FT                   /gene="traD"
FT                   /locus_tag="KPN_pKPN3p06035"
FT   CDS_pept        166728..169040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traD"
FT                   /locus_tag="KPN_pKPN3p06035"
FT                   /product="DNA transport"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p06035"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80414"
FT                   /db_xref="GOA:A6TIJ1"
FT                   /db_xref="InterPro:IPR014128"
FT                   /db_xref="InterPro:IPR019476"
FT                   /db_xref="InterPro:IPR022585"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIJ1"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80414.1"
FT                   /translation="MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLML
FT                   MYRLSWQTFVNGCVYWWCTTLGPMRDIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWC
FT                   GEQLWTGFAFAAVVSLVICIVTFFIASWVLGRQGKQQSEDENTGGRQLSDKPKEVARQM
FT                   KRDGVASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVRARGDMAIIYDRS
FT                   CEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQGS
FT                   GRTIFAEGAYLMREDDDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISI
FT                   RAVLTNYVKAIRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVIS
FT                   MWLSIAIRGLLAMGENRNRRVWIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYA
FT                   QLEDIYGVKPAATLFDVMNTRAFFRSPSKEIAEFAAGEIGEKEILKASEQYSYGADPVR
FT                   DGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLALKYKPRPKIAEGFIPRT
FT                   LDARVDARLSALLEAREAEGSLARALFTPDTPEPGPADTDSHASEQPEPVSPPAPAVMT
FT                   VTPAPVKSPPTTKRPAAEPSVRATEPPVLRGTTVPLIKPKAAAAATAASTASSAGAPAA
FT                   AAGGTEQELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNIN
FT                   HSHRHDEQDDVEIGGNF"
FT   gene            169040..174301
FT                   /gene="traI"
FT                   /locus_tag="KPN_pKPN3p06036"
FT   CDS_pept        169040..174301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traI"
FT                   /locus_tag="KPN_pKPN3p06036"
FT                   /product="oriT nicking-unwinding"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p06036"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80415"
FT                   /db_xref="GOA:A6TIJ2"
FT                   /db_xref="InterPro:IPR009767"
FT                   /db_xref="InterPro:IPR014059"
FT                   /db_xref="InterPro:IPR014129"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040668"
FT                   /db_xref="InterPro:IPR040987"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIJ2"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80415.1"
FT                   /translation="MMSIGSVKSAGSAGNYYTDKDNYYVIGSMDERWQGKGAEALGIDG
FT                   KAVDKALFTELLKGKLPDGSDLTRIQDGANRHRPGYDLTFSAPKSVSVMAMLGGDKRLI
FT                   DAHNQAVTEAVRQLETLAATRVMTDGKSETVLTGNLIVAKFNHDTNRNQEPQIHTHAVV
FT                   INATQNGDKWQSLGTDKIGKTGFIENVYANQIAFGKLYREAFKPLVEKLGYETEVVGKH
FT                   GMWEMKGVPVEPFSTRSQEVREAAGPDASLKSRDVAALDTRKSKEAIDPAEKMVEWMNT
FT                   LKETGFDIRGYREAADARAAELARAPAAPVNTDGPDITDVVTKAIAGLSDRKVQFTYAD
FT                   LLARTVGQLEAKDGVFDLARKGIDAAIEREQLIPLDREKGLFTSNIHVLDELAVKALSQ
FT                   EVQRQNHVSVTPDASVVRQVPFSDAVSVLAQDRLVMGIVSGQGGATGQRERVAELTLMA
FT                   REQGRDVHILAADNRSRDFLAGDVRLAGETVTGKSALQDGTAFIPGGTLIVDQAEKLSL
FT                   KETISLLDGAMRHNVQVLLSDSGKRSGTGSALTVLKDSGVNTYRWQGGQQTTADIISEP
FT                   DKGARYSRLAQEFAVSVREGQESVAQISGTREQSVLNGLIRDSLRQEGVLGEKDTTITA
FT                   LTPVWLDSKSRGVRDYYREGMVMERWDPENRTHDRFVIDRVTASSNMLTLKDRDGVRLD
FT                   LKVSAVDSQWTLFRAETLPVAEGERLAVLGKIPDTRLKGGESITVMKVEEGQLTVQRPG
FT                   QKTTQTLAVGAGVFDGIKIGHGWVESPGRSVSETATVFASVTQRELDNATLNQLAQSGS
FT                   HLRLYSAQDAARTTEKLSRHTAFSVVSEQLKSRSGETDLDAAIAQQKAGLHTPAEQAIH
FT                   LAIPLLESQDLTFSRPQLLATAMETGGGKVSMADIDTTIQAQIRSGQLLNVPVAHGYGN
FT                   DLLISRQTWDAEKSILTHVLEGKDAVAPLMDRVPASLMTDLTAGQRAATRMILESTDRF
FT                   TVVQGYAGVGKTTQFRAVMSAISLLPEETRPRVIGLAPTHRAVGEMQSAGVDARTTASF
FT                   LHDTQLLQRNGQTPDFSNTLFLLDESSMVGLADMAKAHSLIVAGGGRAVSSGDNDQLQP
FT                   IAPGQPFRLMQQRSAADVAIMKEIVRQMPELRPAVYSLIERDVHRALTTIEQVTPEQVP
FT                   RKEGAWAPGSSVVEFTPKQEKAIEKALSEGKTLPEGQPATLYEALVKDYTGRTPEAQSQ
FT                   TLVITHLNKDRRALNSLIHDARRENGETGKEEITLPVLVTSNIRDGELRKLSTWTAHKE
FT                   AVALVDNVYHRISKVDKDNQLITLTDSEGKERFISPREASAEGVTLYRQEKITVSQGDR
FT                   MRFSKSDPERGYVANSIWEVQSVSGDSVTLSDGKITRTLTPKAEQAQQHIDLAYAITAH
FT                   GAQGASEPYAIALEGVAGGREQMASFESAYVALSRMKQHVQVYTDNREGWIKAIKNSPE
FT                   KATAHDILEPRNDRAVKTADLLFGRARPLDETAAGRAALQQSGLAQGSSPGKFISPGKK
FT                   YPQPHVALPAFDKNGKAAGIWLSPLTDRDGRLEAIGGEGRIMGNEDARFVALQNSRNGE
FT                   SLLAGNMGEGVRMARDNPDTGVVVRLAGDDRPWNPGAMTGGRVWAEPAPVAPVPQAGAD
FT                   IILPPEVLAQRAAEEQQRREMEKKAEQTAREMAGEARKAGEPADRVKEVIGDVIRGLER
FT                   DRPGTEKTTLPDDPQFRRQEEAIQQVASERLQRERLQAVERDMVRDLNREKTLGGD"
FT   gene            174381..175106
FT                   /gene="traX"
FT                   /locus_tag="KPN_pKPN3p06037"
FT   CDS_pept        174381..175106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traX"
FT                   /locus_tag="KPN_pKPN3p06037"
FT                   /product="F pilin acetylation"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p06037"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80416"
FT                   /db_xref="GOA:A6TIJ3"
FT                   /db_xref="InterPro:IPR008875"
FT                   /db_xref="InterPro:IPR014125"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIJ3"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80416.1"
FT                   /translation="MRAQHTFPGATDRWLHRLLTWAPGQTDMIKTVALVLMVTDHTGLL
FT                   LAGNNEVMRLLGRGCFPLFGLAWGMNLARHAEIRQSQLNSLWGWALVAQVSFMLIGYPW
FT                   YSGNILFAFAVTGQVLRWVSQPSWYYTLPAAGLLVAWIPLSTASYGMAGVGMLTASWLL
FT                   CRAQHAQERLGYGVLWALMVLLMNMHDVSESVAGLAIALLTLMVCSSAGERVKRFWPRQ
FT                   FFVMFYAVHLAVLGIVVSM"
FT   gene            175264..175860
FT                   /gene="finO"
FT                   /locus_tag="KPN_pKPN3p06038"
FT   CDS_pept        175264..175860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="finO"
FT                   /locus_tag="KPN_pKPN3p06038"
FT                   /product="fertility inhibition, regulation"
FT                   /db_xref="EnsemblGenomes-Gn:KPN_pKPN3p06038"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80417"
FT                   /db_xref="GOA:A6TIJ4"
FT                   /db_xref="InterPro:IPR016103"
FT                   /db_xref="InterPro:IPR021065"
FT                   /db_xref="InterPro:IPR036442"
FT                   /db_xref="UniProtKB/TrEMBL:A6TIJ4"
FT                   /inference="ab initio prediction:Genemark:2.0"
FT                   /protein_id="ABR80417.1"
FT                   /translation="MSEEKRPVLSLKRKPAENSTAPAEATPAPGVVRRKKVVVVSSPPA
FT                   WKAKKEKLEKVKQAAEAAARNAAPVPVKAVKTPPPVRYLRLLPPEQAIMTLKAFWPQLF
FT                   DGNSPRLLATGMREQLFADIVNRDLPLSHKQVIKCLKSLTRSAGYLSRMKEGAARYDLQ
FT                   GNAVATVTAGEAQYASERMMKELLRTERMRSQSAG"
XX
SQ   Sequence 175879 BP; 42689 A; 44713 C; 46200 G; 42277 T; 0 other;
     atggattttg aagcgcggaa acaaaaggcg ctggcgataa tggccagctg taagatgtgg        60
     aaaagcaatt atgcaccgct tctgatacga ctgttgtggc ggctggggat aaacattccc       120
     ccgctgccgt ttgctccgtt ctggcaggtt tttggcgtga tggcaggctc tttctccgtc       180
     ggatacggac tgtggatgta ctggatggtg tggcgggccc aggggatgcc acccctgttc       240
     gcttgcaaaa tcagtcttat tgcgggcgtg ttatttggcc tgacgatggc actgtttcat       300
     ctgtggcgcc gaaaggtgaa taaattacct gactggaaag atttataacg gaatcagaag       360
     aacgccggaa acaggactta ccctggctga atggcatgaa tttccgcgct atgcacttgc       420
     gtgcatactc atgcatgccg taaaaacagc ccctgcgcgt ttctggcggg ttttcggtgt       480
     tttgccagtt tcccgtcaga aacgccctga ggccgttctg gcggtgctta caattaaggg       540
     attatggtaa agggtgactt ggttaatcat aaatatcctg ggggatggca tacaccagct       600
     ggatatccgg tgcatcgttg agccatcgac ctgatttttt catcaggtag ccaccaattt       660
     cttcggtagt cagccgagca tgaaacaatg cttcatcatt gaaccagcag tcagggtgat       720
     agatgagatc cagtgggttt gccctgaaat taatctccag taactggagt gcatagctgt       780
     ggtcagatgc actaccttct gctttgcgta tgaagttgat aacgtcgttc agttctgtcc       840
     atgtaaagtc atcaaggtat ttttcctgat taagcgccat cctggtgaaa tctagtgcac       900
     ttgtccagga tgaaaaatca cgaaaatcag agaacccgca gggtatgacg acctgtgcat       960
     tccagtctgc catcatctgt tttagttctt cattgttttc gtccatcccg ttatcgatgt      1020
     gatcgagaat gccattcagc tgactgacca gttctttcat ctgtttacgg gtgacccgtg      1080
     cgggtttcat tcgctcaggt aatggcatca gaaatactct cttttttatc gtgcactcgg      1140
     gggaactaag taatctatcg ggctatgaat cagagctcaa atcgtttttt ttctttctga      1200
     tgatccgcat tctgcctcgg gtccacctct gctgttattt ttaagtgaat gaaaataaat      1260
     aaaaatattg ttaaccacga catattgaca gagctggtat atcaagagca gcatcaaaat      1320
     actgtatata aatacatgct tttatatgca gtaactggcg tggcagagaa ctaataacag      1380
     cctccggata gctgtcctga agcaataaac cgcacgccgt atttcagaaa attggaaaac      1440
     aaaaaaaaca aaagaaggaa atgtgtgatt ggtggattta actataacgg tgagggtgct      1500
     acgagctcag gccttagctc tccttctgcc agtgatgtgg ctaatcagtt taatagtttt      1560
     ggtgggacgc aaatccgggc atcagatgtc tcgaatattc gcagtgatgg taatggtggg      1620
     tatatggcgg atattcgggg gcagattcac actgtgtcct ctgaggaagg ctcaacaact      1680
     gtcagtggct tcgatggtgt ccgcagttct tctaccggta atggcggaag tcagggtggg      1740
     caggggccac agggacagtc tcttgttatg cataacgggc agatgggata ctgggaaaac      1800
     cgatcatccg gggctggtaa taacgaacat actacccgcg cttttgtggc tgtaggtcca      1860
     tcagaagcag aaaaagctgc acgagcggag aaggtagcta aggaaaaaca gcaagcagaa      1920
     gaggctgcaa aagcattcgc agcgaaaaca gcagcggcat ccgccgctgc tgaaaaagaa      1980
     cgtcagaatg cgatttctgc tgcggctgct gcaggtcaac atcaaactgt tcctgatgcg      2040
     cgtaataatc tgaatcaggc gactgctgaa gcatcacgcc tgaaaacagt ggcagataat      2100
     gcccttaata cagcgaagaa taagcgaaag gaagctatcg atgccgtacc agtagcaact      2160
     caggctgaga aaaaatatca ggatctgcag caaagcatta aaggcctcac tctaaataat      2220
     aacggccaat acggtaccca aaaatgggag gttatcagtt cgaataaaga gcatgaccac      2280
     tggggatacc ggttctatcc atctgggatc acaaaagctc aggttgatgc agcgcagaat      2340
     gatgcggtga acaaacgaaa tgctgctacc agtcttgcca gtcaggcaac ggccgctgag      2400
     caggccagtc tgcaggcatc agctgcctat aatgctgcag aaacgcgccg tcaggctgcc      2460
     caggctgcat tagcgtccgc agaacaagcc gccgctgctg aacgtaaacg ccaggaggcg      2520
     gaagcagcag ccgccgctgc ggcagaaaaa aaacgacagg ctgatgcagc agcgaaagcc      2580
     gctgaggagg ccagagccat tgctgaaaaa gcaaaagcgc tgcaggcccg ttgtacagcc      2640
     gcagataaac tgaaatcttc agagattcag gctgtcaggg gtatcccggc tacagcggca      2700
     ccttttgcta ttcctctgac ctggtcaact gcgtcacgtg gaggttttac tctgtcggct      2760
     gatgctgcgg ccagcctggg agctttcatc agcgaggctc tggcgacgtt aagtgtcgct      2820
     gtggtggcta acccagtagc attaaccatt gccggtcttg tgttatcgaa atcagttggc      2880
     gtcggtagtg atatggtgcc cggtcgggat atcagttcga tgatgcctgg cgatgcgttt      2940
     ggtctgcctg ataccgcggc attgaataaa gcagcagatc agaaaacatc tgtcagtatg      3000
     ccggttcgtg gccgtctggt tatgaatgat agcggcattc tggatgttca gctggtcaaa      3060
     accaatactg ccggtgccgt gaaggtcgct cgtgctgtac tggataagga aaccggctac      3120
     tggggctata ctcttcccgc tgtcgcagat gtaccggcgc aaactatttt tgtcagcccg      3180
     gctgacgcac ttggtgcaaa tggaccactg acgctaagcg ggccggtacc actaccggag      3240
     cgtattctgc ataccggtga tcagatttcg gcgccacagg ctacagataa aaccgtgacg      3300
     ccggtagcgg atgacctcga ttttgacgat attattctgg tgtttccacc ggagtccggc      3360
     ctaaaaccgc tgtatgtgat gtaccgtagc cctcgtaaca tgcccggtac agtaagcggc      3420
     aaagggcaga acgttggcaa taactggatg gggggggcca gtaccgggga tggtgctcct      3480
     gttccttccc agattgcgga taaattacgc gggaagactt tcggtagttt tgattcttcc      3540
     cgtcgggcgt tctggaaagc ggttgctgac gattctgcac taagcaagca atttagtgaa      3600
     gctgatatta atcagatgaa agctggaagg gcacctactg cggacttttt agaatcagta      3660
     gggaaacgtg ttaaaattga attacaccac gaaaaagaaa tatctcaagg aggggctgtt      3720
     atggatgtcg ataacattaa ggcgctaaca cctaaaaatc atattgagac acataaagga      3780
     aaataaaatg gctggtaata aaatttcaga ttttacggaa gaagaattta ctgcttttgt      3840
     tagtaaaata atcgctgctg attttccaac tgacaaagag aacgatgatg ctatttattc      3900
     gttcgcccaa ctaacagagc atcctgctgg ttggaacctc atcttcaagc ctaaggtagg      3960
     cgaagattct tcggcgaaag gaattgttaa aaccgtaaag gaatggcgag ctgctaacgg      4020
     taagccaggt tttaaaaatc gtgattggat gtgcgggttc aggtgatgaa tccgcacatt      4080
     tttaactctg gatttgaaga ataattacta gatatccatt attttttcct gtctccaaac      4140
     tgaccccatg atggatggtt tctgggctct gtccacgata ccggcgacgg acccgtctgc      4200
     tactggtttc ggcataccac aaaatcctga cgcctccgca tggcgtcgtt gtccaacccc      4260
     gggaacgggg aaaagccagt ttcccccgct cccggcgttt cttaaacacc cgttaaggaa      4320
     atactgtgaa aaaaatgaac cgtacactcc acaaatgttg tctgtcgggg cttatcagcc      4380
     tggctttgtg tgcacctgtt ccggccgtgt atgccgccag catcgagacg ggatattctc      4440
     cggaaggaac ggctctgcag ttggtcctga agactattga ttctgcgcag caggaaatcc      4500
     gactgatggg gtattccttt acctcgcctg aagtcgccgg tgcgcttgtc agggcaaagc      4560
     ggcgtggtgt cgatgtgaaa gtggttctgg actggaaagc caataccggc aagcaaaacc      4620
     aggcgagcct ggcggccatg aatcttctgg tcaatgccgg catcccggtt cgcacagtgt      4680
     cgcagtacaa aatcatgcac gacaaagtca tcattgccga cggccgcaat attgaagtcg      4740
     ggtcttttaa ctacacccgc gccgctgatc gggtaaattc agagaacgtg cttgtcgtat      4800
     gggatgatcc agtcgttgct caacgctatc tgcagcactg gttgactcgc tggtcgcagg      4860
     gtacggactg gaaacgggct tattaatgct cctcagacat aaaacgagca tcaatacggt      4920
     ttacttacgt ccatgctaaa gcgcctggtc cgcccgtcgc tcgtatctta tctcttaagc      4980
     cttgcccctg aaggtactca cttttagttc aggatggggc tactatccca ctctcttaaa      5040
     agaggacata ggcatctcat tcagttgaaa tttgtacgcc aatacaaatt acaattttag      5100
     aaaggatctc ttgcaaattg aaagtaagtt attgatttgc aggatctgag agttctgtag      5160
     tatcctccgt tccgaagaca tttctgaggt gtcaggagag cgataaatgt cacgttcagc      5220
     agataaaacc acttcctcta cgaatgcaaa acgtgcatac cggaaaggta agccaatgtc      5280
     tgccagtgag aggcagcttg ctgcaattgc gcggaaacgc gaaactcata aagaagttaa      5340
     ggtttttgtt aaaaacccac taaaggacgt gatgatagcg gtttgtgagg aagaaggtct      5400
     gacacaagcc cagtttatcg agaaactcct cgagcgagag cttacagaac gtggtcttat      5460
     agatgtaaag acttcacatt cttgatcatg tttttattga gtgctagatt gttgatggtc      5520
     tgaataattt tgggtgtgcc acgccctaag gtggcaggga actggttctg atgaggtatc      5580
     tacccgggac cagaaaagca aaaaccccga taatcttctt caatcttggc ggaaggaaaa      5640
     gattaacggg gccttcataa actgcataga acgtgttgct ctatgcgggg agtatatgta      5700
     catgctcaga aaacttcaag atcagtttct gtgtcattcg ctccttccgt gcaacataag      5760
     cgcaggaagc ggtgactgat atccttcaaa accactattc acaggttaaa aacccgaatc      5820
     cggtattcac gccgcgtgaa gggaaaaaga ccctgccgtt ctgccgtaag ctgatggcga      5880
     aagccgaagg cttcacgtcc cgttttgatt tttccattca tgtggcgttt ttgcgttcgc      5940
     tgggtaagcg gcacaggatg ccacccctgt tgcgccggcg tgcaattgac gcgctactgc      6000
     aggcaatgtg ttttcactat gatccgctgg ccaatcgcgt gcagcgctcg attaccaata      6060
     tggccatcga gtgtggactg gccaccgagt ccaggagcgg caacctgtca gtcagccgtg      6120
     ccacccgggc gctgaagttt ctggccgagc tggggctcat cacctatcag actgaatatg      6180
     acccgcagat cggctgtaac atcccgaccg atatcacctt caccccggct ctgttttccg      6240
     cgcttgacgt ttctgaggtg gctgtggtgg ccgcgcgccg cagccgtgtg gagtgggaaa      6300
     acctgcagcg caaaaagcag aaactgaaac ccctggagat ggacgaactg atcgcaaaag      6360
     cgtggcggtt tgtgcgtgag cgttttcgca gctatcaggc tgagcgtaaa tctcacggcc      6420
     gtaagcggga tactgcacgg cgggatgcat cacggcagcg tcatgacatc gagacgcgcg      6480
     tgcgtcagca actgacccgc gaatacgcca ccggccgctt catgggcgat aaagaagcgc      6540
     tgaagcgtga ggttgagcgc cgtgtgcagg agcgcatgct gctgtcgcgc gggaacaact      6600
     acacgcgact ggccactgtc cccctataac attccttcct taaaaaatcc ggccggcgcc      6660
     ggaggctttc gcacgcctgt tggccggcta ctacgtatta tcttatcttc aggcctgctt      6720
     tcctcaccat aattccggtc ttccttgcgt caacgtggcc ttaaatgtta tcgccggcgt      6780
     cacttctgac ggccgatttc tgttatccac atataactgc aagggagtat ttcattaggc      6840
     tacaaccgtg atacgtacaa agcacatgcc gtcggacttt cagggcgcgt ggttcctttt      6900
     aaacaccagc tctgtatctc ttttaaagat cctttaataa atcctgtaaa cacataacct      6960
     gttcatcgcc tgccctgtgg acaggctgcg gagagtgccc gcccttgcag cgacctgacg      7020
     gtcgcgccgg ttcggcaaca tcagagagag ctcccatcgc tgcgcgacgg gccccaaccg      7080
     gagaaccaca ttagttacag cattcaaaag gaaatccgtc ataaaaccgg cgccggtttg      7140
     ccagccaggt gcccctcccc accactgaaa agcgccgccg cccccggccg aaggccggga      7200
     gtagtgtcgc ttttaatgat gggtgttgta actattcttc ttcatcgctg tgggtggtgc      7260
     tgtggtcagt tgtttagtac acgctcgtaa gcggccctgc ggcccgctaa cgcggagata      7320
     cgccccgact gcggctgtcg ccttgtcggg accactccga ccgcgtacag aggcgtctga      7380
     gctgttttaa gcgggtatgg ctttgcagct accgtgttaa gttccctggt gtcgctgaaa      7440
     tagttgatga acatccccct aagcgtcagc agcaagctgc cgccgctaag gccccggaaa      7500
     tcacgccctt tacgtcgtaa acgccgtaaa gcccgctcac cggggttaaa agggattact      7560
     ttgacttctt cattgctgtt agatggttaa ggctaatcag ggcagggggt agggtggcag      7620
     agtttatagc caggtaaccg gctacgccgg gctttcggcg ccatttgacg ccacagacac      7680
     atgtaacctc atctggcgcc tccatgccgc tgacgcggca tccagaagtt tcccgatgct      7740
     gtaagtctta acgtctgctt tgtgccagaa gcggacactg ttcacaatat cgagttaatc      7800
     attggatatg ttgatcgctc ccattgaaaa atttcacatt atccaatata tcattgttga      7860
     ggcttccctc ttacacctct aaaggataac tatcatgggt cttaaacctg gtccaaaacc      7920
     aattgctaaa tcgacaggaa aaccggatca acgtcgacgt gataataaag atactcctgg      7980
     taataccccg ggactaaagc ctagtaaatc tacagggaaa taaaaaattc agggtatata      8040
     tgtcttattt ataccctgat tacatatcca gattactaaa gatgtttctg caaccagatg      8100
     cgcgtacctt ctgtttcata cgcctttgca ccataccctt tcgcaagaag ggactctggt      8160
     aaatactcgt catatttatc taagtacttt tctggaacat ctgtggcaag atcaaatgca      8220
     gatggcaagc ctgacaacag catttctttc agcgcgtgct gaacggaagc tacactggag      8280
     ttatcgattt ctataacgcc agcaaatgaa tttgctttaa aaccacaacg tatgagcaag      8340
     gctgtaatcg tattgacaac tttatccccc atccagggta ttacgtaaca gtgttgtcca      8400
     ctcgtaataa aacactcatt ttgaagttta aaacgctgaa agttactaca gccttccgca      8460
     aataggtttc tggcggcagt atcggcataa tctactttct tgctacctat tgctatgcgg      8520
     taatcacctt ccctatagat agcgagcatt tcctgacgaa cggcatcatg aacagacata      8580
     cctcccccac taaattgtgg tggctgaccg cctttggttg cctctacata gataactttt      8640
     ttctctgtct cgatctctgt cactttccag cgccgcccac cgaagatgat gtgttggtct      8700
     ggtagcagtg gggagtccac aggcactgtt ccaagggttc tgtttccggt gataatgcgg      8760
     aactcttctg gtgtattgaa cacggcataa aaagtgtaat ggttagtcag tttctccccc      8820
     tctgccccaa caaccatttc gccgctagca agttgagtga gtaggccaca tgctcccata      8880
     tgtttaagca ggcttttgaa atcgtttaaa tctacatttc tgaacggccc tgtctggcat      8940
     agttgtgacc agagctggtc ggcacgaact ccaccccatt gtgcggtaat tgcaagaatc      9000
     tggtgtagca gcgtggagta atgcatctgc cgggaatcgg caggctcaaa ccattgttta      9060
     gagatcatca acctgatcat tgccatcgac tgcaccaact ggagtcgtag gtgatcaacg      9120
     atactgctac tcacagtaag ctcattttct gtaattagca ttctgagtac tgacggggaa      9180
     tcgcgtcgcc cagaacgccc cattcgctgg cgcaaactgg aaacagaatg cggaggcgta      9240
     acttggataa ccgatttaac cttaccgata tcaattccca actcaagcgt cattgtacaa      9300
     acagctgttg tgggcaaatt tcctttctga agacgagatt caagcacctc acgtaattcc      9360
     ttggcaaggg aaccatggtg ggggaaaaat tcattcggaa caatttgttc ctcacacatg      9420
     tcgctcagcg ttgccgcaat gctttcagtg cgttttcggc tgtttgcaaa gaccaaatga      9480
     gaatcgccac ggcaaagtct aaaaatgtca gcgcaaacgt catgttcagc tgaactctga      9540
     agttcttcct cattttggat cactcgctcc aggtaccctt tgacctgtac ctgaagagtg      9600
     gccatgctat tactatctgt aacagttacg caggggagtc gtttgtccgg gcgcaacatt      9660
     tcgggcactt tctccagttc ccccagcgtg gcactcaacg caacgcgggg aattggattt      9720
     acctggcatc ctagcacatg gtcaattcta ttgagcagag aaagcagctg tacaccacgc      9780
     tctgaaccaa taaaagcatg aaactcatca ataacgatgt atgcgactga agaaaacgcc      9840
     tgtttgagcc agcccattga atttatgagc aaagactcaa gtgactcagg tgtaatcagt      9900
     aaaatgccag cagggttcgt ccgagccttc ttctttttgc tttgtggtac atccccgtgc      9960
     cagggagtca ctggcatttc caatgcatct ccaaggctcc caagacgacg gtactgatcg     10020
     ttaatcaatg ccttcaacgg actgatatag acgatgccaa atccattcgt gagatctgca     10080
     actgccgaac aggcaggaag aaagaaagcc tctgttttac ccgctgctgt acctgcactg     10140
     attagcacgt ctcgatcacg ggctaaaatt gccgggatag aactctcctg caagggcctt     10200
     aatgtcgacc acccctgctt gtaaacccac ttacggacgc ggggatcgag gctatcgtag     10260
     gcactgctca tagtttgaag ttcgccagtc cgtcgtcgtc atcgctttcc tccgtagtgg     10320
     tgtcatccat atcgctgggc cggtcctctt caatcgccac accctcgatt agtgtttgcc     10380
     agttcatcgt tctgttttgt tccagcacgg ccagcatgtc caggaaacct tttatggtat     10440
     tacggggggt acggaagtaa gcgtctccaa tggttttact acagtgatgc aggaatccag     10500
     tcagtgcctc atctggtacc agataattct ctggatctcc accggcataa acatgacgaa     10560
     gatttctcag caaaatatac agttcctcag gggtgaggct ggcaagatgc aaagtggggg     10620
     atgagtagtc aatcactcct gctttttgcg cgaaccggtt ttccgccaga cgcgactgga     10680
     gcgcctcata gctgtaaaga cctttacgcg gatcgaaaag aaactctggc gtacccccga     10740
     ggataaaacc aatgttctcg gctgagcctt gcaggcagtc attcaggatc cgcaaaatct     10800
     gttcgtagtt cgctgttctt gcttgcgtat tattcagctt caagaggttc accatttcgt     10860
     cgaggctgac caaaagaccg gcatagcctg cctggcggac aaaaaggctc atcagcttca     10920
     aagaatcata gaatgatgcg tctgagataa tagtccgaac gtcgagatcg tgacgggcat     10980
     cagttttagt agtgtactct ccacgcaacc agcgaatggc attggatttt agcgtttcgt     11040
     tatcctgctc atgcccccgc cagaatgcat caatgacctt cgcaaagtca tatccaccga     11100
     ccatatctga tagtgctgcc aggcgtttat gaataactga tgaaacctcg gagccgtccg     11160
     tgtcagcttc cttccttgcc tccgtaacga acctttcaac aacgctaagt aacgcattac     11220
     catccggctt gtttctggtg gacatgtttt tcatgagctc agaataaaga ttacgagcct     11280
     gacctcccga tgagtgaata cgtctgtcag gagaaaggtc agcactgact gacaccaact     11340
     tcttctccag cgcaatagag cgcacaacac tcagaaagaa cgttttacca gaaccatatt     11400
     caccgatgat aagtctgaag cttgcaccac cgtcagcaat cctctcaata tcctgatgga     11460
     gagcggtgat ctcattcacg cggccaacct ggatatgctg aatgcctatc cttggcgtta     11520
     cacctgactt aagtgactga ataatagcgt cgcgttcttt cactcttata cgtgttacag     11580
     acattcacta tccctctaat tctttggcaa tttccaggtc aacccagata tcatcatcgg     11640
     catcgtccag tactggagca tcaaccaccg cataggacca gtcattgatc acctcaagcg     11700
     caccgccgag catcaaattc aaatttccgc acaattctgt cgcctctttt cgggaccact     11760
     gttctttctc cagcaaactg cgataaagct ggctatgtgc ggagtcaagt ccccccgcct     11820
     ccgttgatga ggctggagcg ctttctggct cttccggttc ttcttcggtg aaaattgtgt     11880
     tcagcaattt acgaacatca tccgtggcag attcgtggcg ggcaagtaca ttagcatcca     11940
     gtgtgaaccc tgctgctggc tgatcagttg gtacagacga gacgagatca tgttcagttg     12000
     cggaatgctg atggatattg ctcgagacag atgagggatc cagccccaaa cttgaataaa     12060
     tcttctcaag ctgtttgatt tcggcaggcg ctattgtccc atccgaacag gcaacactaa     12120
     cgataacctt acccacagca gctttttccg cggcccccat caactcaatc ctacttttca     12180
     ttcctgtcat attggctggg gtatgaagtt gccacgttaa atacgcatgt agagagcgtt     12240
     tttcatcatc ggtgaagcca ggattgttgt tgatggcatt ctcaagcact ttctgttcag     12300
     cttgatcaag agaatcgtca atcaaggcga ccatcgcccc taatctgagc gtcattacgg     12360
     ctgagataaa ttcaggagaa ggtgagaagc gtccaccttc ggcggcaggg aatagaacaa     12420
     gtgtcccatc aacatccgcc ttcacatggt gataatacgg gtcaggtgcc agaccgtaac     12480
     ccatcttcag agcaaaggcc tgcatcaaat cggcctcttt tttattgatc ttattggggc     12540
     aactggcatt catatgtgcc caaaagtcag caactgagac taacccctcc ttgacgagga     12600
     tcgcctcatc agcccagcgt ttgaatgagc ttaatatttt ttctgcgctt tcattaacta     12660
     tctctgaagg gagcagcata attgcagccg tatcattgac tgacgtacct ttcctaccaa     12720
     ggtagcgact ataagcatca agttcatctg tacatatatc ggcaagagcc ataattttct     12780
     ggacagggct cttcaacgca cttggatcag gcaggtcggg aacaggaagt cgaacacctc     12840
     gcaaactagg acttgctggt gtgtaatcta acctcaggcg cgttttattc gccttaacga     12900
     ccatcccttc accatatttg agggtgtaac gccgtttgaa aagtgcagca aactctttag     12960
     cacagcggcg agccggggta cgcagcgaat actcggtgtg gtttattacc cagttcaacg     13020
     ccagttcagc tgatacagga actccttcat gtacagtttt tgcaagagcc agcttaaatt     13080
     gcatgctgtt gctgaaacct gaattgctat cgagctcagt ggctaagccc atgttcgggc     13140
     gcagaataga catggcttcg agtaattggg tcgaatatcc acggaaggag cggttctcaa     13200
     tgaatatcga tcttaaccga gcgacttcat tgaacagatt acggaactca gcatcaggga     13260
     attttgggtc agtggaatct acgagcgctt ttctttccag gccgtagagg tagataaaaa     13320
     catagccgat aggacacgat ggatcagacc tatcgctggc aagccaactg acatacgcac     13380
     cgcgtgcttc tggggaaaga gaggaaaaac tgggccagta tcctaatgaa ctgtcctcgt     13440
     aaagataaga agtaggtttt atcttacatg tgtcatcaat taatgatgcc tcacttccat     13500
     cgtcataata gccgcctgat tcctgaccgg agggcttcat acgttgcccc acgtaaatgt     13560
     ggccaccgct aattgctaca ccagctacag ttatcatctc acccggaagt acccatcgag     13620
     ctagtgcacc tgctgacttt gaggtgttgc ggtaatgatt ggttgtcacc cgaagttcaa     13680
     caccccggcc accgctcaat gtaaaagttg caaggttatc gtcttcacta tcatcgtttc     13740
     gcacaaccgc ctcttttttc ttgatgtcag cgagccattc ttttggcggt gctttcacgg     13800
     ggtctgaagc ataagacttt ggagatttac gttttttctt tctaaaaaac aacaagtaaa     13860
     tgacaaaaat cgccgccaaa aaattcaata actccatgat atataacctt aaaatcattc     13920
     ttcacgcata tttacaagca gtgatgaagg cagggcaagt ggattaatct caaaataata     13980
     cttctaaatt gcgagggtta aaagcaaatc acaattaaaa ttaacccaat gatttaaatg     14040
     ataaaaatca tttaataatg tgtttaacca gcagtgaaat tttaaggtgt taaaacctgt     14100
     taggcgattc gtctctaaat gatgttgtac tactgctacg ttaacatgcg agcaaatgta     14160
     ctgcggatgc acatctgacc actgtatgat gatacttacc tattcgctga gaatctcggc     14220
     aactttatgg cagggaagct tttagagact ataccgtctc gaatttccgt ttatcgctct     14280
     cagcagacct tcagcatcct aagcttgtct gctgtaggcc aggagcggtc atttatacgt     14340
     agtagctcaa tgactgcttc gtacataaag ctgtcattgg actttctgac cttacaaggt     14400
     aatctggctt gcaaggaagc cgaccttgcg ggaccggtat aacgcactgt tatatgccat     14460
     aggaggacta gtggaaacga cagacggctt tgttgaataa atcagatttc gggtaagtct     14520
     cccccgtagc gggttgtgtt ttcaggcaat acgcacgctt tcaggcatac ttgctttcgt     14580
     cattttgttc agcgctcgta ccagggccat agcctccgca acctgaccat cgtagtcacg     14640
     cagcgtcagt gaacccccga acagctgttt tacccggtac atcgccgttt ccgctatcga     14700
     gcgacggttg taatctgttg tccatttcca ccgcgcatta ctcccggtca ttcgctgatt     14760
     agccactgca cggttacggt ctgcatattc accgggccag taacccgcac cttttcgggg     14820
     tgggataagc gcgctgattt tcttacgccg cagttcatcg tgacagagcc gggtgtcgta     14880
     agcgccgtct gccgatgctg ccctgatttt tctgtgagtc tgccggataa gacccgggaa     14940
     ggcttctgag tccgtcacat tgttcagcga caggtcagcg cagatgattt catgtgtttt     15000
     actgtcaacg gcgagatgca gcttacgcca gatacggcgg cgttcctggc catgcttttt     15060
     gactttccac tcgccttcac cgaagacctt cagcccggtg gaatcaatta ccaggtgtgc     15120
     gatttcaccc cgggtgggcg ttttgaaact gacattaacc gactttgcct gcctgctgac     15180
     acagctgtaa tccgggcagc gtagcggaac gttcatcaga gaaaaaatgg aatcaataaa     15240
     gccctgcgca gcgcgcaggg tcagcctgaa tacgcgttta atgaccagca cagtcgtgat     15300
     ggcaaggtca gaatagcgct gaggtctgcc tcgtgaagaa ggtgttgctg actcatacca     15360
     ggcctgaata gcttcatcat ccagccagaa agttatggag ccacggttga tgagggcttt     15420
     attgtaggtg ggccagttgg tgattttgaa cttttgcttt gccacggaac ggtctgcgtt     15480
     gtcgggaaga tacgtgatct gatccttcaa ctcagcaaaa gttcgattta ttcaacaaag     15540
     cccattccgt cctgataagt tggtcggata aggcgctcgc gccgtatccg acattaattt     15600
     cttaagcgac ttcattcacc tggcgacgca gcagagaaag tgggccgggg ccgctaagcg     15660
     tgaacacgga aattaaggtg aagcccagcg ccaccagacc cagcaccagg taagcgccct     15720
     ggaaaccgat gctttcatac atattgcccg ccagaataga cataaaaatc atcgccagtt     15780
     gcttaaagaa gcagaaacag accagataaa tcgtcgctga aaaacgcact tcaaactggc     15840
     tggtaatata tttaaagcag cccaccagca ggaacggtac ttcaaacata tgcagcgttt     15900
     tcagaataac cacttccagt gctgaggtag cgaacgatga gccaataata cgtactgaca     15960
     taatagtgcc agccagcagc agggcgtttt tcccaccgat gcgattaatg atcagtggcg     16020
     caaaaaacat aatcgaggcg ttaagtaatt cgcccattgt cgttacgtag ccaaataccc     16080
     gcgtaccctg ttcaccggta gcaaagaacg aagtaaagaa attagcaaac tgttggtcaa     16140
     aaacatcgta ggtgcaggaa acgccaataa catacagtga caaaaaccac agttttggct     16200
     gtctgaacag ttccagcgcc agcttaaggc taaatgccga atggttggca cctaccgcat     16260
     tggcaaccgt ggcagaagag ggcgcatccg ttttggcgaa aaagagtaaa acggcgagga     16320
     tgaatgcaca gccagaaccc agccagaaaa caaactgatt attgatggtg aacatgatgc     16380
     cgacaatcga ggcacacagc gcccagccaa cacagccaaa catccgcgcg cgaccatatt     16440
     cgaaattact gcgacggctg actttctcga taaatgcctc tactgctggc gcaccggcgt     16500
     taaaacaaaa gcctagataa ataccaccaa caatcgatcc tactaaaatg ttgtattgta     16560
     acagtggccc gaagataaaa ataaagaacg gcgcaaacat cactaacatg ccggtaataa     16620
     tccacagcag gtatttgcgc agcccgagtt tgtcagaaag cagaccaaac agcggttgga     16680
     ataatagcga gaacagagaa atagcggcaa aaataatacc cgtatcactt ttgctgatat     16740
     ggttgatgtc atgtagccaa atcgggaaaa acgggaagta ggctcccatg ataaaaaagt     16800
     aaaagaaaaa gaataaaccg aacatccaaa agtttgtgtt ttttaaatag tacataatgg     16860
     atttccttac gcgaaatacg ggcagacatg gcctgcccgg ttattattat ttttgacacc     16920
     agagcaactg gtaatggtag ctaccggcgc taagctggaa ttccgccgac actgacgggc     16980
     tccaggagtc gtcgccacca atccccatat ggaaaccgtc gatattcagc catgtgcctt     17040
     cttccgcgtg cagcagatgg cgatggctgg tttccatcag ttgctgttga ctgtagcggc     17100
     tgatgttgaa ctggaagtcg ccgcgccact ggtgtgggcc ataattcaat tcgcgcgtcc     17160
     cgcagcgcag accgttttcg ctcgggaaga cgtacggggt atacatgtct gacaatggca     17220
     gatcccagcg gtcaaaacag gccgcagtaa ggcggtcggg atagttttct tgcggcccta     17280
     atccgagcca gtttacccgc tctgctacct gcgccagctg gcaggtcagg ccaatccgcg     17340
     ccggatgtgg cgtattgctc gccacttcaa catcaacggt aatcgccatt tgaccacttc     17400
     catcaatccg gtaggttttc cggctgataa ataaggtttt cccctgatgc tgccacgcgt     17460
     ggaccgtggt aatcagcacc gcgtcggcaa gcgtatctgc cgtgcactgc aacaacgctg     17520
     cttcggcctg gtaatggccc gccgccttcc agcgttcgac ccaggcgtta gggtcaatgc     17580
     gggtcgcttc acttacgcca atgtcgttat ccagcggtgc gcgggtgaac tgatcgcgca     17640
     gcggcgtcag cagttgtttt ttatcgccaa tccacatctg tgaaagaaag cctgactggc     17700
     ggttaaattg ccaacgctta ttatccagct cgatgcaaaa atccgtttcg ctggtggtca     17760
     gttgcgggat ggcgtggggc gcggagggga gtgtcacgct gaggttttcc gccagacgcc     17820
     actgctgcca ggcgctgatg tgtccggctg ctgaccatgt ggtcgcgttc ggttgcacta     17880
     cgtgaaccgt tagccagagt tgtccggcgc tcttcggctg cggtagtcca ggcagttcaa     17940
     tcaactgttt accttgtgga gcgacatcca gaggcacttc accgcttgcc agcggcttgc     18000
     catccagcgc caccatccag tgcaggagct cgttatcgct atgacggaac aggtattcgc     18060
     tggtcacttc gatggttcgc ccggataaac tgaactggaa aaactgctgc tggtgttttg     18120
     cttccgtcag cgccggatgc ggcgtgcggt cggcaaagac cagaccgttc atgcagaact     18180
     ggcgatcatt cggcgtatcg ccaaaatcac cgccgtaagc cgaccacgga ttgccatttt     18240
     catcatattt aatcagcgac tgatccaccc agtcccagac gaagccgccc tgtaaacggg     18300
     ggtactgacg aaacgcctgc cagtatttag cgaagccgcc aagactgtta cccatcgcgt     18360
     gggcgtattc gcaaaggatc agcgggcgcg tctctccagg caacgaaagc cattttttga     18420
     tggaccattt cggcacagcc gggaagggct ggtcttcatc cacgcgcgcg tacatcgggc     18480
     aaataatatc ggttgcgaag gtgtcggctc cgccgccttc atactgtacc gggcgggaag     18540
     gatcgacaga tttgatccag cgatagagtg cgtcgtgatt agcgccgtgg cctgattcat     18600
     tccccagcga ccagatgatc acactcgggt gattacgatc gcgctgcacc attcgcgtta     18660
     cgcgttcgct catcgcgggt agccagcgcg gatcatcggt cagacgattc attggcacca     18720
     tgccgtgggt ttcaatgttg gcttcatcca ccacatacag gccgtagtgg tcgcacagcg     18780
     tgtaccacag cggatggttc ggataatgcg aacagcgcac ggcgttaaag ttgttctgct     18840
     tcatcagcag gatatcctgc accatcgtct gctcatccat gacctgacca tgcagaggat     18900
     gatgctcgtg acggttaacg ccgcgaatca gcaacggctt gccgttcagc agcagcagac     18960
     cattttcaat ccgcacctcg cggaaaccga catcgcaggc ttctgcttca atcagcgtgc     19020
     cgtcggcggt gtgcagttca accaccgcac gatagagatt cgggatttcg gcgctccaca     19080
     gtttcgggtt ttcgacgttc agacgtaggg tgacgtgatc ggcataacca ccacgctcat     19140
     cgataatttc accgccgaaa ggcgcggtgc cgctggcgac ctgcgtttca ccctgccaca     19200
     aagaaaccgt cacccgcagc tcatcgcgca gctcgccgta catctgaacg tctgcctcca     19260
     gtacagcgcg gctgaaatca tcattaaagt gagtggctac atggaaatcg ctgatttgcg     19320
     tgctcggttt atgcagcaac gagacgtcac ggaaaatgcc gctcatccgc cacatatcct     19380
     gatcttccag ataactgccg tcactccagc gcagcaccat caccgcgagg cggttttctc     19440
     cggcgtgtaa aaatgcgctc aggtcaaatt cagacggcaa acgactgtcc tgtccgtaac     19500
     cgacccagcg cccgttgcac cacaaatgaa acgccgagtt aacaccatca aaaataattc     19560
     gcgtctggcc ttcctgtagc cagctttcat caatattaaa tgtgagcgag taacaacccg     19620
     tcggattctc cgtgggaaca tacggcggat tgaccgcaat gggataggtc acgttggtgt     19680
     agataggcgc atcgtaaccg tgcatctgcc agtttgaggg gacgatgaca gtatcggcgt     19740
     caggaagatc gcgctccagc cagctttctg gtaccgcttc tggtgccgga aaccaggcaa     19800
     agcgccattc accattcagg ctgcgcgact cttgggaagg gcgatcggtg cgagcctctt     19860
     cgctattacg ccagctggcg aaagggggat gtgccgcaag gcgattaagt tgggtaacgc     19920
     cagggttttc ccagtcacga cgttgtaata cgacggccag tgaatccgta atcattgtca     19980
     tagttgtatc ctgtgtgaat tgttatccgc tcacattttc gcataacata cgagccggac     20040
     acatagagtg taaagcctgg ggtgcctaat gagtgagctg actcacatta attgcgttgc     20100
     gctcactgcc cgctttcaag tcgggaaact tgtcgtgcca gctgcattaa ggaatctgcc     20160
     aacgtgcggg gagaggtggt ttgcgtattg ggcggtaggg tggtttttct tttcaccagt     20220
     gagacgggca acagctgatt gctcttcacc gcctggccct gagagagttt cagcaagcgg     20280
     tccacgctag ttttccccag caggcgaaaa tcctgtttga tggtggttaa cggcgggata     20340
     taacacgagc tgtcttcggt atcgtcgtat cccactaccg agatatccgc accaacgcgc     20400
     agcccggact cggtaatagc gcgcattgcg cccagcgcca tctgatcgtt ggcaaccagc     20460
     atcgcagtgg gaacgatgcc ctcattcagc atttgcatag tttgttgaaa accggacatg     20520
     gcactccagt cgccttcccg ttccgctatc ggatgaattt gattgcgtgt gagatattta     20580
     tgccagtccg ccagacgcag acgcgccgag acagaactta atggaccggc taacaacgcg     20640
     atttgctggt gacccaatgc gatcagatgc tccacgccca gtcgcgtacc gtcttcatgg     20700
     gaaaaaataa tactgttgat gggagtctgg tcagagacat caagaaatag ggccggaaca     20760
     ttagcgcagg cagcttccac agcaatggca tcctcgtcat ccagcggata gttaatgatc     20820
     agaccactga cgcgttgcgc gagaaggtta tgtaccgccg ctttacaggc ttcgacgctg     20880
     cttcgttcta ccatcgacac caccacgctg gcacccagtt gatcggcgcg agatttaatc     20940
     gccgcgacaa tttgcgacgg cgcgtgcagg gccagactgg aggtagcaac gccaatcagc     21000
     aacgactgtt tgcccgccag ttgttgtgcc acgcggttgg gaatgtagtt cagctgcgcc     21060
     atcgccgctt ccaccttttc ccgcgttttc gcagagacgt ggctggcctg gttcaccacg     21120
     cgggaaacgg tctgataaga gacaccggca tactctgcga catcgtatag cgttactggt     21180
     ttcacattta ccaccctgaa ttgactctct tcgggtgcta tcatgccata ccacgaaatg     21240
     ttttgcgcca ttcggagggg gcacgccgaa gtgagattca aaatgccgac gtcagttcac     21300
     aggtgggtaa tgataccaac gtgttgattt cgtattttca ctgacaccag gatcatcctg     21360
     atgttacaag gattgaatga ctacagatta aaatagtcat caacaggttg acagcattac     21420
     cgactgacct tatccatagc ggtaacctga ccgttaacga aattaaccgc tcagccggat     21480
     ttctcatcaa cagttttgat ttgccgggca ttggtatatt catgggcatc agcgcccgct     21540
     ttctgcgtat ttttcgattt gcactgccgg gggcactggc gggtatcgcg ttccgcacac     21600
     ttttacattt atttatctgg tgactgacct ttttaaggag acagaatgaa agccgttggt     21660
     ttctggcaac ccggggaaag tacatccgtt attgaagatt tgtcgcttcc ccacccatcc     21720
     atgcccaagg ggcgtgatct tttgatcaga gtcagggcgg tcgcggttaa cccacgggac     21780
     ctgaaaagcc ggcgaaacat cagtccctct gcaggcaatc cggtagttat gggatacgac     21840
     gcttccggtg ttgttgaagc aaccggacca gatgtgacgc tgttcaggcc aggtgaccac     21900
     gttttctatg ccggtgtgct cgatcgccag ggagccaacg cagagtttca gctggttgac     21960
     gaacgcatta cggggataaa gccggcagca ctaagttttg aagctgcagc gtcggttcct     22020
     ctgaccggtc tgacagcctg ggaaatgtta tttgatcgtc tgcagttgtc agtgaacgga     22080
     gatgctgatc agaccctgtt gatgcttggc ggtgcgggcg gagtcccttg tatggctata     22140
     cagcttgccc gcactctgag tcgggtgaac atcatcggga ctgcctcccg gcaggagagt     22200
     gtcagagcgg ttcgcgggtt tggtgcgcat tatgtcctgg atcattcatg tgcgcttgcg     22260
     ccacaggttg ccagccttgc tggactccct cccattaccc ggattttctc aacgtacacc     22320
     acgccatctg cctgggaaaa tatggccgaa attattgccc cacaaggccg tatcggactc     22380
     atcgacgacc ctgaaccact ggatctgcgt ttgatcaaat ttaagagcgt ttctgttcac     22440
     tgggaggcaa tgtttacccg ccccatgcat gctactgcgg acatgtctaa acagcatgat     22500
     attcttaaca aactctcatg catgctggat tccggtaagc tcaaacctcc gttgctggca     22560
     gagtatggca ggctgaatgc taaagcactt cgccgggctc atgaggacat ggaaaataaa     22620
     aatgtgaacg ggaaaattgt tttttcaggg ttctgatgaa caggcctgtc agagtaaaaa     22680
     aagattcggg ttcagcacaa tgctgaattc tgtctggcta tagagtaaga atcgtaccgg     22740
     aattgagcat ttaccctcag tacctgcgga tgaaaaagca gtctgccctg acatactgaa     22800
     taatcccttc tcataagatg cctctctttt gctgtttaaa gagctgagca gtccgggcgg     22860
     agactgacct cgttccgctt tccaagcgac ccccttgttg aaagtgcgac aaaagagata     22920
     gggcgaatga ctatacttcg ctcatagctg cccgtcatgc cagctcaaaa aacaggctta     22980
     acgtaggata tttaatgaga tggtcactcc ctccttccca gtactatgct gaggacaggc     23040
     tttcattcgg agaaccatca tggaaaacat tgcgcttatt ggtatcgatc tgggtaagaa     23100
     ctctttccat attcattgtc aggatcatcg tgggaaggcc gtttaccgta aaaaattcac     23160
     ccgaccaaag ctaatcgaat ttctggcgac atgcccggca acaaccatcg cgatggaagc     23220
     ctgtggcggt tctcacttta tggcacgcaa gctggaagag ttagggcatt ttccaaagct     23280
     gatatcaccg caatttgtcc gcccattcgt taaaagcaac aaaaatgact tcgttgatgc     23340
     tgaagctatc tgtgaagcag catcacgtcc atctatgcgt ttcgtgcagc ccagaaccga     23400
     atctcagcag gcaatgcgag ctctgcatcg tgtccgtgaa tccctggttc aggataaggt     23460
     gaaaacaact aatcagatgc atgcttttct gctggaattt ggtatcagcg ttccgcgagg     23520
     tgctgccgtt attagtcgac tgagtaccct tcttgaggac agtagtttgc ctctttatct     23580
     cagccagtta ctgctgaaat tacaacagca ttatcactat cttgttgagc agattaaaga     23640
     tctggaatct cagttgaaac gaaagttgga cgaagatgag gttggacagc gcttgctgag     23700
     tattccctgc gttggaacgc tgactgccag tactatttca actgagattg gcgacgggaa     23760
     gcagtacgcc agcagccgtg actttgcggc ggcaacaggg ctggtacccc gacagtacag     23820
     cacgggaggt cggacgacat tgttagggat tagcaagcgg ggcaacaaaa agatccgaac     23880
     tttgttggtt cagtgtgcca gggtattcat acaaaaactg gaacaccagt ctggcaagtt     23940
     ggccgactgg gtcagggagt tgttgtgtcg gaaaagcaac tttgtcgtca cctgtgctct     24000
     ggcaaacaag ctggccagaa tagcctgggc actgacggcg cgacagcaaa cttacgaagc     24060
     ataaaggcag aaatacacca gtttaaacaa tcattcatct ggttttgcga atactgatat     24120
     tgatgatact aacggcccac cggcctgttg aggaacctgt aaaacggaaa ggctcattga     24180
     agccgtatat tttctggagg ttcatcaggc gcggaactca tcgaggcgcg ggaataaaat     24240
     cccattcaga cgccggatag attcaagcaa gccaacttgt cgtcaaaatc ggtgttgcaa     24300
     aaacgggagt gaccatagat tccgttttcc aagcggaccc cattttcagc gtgacatcat     24360
     tctgtgggcc gtacgctggt actgcaaata cggcatcagt taccgtgagc tgcaggagat     24420
     gctggctgaa cgcggagtga atgtcgatca ctccacgatt taccgctggg ttcagcgtta     24480
     tgcgcctgaa atggaaaaac ggctgcgctg gtactggcgt aacccttccg atctttgccc     24540
     gtggcacatg gatgaaacct acgtgaaggt caatggccgc tgggcgtatc tgtaccgggc     24600
     cgtcgacagc cggggccgca ctgtcgattt ttatctctcc tcccgtcgta acagcaaagc     24660
     tgcataccgg tttctgggta aaatcctcaa caacgtgaag aagtggcaga tcccgcgatt     24720
     catcaacacg gataaagcgc ccgcctatgg tcgcgcgctt gctctgctca aacgcgaagg     24780
     ccggtgcccg tctgacgttg aacaccgaca gattaagtac cggaacaacg tgattgaatg     24840
     cgatcatggc aaactgaaac ggataatcgg cgccacgctg ggatttaaat ccatgaagac     24900
     ggcttacgcc accatcaaag gtattgaggt gatgcgtgca ctacgcaaag gccaggcctc     24960
     agcattttat tatggtgatc ccctgggcga aatgcgcctg gtaagcagag tttttgaaat     25020
     gtaaggcctt tgaataagac aaaaggctgc ctcatcgcta actttgcaac agtgccgatt     25080
     tattcaacaa agccccttga agatgcagaa aacggtctaa gttcccgtat gcgcagaaca     25140
     attgccgaac tctatgatct ctttaacgat ctcgagcgtc ggatccattt ttttgataag     25200
     gaaattgaaa cagtattcag gcaatcagaa gcctgtcagc gtatcgccaa agttaaaggc     25260
     attggcccta aaacggccac ggccgttgtt gctgctattg gcaaaggaac tgaatttaag     25320
     aatggccgcc actttgctgc atggctgggt ctggttccac gccagcattc gagtggcgac     25380
     aagcatctgc ggacactttt tattcatggt gcccgcgctg tcgtcagggt tgccacgaat     25440
     aacaatgatg gccatatgaa tcagtgggtt aaccagttaa aggaacggcg cggatttaat     25500
     aaaacgaccg tggcggtcgc taacaaaaac gcgagaataa tctggtcgat gctgagaaat     25560
     gagaccgagt atcaggtagt gtgaaattaa tcccctgcca gaaaaagttg cagcgtactg     25620
     agaaatggtg acaggttgta cctgcacaat cggaacctga tttttatact ggcctcagag     25680
     gccgtccagt tgttgaggcg attatgtgcg gattacccat ttgggcacag attttcctga     25740
     tgccggatag atgtaagcaa caacccaaaa ccagattcag tacttgcaaa acggaggtag     25800
     tccatagatg taaaacgtgg catcggaaat ggcatgcttg cggcagagtt cacgggcggg     25860
     taccccagct tcggcttcgc ggagaatact gatgatctgt tcgtcggaaa aacgcttctt     25920
     catggggatg tcctcatgtg gcttatgaag acattactaa catcggggtg tactaatcaa     25980
     cggggagcag gtcagtggta actgtcaatt ttttcatatt ctgttaagaa taaattaatg     26040
     tttaaaaatt atgataaatg aatgtcatca caaacatggc acgtccttta caggaataaa     26100
     tctcaccaat tattatattt tcgccacaga acctgtccgg gaaggatagt ccgtttagta     26160
     ttaactgttg atgctgttat aaggagtttc tgatgcaggt aaacaaattt acggatgata     26220
     ttgatattag ttctcatgag cgtttcatcg cggcccgtaa aagtacgtgg gttagtgtgc     26280
     ttgttaattg ttttctgaca tccgggcagg tgattactgg tatattttct ggatctcagg     26340
     gacttatcgc ggatggtatt cattccctgt ctgatttagt ctcagacttt gttgtactca     26400
     ttgcaaacca taaaagtaaa aaaaatcccg atgatgacca tcactacggt catcatcgtt     26460
     atgaaaatgg tgcatcatta attctgggga caattttatt tattgttggc atcggcatgt     26520
     tatggtcagc agtaaataaa atgaaacaac cagatgatat tcctcaggta catattgttg     26580
     ctctgtgggt ggctttagcc gcactggtta tcaaagagct tctttttcgc tatatgcttg     26640
     ccgtagcaac ccgagtaaaa tccactatgc tggtcgctaa tgcctggcat gcacgctctg     26700
     atgccgcttc gtctttggtt gtggctattg gtattattgg gaacttatca ggttttaaat     26760
     tactcgaccc agttgctgca atggttgtcg gactgattgt aaccagaatg ggatattcat     26820
     ttatgtcaga ttcgcttcat gacttgatgg acagatccgt ggatattgaa actgaaaata     26880
     aaataaaaac cacattattg tcaacgcctg gagttgaagg tatccatgat ctcaaaaccc     26940
     gtaaaatggg agatcttgtt gttgttgatg ttcatctgga aattaatggt aatttatcag     27000
     tgaaagtagg gcatgacatt gctgttttag ccaggaaatc agttttagat aatcatcatg     27060
     tattaaatgt catgacgcat gttgaccctt tttttaagga ggtaagtggc cttgattatg     27120
     gaagtgtaaa taatcataaa caataatttt aatgctgatt ttcttcgggg aaattggcaa     27180
     ataattattt tctttgctca atgttacgtc ttcggattgt gattttttta aatgatagta     27240
     aacaatgtgg ggttattatg agaaaaatta tgcatagtgt tataatagga acagcccttg     27300
     ttttatctac cagtgtaata gctggttctg acggtgttga acatgccatg aagatgatga     27360
     ataaaagcta ccgcgcagca cttaaggagg aggacgttac atctttcagg aaagatatgc     27420
     aggatctgaa atcaacagca gagtccatct tgaacggccc ggtagagggg tatgacaggg     27480
     aaacgtatgt tgcaggtatg tcacttctga ttgatgaggt aactgctgtt gaaagtaccg     27540
     ctgaaaagga aggtcttgac gctgggaaaa ttgcagcaca gaaactgggc agtatgatga     27600
     gaaaatacca taataaactt ggcgttgact gaaccgggaa ctatcaggag aaagtagata     27660
     tgctggaaag atatcccgga actgacatga tatagctgct tgtattagaa tggatagtta     27720
     tgccctggtg aagaaattat aatacgttat cttatctgct cagtacatat aaaaatgttg     27780
     gggtcgcaaa catgcttacc gatgctacat tgcctcaaca taagctaagt cctattgatg     27840
     ttgcacgggg cggatatacc cgcttcgtgc ttcactgaaa catactgatg atctcttggc     27900
     tggaaaaaca cttcttcatg gtaatctctt catattactg atgtgatgta ctataggttt     27960
     agataccatt ctctgattaa agagtattgt ttagttccga taagttaagg tttcgttaat     28020
     aaaaaggcat attgatttgg tcaaccaccc ctaacaaagt ggctaaatta tgaatgaaaa     28080
     tttacgtaat gctctccctc acaaagacac accatttcta cgtgtgcttc atatcatctt     28140
     agctgtattg attttattgc agattgttag ttcaaatctt accgaaagcg atgctctcag     28200
     tgactatact ctcacagggt tcgttacatg gttccatgtt atcactggat tatcactgat     28260
     tgttcttggg ttaatcatgc ttgcatggat gctaacacaa cgaggatttc attactattt     28320
     tgcttggctg actcttgatt ttcgaggtgt ggttgaagat atcaaaatgc tgatgtcatt     28380
     ccgtctccct gaagctcatg ctggtgggat tgctgcctta gtccaggggc ttggtgtact     28440
     tgcgctattg ggcgttgcat catgtggtgg tttctggttt gcactcaata caattcctgg     28500
     aatgtcgcca gtgctgacag aaagtgtcct aaatttgcat aagtttctga ctgtatttat     28560
     tgaaacctat ttctgggcgc atggttcgat ggggttgctg catatatttc tcaccatccg     28620
     tagccaaatg aaaaattccg ttacggaata gtgtgataga ttgatgatta ataaagtgtg     28680
     ctgtaatggc tggataaaat tgactacaat agtttaatta tctgtcaagg cattcttata     28740
     tgtccgtaat tccgattagt gtgcgtagtt gaagggaagc aaagatatgc atcttgaacg     28800
     acacagcatc gaaaaagtgg gatggcttcg ggcggctgta ctgggggcaa atgacggaat     28860
     tgtttcgaca gcaagccttg tccttggtgt tgcgtcagca aacaccagtt cttcgggagt     28920
     tttacttgct ggtgttgccg gactggtttc tggtgcgatg tcgatggcaa cgggagaata     28980
     tgtttcagtc tcatctcagg ctgataccga aaacgctgca cttgctcagg aaaaaaggga     29040
     gttggaaacc gattatgaag gtgaaatgca ggaactgact tcactttata tacaacgtgg     29100
     actggatcct gtgcttgcct atagggttgc agagcagctc atggcgagaa atgctctgga     29160
     tgctcatgcc cgtgaagaac ttgggctgac ggatacaaac tctgcacagc cccttcaggc     29220
     tgctgtcttt tctgctctga gtttttctgc tggtgccgtg ttacctttaa tagttgcatg     29280
     gttatctcct ccaaagcagg tttttttgtt tattatcctt tccacccttt tttcactggt     29340
     ggtccttggt tatatatcct ctgttgcagg taaagcacct cctgtcaggg cgatcataag     29400
     aattatgttc tggagtacac tggctatgtt tttgtcgatg gggattggtc attttgcagg     29460
     gcaggtcctg ctttaatgtt ctgtcgcgat atttcgagtc gtatgtcata aaaaaaaacg     29520
     ctaatgtagc tctttacagg ttttattccc cttggtacag tgtccattga agaaagatgc     29580
     aggggcttgg cccctgcatt tgaagagaat aaataatgtt acttaagaca aatctcccga     29640
     tcatagactc caccattcac agccaacatt tgccttttct tttttgaaat cataccagtc     29700
     atgatttgcg aatcatctaa aaaaatacct tcaaatgttc caggacgtgc attccatcct     29760
     gcaataatta ctgtatctcc aacgtttaac tttgctacct tatcgttatt ataatccgta     29820
     ttttcaaaaa taaactttag tccttcattt gaaccagaaa tatacaatgt aactaacgga     29880
     ttcttactga atgtaacagt accgattttt tttattttac ctgtaaccat caatcggcac     29940
     tttttgaaat cgttagttgc cctaaactca tgttctttaa atcgtgaata aacctcttca     30000
     gctgtataaa gtgatgtagc cccctgaaac accggacagt agctgtatct ccagataaga     30060
     gataggcttg aatatatgtc taacactaac gccaattttg agatgaccgg gatcctgtta     30120
     gggcaagaag cccgtaaacg taaaactcct caggagaaga tcgccattat ccagcagacg     30180
     atggagccgg gcatgaatgt ctcccatgtc gcccgcctgc atggtatcca gcccagcctg     30240
     ctgtttaagt ggaagaagca atatcaggaa ggcagcctca ccgccgttgc ggccggagag     30300
     gaagtcgttc ctgcttctga gcttactgct gctctgaagc aggtccggga acttcagcgc     30360
     cttctgggca agaagacgat ggaagttgag atcctgaaag aagccgtgga gtacggccag     30420
     tcgcgaaaat ggatagcgca cgcgcccttg ttgccaaagg acggggaata gccctggtca     30480
     gccgcaccat gggcgtgtcg cgtgcgcagc tgtcactgcg gattaaccgt tctgccgact     30540
     ggcaggacaa gcgctgtaac cggcgtaatg acgaagcaga cgaagaaata ctgtcggcta     30600
     tcctcgacat catgggctcc gtttgggaaa cggcaaatat tgtacgttaa ggttgttttt     30660
     tgtactggct gatatcaacc ggccgcaaag gtcgatactt cccttctgcc agttttttat     30720
     tgtttctcca gatataatct cccgtcagat taatgtgctc ccagcccaac ggagacaagt     30780
     gtgacagcaa ttgctcattg aggggtcgtc tcagaaaacg gaatctatgg tcactcccgt     30840
     ttttgcaaca ccgattttga cgacaagttg gcttgcttga atctatccgg cgtctgaatg     30900
     ggattttatt cccgcgcctc gatgagttcc gcgcctgatg aacctccaga aaatatacgg     30960
     cttcaatgag cctttccgtt ttacaggttc ctcaacaggc cggtgggccg ttagtatcat     31020
     caatatcagt attcgcaaaa ccagatgaat gattgtttaa actggtgtat ttctgccttt     31080
     atgcttcgta agtttgctgt cgcgccgtca gtgcccaggc tattctggcc agcttgtttg     31140
     ccagagcaca ggtgacgaca aagttgcttt tccgacacaa caactccctg acccagtcgg     31200
     ccaacttgcc agactggtgt tccagttttt gtatgaatac cctggcacac tgaaccaaca     31260
     aagttcggat ctttttgttg ccccgcttgc taatccctaa caatgtcgtc cgacctcccg     31320
     tgctgtactg tcggggtacc agccctgttg ccgccgcaaa gtcacggctg ctggcgtact     31380
     gcttcccgtc gccaatctca gttgaaatag tactggcagt cagcgttcca acgcagggaa     31440
     tactcagcaa gcgctgtcca acctcatctt cgtccaactt tcgtttcaac tgagattcca     31500
     gatctttaat ctgctcaaca agatagtgat aatgctgttg taatttcagc agtaactggc     31560
     tgagataaag aggcaaacta ctgtcctcaa gaagggtact cagtcgacta ataacggcag     31620
     cacctcgcgg aacgctgata ccaaattcca gcagaaaagc atgcatctga ttagttgttt     31680
     tcaccttatc ctgaaccagg gattcacgga cacgatgcag agctcgcatt gcctgctgag     31740
     attcggttct gggctgcacg aaacgcatag atggacgtga tgctgcttca cagatagctt     31800
     cagcatcaac gaagtcattt ttgttgcttt taacgaatgg gcggacaaat tgcggtgata     31860
     tcagctttgg aaaatgccct aactcttcca gcttgcgtgc cataaagtga gaaccgccac     31920
     aggcttccat cgcgatggtt gttgccgggc atgtcgccag aaattcgatt agctttggtc     31980
     gggtgaattt tttacggtaa acggccttcc cacgatgatc ctgacaatga atatggaaag     32040
     agttcttacc cagatcgata ccaataagcg caatgttttc catgatggtt ctccgaatga     32100
     aagcctgtcc tcagcatagt actgggaagg agggagtgac catctcatta attatcctac     32160
     gctaagcctg ttttttgtac atattactat tcactgagcg taatgcgcgg tatttaccct     32220
     gtcccagttt gaggttcgtt ctccagacgt aatccccgct caggttgata tgttcccatc     32280
     ccagtggtga cagatgggta atcagttgct cattaatcgg gatccctttt cgtctcaaag     32340
     aatctatcgc tctttctata tataccgtat tccacagtga gatcgccgca gtcagcaacg     32400
     tcagaccgct ggctcgatag ctctgattct ccagcccccg atctctgatt tcacccagcc     32460
     gatgcataaa gaccgctcgc gcaagggcat tgcgagcctc acctttattc agccccgcct     32520
     gtacgcgtcg acgcagtaaa ggatccctga accagtccag cataaacaat gacctttcga     32580
     tgcggccaat ctctctcagc gcctttgcca gaccattctg cttcggatag cttgccagct     32640
     ttttcatcat cagtgatgct gttaccgttc cctgctttat agaacttgcc agacgcagca     32700
     cctcatgcca gtgggtttca atttccttta gattcaggct ggttgtcgag atgattgact     32760
     gaagcccctg atacaactca gcttttccat gaataaacag ccgtttgtca tgaagatccc     32820
     ggatccttgg cgcaaaagcg aatccgagca gatgcattag cgcaaaaaca tgctcagtga     32880
     aacctgctgt gtcggtgtaa tgctctgtaa tttccagatc agtttcgtgg tacagcagac     32940
     catcaagtac gtgtgttgaa tcccgcacgc ggctgataac tttggtgtaa aacgggctgt     33000
     attggtccga aatatgcgta taaatctgca cgcttggatc ctgaccgtat ttaagattga     33060
     cctgaccagc ataacgcccg tgactcccca cccgaaagtt ctgtccatca gacgatgacg     33120
     ttgttccatc gccccagaat gccgccagag ggcttttttt ctgggcattg accaactcgg     33180
     ccagcgcagc tgaataggtt tcatccctga tgtaccaggc ctgaatgccc tcgagtgacg     33240
     atttggtcgt tcccggacag gattcggcca tttttgtcag tccaaggttg ataccatcgg     33300
     ccaggatggt ggtcagtaac aactttctgt ctttaggtct gacgtgattg ttttggcact     33360
     gttgcaaata gtcggtggtg ataaacttat catccccttt tgctgatgga gctgcacatg     33420
     aacccattca aaggccggca ttttcagcgt gacatcattc ggtgggccgt acgctggtac     33480
     tgcaaatacg gcatcagtta ccgtgagctg caggagatgc tggctgaacg cggagtgaat     33540
     gtcgatcact ccacgattta ccgctgggtt cagcgttatg cgcctgaaat ggaaaaacgg     33600
     ctgcgctggt actggcgtaa cccttccgat ctttgcccgt ggcacatgga tgaaacctac     33660
     gtgaaggtca atggccgctg ggcgtatctg taccgggccg tcgacagccg gggccgcact     33720
     gtcgattttt atctctcctc ccgtcgtaac agcaaagctg cataccggtt tctgggtaaa     33780
     atcctcaaca acgtgaagaa gtggcagatc ccgcgattca tcaacacgga taaagcgccc     33840
     gcctatggtc gcgcgcttgc tctgctcaaa cgcgaaggcc ggtgcccgtc tgacgttgaa     33900
     caccgacaga ttaagtaccg gaacaacgtg attgaatgcg atcatggcaa actgaaacgg     33960
     ataatcggcg ccacgctggg atttaaatcc atgaagacgg cttacgccac catcaaaggt     34020
     attgaggtga tgcgtgcact acgcaaaggc caggcctcag cattttatta tggtgatccc     34080
     ctgggcgaaa tgcgcctggt aagcagagtt tttgaaatgt aaggcctttg aataagacaa     34140
     aaggctgcct catcgctaac tttgcaacag tgccggtctt aaacaactga actgggctag     34200
     cgaaggagtg ggggcaacag cagctgcgct ggtagactta tccacagttg ctggtaacaa     34260
     aatcagcaat ccgccctggg tcaaatttca atcggcaggg tgggtcaatt ttccatcagc     34320
     gccaacaaat ggtggtttcg tcggggatgc gctccaggtt cagcccggca aactggcgca     34380
     ggatcgtggt ttcgtacagc gcttcctcca tcgctggatc gctgtagccg aaccagttct     34440
     gcagcagatg cacacgcagc atcgccatca acgggtaggc cggacggcca ccttcaccct     34500
     tcggataatg tggctcgatc aaagcaatca agcccttcca cggcaccacc cgatccatct     34560
     cgatcaggaa caactccttg cgggtttgct tgcgcttgcc agcgtactcg gcgtcggcga     34620
     aggtcatctg cttcatcggg aaactcggtg ggtgggggcg cggtattttg ccaaatcaga     34680
     aagtcttttt cagagtttcc ctagtgtgcg ctctcttgct tggatggcat tacgttctgg     34740
     cccaacgtta ctgtagcgaa tccgcagcag tatcaatcaa agcctcctgt atcccgcgtg     34800
     aagaaagacg ctacgttgcg cccgttcttc cacggcttcg cttgccgccc cgctacggca     34860
     gattcgaagt attcatcgaa atgtcatcct ttagaaacag tgcgttaaca aggaatttct     34920
     atcctttgca tcgcgaaccg caattgtgcg gccagcaata ttgcaaaagg tgatcaaatg     34980
     atgccccatc caatacagga cgccgtgctg cgggtcgacc ggttgagcgt cgtctatcca     35040
     ggcggcgtga cagccctacg cgatacctcg attgcatttc ggcgtggtga gttcaccgtg     35100
     ctgcttggtc tctcgggcgc aggcaagtcg accttgctcc gtagtctcaa tcgactcgtc     35160
     acgcccactg gcggcagtgt caccagcgaa ctcggtgagc tcggcagcgg ctcggccttg     35220
     cgtcagcatc gtcggcgtac cgccatgatc tttcagcacc accagctaat cgaacgtcaa     35280
     agcgcactgg ctaatgtgct taccggtcgg ctggcctttc acaacacgct ccgctcgctg     35340
     tttcctctgc cgcgtgccga tcaggagatt gcgctcagtt gcctcgctcg ggtcggtctg     35400
     gcagacaagg cgctaagccg ggtggacaaa ctgtccggtg gccagcagca gcgggtaggc     35460
     atcgcgcgtg cgctagcgca acagccggcg atcattctgg ccgatgagcc ggtagccagt     35520
     ctcgacccgg ccacttcggt ccgtgttctc ggattgctgc gcgacatctg caaggaagac     35580
     ggcatcaccg ccatcgtttc gctgcatcaa ctcgaatatg cccgccgctt cgccgatcgc     35640
     gtcgtcgggc tggccgattc tcagatcgtt ttcgatgccg cgccctcgga actcaccgat     35700
     gcgcagcttg agcgcatcta tgcaggccgc tctacgactc agccagcgaa tactccggct     35760
     gaaccacctg tcatgctcga accttcactg gagatgtccc gatgaaacgc ttatccgcgc     35820
     tcttattgac ttgcttgctg tccgctgttt caagtttgtc cgccctagcg gccgatgccg     35880
     atccggatgt gctaaaggtt gccctgctgc cggacgaaaa cgcctccgag ctgatcaagc     35940
     gtaaccagcc gctgaaggat tatctggaag agcatctgga caagaaggtg cagctgatcg     36000
     taaccaccga ctattcctcg atgattgagg cgatgcgctt tggccgtatc gacctggcgt     36060
     atttcggtcc gctgtcctac gtcatggcca aaagcaaaag cgacatcgag cccttcgctg     36120
     tcacggtcat cgacggcaag ccgacctatc gctcggtgat tatcgccaat gtggcgtcag     36180
     gcgtgaatga gtatgccgac cttaagggca agaagatggc ctatggtgac cgggcatcga     36240
     cgtccagcca tttgattccc aaaaccgtgc ttcttgagac ggccggtttg acgggtgggc     36300
     gggactacga agaatatttt gtgggcacgc atgacgccgt tgccgtcaac gtggcgaacg     36360
     gcaacgccga tgcgggtggg ctgtcggagg taattttcaa tcacgtagtc gaacgtggcc     36420
     taatcgatcc gagcaaggtg aaagtacttg gttacagcgg cgaatacccc cagtacccct     36480
     gggcgatgcg ctcgaacctg agccccgagc tgaaaaccaa ggtgcgggat gtattcgtcg     36540
     gtatcgacga tcccgaagtg ctgcgcaact tcaaggccga ggccttcgcg ccaatcaccg     36600
     acgccgacta cgatgtgatc cgcaaaatgg gatcgctgct cggcctcgac ttcgccacga     36660
     tgtgagcacc gatatgtcta ctcattacga cgtgcaggcg ctgcctgcag agcaacgcga     36720
     gcacatcctt cgaggcttcg gcctcggttg gtggcgccag ctggggcagg tggcgattgt     36780
     attcggagtg gtgctgttgg cctgctggta cgtggggctg ctcgatgcca ccacgctgct     36840
     gaacgggctg ccctccatcg cgaccctggc aggcgaggcc atgccgccag acttttcggg     36900
     ctatcgaagc tggattcgcc ccttgatcga caccttggcg atgagcatcg ccggtacggc     36960
     catcgcagtg gtgttctcgc tggtggtggc cttcgttgca gcgcgcaata cggcgccgca     37020
     cccccttgtg ttcggtgttg cccgggtgct gctcaatgcc ctgcggtcgg tgccggagct     37080
     gatcatgggc atcatcttcg ttgcagccgt agggttcggc gccttgccgg gcgtgcttgc     37140
     cctgggtctg cattcggtcg gcatggtcag caagttcttc gccgaggcca tcgagcacgt     37200
     cgacgaagcg ccggtggaag ccgctcgggc ggcgggggct acgccgatgc aagtgctgct     37260
     gcacgcggtt ttgccacagg tgacgccgca gttcgccgac gtggcgatct accgctggga     37320
     atacaacttt cgcgcctcca ccgtgatggg catggttggc gccggcggta tcggcttcga     37380
     actcatgggc tcgctgcgca tcatgcagta ccaggaggtt gcagcaatcc tgctggtcat     37440
     cctggccatg gtcacgctag tagacgcctt cagtggcgtg ctgcgcaaac gtttcaaata     37500
     ggacaaaaca tgctgccgaa actcgttata actcaccgag tacacgatga gatcctgcaa     37560
     ctgctggcgc cacattgcga gctggtgacc aaccagaccg acagcacgct gacgcgcgag     37620
     gaaattctgc gccgctgtcg cgatgctcag gcgatgatgg cgttcatgcc cgatcgggtc     37680
     gatgcagact ttcttcaagc ctgccctgag ctgcgtgtag tcggctgcgc gctcaagggc     37740
     ttcgacaatt tcgatgtgga cgcctgtact gcccgcgggg tctggctgac cttcgtgcct     37800
     gatctgttga cggtcccgac tgccgagctg gcgatcggac tggcggtggg gctggggcgg     37860
     catctgcggg cagcagatgc gttcgtccgc tctggcgagt tccagggctg gcaaccacag     37920
     ttctacggca cggggctgga taacgctacg gtcggcatcc ttggcatggg cgccatcgga     37980
     ctggccatgg ctgagcgctt gcagggatgg ggcgcgaccc tgcagtacca cgaggcgaag     38040
     gctctggata cacaaaccga gcaacggctc ggcctgcgcc aggtggcgtg cagcgaactc     38100
     ttcgccagct cggacttcat cctgctggcg cttcccttga atgccgatac ccagcatctg     38160
     gtcaacgccg agctgcttgc cctcgtacgg ccgggcgctc tgcttgtaaa cccctgtcgt     38220
     ggttcggtag tggatgaagc cgccgtgctc gcggcgcttg agcgaggcca gctcggcggg     38280
     tatgcggcgg atgtattcga aatggaagac tgggctcgcg cggaccggcc gcggctgatc     38340
     gatcctgcgc tgctcgcgca tccgaatacg ctgttcactc cgcacatagg gtcggcagtg     38400
     cgcgcggtgc gcctggagat tgaacgttgt gcagcgcaga acatcatcca ggtattggca     38460
     ggtgcgcgcc caatcaacgc tgcgaaccgt ctgcccaagg ccgagcctgc cgcatgttga     38520
     atccggtctg gctgaagagc ctggtagcga tcgttcaaac aggcagtttt cagagcgcgg     38580
     cgagggcgtt ggggctggcc cagccgacgg tgtcgcagca cttgcagaag cttgaagagc     38640
     aggtcggcgt aacgctggtg cagcgcagtc gtagcggctg ccagcctacc acacgggcgc     38700
     tggccttcat gccgcatgcg accgccttgc tcgacatgca cgcccgggcg ctagaagccc     38760
     tgcatggcaa tcgtgagcgc gtcggggcca gcaccaacat cggcacctac cttctccagc     38820
     cattcgtgcg caactatctg acgaccgcaa atgagagggg cgaggtggat ctgcgcatcg     38880
     ccgccaaccc ggatgtggcc gaccagctac tggcgggcca gctcgacgcc gcgatcatgg     38940
     aatggtggct acctcacccc gacttcgaac accgcctctg gcgggtcgag ccgctggtgc     39000
     ttatcgtcag ccccgaccat gcgctggctg aagcagggtg catagaacgt gatcgtctgg     39060
     tggacctgcc gatgctggga ggtgaaccgg gtagcggtac cggacggctt ctgaccgaat     39120
     actttggcga actgggcgtg cctcgcagcg gtatgcagct aggcagcacc gaggcagtca     39180
     aacaagcagt gagggcggga ctcggcgtgt cgttggtgat ggcttccgca gtacaagacg     39240
     aagttcgcag tggcgcgctg gtagctcttc ccatcccggg gcttgaaaag cgtctccaac     39300
     tgatctggcg caaacctccc ggaaatctgc acccgccggg atttgtgcgg cacttattgg     39360
     aggaggcaga tctagctgga taaggtgatg gatggttgcg atccagcgct tggcttgtca     39420
     gcctagggaa actctgaaaa agactttctg atttggcaaa ataccgcgcc cccacccacc     39480
     gagtttcccg atgaagcaga tgaccttcgc cgacgccgag tacgctggca agcgcaagca     39540
     aacccgcaag gagttgttcc tgatcgagat ggatcgggtg gtgccgtgga agggcttgat     39600
     tgctttgatc gagccacatt atccgaaggg tgaaggtggc cgtccggcct acccgttgat     39660
     ggcgatgctg cgtgtgcatc tgctgcagaa ctggttcggc tacagcgatc cagcgatgga     39720
     ggaagcgctg tacgaaacca cgatcctgcg ccagtttgcc gggctgaacc tggagcgcat     39780
     ccccgacgaa accaccattc tcaacttccg ccgcttgctg gagaaacacg agctggcggc     39840
     cggcatcctc gctgtcatca atggctctgg gcgaccgcgg cctgtcgctg cgccagggca     39900
     ccatcgtcga tgcaacgctg atcaatgcgc ccagttcgac caagaacaag gacggcaagc     39960
     gcgacccgga aatgcaccag accaagaagg gaaaccagta ttatttcggc agtgcgacct     40020
     gaaagtcgca tgggtttctg ttccgcaggt taacgcccga cggaaccgac tgttccacca     40080
     ctcgttccct acccagacag gcgtggccgg taacagccgg gtctgaagct ctggggacaa     40140
     tgtaaccgcc gatatttcgg taggtcgaac cgcgaggcca gactgaatct gccagcatca     40200
     aggcggagag gcgccaggga tgaacaggta cccgccaact gcacgggggt gatggtgctc     40260
     gcttggcgac tggcttcttg ctggaggtta gagattgctt cggcaattgc cttggtctga     40320
     gccacatagc tgccggatag gttggcaatc acaatgcagc aacgcggtaa ctccagagcg     40380
     gcgctcatca ggcagctgag tgtgtaggtg ctcacggtag ccagcgtacc gccgccgatg     40440
     acagggaagg tgcgaataag caggtcattt cttcccaagc tgactcgctg attaaaattt     40500
     cgcggatctg ggccgatttt tttcccgcaa acacatcgaa tcagcctatt taggctattt     40560
     tttccaccat ttctggcgtt atttccggtt tttactgaga tctctcccac tgacgtatca     40620
     tttggtccac ccgaaacagg ttggccaggg tgaataacat cgccagttgg ttatcgtttt     40680
     tcagcagccc tttgtatctg gctttcacga agccgaactg ccgcttgatg atgcgaaacg     40740
     ggtgctccac cctggcacgg atgctggctt tcatgtattc gatgttgatg gccgttttgt     40800
     tcttgcgcgg atgctgcttc aaggttttta ccttgccggg acgctcggcg atcagccagt     40860
     ccacatccac ctcggccagc tcctcgcgct gtggcgctcc ttggtagccg gcatcggctg     40920
     agacaaattg ctcctctcca tgaagcagat tacccagctg attgaggtca tgctcgttgg     40980
     ccgcggtggt gactaggctg tgggtcaggc cactcttggc atcgacacca atgtgggcct     41040
     tcatgccaaa gtgccactga ttgcctttct tggtctgatg catctccgga tcgcgttgct     41100
     gctctttgtt cttggtagag ctgggtgcct caatgatggt ggcatccacc aaagtgcctt     41160
     gggtcatcat gacgcctgct tcggccagcc agcgattgat ggtcttgaac aattgacggg     41220
     ccagttgatg ctgctcgagc aggtggcgga aattcatgat ggtggtgcga tccggcaggg     41280
     cgctatccag ggataatcgg gcaaacaggc gcatggaggc gatttcgtac agggcatctt     41340
     ccatggcacc gtcgctcagg ttgtaccaat gctgcatgca gtgaatacgc agcatggtct     41400
     ccagcggata gggccgtcgg ccattgcccg ccttgggata aaacggctcg atgacttcca     41460
     ccatgttttg ccatggcaga atctgctcca tgcgggagag gaaaatctct tttcgggtct     41520
     gacggcgctt agtgctgaat tcactatcgg cgaaggtgag ttgatggctc atgatgtccc     41580
     tctgggatgc gctccggatg aatatgatga tctcatatca ggaacttgtt cgcaccttcc     41640
     ctaagtcaat cactttaaag actgaagtct ggcgcagtag cccctgaaag ttgaatatcc     41700
     aattccaatg agtagggggc tgagccatcc ggtaagggct gaatttgcct gcgggattgg     41760
     ctcagcccgc cagacccgtt tggtgttgcg ccggacaatg tccggcggca aagaaggtaa     41820
     tgactccaac ttactgatag tgttttatgt tcagataatg cccgatgact ttgtcatgca     41880
     gctccaccga ttttgagaac gacagtgact tcctgcccag ccttgccaga tgctgcctca     41940
     gattcaggtt atgccgctca atgcgctgcg tatatcgctt gctgataacg tgcagttctc     42000
     ccttcaggcg tgattcataa agcggccagc catccgtcat ccataccacg acctcaaagg     42060
     ccgacagcag gcccagaaga cgctccagcg tggacaacgt gcgttcaccg aatacgtgcg     42120
     ccacaaccgt cctccgtatc ctgtcatacg cgtaaaacaa ccagcgctgg cgtgatttag     42180
     caccgacgta accccactgt tcgtccattt ccgcgcaaac aatgacgtca ctgcccggtt     42240
     gtatgcgtga ggttaccgac tgcggtctga gttttttaag tgacgtaaaa tcgtgttgag     42300
     gccaacgccc ataatgcggg cggttgcccg gcatccaacg ccattcatgg ccatatcaat     42360
     gattttctgg tgcgtaccgg gctgagaggc ggtgtaagtg aactgtagtt gccatgtttt     42420
     acggcagtga gagcagagat agcgctgatg tccggcagtg cttttgccgt tacgcaccac     42480
     gccttcagta gcggagcagg aaggacatct gatggaaatg gaagccaccc gcacagcgcg     42540
     ctgggatatc actccccgag ggaataccgg cagcggacat cgttaactta agatacaaaa     42600
     gctgttcgga gatggagggt caagatcagg gtgacctgcg ccatgatgtt atccgagccc     42660
     tgtttcctaa tcactacacc ggtatttgat tacccaggtc aacttcaggc tgttacaggg     42720
     acggcaaccg tgtcagcaca tccttgagat aggcatacgg atcgtgccca ttattacggg     42780
     ccgactggat caaactcatg atcgcagcag cgcgcttgag tatgcgaacc cacgccgagc     42840
     atttgagaag gcaacgggat gaacgctggc tggatagccg tggttttctg ggtaggcagc     42900
     cgaatccatt tgtggtcgag gttggcattg aggctgtagc ccaaggcgat gtttgcgatg     42960
     gaggcaccgg gttcagaaca ctcctgaatg acctgagcct tgaaagattt gctgtaggta     43020
     cggcgctgag ggcgcatgga aaatccgctt gatgggccat ggccttcggc ggcggtgtcg     43080
     ggaaggtgtg ttggccggac ggatactgtt gaactacgtt gtctggggca acggaagtgt     43140
     ttcggcccga ctctggaacg cgatccgcag cgacgactgg gcaattccgc acgttagcct     43200
     gagcagcctc ggggaaatcg tcgtctgggc gcgcccagac gagtttccgc caaggaacat     43260
     gcagacgagc aaggggctgc gggcactcgg ctacaacgtg aggatcggtg tttgatcgag     43320
     gcgcctgtgg tacacgcagg ctgacgagcc aggcgctgtc cattgcctga tcagaccgcc     43380
     ccgctgcgcc ttgcctgagc agttgacctg catcaatggg gcgggagaac gctgtacatt     43440
     gactcttgaa ggctgtcatg gtaagcgtaa tatcttacaa agtattacaa ggatttcctt     43500
     ggccggaacc gcaaagcgac gcgattggag agggtgagat gaaagcgcac ctacagggat     43560
     gaaagcgcac ctacaggtga ttttcacgct cgatgaattg gctgcgtact tgaaagtcgg     43620
     caagcggacg ctttatcggc tcgccgcgca cggggaaatt ccggctttca aggtgggcgg     43680
     gacgtggcgg tttcctcaaa gtgaaatcga tcagtggatc aatgatcaga cccgagccgc     43740
     agcaaagaag gaggtgatgc gcaagcgtga acagcagaag tcatccgagc agcccgtgtc     43800
     gcctgggcgc actgcccgtc acagcaggca aagggcttga gtaactcgtt ttccaatttt     43860
     tctggaggta tgacatggac atcgatttca agaagttggc tccctggaac tggttcaaga     43920
     acgagcagca agagcagcag accgtctctt ccctgccggt gcagcgcaat gacctgccag     43980
     cggcgagcgg gccagtcagc ccgatcctgc aactgcatcg ggaaatcgac cggctgttcg     44040
     atgacgcatt ccggggcttc ggttttccgg cgttgaacat gccgcagtgg ccatccgatt     44100
     ggtcgggcat gctgaagccg gccctggaca tccaggaaac cgacaagcag tacaagattg     44160
     ccctggaagt gcccggtgtc gaggagaagg acatccagat cactctcgac aacgacgtgc     44220
     tgatggtgcg tggcgagaag cgccaggaac aggagaagaa ggaaggtggc ttccaccgtg     44280
     tggagcgctc ctacggcagc tttcagcgtg ccttgaacct gcctgacgac gccaaccagg     44340
     attcgatcaa agcatcgttc aagaacgggg tgctcacggt cacgatcgac aagcgcgagg     44400
     tcagcgcgcc gaagcaggga cgctcgatcc cgatcaacgg ctgacgtcgc cggctcgttc     44460
     gtcacaagaa aaacccggca cgagacgagg agtcgcggtt cgcgatgcct cgtcgcctca     44520
     accttgtcaa ccttgtcaac cttctcagga gcatcagcat ggccagaaaa caatgccagg     44580
     tctgcggcca acccgccacc gtgcgggtgg aagccaatct caacggtcgt cacagcacca     44640
     tgctgttgtg cgacgaccat taccggcaat tagtgcgcca gcaaaagcgc accgtttcgc     44700
     cgctggaagc cttgttcggc tcgcgcagcg gcctgttcga ggacttcctc ggcagtgact     44760
     tcttccgcat cggcgacgac gcgacgccag ttgccgccga taccgatgac gtggtcgatg     44820
     cctcgtttgg cgagcccgcc gccgcaggtt cgggtgcgcc gcgccgtcgc ggcagtgggc     44880
     tggccagccg catcagcgaa cagtcggaag ccttgctgca ggaggccgcc aaacacgctg     44940
     ccgaatttgg ccgctccgag gtggataccg aacatctgct gctggcgctg gccgacagcg     45000
     acgtggtcaa gaccatcctg ggtcagttca agatcaaggt cgatgacctc aagcggcaga     45060
     tcgagtctga ggccaagcgc ggggacaagc ccttcgaggg cgagatcggc gtgtcgccgc     45120
     gcgtgaagga tgcgctcagc cgcgccttcg tggcctccaa tgaactcggc cattcttatg     45180
     tcggtccaga gcatttcctg atcggtctgg ctgaggaagg cgaagggctg gccgccaacc     45240
     tgctgcgccg ctacggcctg acgccgcagg cgctgcgcca acaggtcagc aaggtggtcg     45300
     gcaagggcgc cgaggatggc cgcgctgaga cgccgaccaa cacgccagaa ctcgacaagt     45360
     actcgcgcga cctgaccaag atggcgcgcg acggcaagct cgacccggtg atcggccgcg     45420
     cgcaggagat cgaaaccacc atcgaggtgc tggcccggcg caagaagaac aacccggtgc     45480
     tgatcggcga gccgggtgtg ggcaagaccg ccatcgtcga agggctggcg cagcgcatgg     45540
     tggcgggtga agtgcccgag accttgcgcg acaagcgcct ggtggaactc aacatcaacg     45600
     ccatggtggc cggcgccaaa tatcgcggcg agttcgagga gcgcgtgcag aaggtgctga     45660
     aggaggtgac cgagcaccag ggcgagctga ttttgttcat cgacgaggtg cacaccatcg     45720
     tcggtgccgg ccagggcggt ggcgaaggcg ggctggacgt ggccaacgtg ttcaaaccga     45780
     tgatggcgcg cggtgaactc aacctgatcg gcgccacgac gctgaacgag taccagaaat     45840
     acatcgagaa ggatgccgca ctggagcggc gcttccagcc ggtgacggta cccgagccga     45900
     cggtggccca ggccatcatg attctgcgcg gcctgcgcga caccttcgag gcgcaccaca     45960
     aggtcagcat ctccgaggac gcgatcatcg cggcggccga gttgtccgac cgctacatca     46020
     cggcgcgctt cctgccggac aaggcgatcg acttgctcga ccaggcggcc gcgcgcgtga     46080
     agctgtcggc cacggcccgg ccggtggccg tgcaggagct ggagtccgaa ctgcaccagc     46140
     tgcggcgtga acaggattac gtggccgcgc gcaagcagta cgaccaggcc gccgagctcg     46200
     ggaagcgcat cgaagccaag gaggccgagc tcaagaagct cgtcgaggac tgggagcggg     46260
     agcgggcctc cggcagtgcc gaggtcaagg cggaacacgt ggcgcagatc gtctcgcgcc     46320
     tgaccggcat cccggtcaac gagttgacgg tggaagagcg cgaaaagctg ctgcacttgg     46380
     aacaacggct gcacgagcgc ctggtgggac aagacgaggc ggtccgtgcc gtggccgatg     46440
     ccgtgcggct gtcccgcgcc ggcctgcgtg aaggcagcaa accggtggct accttcctgt     46500
     ttctgggccc gaccggggtg ggcaagaccg agctcgccaa ggcattggcc gaatcgatct     46560
     acggcgatga gcacgccctg ttgcgcatcg acatgtcgga atatggcgaa cgccataccg     46620
     tggcgcgatt ggtgggcgcg cctccgggct atgtcggtta cgacgaaggc ggtcagctca     46680
     ccgagaaggt gcggcgcaag ccctacagcg tgctgctgct cgacgagatc gagaaggcac     46740
     accctgacgt atacaacatc ctgctgcaag tgttcgacga cggtcgcctc accgacggca     46800
     agggccgggt ggtggatttc accaacacca tcatcatcgc cacgtccaac ctgggttcgg     46860
     acatcatcca gcgacggctg aaggcgcgcg gggcggccgg cgaggagtac gaaaagacca     46920
     aggccggagt catggacgtg ctgcgcggcc atttccggcc cgagttcctc aaccgcatcg     46980
     acgagatcat cgtcttccat gcgctgggca aggaggagat ccgccacatc gtcggcctgc     47040
     agctcgatcg cgtggcgcgc agcgccgcca gccagggcgt gacgctcact ttcgatcaga     47100
     cgctgatcga ccatttcgcg gaagaaggct acaagcccga gttcggtgcg cgtgaactca     47160
     agcgcctgat ccgcagcgag ctggaaactg cgctggcgcg cgagatgctc ggcggcggca     47220
     tcggcaaggg cgatcacgcc agcgcacgct gggacgacaa ggccgaacgc gtggtgttcg     47280
     aacgcaaaga gccaccgcag accccggccg agccggagca gccggatgcc gcgaaggcga     47340
     gcgacgcatc ttgatggcgg gcgaggctgc cgtgtccgac cccatcggcc tggcactggc     47400
     atgggcagcc tccctggcct cgatcgcggt ggcggtcgtg gccgcaggtc acgcgggcgt     47460
     ctacaagcgt gatgagcagt cggccacgcc gtggggactg ctcatcagcg gcggcactgc     47520
     cctcccgctc gctggccatc cgttcgcgtg acggcgcggc ccatctgttc acctgatcct     47580
     ctggcaactc gactttcgag gaacaaggcc catggctggg tgacgcgggc aggcaactga     47640
     tagtcggtac tctgttcgac atctcttctc gcaaggaaat agagcagcag ttgctgcgta     47700
     tggtgatcac cgaccccttt gcttcacggt tgagggaaca tgttcgcgca accgacatgg     47760
     ctgcccggat tggggggagg aattcgctgt gttgttggaa gcggcatcga tagaaggcgc     47820
     ccaagtatgg gcggagcgat ttcgtcagga cactgcggcg acagcggtgg tgtgtggaga     47880
     ggtgtcgatc agctatagcg ccagcatggg gggggctctc cttgaccccc gtttgcactc     47940
     tgtcgagcag gtgatgctgc aggcggacag cgcgctctac caggcaaaaa agacaagggt     48000
     gcaaccaagt tgtgggcgca caagtatttc agaattgaga ggagtggcga tgaaggaaaa     48060
     gcaagcagac ccgatcaaaa catttcgcgc ccaatgggca gtgatgacgt tctacgagcg     48120
     ctttgaacag gtgatcgcgc tcgcgctgtc cgcaatcatt gccgttatca tcgtggtctc     48180
     gctgctgcag ctgatctcga tcgtcttcag cctgctgatc attgatgcat tcaatccgct     48240
     cgatcacaag gtcttccaga ccgtgttcgg catgatcatg acgctgctca ttgccatgga     48300
     gttcaagcat tccatcgtga gggtggcctt gcggcgcgac agcatcatcc aggtcaagac     48360
     ggtgatcctg atcgggctga tcgccctggc gcgtaaattc gtgatcctcg acccggagac     48420
     cggccccgcc aaggtcgcgg cgcttgcagg cgcgacactg gccctcgggg cgacttactg     48480
     gctgctgcgc gagcgcgatg accggacagc cggggaaagc tcagatgatc agtcgtgatc     48540
     tgcgccacgc gcagaatgtc ggcgcgcggc atcgctggca caatcgcctg caaaccgtgc     48600
     tgttggtgct gaccctgctc ggaattgccg ccgtcgctgg cagcctgctg ttgggtgacg     48660
     gcgggctttg gctggcgctt gcggctgcgg ggttcaccct gctgcttgaa ccggcggccg     48720
     ctccgggctg accttgcggc tgtatggcgc acgccccctg cacccggatg aagcgcccga     48780
     tctttgggct gtgttgcgcg aactggcggc gcgggccggg ctgcctaccg tgccggtacc     48840
     gcactacgtg cccagcgggg tcgtcaacgc cttcgccacc ggttcgaagc atcacgcggc     48900
     catcgcgctg accgacggcc tgctgcgtag cctcacgccc cgcgagttga ccggcgtgct     48960
     cggccacgaa atcgcgcata ttgcgaacga ggatttgcgt gtcatgggct tggccgattc     49020
     catcagccgg ctcacccatc ttctggcctt gttggggcag cttgcgatcg tgctcagttt     49080
     gccaacgcta ttgcttggag tcacggaagt caattggccc gcgttgcttc tacttgcggt     49140
     cgcgccacag ctggccttgc tggctcagtt gggcttgtcc agggtgcgcg aattcgacgc     49200
     cgaccggctc gctgccgaat tgaccggcga cccgcacggg ctggcctcag cgctcgccaa     49260
     gatcgagcgg gtgagccgct cctggcgcgc ctggctgctg cccggatggg gcaatccgga     49320
     accctcctgg ttgcgcacgc atccagcgac ggctgaacgc attgagcgct tgctagaact     49380
     agctccgccg cccgcgatgc cgccgtttcc atcggcccgt ttcgaccccg aagtgaccgt     49440
     atcaccacgt ccgccacgct ggcgcactgg cggcctttgg cgctgatttc aacatggaga     49500
     atgacgtgac ctacccgacc cctacagccg cccggagccg gatcgattca tccggcgctg     49560
     gctcgtcatc actggctgca tcgccgcact catgctgctg tggcagttcc tgcccgccat     49620
     cgaagcctgg ttcagtcccc acgaaacaaa tgcttcagcc cggaagagag gtctcaggcc     49680
     gtccgggagc tctgtaaccg acgtggaacc gcgcgtaaag ttgcacaaag cataggcgtc     49740
     agcgtcccgg tcctgtacaa atggaagaaa gaccttatca gtgacgaggc ttatcaatcc     49800
     atgcgcaaac gaaagtcagc ccctcaggat aaaaatcagg atgctttact cggtgaaatc     49860
     cagcgtctca ggaagcaggt tcatcagctg cagctcgaac gtgacatact gacaaaggcg     49920
     aatgaactga taaaaaaaga tctgggcgtc agctttctga aactgaaaaa cagggagaaa     49980
     accctgatag ttgatgccct taagaaaaag taccccgttg ctgagttgct aagcgttctg     50040
     caacttgccc gcagctgtta tttttaccaa aacgtctgta cgataagtat gcggaaatac     50100
     gcgtgatcat ggccgatatc tttgaggaga attaccgctg ttacgactat cggcgccttc     50160
     acgcgatgct tcgcggtaac aacagggtta tttctgaaaa ggttgtccgc agactgatgg     50220
     cagaagagca gctcgttgtt aagcgcacca ggcgacgacg atacaactct tactgtggcg     50280
     aaatcggccc ggcaccggaa aatttactcg cccgggattt tagttcctgc aggccaaatg     50340
     agaagtggct gaccgatatt acggagttcc agcttccggc tggaaaagtc tatctgtcgc     50400
     cggttatcga ctgctttgat ggcctggttg taagctggtc gataggaaca cgcccggacg     50460
     cgacgctggt gaatacgatg ctcgatgacg cactcgatac gctcaacgaa catgataaac     50520
     cagtgataca cagcgatcgt ggtggccatt accggtggcc gggctggctc gagcgtatca     50580
     acacctccgg acttataagg tccatgtcgc gcaaaggatg ctcgtcggat aatgctgcgt     50640
     gtgaaggctt cttcgggcgt atcaaaaacg aaatgttcta tggcagagac tgggcgggta     50700
     tcacgctgga aaaatttatc tgcttcctgg acaggtacat acgctggtat aacgagaaac     50760
     gtatcaagct atcattaggt gcaatgagtc ctgtgaagta ccggcagcat cttgggatca     50820
     caacataaca gtccaggaaa acatccgcag ccccctaata gacattagca ttgagcccct     50880
     acaatacatg ttattgcaag cttaaaatgt caccaaattc agccagttag aaatgtcacc     50940
     ttaagagatg tgaagagaga gaagttggtt tatgtcagag gaaagcaggc atgaatgacg     51000
     tccatgcctg tgatgagagg ctataccaat aagctgttat tccccttttt tatggtcgtg     51060
     ttccttcagt ccgggatgct ttggcttgtt ttccggagtg acacgccttc ttttatcttc     51120
     tttgccagtt gattcagcaa tcggctttgg gccaggttta atacccataa aaatctcctt     51180
     gagtgacaaa cagattcata tttacgaact gtggcagtaa tgccaaatat gaaatgaggg     51240
     ttcatggtta taaaaccaac tgacgtgttt tcagaagctt gcactccatc acactgctaa     51300
     aggtaaaaaa acagaacaga gcagggggct agcgtttcag actggctcgg aactcttcag     51360
     gattagccag tacggggttg atggctctga gttgctcctg aacccgggct tgtgcacgtc     51420
     gtttgggcat ttttttactc ctatctcgct ttccctctcg atccaattca tccatcttgt     51480
     cctgagccag tttcagtaca gcaccgagcc gtttgttatc aacgatttgc ccctggtcga     51540
     tgcattccag tttatcgaag acctgataat tgagtgatcg gtagccatat ttaaacgcca     51600
     gcgtaccatt tgggtagtcg taaactgtga ttttttcacc tgcaattctg gtattttctt     51660
     ccgtaggttc aacgagatat atcatcttat cgtaacggaa agtcagtgtt ttcgagagtt     51720
     ttcgtgattc ctgccaagca aagatatcat ccagatcttc agagctttca agcaccggtc     51780
     gatgcaggtc tttgggatat tttgctggtc tggcaaaacg acgattgaag tcaataatga     51840
     aggaatccag ccaggcattg gcatcctcga tgctgctgat gccttcaagc cgcatttctt     51900
     tgataagtcg atcctgaaga gtctggtttg cgcgctcaac gcgaccttta gcttgcgggc     51960
     tgttggcgca tatcaactcg atccccagtt cggaaagcac ccggccgaac tgagtgattc     52020
     cagttgtggt agtgccacca ttattgaccc tgaaaatgcc gtgcttatcg ctgtagaacg     52080
     ccagtggttt gccatgctgt tcaagatacg cgcgggtggc catcatgtaa tcaaaggctg     52140
     attcagtctc gccgaaacgg aggtgcatca ggcgcccagt agcatcatca atgaagacga     52200
     gcaggcagca tttgggggca cgtccttcaa accagtcatg cggggaacca tcgatctgaa     52260
     caagttctcc aaggcagtca cgccggtatc tgggttgatg aacacgtggc ctgcgacgtg     52320
     agtatgggac ccagagtcca tcagccgtca tccattttct cagtgtttca acagacaccg     52380
     tgatgttatg gcgttcgcgc aatttttctg cggccagcgt tggtccaaag tcgctgtaat     52440
     gatcgtgaag taaagaaagt acacgcagct tcagtgactc aggaagtctg tgattaccgg     52500
     ggcgtcctcg tcgaaggttt gccagacctg cagcaccaga ttcacgaaag cggttcatca     52560
     aacgctgtgt ctgacgttcg gtcaaagcaa gctgatgagc agcgtcgcga cggcgcatgc     52620
     gcttttcaac aactgactga atgatgttga tccgactgag ttctttatct gacatggtca     52680
     caagcatcct gatgtctcca tggcctgagg attggatcct ttatgccaga aaaagtgaca     52740
     tcactaaatg ggttaaaagt gacatcagaa tattggagtt acaatacatg tcaaggctca     52800
     attgaaatgt ccgttatcca gctcaattaa aatgaccact ttgatctctc attctcttta     52860
     ctgatagact ttcctccgac tgaaacaaca ggatgattga gcccatgctt cgatacgagt     52920
     taacgccgaa caatgcaggt tttatactgt ggggagattc agaagccctg aatgaattac     52980
     atgaactcat tcattacatc gtggatgaaa gcccactgat taaagttaaa gacggattta     53040
     tgttatccct tgcctatgat attcgtaaag cacgggaagg taatcgtcgt gttgagcaac     53100
     atcagtatga tcaacatgat acatataagc tttatggtgt tgagctttta tggcctctgg     53160
     tcctggtaca gtcctcaata ctcagaaact caatgggtta tattcagaca gacaaaaacc     53220
     agctgtctgt catgtatgcc tttgaatacc tgatagaatc agcattaaca gagtctgaga     53280
     gaacaacgtc gaatgatatt atgctaacag taaaatatgc atcagactct gattttaatt     53340
     tcattgagga taatattgac agcaggtgct gctattttat cagcctatct ccggagcaaa     53400
     gaaaaaagca gttaatcagt attgttcgtt cttttcattc attatggggt aagtatgccc     53460
     gtgaaaagca ggacataaag atgctgaacg aaatgaataa tacatcatgg gtctggccgg     53520
     acaatatcaa ctggtgagca accactgtcc ggccagtgag taccatcagc gggctctttt     53580
     accaaaaatg tcctctgaac gtgactgaag ctgtttgagt gcttcgagca tgtcatcatt     53640
     atccagtgag cgctgggatt tcttcccttc ctgctttggc cgtcgtcggg aagggccatc     53700
     tccagcggga attgactgag agcgcgtgtt atcccgcttg ctctgcacca gactgataaa     53760
     ctccagggtt cggccaagac gcttgttatc gacaatcgcg ccctggtcga tttctgacag     53820
     tcggtcgtag gtagagtagg gaagtagcgt accgttcagg cgcagctctt ttctgccatc     53880
     aggatagtga tacacatcga tatatttacc tattgcacgg cgactcagtt cgctgtcttc     53940
     aatcaggtac aacattttat catattgtat cgtcaacgat tttgagactt tacgtttttc     54000
     acgaacagtg aaaataagcc ccaggtcctc atcatgttct acagcacggt gtacgtcaaa     54060
     atcatgtcgc ggtactttgc caaaacggcg gttatagtca gccatatagg cctcagcgaa     54120
     gtcatttgca gcctccattg aacaaatgcc ctgtaaccgc agctctttga ccagacgatc     54180
     ctgtaaagtg aggtgagctc gttctacacg ccctttggcg ggactggttt ctgcacagat     54240
     agtctggatg ttcagttcat gcatggctcg cccaaactga gtatgcccgt ctccgcctgt     54300
     ggcgtgttta ttgttaacac gaaaaacacc ggctttatcg ctgtacagtg ccagcggttt     54360
     accatgctta tcgatatagc gccgcgtggc ttcgaagtaa gaaaacgtgg actccgattt     54420
     aacaaacaac agttccatca gtttgctggt tgcatcatca acatagacca gcgcggtgca     54480
     ggccgggcca cggccttcaa accagtcgtg atcacagcca tctatttgta tcagctcacc     54540
     agtacacgga cgccggtacc gtggttgagg gatccttgcg gcacgttgtt tacggggaac     54600
     ccataagcca gcccgcacca tgatgcgccg gacagtttct ttgccaagaa acagtccgtg     54660
     gagttcttcg agcttttcac gcgccagagt cggaccgaaa tcagcataac gcgtcttgat     54720
     cagttccaga gcctgatctg cgagcccggg tggcaactgg cggttaccac gcatgccaca     54780
     tcgtctgctg gccataccaa gcggtccgcc ttcacggtaa cgggcaagaa gtctgcggca     54840
     ttgcctgtcg ctgataccga ggtgctcggc cgcacggcgc gttgtgatgc gacgttcaat     54900
     gacgtcctgt ataatcttga tccggttgat ctctttcaaa gtaaacactc ctgagctttc     54960
     tgcgctcatg atatgcctcc cggtagttta aacggaccag tgaagcttac catagcgcgg     55020
     acatctgaat tgagccacag gcggacatta ctattgagcc attacaatac aggtgcgcat     55080
     aacaaagatt atgttaaata ttaaaataaa taacataaaa atcaatatgt taagacggta     55140
     accagctact ttcccattcc agcaaccagt catggaagct ttagaaacag agtcctctca     55200
     tgagtttgtg atgccttaaa tccatggtga gcatagaaac ctttggcttc ttcagtaagc     55260
     gcatgaacca ttatcgcacg aaccccaatg ttctcagcta cgcgataaca ccgtagaact     55320
     gcatcgtgga gtaaatcggc gccaacccct tttccgtgca atgagacatc taccgccagg     55380
     cgagcgagta taatcaccgg tataggatct ggcatgttac gccgaagact acctgtcgct     55440
     tccgtatggt taacgctacc ggtggccaaa gagtaaaaac cagctacttg cttcgtaccc     55500
     gtcttgcaaa caacgaacgt tcgggcagcg ccaagagctt gattttttaa acctctctgt     55560
     tttagccatt catcgaggac tgtctctcca ctgacgaact cagccagctg atgagagctg     55620
     gataacggct cgggcgtggt tatacgtccc actgaggttt ccttgccagt agtttattaa     55680
     tggcgggctc atcctcgact ggtgcatcga gcatatcgat gaactctgca tactgttcgt     55740
     cgttaaaatt gaaaacacgg cgatcaagga tcacattctc cgcagccttg caggccatct     55800
     ccaggataaa gtcggttcgc gatttatgaa ggatctctgc agcagcatcg atgagtgctc     55860
     tctgagactc tttagctctt aggttgagtt gaacatctga tttcatacac acctctcttg     55920
     tatagcaatt gatatacaag aataacacaa cacgaacgta tagcaaatgc tatacacttc     55980
     aaagtaccga taatgcgttt tatgttaaat atcatacatt taatgaaaaa tgatggctga     56040
     tcttctgcaa tagtcagctc attatcgctg caggcgtggc ttcattctgg atagatggag     56100
     tcttttctgg cattaatgcc ctgaagacga acacggtcgt tatcaggcaa atggataccc     56160
     atcatgcgaa gaataaagcc gcgccacccc cggttaacct gaccgttata gtcatacagg     56220
     tctgcatttt cttttttaag ctttgaccat tcatgcatga gtgttagtgc atcgagctcg     56280
     gtgatgtgct tcacttcatc gccgatacgt actgtgttaa tgcctcttcc cgtcatgatg     56340
     atcccctccg gcaatatcag tttcagatta acgctgttat gatgatgatt taactacaca     56400
     ctaaaggcaa tctaacgttt aatcatacct ctgataataa agaacatcat ggttaatgaa     56460
     aacacaatca gaagccagcc aaagggtttg gcatcaaaaa cagtagtgat gcaatcatta     56520
     gtacaggtaa ccaacttcgg ggtgacaata gaaattcccc acccaaaaat aactaccata     56580
     gtgcctgcta ctgcggctaa gaaaaaagtg gtgaagaatg cgcatccgac tacaagtaac     56640
     aatccaatca gttcaaatat catattcatg attgcgctcc aggtgagata actgcgaaca     56700
     gactgatgct ggctgtttta tttaacatat ttccagacgc ctgcaggaat tttatcataa     56760
     aacttcccca ttgccatttc cgccagccgg tgatccactg cggcattaaa gtgctcaagt     56820
     tcgtcatccg tcagggaata tttatttttt tctattatcc tttccagagt ttccttagat     56880
     gtacagcggc gtagtcttaa aatccattcc tgtttcgtca ttggtttttt atatcctgag     56940
     gtgtcccggt aatttcattt tggaagaaga tttcctttca gccggttatg agtgaaccat     57000
     tttgcatata tgatgtaacc tacaaaagtt aagagtgcgg acagactata tatccctaga     57060
     acaggtacca cgtgatgaaa acgtatcatc tgaccggatt catctgccag actcattaat     57120
     acattgctgt atatttcagt ctgaaaaaac tcgtagtaag gtaccatcac tacatgaaga     57180
     aaaaataaat taagcagata cgtcagagaa aacgcgtgtt cctgcccgtt atagggcgca     57240
     tactgcgcaa aggcgaaaat ccagcctgtg aaaagcagaa aacacatcgt gaaatacacc     57300
     accacccata tcgctgtttt catcactgcc cctcagttat ataatttttc tgtaacgcaa     57360
     atttcttcag gcgttatggc ccgtgccgtt ctgcttcaga taatcactga tgctcaggcc     57420
     ggacaagcga attttatccg aaatctccct gaactgctcc tcccagccgt cctgcagctc     57480
     cctgattgcc gcgatctgga aagcaacact gaaaggcgtt ctgcccagtt tctcggaaag     57540
     ccagaaaaga tgcgtaccga tctcttcatc cgggaccggt tcaagcgcat cactcagtaa     57600
     ggttttttcg tcttcctgcc agggatgacc ggctcgcgga aaacgcggat caggctggcg     57660
     gtcttttttc tccctttttt cccgtctggc aacggtcggc gcttcgcctt ttttcatgct     57720
     gacgcgtgct ttcatggcgc cgatggccgc cacggcccgc accagggttt cacgctcctg     57780
     gcgcgtgagc aggctgtcct cacaaatcag ggtgttcagg ttatcgatca gcgtattcag     57840
     tccgggttca gtgactttca ttttatgctc ctgttccttg tgtggtggcg atcagtcccg     57900
     gctctcattc acctgaacga tgaccggcag gcctgcatca aaacaggcct gataccagct     57960
     ggccacctgc aggggatcgc cctcttttat ccggcgtatg ccgccggcat ccgtcagctg     58020
     caggcaggtg gtaccgtcca gacggatcac gtaggccgct tccctgatgg tgtaatggcc     58080
     gtcacccagc tgcagctcca ccgcgtcacc ggcagccgtc tggcgtaacg gcagacgccg     58140
     gacgtcggtc agtcgttgtc gtgccgtttc agcctcgcgt tctgcctgga agagcggttc     58200
     tgcaatgccg cgaccggcct ccgtcagctc gacggccagc tgcaggttcg gcgcgcgcag     58260
     ggtgcgcagc cagcccgcgg cttccatgcg ccggcaggag gcgcgcaggt tcggtccgta     58320
     caccggggcg tccccgccct gctccagcac ccgctcgata tcccgcgtcg ccaccggccc     58380
     cggacgtttc gcatcgaggg cggccagcac aatcagtacc cgtcgctgca gcggcgacgg     58440
     cctgcgggag gttgttactg ctgccatgaa cgttgttctg ctgtgggagc gcgcaggagc     58500
     attccggtga ggcgcagatg gtccctgtcg gcgacgtctt ccggggcacg gcccgccatc     58560
     gccaggtggt accagagttc gatcgcgctg cgtgcccggg caatctccgc atcggcatca     58620
     ttgcagtccg cacggtttgc ccgttcaaga cacgcgttaa taaaatcttc cgtgtcgcca     58680
     agcatggttt cataactcag gtgaaagaat actttctcat ccatcctgca cgctccgtct     58740
     gattatgtga ttaaagaaga taaatcatat catatatgat ttgttattca tcatttaaac     58800
     atcatatcag atattattat gcggttaatg ataaatatca tatcaagtat gattttgtga     58860
     gtgtgactta attatcatat cacttaccgg tttcccgccg cgcagatccg atttctggct     58920
     aagtcggatc tctgtaacac acatgtattt tccccggaaa gtaatggacg tataccagcg     58980
     tgacagcgtc atctgacact ttcacacatt cgattttccg aatatatggt tgtttttttt     59040
     gtcttcgggc gtatgcttta cgcaaccgaa caggaggaat aatgcccctt acagccctta     59100
     agcttttcaa aaacctgtcc gatgaaaccc gtctgggtat tgtcctgctg ctcagggagc     59160
     tgggagaact gtgcgtctgc gatttctgca cggcgctgga tgagtcccag cccaagatct     59220
     cccgtcatct ggcaatgctc cgggaaagcg gtctattgct ggatcgcaag caggggaaat     59280
     gggttcatta tcgcttatcc ccgcatattc cttcctgggc tgctcaggtg attgagcagg     59340
     cctggttaag ccaacaggac gacgtacagg ccatcgcccg taagctggca tcggcaaact     59400
     gctctggtag cggtaaggct gtttgcatct aaaaaatttg cctgaacata tgtgtttttt     59460
     cgaatgtatg aggtattcag aatgaagacg ttaacggtgt ttgacccggc aatgtgctgc     59520
     agtaccggtg tatgtggttc agatgtcgat caggttctgg ttgatttttc tgctgatatg     59580
     cagtggctga aaggacgtgg cgtacaggtt gaacgttaca acctggcgca gcagcccatg     59640
     agctttgttc acaatgagaa agcgaaagcc ttcctcgatg catccggcgc agaagggctt     59700
     ccgctgctgt tgctggacgg cgaaacggtg atggctgggc gatacccaaa acgcgctgag     59760
     ctggctcgct ggttcggtat tccgctggag aaggtagggt tagctcccac cagttgctgt     59820
     ggtggtaata cttcctgttg ctgaatatgt caggaggaca tatgaaatta ttacagaata     59880
     tcccgcctta cctgtttttt actggcaagg gtggtgtagg aaaaacttcc atttcctgcg     59940
     cgacggctat ccaccttgcc gaacagggta agcgggtttt gctggtcagt accgacccgg     60000
     cctccaatgt cggtcaggta ttcgatctgg ctatcggtaa cacgattcgc cctgtgacag     60060
     cagttcctgg gctttctgct ctggagattg acccgcagga agccgcccgg caatatcggg     60120
     ccagaatcgt tgatcctatc aaaggtcttc tgcctgatga cgttgttaac agtatcagcg     60180
     agcagctttc aggagcctgc accactgaga ttgcggcgtt tgatgagttc accggcttat     60240
     tgacagacgc ttccctgctg acccgtttcg atcacatcat ttttgatacc gcgccgacgg     60300
     gccacacgat tcgccttctc cagcttcctg gtgcctggag tagctttatt gaaagcaatc     60360
     cagatggtgc ctcctgtctt ggcccgatgg ccgggctgga aaagcagcgt gagcagtatg     60420
     ctcatgcggt agaggcgtta tccgaccctg aacgtacccg cttggttctg gttgcacgac     60480
     tgcaaaattc tacgctgcag gaagtcgccc gcactcatga ggaactggct gagattggcc     60540
     tgaaaaatca atatctggtg attaatggtg tgctgcctga agccgaagct gaacatgacg     60600
     ccctggccgc ggcgatatgg caacgtgagc aggaggcact ggcaaatctt cctgccggtt     60660
     tatctgagct accgacagat accctgttac tccagccagt caatatggtt ggtgtttcag     60720
     cattgaaggg actgctggct acccgttctg aggcattacc gctcccggta acgaacatcc     60780
     tgtacacgcc tgaaaactta tcactctctg gcctggtcga tgatatcgct cgcagtgaac     60840
     acggcctgat tatgctgatg ggcaaaggtg gtgtagggaa aaccacgatg gctgccgcca     60900
     tcgccgtcag gctggccgac atgggatttg acgtgcatct cacgacctct gatcctgctg     60960
     cgcacctgag tacaacgctg aacggcagcc tcaaaaacct gcaggtcagc cgcatcaacc     61020
     ctcacgatga aaccgaacgc tatcgccagc atgttcttga gacgaaggga agagatctgg     61080
     acgaagcagg gaaacggtta ctggaagagg atttacgctc tccctgtact gaagaaattg     61140
     ccgtgtttca ggccttctcc cgtgtgattc gtgaagcggg taagcgcttt gttgtcatgg     61200
     ataccgcccc taccggacac acgctgctgt tgctggatgc gaccggggct tatcaccgag     61260
     agattgccaa aaaaatgggg agtaaaggtc attttactac ccccatgatg cagcttcagg     61320
     acccggatag aaccaaagtt ctgctggtta cgcttcctga aaccacaccg gtgctggaag     61380
     cggcaaacct gcaggctgac cttgaaagag cggggattca tccgtggggc tggattatca     61440
     ataacagcct ttccattgcg gatacgcgtt ctccgttgct ttgtcagcgt gctcaacagg     61500
     aactgcctca gattgaggct gttaagaatc agcatgctga ccgtatagcg cttgttccgg     61560
     tgctggcgtc agagcccgcc ggtattgaaa agctcagaga gttgatgagt taattttttg     61620
     acatctacag ggcgacaaag tcgccctgtc aggaggtttt atgttactgg caggcgctat     61680
     ttttgtcctg accattgttt tggttatctg gcaaccaaag ggattaggga tcggctggag     61740
     tgcaatgctg ggcgcgggac tggctctgat atctggcgtt gtgcatgtgg gcgatattcc     61800
     ggtggtgtgg aatatcgtct ggaacgcgac ggcgaccttt attgccgtga ttattatcag     61860
     cctgctgctt gatgagtccg gctttttcga atgggcggca ttgcatgttt cgcgctgggg     61920
     taacggtcgt ggccgtttgc tctttacgta tatcgttctg cttggtgcag cggtggcggc     61980
     actgtttgcc aacgatggtg cggcacttat tctgacgccg atagtcatcg ccatgctgct     62040
     ggcattaggg ttcagcaaag gcacgacact ggcattcgtc atggctgccg ggtttattgc     62100
     cgatacagcc agcctgccgc ttatcgtgtc caacctggtt aacatcgttt ctgcagactt     62160
     ctttggactg ggcttcaccg agtatgcgtc ggtaatggtg ccggtggata ttgcagccat     62220
     tgttgccacg ttggttatgc tgcatttgtt cttccgcaag gatatcccac cgacttacga     62280
     cctggctctt ctgaaagcac cggcaaaagc gattaaagat ctggcaacct tcagaaccgg     62340
     ctggatagtt ttaatacttc tgctggttgg gttctttgtc cttgagccgc ttggtattcc     62400
     cgttagcgcg attgcggctg ttggagctgt gatcctgttt gcagtagcta aacgaggcca     62460
     tgccattaaa actggcaaag tgctgcgcgg tgcgccatgg cagatcgtca tcttctcatt     62520
     ggggatgtac ctggtggtct acggtctgcg caacgccggg ctaaccgaat acctttcagg     62580
     tgtgctgaat gtacttgcgg ataaaggact ctgggctgca acgctgggta ctggcttcct     62640
     gacggctttc ctgtcttcca tcatgaacaa catgcctacc gtgctggttg gcgctctttc     62700
     tatcgatgga agcaccgcaa caggcgttat caaagaagcg atgatctacg ccaacgtgat     62760
     tggctgcgat ctgggaccta aaattacacc tattggtagc ctggcaacgc tgctctggct     62820
     gcatgtcctt tcacagaaga atatgaccat cacctgggga tactatttcc gcaccgggat     62880
     cgtcatgact ctgcctgtgc tgtttgtaac gctggcagcg ctggcgctac gtctctcttt     62940
     cactttgtaa tgagatactg atatgagcaa catcaccatt tatcacaacc cggcctgcgg     63000
     cacgtcgcgt aatacgctgg agatgatccg caacagtggt aatgaaccga ccgttattca     63060
     ttaccttgaa aatccaccgt cacgcgatga gctggtcaaa ctcattgcag atatgggcat     63120
     ttcagtccgg gctttgctgc gcaaaaacgt cgagccttat gaagaactgg ggcttgagga     63180
     agataagttt actgacgatc agttaatcga ttttatgctt cagcatccga tcctgattaa     63240
     ccgtccgatt gtggtgacac cgttgggaac gcgtctgtgc cgcccttccg aagtggtact     63300
     ggatattctt ccggatgcgc aaaaaggcgc atttgctaag gaagacggcg agaaagtagt     63360
     agatgaggca gggaaacggc tgaaataacc gaaagggggc gatgccccct ttctcctgcc     63420
     tcagcgtccg ggtaccggac tgtccggcag cgtacagctc ccttttccca gctgacgctg     63480
     cagcaacacc gtgtccagcc agcggccatg cttgaaaccg atgtccttca gcgtgccgat     63540
     ttcagtaaat ccggcgcgaa gatgcagcgc tacagacgcg acgttcgcac tgtcccccac     63600
     aaccgctatc atctggcggt atccctgaga ccgggcccat gttaaggcat gatcgagtaa     63660
     ggcttttccg cccccctgcc gctgataagc cggatcgatg tacaccgaat tttcaaccgt     63720
     aaaccggtag gcatggcgtt cgcggtagcg ggagagataa cagtagccga tgaccgtctc     63780
     cccctgcagg gcgatatacc agggaaatcc acgtgactga acatttttca cccgggcaag     63840
     catttcctgc gtgtccgggg gttccgtctc gaagctgcct gtgccgtgca ggacatgatg     63900
     ggcgtaaatg cgccgtatgg cgggaatgtg ctgctcttca gcattgataa tgtgcattgt     63960
     atgactcctg tgacgttgac tgacacacta ccggaattcg cgacggcaga ttaagcgctt     64020
     catcttatga cctgtataag gaaatgtttt aagtggaggt agggcgtcgc cccacctgtc     64080
     agcccgccat ttcagccagc aggtccacgc ctaccgggtc gtccttcagc agtggcgtca     64140
     gggcaatgcg ctgtgcataa tgcccggcaa cgtcgtcgat cagcggcagt tcgcgacggg     64200
     cacgggtgac caggaacggg gaggacggct tcgcggccgc gaggctgtta ttgatgaccc     64260
     acgcccaggg ttcaatcccg gcccggcgta agtcctgctg cagcccggcc gcttccagta     64320
     ccggcgtggt ttcggcaagc gtcacgataa tgactctggt cttctccgga tcctgcagct     64380
     gcatcattgg cgttatcacg tgatcgtgag cctgccccat ctggcgcacc atttcccggt     64440
     gataggcccc ggttgcatcc agcaacagca gcgtatgccc ggtgggcgca gtgtctataa     64500
     tgacaaaatg gtcgttggcc tctttgatga tccgggagaa tgcctgaaac acggcaatct     64560
     cttcggtgca gggggaacgg agatcttcct ccagtaccgc cagtccctct tcatccagac     64620
     cttttccctg attttccagc acaaagcgac gatagcgctc agtctctgct tttggatcga     64680
     tacggctgac ctgaaggcct ggcagcgagc catccagggt gtaagacagg tggctgccgg     64740
     atcggaggtg gtcaggtgga ctttatgacc gcgtctggcc agcgagaccg cgaccgcagc     64800
     cgccaccgtg gttttcccca cgcccccttt tcccatcgtc atgaccagcc cttttcccgc     64860
     tcggctgagg tcctccacca gggaggcaag ctccggtaaa tcgaccgtcg tgagcgtggc     64920
     tcccggatcc ggcagaacaa gtgtgctctc tgtaaacagc gccctcaggg cttccagacc     64980
     aaccagatta aaaggcttca gatacagcat cgaccgggga agatgcgcga ggttttcagg     65040
     catggcccgt aaggcccgtt cctcccgcgc cagaatactg tgcgccagcg gatcctgttc     65100
     accggcaaag ggaggcagca cgccattgat ggcaaggtgc tgatgctgca gaccgatagc     65160
     cgacagctcc tcgtgggtat gggagacctc tttcagggtc gacgcctgtg cgcgggcaac     65220
     cagaaccagt cgcgtgagtg ccgtatcaga gagggctttc actgcgtcag cgtactggtc     65280
     ctgttgtttc tccagcccca ccagagggcc gaggttcgcc gcagcatcag gatgtgcatc     65340
     gaggtacccg ctccaggcgc ccggcagctc aagcatacgg atggtgtgtc cggttggtgc     65400
     agtatcaaag acgatatgat catatttttc gcgcagttca tgactggtca gcagcgcggt     65460
     aaattcatca aacgccgcga tctccgtggt acatgaaccg gaaagctgtt cttcaatgtt     65520
     gctgatgaca tcggcaggca tcagttcacg aacaggatcg agcacgcgat cgcggtaagc     65580
     ctgcgcggcc gccatcgggt caacttccat tgccgcaagg ttttccacgg tgcggatacc     65640
     agtgatccgg tggcccacag tctggctgaa gacctgaccg acattggagg ccggatcggt     65700
     actgaccaga agcgttctcc ggccctggtc agccagccat accgccgtcg cgcaggccag     65760
     agaggttttc cccacgccgc ctttgccggt gaagaagata aacgggggga tattctgtaa     65820
     aaatggcatc gtcattgttg agctcctccg ggattaaggc atacggggaa tgctgcagca     65880
     gcgcggctgc gtgctgtctt cattccagtc ctgcgtgagg gaaataccgg cccagcgggc     65940
     gatatcttcc cgggacggga gcttgcccgc catcaccagc tggccgtcaa gcagggtagc     66000
     gggaagggac tccattcctg acgtgttcag gaaggccctg atgacgggcg tattcaggaa     66060
     ctgctgcggg ttctttgcca ggctgtaacg ctgaatattc acaccatgct ttttcgccca     66120
     ttcggcgctg gcgttccatt tgacggcttc atcgctgacc acgacgctgc tggtcgcaca     66180
     gcagcctgcg gcttcaaaga tctcaatttt tgacatggac tgtttacctc agtgttgaat     66240
     gatggggctt tacactgagg taaacgagtg aggcgggaaa aagatgcgcg gttaatccat     66300
     ttttttatgg cagcagacgg aagacgcatc atccacttcc acctggcaga gttccgtcat     66360
     cgtcttcttc agatgtttcc gggcgcgaag caggcgcgac ttaaacgccg tcagcgtgat     66420
     ccccagctcg tcggccaggc gctgctgggg acgccggttc agatcggcct cttctatcag     66480
     ccatctttcc tcgtcaggta aggcctgcag ggtttcaggc aggcaaatct ccagcgttga     66540
     aaccgcctca tggaaggcgt caggcagcgg gatctcgtct tccagcacca cgacgtctct     66600
     ggcggcacgg tactcatccg tcagcagatt cctcgccgtc cggtacagcc aggcccgcgg     66660
     gttctccatt tcacagaagc ggtctgcaca ggcccgggcg cgcaggaaga cttcctgaag     66720
     cagatcggct gcctgctccc gatcgcctgt ccttgatgcc agaaaacggg agagctctgc     66780
     ttcatgctgt tgccagaaca cgctcatgca gttgttgaat gccgttacat cactcatacc     66840
     agccctcaga ttttgctctg attcacccgc cgggaaagtg cttctgccga ctctttacgt     66900
     tcactgtagc gatcgacgag atacgctgca tactcccggg tcagcagggt aaacttcatc     66960
     agctcttcca ttacatccac aatacggtcg tagtacgggg atggtttcat ccgtccgtct     67020
     tcatcaaact cctgccaggc tttcgctacc gaggattgat taggtatagt aatcattcgc     67080
     atccagcggc caagaatacg catctggttt accgcattga aagactggga gcctccgcag     67140
     acctgcatga cggccagggt ttttccctga gaagggcgta ctgcgccctc tgatagtggt     67200
     atccagtcaa tctgggcttt cataatgccg gtcatcgcac catgacgttc aggagagcac     67260
     cataccatcc cttcagacca gcgcaccatt tcgcgaagtt ccataaccct gggatgcgta     67320
     tccgctgcat catccggcag agggagaccg gaaggattaa agatgcggac atccgcaccc     67380
     atggcggtaa gaagccgggc agcctcttcg gtggccagac ggctgtagga ccgctctcga     67440
     acggaaccgt acaacatcag gatccgggga ggatggtcaa ctgtctttac acccaggcgg     67500
     accccggtgc gacctgtatc aaacagctca ggaacaacat ttttcagttc agcaatcatt     67560
     ttttctccgg tggtgacata aaaccaggcg gggcatattc gtctgcacag cactcttctg     67620
     tcagaaaggc aatcaatgca gcaaggttgt cataacaggc gtggcagaac agtgttctcc     67680
     cctgcctttc ctggcgaacc agtgagacgg atatcagcga tgaaagatga tgactcaggg     67740
     tcgaggccgg aatggcgaga tgttgctgca gttcccccac gggcagtccc tgacgtccgg     67800
     ccttaacgag tgttttgtaa atatcgagac gagtggtgtg gccaagttct ttcagcacca     67860
     tcgcggcgat tttcagctcc atcccattcc tcgtaatttt atttctatat ttccagaata     67920
     atagaaatat atagtgagcg caaccacgtc cataatatga ctccatctcc ggggccttac     67980
     acttacgcgg catggagaaa acatgatcgg tgtttatacc tctcagaaat gaggtacgtc     68040
     acaatatata tggaaaaatg catatgaatc cgtcacagta gaaaccgatt cccgctaaaa     68100
     ataaaatgac cttcatcctt tgctgacggg cgcattatgt cccgccgccg ggaagcccag     68160
     gcaggctcgt tttctgactg cctatgaata cagcaaacat acggtacaga gaaatggcag     68220
     agatcatcat tagaaaaatg cacgaagagg actggtgtgc agtcagggaa atttatcagg     68280
     aaggaattgc aacagggaac gccacctttc agaccgcagc acctgagtgg ctggaatgga     68340
     atgaagggca tcttcaggac tgccgctacg tcgccactgt tgataacaga gtggtgggat     68400
     gggctgcgct atctcctttt tcccgccggc atgcataccg cggtgtcgca gagctgagca     68460
     tttatgtcag tactcatttt cagggaaaag gcgcgggcag ggctttgctc tccgggctga     68520
     taaagggctc ggaaagtgcg ggtttctgga cgctacttgc tggcatcttt ccggaaaacc     68580
     aggccagtgt tgctttacat cgcagccagg gattcaggga agtcggctgc cgggaaaatg     68640
     tgggtgaaat gaacggaaaa tggagagatg ttctcattct ggaaaggcgt agccggacag     68700
     tgggttgctg aaaaaaagaa tgcctctgtt catcagaggc attctgtcct ggaagggact     68760
     ttattccggt gagggtgact tcagttgcgg cataaacagc tggcagcacg caacagctgc     68820
     aagcccgcca gacagcggag cggcccagta cagccactga ttatcccagt atcccatggc     68880
     caatgccggc ccgaagctac gggccgggtt catgcttgcc cccgtcagcg gcccgccaat     68940
     aaaagcatca agaaaaacag caatgctgat aatcgcgggg tttctggtcg ttaggatgct     69000
     cataatcaga ataaaagtca tgacaccttc gatgaaaaag gcattgtaca gtgatacccc     69060
     catatggacc cgggtcaccc cggccagcag ggagtggcca aagacagcct tcaggcacag     69120
     tgcagcagcg ccggccccta acaactgagc cacgatgtaa ttcatggttg ccctgaaaga     69180
     gcaggccccg atcagataaa aaatcaggct taccacgggg ttaaggtgtg ctccgctgtc     69240
     aacaacgggt aaaaagtggg tcttccgcaa cttaggtgga caaaaattga tgaaactttt     69300
     tagttaacaa ggatctaagc tgttttaagt tatgtataac aaaatggcct cacttaagag     69360
     acttttacag ctaccgcgcg ggtggcaaac ctgccgacag attactggta ctgatggaat     69420
     aaccctccat ctccgcgcca cacgtaaaac ggcatcatgt cctgagtgcc tcacgcacag     69480
     tcattctgtt catagttgcc ggcggaggcg agtacagcat cttccatgct caggccaggc     69540
     cctctggtta gtcttcgcca tccggcactg gtactgtcgt aacccttcct gttcacgtaa     69600
     aatttttgct gaatcgcttg ctccctttgc aggcccgcag cagcagtctt ctgcattgct     69660
     gaaaaatctg cagcatcagc tggggcttat cgcaggtggt gaagcaggga gacgagctgc     69720
     agtagcttca ggaatacaga tcagcgcgga tactttactg cgcagagtgg ttcaagctcc     69780
     ggaacaaaca gagaaccgga ccaggcatgt tggtattgac gagtgggcat ggcatcgggg     69840
     ccacaggtac ggcacactga tcgtaaatct tgatacccat cgccccctgg tgttactgcc     69900
     aggccgggag caacgcactc tggcggcatg gttcaaaaaa tacccagaaa tacaggtcgt     69960
     ctcacgcgat cgtgggggga tctatgcgtt agctgctcgc gatggtgcac cgcaggcaat     70020
     acaggtggcc gatcgctggc atctgctgaa gaatattggt gatgcgctgg agcgcatgat     70080
     gtacagacac atgccattga tacgactggt ggccaccgag ttatcccccc aaaaaacaga     70140
     atgctgaagc gtctttggtg ccaacgtcaa cgttacgtcg ccctgaacgt attaaacgag     70200
     agcaacgtga caaacggtat cagcgctggg ctgaggtaga ctctcttcat aaaaagggtt     70260
     gtgggataag agaaatatcg cgtatcaccg gactgtcccg ggtgacggtt cgccggtgga     70320
     tacagtcaaa agcgttccct gaaatatcaa ctaagccacc cagacccggg ttacttgaac     70380
     catggcagga atggctggaa gaacaacgga taaacggtaa ccataatgcc gggcagctat     70440
     ggcgggagat ggtaaatgct ggcttcaccg ggagcgaaac gacggtcagg gatgctgtgg     70500
     ctaagtggcg taagcaggtt aacagtcccg ttatcgcccc agttcgactc ccctcagcat     70560
     ccagagtaag ccgctggtta atgccctggc gaatgatcag aggagaagaa aactatgcat     70620
     cccgcttcat cgaatcgatg tgccagaaag aaccgcaact gaaaatggcg caacagctgt     70680
     cgctcgactt ctatcgaatg ttgaaaacga agaataaatc gcagttaaat caatggttct     70740
     ctgacgtcag tcaaagtggg ctcattgacc ttcagcgtgt tgcggccggt atggaagcgg     70800
     atgcaacagc aatacacgaa gcgataagca gcagatggag taatggcgtt gtggaaggcc     70860
     atgtaaaccg cctgaagatg ctgaaacggc agatgtacgg tcgagctggc ttcgagttac     70920
     tgcgacgacg agtcatgagc cctctggctt aaacaactcc acctaagttg cggaagaccc     70980
     agttttgcac cgttggtaac agtatagcag cggtgtttga cgttctggcc atgcatgaca     71040
     taggcacgca tcgcgcggag ctgggagaca atatctgctc gctgccggtg gaacagcaca     71100
     tgatctattt tgtgtcatca cattcggtgg ttacgatcat tcgtattctc agccagtctc     71160
     aggatacggc gcggcatgaa ccctggatat aggatataac cgggaacgaa aataataatt     71220
     aaaaacaata tgatactgat atttttttca tgaactgaat tctcgcgcaa cataagttaa     71280
     attttatttg atcagggcca attatgataa tggtgatgga tgcttttgat gacacttatt     71340
     aattacgaaa aaaaacgctc ccggcgggag cgtaagccag tgacttcggc gtcaaatgag     71400
     ggtctgacaa gtggagctgc gggttaattc tgggtgatct ggctgcgatg cttttcagcc     71460
     tgctgctgat gaatcactga agactgacca ttattcgcct tctcgtgtac aacagcggct     71520
     ttctcatgct cgttcatttc ggaaaatgat tttgctgttt cgttagaagc tgctggcttg     71580
     gatttcatca tttttttatg catttcagcc atgtcctgat gggcagaagc gttgccgttt     71640
     tgcatcattt catgggtcat tgcagcctga tcgtgaccac tcatatccat cattgtcata     71700
     ctgtctccct gaacagcgct tttttcagag gttgactgca tctgatgggc gggtgcctgg     71760
     gcattattta cctggtcatg catgttcatt gtctctgcag ccatggcgga tgaagcgaca     71820
     gccataatgg caacaaatga tacaaggatc tttttcatgg ttgggtctcc ggtgttttca     71880
     tacccaaaca atcaacggct tataacagag aaagcatttg atctcagggc tggttgatca     71940
     tcacgccagg aaccgggcga ttgaattatc acgctgtcct gatttatggc tgattataaa     72000
     aaaccgcctc tgtttatcgc gtgactgaac gatgacattt ttgtcacctt ccgggtttct     72060
     cctgaataac ggtattaatc cattaacaga cgcacactga acacaatttc ccgcccctgc     72120
     tgttctgctg acagctcgcc gccgtgagca tgaatgatcg accttgtaat tgataatccc     72180
     agccccgcgc cttccgtgtt gtagaacctt gatgagtctg cgcgatagaa ccggtcaaac     72240
     aaacgttcca gattagcggg aacctggccg gacatcgtat tcgtaatcat cacgttcaca     72300
     cagtcactgt cacgctcaat gtgtatcgct gtacaggtgt tatcgggaga atacttgatt     72360
     gcattggaaa gcaggttact gaaagcacgt cggagcatat cgctgtctcc ggcaacaacg     72420
     ccctctcctt caaccgtgat tgtctttcct gtttcgtctg ccaggggctc gaacaactca     72480
     cgtaattcat tcagttcggc tgccagatcc acatcatgtt tatccagccg cagcagacca     72540
     tgctctgaac gtgccagaaa aagcatgtca ctggtcattc gtgacaacct tttcagttct     72600
     tccaggttag cgaataaaat ttcgcggtaa tgcgaaacat ccctttcctt agccagtgca     72660
     aactgcgtct gcatcatcag attactgact ggtgtgcgca gctcatgcgc gatgtcagac     72720
     gagaaatctg acagtttccg gaatgccccc tccaggcgat caaacatatt attgaactcc     72780
     tgcatggtct cagagatttc cggcggagcc agatcgggat ttagacgctg atccaggctg     72840
     tgtacggtca tggaggaagc cagactggtc atttcccgta gcggtttcag accaatacgt     72900
     gtggtcagcc agcccagaaa aacagaaata aagaccagac cgatattgaa ccagaacagc     72960
     caggtactga gtttgtccat aaacagggtg tgatacccag tatccgtggc aaccgtaatg     73020
     atgacatgtt tgcttttacc ctgttccggc gtcacggcaa cccgccgcga gatactgcgg     73080
     tacacggtgt tattttcttc cgtctggatc atatagtcga gaatatcacc cgacttatta     73140
     agcaggaccg ctgggtgatg ctaccaactt gctgatttag tgtataatgg tgtttttgag     73200
     gtgctcccgt ggcttcagtc tccgtctgct gtccctcctg ttccgctact gaaggcgtga     73260
     tgcgtaatgg caaaagtact gccgggcatc aacgttatct ctgctctcac tgccgtaaaa     73320
     catggcagct caccttcact tatgccgctt ctcagcccgg tacacaccag aaaatcattg     73380
     atatggctat gaacggcgtc ggttgccgtg ccaccgcacg actaatgggc gtgggcctca     73440
     acaccatttt gcgccattta aaaaactcag gccgcagtca gtaacctccc ggatacagcc     73500
     gggcagtgat gtcattgtct gtgcggagat ggacgagcaa tggggctacg tcggtgcaaa     73560
     atcacgtcag cgctggctgt tttacgcgta tgacaggata cgcagggcgg tggtagccca     73620
     cgttttcggt gaacgcacta tggccacact ggagcgtctt ctgagcctgc tgtcagtttt     73680
     tgacgtggtg gtatggatga cggacggctg gccgatgtat gagtcacgtc tgaagggaaa     73740
     actgcacgtc atcagtaagc gttacacgca gcgaattgag cgacacaacc tgaatctgag     73800
     acagcatctg gcaaggctgg gcaggaagtc cctgtcgttc tcaaaatcgg tggagctgca     73860
     tgacaaagtc atcgggcact atctgaacat aaaacactat cagtaaattg gagtcattac     73920
     cggaccgctg gaacaacaga atttttggca tagagttcaa caattttttc attttccatg     73980
     ttttttatag aaatgaataa gccattgtgc cccaccatcg catcgtttat tttttctgat     74040
     aatgacttaa tatccgtttt gttcctgaac gtctctgttt taagaaactc ttcggtgagc     74100
     tgaagtttac ctgtcagaaa atcgcggtcc tgattatcga aatagccatt cagggtgcta     74160
     atcaggataa aacttgataa ccaccatacc gtaagcatca ccgcagaaaa aatcaggctc     74220
     aggcgtgtgg tcagggaaat tttgaacctc actcttctct gatctccagg acatatccgg     74280
     caccgcgaac ggtatggatc agttttggct caaagtcatc atcaatttta cttctcagac     74340
     gtctcacggc gacatcaatc acattcgtat cactgtcaaa attcatgttc cagaccaggg     74400
     acgagataag actcctgggt aacacttctc cggtgcgttg cagcagcaac tcaagcagaa     74460
     cgtattcttt accggtgaga tggatcttct tccccgaacg gatcacggtc cggcgcacca     74520
     tatcaacggt catatcggcg atggtgcaga ctgttgcggc ctgcgagcgt gcccggcgca     74580
     gtagggttct tacacgtgca accagctccg taaaatcaaa gggcttaatc aggtagtcat     74640
     ctgcgccaag ctccagtcct ttcactttgt cccgcacgtt gtcctttgcg gttaaaaaca     74700
     ggaccggttc ttcgtgcccg gactccctca gtgcgctgat gatttgccac ccgtcgagga     74760
     aaggcagcat cacgtccagt attatcaaat catactgtcc cttcgacgcg gccccgagac     74820
     catcgcggcc attattaaag agatcggcct gatagccttc ctcaaccagt ccctgctgca     74880
     ggtaacgacc tgttttttgt tcgtcttcaa cgattaaaat acgctgcatg gtcaactcgc     74940
     tgatatgaaa gtaaaaatct cacgcatgag ctttggctgt cccctagctg atctgagacg     75000
     gagcaagcat tccaagccac gctacggcgc ccagaatgat aatcgcaaca acgaattctg     75060
     tcaggatgct gtttcgcatc agggcaacgc tgcgatcata attcccttcc ctgaccataa     75120
     cttcaagccg gggacccagg tgaaaccggt ttgctgcagc cagaagaagc atcagaacaa     75180
     acagagccgt cttggcaagc agtatcctcc cccaggaact gttgaataag ggagttaagt     75240
     taccctcagc aatatacaga tagttgacca gcgcactcag gatcagggct acaacaatca     75300
     ccgttcctgc cgtggcaaat tttgccaggg agtcagatat cacaatgacg ctctgtgcat     75360
     tatgctcgtt tctgcgcatc agcaggatag caaatgcaac cagagcacct gtccaggcac     75420
     ctgcagcgcc gagatgggtc agatcgctca gtaaatggag atagtaatgc agaccgtcat     75480
     gcataacggc gtgtcctccc caggcaagtg tagccagcgc cacgccccca ctcatcgtca     75540
     tcagcaggca ggacaatact ctcttattag tgtaaaggaa caaagcaccg agtgtggtaa     75600
     acagggcaca gagtctgaca atccagctaa tacccacatc agtttcttct atcaccatct     75660
     cgataacatg gatggataat tctctgaggt cagttactcc actcatggca ttagatacca     75720
     ggagcatatt aatgccagta agaatgatgc ctgtaacaac agcaaaggtt ataaacgacc     75780
     tgaaattagt caggttatag gtttcatgtc tgacaccgct tattccatat atctgaaaaa     75840
     atggcaatcc aaatattacc atcaaatcca gataaagaag aaaacgaata acaatcataa     75900
     tcaggtcgtt cataatatta cttcactgta aaggtgtaat taccggtaat agggtgcgta     75960
     tctgaagaaa ccgcgcgcca gtcaacacga taagtgccag cgggtaaagg ctctcgcgga     76020
     ataatgacca tcgatttagg gtcagcgcct ggcgccactt ttgccgcgac cggcatcgga     76080
     gaatgtgatg acatgccttt catacccgtc atcgttaatt ttgcacctga gaatttcacg     76140
     gtcagatttt ccgagaaatt aagctgaatc ttttccgggg ccgctacggc tgaatcagcc     76200
     tgtggcacag agctttttaa ttccggatgg gccatagcag agaaagcaac gcccataacg     76260
     aggccacctg taagaatggc tttatttaaa atcgacattt tatttacctg tttagttgag     76320
     tgttttatat cagtgcgtta aaaccagatt ctggctcccg ccaggaatac tacctgatgg     76380
     tctttctcac cttctctttt cgccatatcg gatgttttcc cgtaaagttg attccaggaa     76440
     acgcctatat agggtgcaaa ctcacggcgt atttcatagc gcagccggag ccccagctct     76500
     gtgtcagtca gtcccctgcc gcgaccccgc gattcatcat cctgactgta gaaattcacc     76560
     tcataggatg gctggagtat gagccggtta gtcagtaaaa cgtcgtattc tcctcccaga     76620
     cgaagggctg cttttccgcc attactgaca aaacccgtaa tttcagactc aaaattatag     76680
     agtgccagcc cctgaaaacc gacagcagcc caggtccggg cagaagcagg tctgaaatcc     76740
     tgcctgacac ccgcaaccaa atcccaccat gggccaaccg catgtcccca gagtaactgc     76800
     gcttcagccg cctccgtttc cccattgctt cgttcacctt cactctttag ccaaatccga     76860
     tctgtgtcgc ctccaatcca gctgttaaca ctccagctga aattgttggt gttatccgac     76920
     cgttgccatt ccagttgatc cagcagaacc agataattaa tcgcactgtc gtgaatcgca     76980
     tgcccctgta aattgccgaa tgcagccttc cggtcggcat cggtaacagg cggaattggc     77040
     gttctgctct cagttacaat gggctccatt gacgtcatct cagtgaaatt ctcatctgct     77100
     ggcatctgca tggcagacat gtcgtgcccg gcgtggggat ctgcagagac ggagcccgcc     77160
     gcaatagaaa gctgtgaggt aaacaaaccg gcgaccagaa caggtatggc cttcaaattt     77220
     ctcttcattc gcatcattcc tccacccgga cttcacgaaa cattcccatt tccatgtgat     77280
     agagcaaatg gcagtgatac gcccagcggc caagcgcatc tgctgtcact ctgtaactgc     77340
     gttttgtacc agggggaaca tctattgtgt gtttacgaac catgaaatta ccgttttcat     77400
     cttccagatc gctccacata ccatgcaggt gaatggggtg agtcatcatg gtatcgttga     77460
     tcagcgtgat cctgagccgc tcaccgtatt tcagcagcac cggtgcggca tctgaaaact     77520
     tgattccgtt aaatgaccag gcaaactttt ccatgtggcc ggttaaatgc agttctatgg     77580
     tacggccagg ttcacgtccg tcaggatcct caaagcggct tttcaaatcc gcgtacgtga     77640
     gaacctttct tccgttattt cgaagaccaa tacccggatc atttaatttc ggagagacgc     77700
     tcatcgcctg catatcaacc agtgggttat ccgtttctga cgcaggatga ctttgcatac     77760
     ccggcattcc ggccatccgg gaatgatcca taccggccat gctgctgtga tccatgggcg     77820
     cggaggatgt cccgctatcc ggaaggtcag caccgtccat agacatcatc tctccgctgt     77880
     tatccatgcc tcccatctgg ctgtggtcca ttcctgccat atcatgtccc attcccccca     77940
     tacccatatc ttccatggtc aacagaggac ggggatcgag ggggggaacg gcagcactta     78000
     acccttctct cgtggccagt gtccctcgag cgtaaccggt cctgtccatg gattgtgcga     78060
     agatggtata ggcctcaccc tgaggctcca caatgacatc ataggtttcg gcaacggcaa     78120
     tcctgaattc gtcaacggta accgggttta catactggcc atctgcagcc acgaccgtca     78180
     ttttcagccc ggggatacgg atatcgaaat aggtcattgc cgagccgttg ataaaccgta     78240
     agcgtatctt ttcaccggga cggaacagtc cggtccagtt tttcagcggg gcctgcccgt     78300
     tcatgagata ggtgtaggtg tagccactga catccgcgag gtcagtcgga ttcattttca     78360
     tttcagccca cattttccga tcggcaatgg tggctgacag ccccctggta ttcacgtcgc     78420
     ggaaaaaaga gccaacggtt ggtttattga aattgtagta atccgactgt ttttttaatt     78480
     ttttcagcag gctgtgagga ttttcatcgg tccagtcaga caacatgacc acatgctcac     78540
     gatcgtaagc aaacggttct ggctccctag catcgatgat aatggcaccg tataccccct     78600
     cctgttcctg cagaccggaa tggctgtggt accagtaagt cccgttctgc ttaaccttaa     78660
     aggtgtaaac gtaggtatca tcaggctcta tgcccataaa actcagcccc ggaacaccat     78720
     ccatattggc cggaagaata atgccgtgcc agtgaatgga cgtctgttca ttaagacggt     78780
     ttttgacctt cagggtaatg gtgtcacctt ctttccagcg aagaacgggc cccggcaggc     78840
     ctccattgat tgttttggcc tgacgctcac tgcccgtgat attgacggcc gtttcaccaa     78900
     tggtcaggtc aaactgagta ccctgcaggg atgcggcaac tggcaggctc agactggaac     78960
     gcgcattgaa actccatacg ccaagacttc cggctacgcc agagagggtt aaccccttca     79020
     ggaaagttcg tcgagacgtt ttcaacagca tgcgcattcc cttatttaaa gtatggttac     79080
     tgacagaatt cgagaaccga tttaaattaa attactggtt catccactta caatgaaatg     79140
     aatctagcac accttaagaa acaaattcat tacaatcgtg taatgtacgt ggctgtatta     79200
     catttacgtc atcttcccca caggttgatt tttttatata tgatcataag gacatctttt     79260
     atgtacctca gaaggtaatt acacatgaat atattaatca cgaccactgc gtttacagct     79320
     ttattttgtg gggcagcttt tgctcagtcc agtgatattg cccatgaagc acatcgattt     79380
     gttaataatg cctcagccgt cagtcatgtg aactcctcga cgcatgaaaa cttaccggac     79440
     agggttaata aaaacaacac gccctcattc tctgaaatga atgaacatga aagggccatt     79500
     gttgctcatt catttatgaa caacagcgcg tcctatgcgc atcagaaaat gattgaggaa     79560
     cataaaaaaa tgctgtccgg cagtgatgca aattcaaaga cctcgtcttc ttcttttaac     79620
     gaactgaatg ccggagaaaa agccgctctc gtgcatgagc aggtcaataa tgccggtgcg     79680
     gaagcacatc agacgcaggc aagaaagctt cgcgggctgt attcgaccag gtaactgcag     79740
     gcgggttagt gcttagcgtc aggtgcgcag cagggcttta ctgacgggtt acgtagcagg     79800
     acatgagccc catattgctc tgccgtaacc tgtttcagtc ccgttaatca tcaccgtcgg     79860
     gctggtcata cagttcccag agcttcagga gcaaacggga aacaagatat gttacaaaaa     79920
     tgacgaccat caacggtgct cccgattaac tgacagatga cacgcctcct gaaaacccct     79980
     agcatacgcc gcagtgttca tgctaacggc gaattccagt aaatgtattc taccgatgtc     80040
     gtaaaagaaa atgcctacct ttcagccacc cgctcggggc tggaatcgaa cgagatcgct     80100
     actcttcagc gctccttgcc ttcccggttt aatctgcggc atttgaaaaa aaatgaatca     80160
     ttaaaactcg tactgcaaaa gaaagcggga aaatcacgtg tcgtggccta taaatttacg     80220
     tccggttcat ttaattacac ggcgtatcgt atatcagata aaaagttcta taacctttcc     80280
     gatacttccg ggaaaggcag tctcgattat ccgttaccgg ccacagcaag actcagttcg     80340
     cctttcaatc ctgcaagact taacccggta tcgggaaaag tgagtcccca taatggcatt     80400
     gattattcca tgcccatgaa cacgaaaata gtcagcgtca tcgacggaaa aatcacccgg     80460
     gccgaataca acagtaccat gggatatttt gttgaagtaa cgggaaaagc cggtgttaaa     80520
     actcgctatc tccacctcaa taaaatactc gttactaaag gggccagggt tacccgggga     80580
     gacgctattg cgttatccgg taacagcgga cgttcatccg gtcctcatct gcattacgag     80640
     ctggtcatca ataacaatcc tgttaactca ctggcgttcc gggcagcggc acccgctgat     80700
     aacaaacttg aacagcatgc ctttgcgcat gccagagact acgaacgata cctggactga     80760
     taacggggcc gcgacgcggc cccgtctgcc ggattaattt tttttatcgt tttcacttcc     80820
     ttgatgttga tgatctccat gccctccgtg gccgtggaaa agatgcatta gcgggcagac     80880
     cagcaataac agatatggcc agtaacctgc cacatgtgac cagtgttcgc gcaggagggc     80940
     aaatgccgca atcgcggcga cagcaataag cgcataggtg gtacttttca taccggactc     81000
     cttctgttag taacagaccc ttcattcagg gttatttccc gagcctgaca cttttcagac     81060
     gcaacgcatt tgcaatgacg ctaacggagg aaagggccat agccgccgcc gcaataactg     81120
     gcgacagcag tattccatac acaggataaa gcagacctgc agctacaggc accccaagag     81180
     cattgtagat aaacgcaaaa aacagattct gccggatatt tttcatggtg atttctgaca     81240
     gatgacgggc cctgttgagt atcatcaaat cgcctttgag aagggtaacg ccagcacttt     81300
     ctattgccac atctgtaccc gttcccatgg ctatacccac gtcagccgct gccagcgccg     81360
     gggcatcatt cacaccgtct ccggccatcg caaccacatg gccagacgct ttcagtcggg     81420
     ttatcactgc ttttttgcca tccggcagaa tcccggcttc aacctcatct attcccagtt     81480
     tccgtgcgac tgcttcagca gtaagctggt tatccccggt gagcataaca atgcggatcc     81540
     ccgcctgacg caaagcttta agcgcatccg gcgtggttgc tttcacggga tccgagatag     81600
     ctatcaggcc tgcaaggttc ccgtctgtgg ccacatagat aacggtagcg ccttccatcc     81660
     gcaacgtatc cgcaacggcc ttttgattat caataacgat actgttttcc tgcatagcca     81720
     gttcattacc aataacaacc cgttgacctt cgacatcgcc tgagacacct ttccccgacg     81780
     gggcattgaa attactgacg gcaggtatca cgatcccctt ttcatgcgcg gctctgacaa     81840
     cagccatacc caacggatgc tgcgaacctt tttccactgc agctgttaca cgtaaaagag     81900
     atatttcccc acccggactg agactgataa tccctgtcac cgtaggcgaa ccttccgtga     81960
     gcgtgcctgt tttgtcgaca accagcgtgt ccactttttc aagacgctca agggcttcgg     82020
     cattcttgat taacaccccg gcctgggcgc ctttgcccac ccccaccatt atcgacatcg     82080
     gcgtggccag tcccagcgcg cagggacagg caataatcag gaccgacaca gccgcaatga     82140
     gaccgtgcgc catcctgggc tcgggccccc agacagacca gatcaagaaa gcaacaaccg     82200
     cgataagtat caccagagga acaaaccagc ctgaaacgct gtctgccatt ctctggatgg     82260
     gggcacgcga acgctgtgca tcagcgacca tctgaacaat tcgtgagagc atcgtttcat     82320
     caccgacttt ctctgcacgg atgataagac tacctgtctg attaatcgtc cccccaatga     82380
     cagggtcacc cttcgttttg gtaaccggca tagactcccc ggtcaccatc gattcatcaa     82440
     cggttgtttt gccttcgatc acgataccgt cgaccggaat actctctcca ggtctgatgc     82500
     ggagcttatc gccaggcagg acatcttccg cattaatatc cgtttcatga ccgtcatgat     82560
     ccagccgtct ggcggttttg ggggcaaggt tcagaagcgc agtaatggcg cctgaggttt     82620
     gttcccgtgc ccgcagctca agaacctgtc ccagcagaac aagcaccgta ataactgctg     82680
     cggcttcaaa ataaacggcc accaggccat ccatgtttct gaacgatgca ggaaaccagg     82740
     aggggaagac ggttgcaatg acgctgtaaa cccaggctac gccggtcccc attgcaacaa     82800
     gggtaaacat attcagggag cggttacgta acgacattcc ggcccgggcg aagaatggcc     82860
     agccacacca caacacgaca ggggaggcca gaagcaactg cagccatgtg ttgtactgtg     82920
     gcggtactgt attcctcaag tcgggaaaca gatgagatcc catttcgagt accagaaccg     82980
     gaaacgccag caacaacccc agccagaagc gtcttgtcat gtcgtgaagt tcatcactcg     83040
     gccccgtgga tgccgtagct acgagcggct ccagtgccat tccacagaca ggacagcttc     83100
     cgggaccact gcggcgtatc tccgggtgca tcggacatgt ccacacacct tcagaattct     83160
     ctttttccgc ctggttgtga ggctgtttta tctgatcagg gctgacttcg tgatgatcgt     83220
     ggtgatggtg atgggaatgt tcactggcat cttcggtaag ataacgatcg ggatgggctt     83280
     taaatttact ctcacagctg gcggagcaga aataaagttg gtggtcctgg tatcgaatgc     83340
     tgctgtgcgc cctgtcgggc aggatggcca tcccgcacac gggatctctc accttatgca     83400
     atacgtggcc ctcgtccggg gataatgtct gctcagaagc agtctggttg ttgtgttgca     83460
     ctgcattgtc atttttcaca gtaactctcc ttatgcatac cgaagcatct tctgtcttca     83520
     gggtatgtca tggatgcgat taccacgaat atcgccggca caggagtgcc tgctaccggc     83580
     gtcccgttat cagccgttcc gctgactatt cgattcgctg gaagactttt ttacttccat     83640
     ccggtgagaa tgcgataaca tcgtaagcct cttttcgggc tcccatctcc attccaggac     83700
     ttcctgctgg cataccgggg gtggcgagac cgtatatacc cgaaccagac tgcattgcct     83760
     tatgtatcgt tgtcgcaggc acatggcctt caatgatcaa attaccggca accgcggtat     83820
     gacaacttcg tagtcctgca ggaatagcat gcttttcttt cagggctgac agcgcctgat     83880
     cattcatgac gtgagttcgt acttcaaacc cgtctttttc catcgctttg ccccacaggg     83940
     aacaacagcc acagttttca gatttgtaca tatcaatcac tttttcactc gccatcgcgg     84000
     gtagtgaaag gccgagagcc agcgccatta gaaccacttt tttcatactc acctctgtat     84060
     attatcgata taaaccctga cgtcagggtg aatcagtaaa gaaggacacc cacagggggt     84120
     gccctttcag gttcaggaca cgcttttttt atgtctgcgc agccagatta atttgtaggc     84180
     ggcaggaata atgaacaggg acagcagcgg agccgtgatc atcccaccaa tcatgggtgc     84240
     cgcgatacgg ctcatgactt ctgaacctgc accggttccc cagagtattg gcagcagacc     84300
     cgcaatgatc accgccacgg tcatggcttt cggccggaca cgcagtacgg caccatgata     84360
     gagggcttca tcaaggcctt ccggtgtgaa cgtctcttta cgggacaatt ccgggtgcgc     84420
     ttcaatggca tgacgcagat acatcagcat gaccacgcca aactctgctg ccaccccggc     84480
     cagggcgata aacccggttc cggtcgccac tgacatatgg aagccctgcc agtacaggaa     84540
     ccatatcccg ccaaccaggg caaacggcag gctcatcaga ataagtaagg cctcatcagc     84600
     ccggcggaat gccagatata acaggatgaa gatgatcatc accgtcatcg gtaccatcag     84660
     ttttaatttc ttattggcgt gctcgagtaa ttcaaactgt cctgagaatg ccacactggt     84720
     ccccggtctc agtttcactt tctcactgat ggccgtctta atatcgttca ccaccgacac     84780
     catgtccctg ccgcgggcat caacataaat ccagctggct ggccgggcat tttcggtttt     84840
     cagcatggtt ggtccggaaa cgaccttaat atcggcaaca tcgcccagcg taatttgctg     84900
     cttcattggg gtcaggattg gcatctctct caacgcctgc ggactgttac ggtaatcctg     84960
     cggatagcga atgttaatag ggtaccgggc cacgccttca accgtctcac ccaccatagc     85020
     cccaccgatt gctgaagaga cgaacagctg gacgtcgccc acagtcatcc cgtaccggga     85080
     agctttctcc cggttgatat cgatatcgat gtagcgcccg ccctcaagtc gctcagccag     85140
     gacagacacc acgccaggca cggttttggc taccgcctcg atactctgcg ccgtcgcgtc     85200
     gatatcggac agaacagtcc cggacacttt gatacctatc gggcttttga tcccggttga     85260
     gagcatatca atacggttac ggataggcgg cacccagagg tttgccagac ccggtaaacg     85320
     gactgtcctg tcgagttcat caataatctt gtcaattgtc atgccgggac gccactgatc     85380
     ctcaggtttg agctggatcg tggtttccac catttcgagc ggcgcggaat ccgttgcggt     85440
     ctctgcttta ccggtcttgc caaatacaga agccacttca ggaacgcttt tgattaactt     85500
     gtctgttgtc tgcaggagcg ctgcagcttc tgccggagag acgccaggca aggtcgacgg     85560
     catatacagc agatcgccct cgttaatctt cggcagaaat tcaccgccca cctgactcag     85620
     tggccagata accgtgaaaa tggacaaggc cgcaaccagc agggttgttt ttggccagtg     85680
     gaggacccgc agcagcaaag gatgatacgc tttgatcagc acccggttca gggggttact     85740
     tgtctcggca ggaattttcc cccggatcca gaatcccatc agaataggaa tgacgatgat     85800
     ggccagtgcg gcgctcccgc catggagtac gttttcgtga atgccagcgg gccaaacaga     85860
     cgaccttcct gcccttccag ggtaaagata ggaataaagg acagggtgat gatcagcagg     85920
     ctaatgaaca acgcgggtcc cacttccacg gaggcgtcgg taatcacctt ccagcgggtg     85980
     gcgttgtcaa tctgctcacc cggatgctga tgatcccact cctcaagccg tttgtgcgca     86040
     ttttcaatca tcacaatggc ggcatccacc atcgcaccga cggcaatcgc tatccctccc     86100
     agcgacatga tattggcgtt cagtccctgg aagtgcatga cgataaaggc gatacacagg     86160
     ccaagtggca gagaaataat cgccaccagg gcagaacgga catgccagag gaacagtgcg     86220
     caaacgacag caacaacgat aaactcttca agaagcttgt aactgaggtt atcaatcgcc     86280
     cggtcgatta actggctgcg atcgtaggtg gtcacgattt caacgccttc cggcaggctg     86340
     gccttcagcg tctccagttt atccctcact gccgtgataa cgtcgcgcgc atttttaccc     86400
     gaccgcagga tcaccacgcc gccagcgact tctccctggc cgttcagctc ggcaatacca     86460
     cgcctcattt cgggcccggt ctgcacgcgg gcaacatccc gcagataaac cggcacgccg     86520
     ttctcacctg ttttcaggac gatgttatta aaatcatcaa tgctctgaag ataaccgctg     86580
     gcacggacca tatactccgc ttcggccatt tcaacggatg agccaccggc ctcctggtta     86640
     gacgattcaa gtgcctgttt cacttcgggc aggctgatac cgtactggga cagttttacc     86700
     ggattgacct gaatctggta ctgtttcacc acgccgccaa ccgaagcgac ctcagccacg     86760
     ttcgggatgg ttttcagctc aaatttcagg aaccagtcct gcagagagcg cagttctgaa     86820
     aggtcgtgtt ttccgttgcg atcgacaagg gcatattcaa aaatccagcc cacacccgtg     86880
     gcatcaggac cgatttcaga actcacaccg gcaggcagtt ttccctgaac ctgattcaga     86940
     tattccagca cgcgggaacg ggcccagtac agatcggtgc cgtcttcaaa aatgacatac     87000
     acatacgaat ccccgaactg tgaaaaacca cgcacggttt ttgcgccagg tacggacagc     87060
     atggtggtgg taagtggata ggtgacctgg ttttctacaa tctgcggggc ctggccggga     87120
     tagctggttt tgataatgac ctgtacatct gacaggtcag gcaaggcatc gaccggcgtg     87180
     ttaataatcg tccatgtacc ccagatgctg agaaacaggg cccccatcat gaccaggaaa     87240
     cggttggcga cagagcgccg gataatccat tcaatcatcg tcgtctcctc agtgccctga     87300
     atgcatattt acaggctggt cagacattgc tggcatactg ctttctgttt tttcagggtg     87360
     gcgcatacgt tccagcgcgc ccgtaatatt ggcttcggag tcaatgagga acaggccact     87420
     gaccaccacg gtatcgcctt cattcaggcc ggaaccgatg ccggactgtt gctgtgattc     87480
     atgcagaacg tggatctgtt tcggcacaaa cttgccttca tcatcaacag taatcacgcg     87540
     ctgttctttg ccggtatcga taacggcctg gcttggtatc agcagcatct cctggctctt     87600
     ggtattcagt ttcagatagg cattcatgcc cggcttgaga aactcatcct tattagaaac     87660
     ctggagacgg acctgaagcg tacgggttgt ctgatccacg ctgggaagaa tgttccattt     87720
     ttcgacatgg aatgttttat ccggataagc cggtaccgaa atttcaaact gcgacgtatc     87780
     tttcagcaga tatgcgatag attctggcac tgcagcgctg atccagaccg ggtccatccc     87840
     ctgaatctga gccactactt tatctttcga aatattcatg ccggtgcgca ggtcaaacgc     87900
     agtaatgaca ccatcaatag gtgctttaat ggtaaaacgg gtctggattg tgcgggttga     87960
     acgcagcctt tgaatatcct cttccggcat accagccaga cgaagtcgct ccagaacccc     88020
     ttttatctgg gttgacgtac cgcctgtacc ggataacagc aggaactcac tttgtgcctc     88080
     aacccattca ggaatggtga tatcgataag cggagtgcct ttcttcacat gatcgccaat     88140
     cgtcagggga tacacttttt cgacgaaacc gtcagagcgc gcctgcacaa tgacaaactg     88200
     atactcgttg taactgacat tagccgggat tgtctgggaa taattcagca ttcctcgcgt     88260
     gactttttgc gtttttaatc ccagattctg aacctgcgtt ggatcgatac ggatcccgcc     88320
     actgctttca tcgccacttt catcagcata tttcggcacc aggtccatat ccataaaggg     88380
     agattttccg ggtttatcaa atttggtatc cggtttcatc gggtcatacc agaaaagtac     88440
     ctttcgctcc ggtgcctttt gttcggtttg tactgttttt tgtgatgagt ttacatactg     88500
     ccaggcagta accgatatca gcccccctgc tatgaggctg ctgataatta ttgcagcata     88560
     ttttatcttt aaagaagcca tacaatttct cgctgaaaaa tcaaaacacc tggcatatgc     88620
     gcccgatcat tcattcacag taatccctta atgaatgttc aggcgcactg gatgtattcg     88680
     ctccggactg ataatcagga ttgcgtaacg ttaatgcttt tgagtaagga gatattgccc     88740
     tgctgaataa acgagaaatc gacatggttg ccggttttca gggcattgat agcgtcgtct     88800
     gcattaacaa aagtgaagcg catggtcatt gcaggccagc ccacagcagg gattgcttcg     88860
     tgcgaaatgg taatcttttt actattcata tcaatgtctt taacgacacc ggtgcccttg     88920
     ataacctgct gtaccgaagc atcactggca gcattcatat cgccatgctg atgtgtttca     88980
     gcatgaagac cggcagaaaa catgacagag aaggcaccaa ataaaacggc tttaagtgaa     89040
     ttacgcattt ttaatttcct gattaattaa ataaatttac tctacccaac cgccacccag     89100
     cgcggtaaac agattaattt cgttaacctg tcgggaatag gtaagatcga gaatggtttg     89160
     ctgcgtagcg aagagggaac gttctgcatc cagcacttcg atgtaactga cagcaccact     89220
     tgcatataat cctctggcac gctggagagt tatctgaagt gaatcaagat aacgctgctg     89280
     tgactcaagt tgctggctaa gactgtcgcg cagcgcaagc gtgtcggaaa catccttaaa     89340
     ggctgactga attttttgtt cgtaattaac caccgattgt tgctggcgaa tttcagccag     89400
     cttcagattg gctttattcc tgccagcatt aaaaatagga atttcaattt tagggataaa     89460
     attccacatt ccacttcctg acgtaaacag gcttgacagc tccgtactgc ttgcggaaag     89520
     accactggtc agggtaatgg aggggaaaaa ggccgctcgc gctgcgccaa tattggcatc     89580
     agccgctttc agctgatatt ccgcttccat aatatccggt cgctgcagca aaatttgtga     89640
     agatagattt ggtggcaatt ttactggtgc gatctccccg cctttcatcc ctttttctga     89700
     cggaagtgcg cggtacgttc ccagcaccag ttgcagggca ttgtttgcct gagccagatc     89760
     gccttctcgt ttggctattt cggcgcgggt actttcgatt tgtcctctcg cctgttcaag     89820
     tgccagaacg ttcgtactcc cggtcacgag ctgttgctca acgaaagcat aggactgttc     89880
     ataatttttc agcgtttccc gcgcaatacg gagttgttcg tacgccagtt gctggctgaa     89940
     atagctctgt gaaacgttgg agaccagcag gatgtgtacg gcacgacggg cttcttcgct     90000
     ggcaaagtag ttctggcgat cagcctcact catgttctta agtttgccaa aaaaatcgag     90060
     ctcatagctg agctccagac ccgcgtcgta ctcctgtgtg gtcggcttgt cacctttcag     90120
     accaccgttg tatgtgatcc cggatgaggc attcagttgg ggataacgat ctgcatccgt     90180
     gacgttgaac tgggcccggg cctcttcaac cttcagggca gccattctca aatcacggtt     90240
     attattcagg gcttcaccga tcagcctgct gacctgggga tcgacaaaaa agtttcgcca     90300
     gcccgtatcc tgatagctgt ttaccgcagg cgtcagactg tttttagaca atgaaaactg     90360
     ctggggaacc ggagctggcg gacgctgata ttcaggtgcc agagaaacac aaccagccag     90420
     gatgaatatg gtactgatgc tgagtaattt taatttgaac ataacgcttc tcgtacaggc     90480
     agacctggta aatggttcaa acgaaatcca gagtattgat agggatactt taccgaacgc     90540
     tctctgtttg ccgggtgaca ggataatgac aatgttgtca tttttgctgt aatccgttga     90600
     taacgatcgt gggcgcaata aaatgacatt agcagccagc cggggagcat gatgaaaata     90660
     ttaatcgttg aagacgaaat taaaacaggt gaatatctca gcaaggggct gacagaggcg     90720
     gggttcgtcg tggatcacgc tgataatggt ctgaccggat atcatcttgc catgacagcc     90780
     gagtatgatt tagtcatcct ggatatcatg ctgcctgatg taaacggctg ggatatcatc     90840
     cgtatgctgc gcagtgccgg aaaggggatg ccggtattac tgctgacggc ccttggcacg     90900
     attgaacaca gggtcaaagg acttgagctg ggtgcggacg attatctggt gaagcccttt     90960
     gcgtttgctg aactgctcgc ccgggtaaga accctcctca ggcggggaaa cacgatgatc     91020
     acggaaagcc agcttaaagt ggctgacctc tcggttgatc tcgtatccag aaaagtcagc     91080
     cgcgccggga accgcattgt gctcaccagt aaagagttca gcttgctgga attcttcatt     91140
     cgccatcagg gagaagttct tccccgctcc ctgattgcct ctcaggtctg ggacatgaat     91200
     tttgacagcg acactaacgc gattgatgtc gcagtaaagc gactccgcgc taaaatagac     91260
     aacgattacg ggacaaaact gatccagaca gtgcggggcg tgggctacat gctggagatc     91320
     ccggatgcat agcaaaccgt ccagacgacc tttctcactc gctctgcggc tgaccttttt     91380
     tatcagcctg tccacaatac tggcgtttat cgccttcacc tggtttatgc tgcattctgt     91440
     tgaaaagcat tttgccgagc aggatgtcag cgatctgcaa caaatcagca ccacactgag     91500
     ccgtatactc cagtccccgg cagatccgga tgaaaaaaaa gtaagcaaaa taaaggaatc     91560
     aattgccagc taccgcaacg ttgccctttt gctcctcaat cccaggggtg aagtgctctt     91620
     tagctcagct cagggggcgg cactacgccc ggcagtgaat tcagcagatt ttagcgagca     91680
     cagccgcgca cgggatgtct ttctctggac ggtggaggat cctgcgggac cgatggatac     91740
     cgggtccgaa atgaagatgg aaacatacag gattatcgcc tcctctggtc aggcgatatt     91800
     tcagggcaaa cagcagaact atgtcatgct gactggccta tccattaatt tccatctcca     91860
     ttacctcgat gcgctgaaaa agaacctgat tgcgattgcc gtcgtgataa gcctgttgat     91920
     tgttctgatc attcgaatcg ctgtccgtca ggggcacctg ccccttcgta atgtcagcaa     91980
     tgccattaaa aacatcacct ccgagaatct tgatgcgcga ctggaaccga cacgcgttcc     92040
     cattgagctg gagcaactgg ttatctcgtt caatcatatg attggaaaga ttgaggatgt     92100
     ctttacccgc caggccaatt tctctgccga tatcgcgcat gagatcagaa cgcccatcac     92160
     caatctggtg acgcagactg aaatcgcact gagtcaggat cgaacacaga gggaacttga     92220
     ggatgtcctc tattccagtc ttgaagagta taaccggatg accaaaatgg tcagcgatat     92280
     gctgttcctg gcacaggcag ataataatca gctgatacct gacagggtca tgtttgacct     92340
     cagagcggaa gtcatgaaag tcttcgagtt tttcgaagcc tgggccgaag aacgcaatat     92400
     cacgctcaaa tttaacggga tgccctgcct ggttgaggga gatccacaaa tgttcagaag     92460
     ggcgatcaat aatctgttat ccaatgccct gcgttatacc ccggagggac aggcaatcac     92520
     cgtctcaata agagagcagg agagcttttt tgaccttgtg attgaaaatc cggggaaacc     92580
     gatccctgaa gaacatttat caaggctgtt tgaccgtttt tatcgggtgg atccatccag     92640
     acaacgaaaa ggagaggcct tgcgattgtg aagtcaatcg tggaagcaca tcacggaaga     92700
     gtgcaggtgg aatcagacgt acgctccacg cgttttatct tatccgtgcc cagactggag     92760
     aaaatgatcc cggaaaccca atgctgaaaa taaagatgta aatgacaaag atgtcattag     92820
     cctgtcatgc agcaaacaga agccattcga tataattagt gcaacttatc aggaaggctg     92880
     gattgcttca tcaatacccg gcgtcagagt acgccaggaa atgaatatcc agccctcttc     92940
     cggagaaata aacgctgccg aacttgtttc agttatggaa ctgaaaacac cggttgtact     93000
     tccccggaca tcactaattc agaaatggag agttatcatg aaaaatatcg tattagcatc     93060
     tttgctgggc tttggtttaa tttcatcggc ctgggccact gaaaccgtga atatccatga     93120
     tcgcgtcaac aatgcacagg ctcctgctca ccagatgcag tctgctgagg ctcctgtcgg     93180
     gatccagggg actgctcctc gtatgaccgg tatggaccag catgaacagg ccattattgc     93240
     tcatgaaacc atgacgaacg gctcggcgga tgctcaccag aaaatggtgg aaagtcatca     93300
     gaagatgatg ggaaataaca cggtatccac gaccgtcccg tcaacgtctt acgcggcgat     93360
     gaatgagcat gaaagagcag cggttgctca tgaattcatg aataacgggc aatccggccc     93420
     acatcaggcc atggccgaag cgcaccgccg catgatcaat gcaggctgaa tgcgacggta     93480
     gtatccgtgc tgttaccttt tccctgatag attttcctga aacaacgttg ctacattttt     93540
     gccccccgtc agggggcttt tttgtctgac tcagctacac ttaaccggta cctgtctgaa     93600
     aggaattatt atatgggcta tttgcattct agggttggaa ttcatccatt ctaacccttg     93660
     attcttagtc ggacaaaaag ctgcttctgg ttggattttt ctgtttttca ccaccctgcg     93720
     aaaatctaac attggttgga ttctcagacg cgccctctct cgcgttaatc caactctcca     93780
     ccttctgcct gcttcaacaa tgtcggaatg tgcggtccat actcgacctt gcctcgtcct     93840
     gctcgaatac cactgccaac cttgcgggct tctttggagt acaacgtctt tgcacggatg     93900
     atctcatagc tataaccccg acctaaccgg ttggacatct tgatcaaacc gttgagccct     93960
     tcggtatagc cattggtgag tgagaacggc gcatcccagt aggcaaagat gtcgtcgtaa     94020
     tggttgtgta ccgtttttac cagttttttg aaaggctcca tgccataagg cggcaggctg     94080
     ttcttccaag cctcaaaggc gttctgagca ctctgcttgt cgggttcgtc gtagatgcag     94140
     aagaaggctt ccttgaagtc ataggccatg gcaagtgctg ggatcgcctg ctttacaacc     94200
     tccagcgcct tttgctctgc gggcgtcagg ttgccgggtc gcttcagggt aagccagcga     94260
     atggactttt tgacgtaaat gcgatcttct ttgcttaact gtgcctgggt aatgacccca     94320
     acttactgat agtgttttat gttcagataa tgcccgatga ccttgtcatg cagctccacc     94380
     gattttgaga acgacagtga cttccgtccc agccttgcca gatgttgtcg cagattcagg     94440
     ttatgtcgct caatgcgctg agtgtaacgc ttgctgttaa cgtgcagctt tcccttcagg     94500
     cgggattcat acagcggcca gccatccgtc atccatacca cgacctcaaa ggccgacagc     94560
     aggctcagaa gacgctccag tgtggccaga gtgcgttcac cgaagacgtg cgccacaacc     94620
     gtcctccgta tcctgtcata cgcgtaaaac agccagcgct gacgtgattt agcaccgacg     94680
     tagccccact gttcgtccat ttcagcgcag acaatcacat cactgcccgg ttgtatgcgc     94740
     gaggttaccg actgcggcct gagtttttta agtgacgtaa aaccgtgttg aggccaacgc     94800
     ccataatgat gtagccccct gaaacaccgg acagtagctg tatctccaga taagagatag     94860
     gcttgaatat atgtctaaca ctaacgccaa ttttgagatg accgggatcc tgttagggca     94920
     agaagcccgt aaacgtaaaa ctcctcagga gaagatcgcc attatccagc agacgatgga     94980
     gccgggcatg aatgtctccc atgtcgcccg cctgcatggt atccagccca gcctgctgtt     95040
     taagtggaag aagcaatatc aggaaggcag cctcaccgcc gttgcggccg gagaggaagt     95100
     cgttcctgct tctgagctta ctgctgctct gaagcaggtc cgggaacttc agcgccttct     95160
     gggcaagaag acgatggaag ttgagatcct gaaagaagcc gtggagtacg gccagtcgcg     95220
     aaaatggata gcgcacgcgc ccttgttgcc aaaggacggg gaatagccct ggtcagccgc     95280
     accatgggcg tgtcgcgtgc gcagctgtca ctgcggatta accgttctgc cgactggcag     95340
     gacaagcgct gtaaccggcg taatgacgaa gcagacgaag aaatactgtc ggctatcctc     95400
     gacatcatca gcgatatgcc gagttatggt tatcgacgcg tgtggggcat cctgcgcaag     95460
     caacgtcgca cagagggaca gccacctgtg aacgccaaac ggctctacag gataatgagc     95520
     gagcataacc tgttgttgtt gcatgacaaa ccagagcgac cgaagcgtga acataagggc     95580
     aagatagcgg tggcagaaag cgatatgcgc tggtgttcag atggcttcga gttcggctgc     95640
     gacaacggcg aaaaactgcg ggtaacgttc gcgctggact gctgcgaccg tgaggccata     95700
     gactgggcag caagcacggg aggctatgac agttcaaccg tgcaggatgt gatgctgagg     95760
     tcggtggaaa agcgcttcgg cgacaggttg cccgatacag cggtgcagtg gctgacggac     95820
     aacggttcag cgtataccgc gtatgaaacg tggaggttcg cgagagagct gaatctggag     95880
     ccctgcacaa cagcggtgag cagcccgcag agtaatggca tggccgaacg gttcgtgaaa     95940
     acgatgaaag aagactatat cgcgttcatg ccaaaaccgg atgtgagaac agcactgcga     96000
     aaccttgcag tagcgttcac gcattacaat gaaaaccacc cgcacagcgc gctgggatat     96060
     cactccccga gggaataccg gcggcagcgg acatcgttaa cttaagatac aaaagctgtt     96120
     cggagatgga gggtcaagat cactagactg gccccctgaa tctccagaca accaatatca     96180
     cttaaataag tgatagtctt aatactagtt tttagaccag tcattggaga acagatgatt     96240
     ggtaatgctg ccaacttact gatttagtgt atgatggtga ttttaaggtg cttgcgtggc     96300
     ttccatttcc atcagatgtc cttcctgctc cgctactgaa ggcgtggtgc gtaacggcaa     96360
     aagcactgcc ggacatcagc gctatctctg ctctcattgc cgtaaaacat ggcaactaca     96420
     gttcacttac accgcctctc agcccggtac gcaccagaaa atcattgata tggccatgaa     96480
     tggcgtcgga tgtcgcgcca gtgcacgcat tatgggcgtt ggcctcaaca cggttttacg     96540
     tcacttaaaa aactcaggcc gcagtcggta acctcgcgca tacaaccggg cagtgatgtg     96600
     attgtctgcg ctgaaatgga cgaacagtgg ggctacgtcg gtgctaaatc acgtcagcgc     96660
     tggctgtttt acgcgtatga caggatacgg aggacggttg tggcgcacgt cttcggtgaa     96720
     cgcactctgg ccacactgga gcgtcttctg agcctgctgt cggcctttga ggtcgtggta     96780
     tggatgacgg atggctggcc gctgtatgaa tcccgcctga agggaaagct gcacgttatc     96840
     agcaagcgtt acactcagcg cattgagcga cataacctga atctgcgaca acatctggca     96900
     aggctgggac ggaagtcact gtcgttctca aaatcggtgg agctgtatga caaggtcatc     96960
     gggcattatc tgaacataaa acactatcag taagttggag tcattaccga atatcggatg     97020
     atttgtatcg gaactcatta caccatgcgt tccgattaac gccgcatagc cagttgaact     97080
     ttgctactct gtgaaaggta gtaccgtcta tccagtgcgg atttaattaa tggaataaat     97140
     gattatgagt gataatgata caatcccgaa gaagtctaca agccagatta acaaagcggt     97200
     attctttaca tctgctttgc taattttcct tcttgtcgcc tttgccgccg tattcccgga     97260
     tgtcgccgac aaaaatttta aactactaca gcaacaaatc ttcacgaatg ccagctggtt     97320
     ctacatcctt gctgtggccc tgattttact aagtgtcacg ttccttggac tctcacgcta     97380
     cggtgatatc aagctgggcc cggaccatgc gcagcctgat ttcagctacc attcctggtt     97440
     tgcgatgctt ttttcggcag ggatggggat cggcctgatg ttctttggcg ttgccgaacc     97500
     tgtaatgcat tatctttcgc ctcccgttgg cacgccagaa accgttgcgg cagccaagga     97560
     agcaatgcgt ctgaccttct tccactgggg actgcacgca tgggcaattt atgccattgt     97620
     ggcgctgatt ctggcgttct tcagttaccg tcacggtctg cctttaactc tgcgctccgc     97680
     actctatccc attattggcg atcgcatata cgggcctgta ggccatgcgg ttgatatttt     97740
     cgctgttata ggcacggtct ttggcgtcgc gacatcgctg ggttacggcg ttttgcaggt     97800
     gaatgccggt ttgaaccatc ttttcggggt gcccatcaat gaaacggtgc aggttattct     97860
     gatcgtggtc atcacggggt tagcgacgat ttcagtggtg tccggcctgg ataagggaat     97920
     acgtatcctg tctgagctca atctgggtct ggcgttgttg ctcctggcgc tggtcctgtg     97980
     tctgggacca accgtgcttc tgctgaagtc atttgtggaa aatacgggcg gttatctttc     98040
     ggaactggtg agtaaaacgt tcaaccttta cgcgtatgag cctaagtcga gcaaatggct     98100
     ggggggctgg acattactgt actggggatg gtggctttca tggtcgccgt ttgtggggat     98160
     gttcatcgca cgggtctccc gcgggcgaac cattcgcgag tttgtcaccg gcgtgctgtt     98220
     tgttcccgcg ggttttacgc taatgtggat gacagtgttt ggtaacagcg cgatctatct     98280
     cattatgaac cagggggcca cagacctcgc caatactgtt cagcaggatg tggcgctggc     98340
     cctgtttaat ttcctggagc atttcccgtt ctcttccgtg ctgtcattca tcgcaatggc     98400
     gatggtcatc gtcttctttg tcacgtctgc tgactcgggg gcaatggtag ttgatactct     98460
     ggcaacaggt ggagtggcaa acacacccgt ctggcagcga atattttggg cctcgctcat     98520
     gggcattgtc gcaattgcgc ttctccttgc cggagggcta agtgcgctgc aaacagtgac     98580
     aatagcgagt gcattgcctt tctcagtgat cttactgata tccatatacg gacttttaaa     98640
     agctttgcgc cgggatttga ccaagcgtga aagcctgagc atggcgacaa ttgctcctac     98700
     ggctgcacgt aacccaattc cctggcagag aaggttacgc aatatcgcgt atctgccgaa     98760
     gcgatctctt gtgaaacgtt ttatggacga cgtcatccag cccgccatga cgctggttca     98820
     ggaagagctg aacaagcagg ggacgataag ccacatcagt gacgcagtcg aggatcgtat     98880
     tcgtcttgaa gtcgatttgg gtaacgagct gaattttata tatgaagtga ggcttcgcgg     98940
     gtatagctca ccgaccttcg cgctcgccgc gatggataat aatgagcagc agactgaaca     99000
     acatagatat tatcgcgctg aggtatatct caaagaaggc ggtcaaaatt atgatgtgat     99060
     gggctggaac caggagcagc tgattaatga catactggac cagtacgaaa aacatctgca     99120
     cttcctgcac ctcgttcgtt aatagcaaca tgccgtcctg ggggcggcaa ttatttatcc     99180
     cggccgcaat atgaggaatg cagaatgatt tcacgctgga aatggattct gaagcagaca     99240
     gttaaaaagc tatggttcag ggcaacgtta ttcgccattg tcgcgataat aacggccctt     99300
     ttatcaattc tttttaaatc aatgatacct gagtcggttt ccgtgaaggt tggtgcggaa     99360
     gcagtcgata acattctgaa catactggca tcgagtatgc tggcagtgac cactttttcg     99420
     ttgagtatca tggtcacagc ctacggttca gccactacta atgtgactcc cagagctacg     99480
     cgtttagttg ttgaagacgt aaccacacaa aatgtactgg ccaccttcat cggttctttt     99540
     ctcttcagtc tggtagggat tattgccctc agtatgggag cttatggaga aagggggaga     99600
     gtcattttat tcattgtcac actggttgtc attgccttaa tcctcatcac attgcttcgc     99660
     tggatacagc atttgacctc tctgggaagg gtaggtgaga caacggcaaa agtagaacag     99720
     gcggccatcg aaacatttat tgcgagagca agaaatccct gtctcggcgg atatccatgg     99780
     cttgagaaca atgaacagcc gaaaggaacg gttgcagttt atccgaagaa gattggctat     99840
     gttgaatata ttaatatggt gaaacttagc aagctgctga ccaatgatcc ccgtcatgta     99900
     tacctcgtgg cgcagccagg cagtttcatc catccatcca tgcccgtttt gtacctgagt     99960
     caaggccagg agtcatcaat cagcgccgat ttacttgaga cgattattgt ctcggatgta    100020
     cgttcatttg ctcaggatcc ccgattttgt cttagcgtca tggccgaaat agcctgccgg    100080
     gcactttccc ccgcagtgaa cgatcctgga accgccattg atgtcattgg cagaggtgtt    100140
     cgtatacttt ccacttacgc gcagaataaa tctgatgaaa tagaagtgaa atatccttca    100200
     gttcatgttg caccacttca gaataacgat ctactggaag actttttctc acctgtcgcg    100260
     cgcgatggtg ccggtatgag ggagatacag ataagagtcc ttaaaggact gtctatgctg    100320
     agtaagggtt ggcctgggat attttctgag gccgcgcata atttagcatt tgaaacatta    100380
     gagcatgcaa tacgtgctga ccatatagat tctgacagat gtctaataaa atcaatttat    100440
     tataatttat ttagtggtga agactctaat aaaaaaccat agttgtgggg aaagtaatta    100500
     ggccgcagga aagataatgg caaaaaaaat tccgagaatg ggcgtcagtt ttgtggcata    100560
     tgcgggcgtg ttaattgcga gatgtattaa cctatggaga gcagttccat ctatactcct    100620
     gtcagcccat gctggaaata ttgttatcac tagtcctatc acggaaaagt taattgtata    100680
     ttctaaccct acgcagtatt ccgcttaatg gcttgcttct ttgtgtcttt tcccaacagt    100740
     atccgacaat aaaaagtacg tgaagtaaac ccaacaaaat aacgctgtac tgtatggtca    100800
     gtcaatgtat tagattaaca gctttcgggt atttttctag tgctttgaaa aaaggaatat    100860
     cagacatttg aaggaattca ggatgtcaac accagttgct ttagagaaaa atggaaacgg    100920
     cttcctattc actagatgca atagatagag gtcctcgtta tctgctgaag caaatattgg    100980
     aattgcattc aaccctcaac gacttctgat tttcaagaca gtgtctactt gtacataaca    101040
     catatctgca gcactgtgct gaattagggc cagatggcac tccagccccc tgaggtaggg    101100
     acacatcttc aaagattcca ggttttttct actactttca tcaatgccat ctctggaagg    101160
     cgctgagtag ttatccgcag caaccagcag agttatgttg cagacgaata atgctgtcta    101220
     ccggatactg gcagccccga ctcctctgta ctatgagaca aagctcgctc atctcagtaa    101280
     atattacatt cgctgttccg tgttttgcat caaatcacat cctggtttct ctgttattta    101340
     agcagttcag aacgactttt cagtaacgct ttcccctgcg ccagcagcag gtgattacac    101400
     tgcccttcaa tttctaccag ctgatcggca agcaattgct gagtgtttgc gctgaaagtg    101460
     ccggtcagtt caattcccgg atggtaagtt ttctcgcttc ttccagcgga agcgctctgg    101520
     agtaatacca gccctgagca taactctgtg gccagaacgt cttcagatag ttcacctgct    101580
     cctgagtctc tacaccctca aacacaatct tatctgcaat ggagcggaac atctcatgca    101640
     gtccgggaag aagatcatat cgtaaagatt cagtaccaat agcactagtt agcgatttgt    101700
     ctatttttat ttcatctaca tcaagcgcag ttaccagatt aagattagaa tatcctgtcc    101760
     caaagtcatc gatggcaaac ctgacaccat gatttttata tttatcaatg tgaattttca    101820
     taccttcaaa atcccctcct tgacgctccg taatttcaag aaggattgtt ttatatggga    101880
     tgttatattc agaaattaat cctagtagtt tatccctgaa tttttctgaa tcaagatcgc    101940
     ttggattaat gtttacgctc aaaaatattt cattctgaat agcagtatgg ataaattctc    102000
     ggatagcatg gttaatgacg aataaagtca catcctcctg caacccttcc ctttcagaaa    102060
     gcggtataaa tacttcaggg ctaatattcc cgagtctttc atctttccat ctgagcaagg    102120
     cctcaaatcc gcagatctgt ccgtcttcaa ttctgtaaat aggttgatag accagcgaca    102180
     gggcttcatt tttcaaagcc tttacaaacc ttgcagatag tgaactattg agttctgctc    102240
     tgttcataat gataatataa atcattaaac cggaaagtag tgacactgtt actaataaca    102300
     tttgtatgct ccagtgctct gaaaatatcc ccgtaaaata cccacctcct gcaacacaga    102360
     gatcataatg taggctacat gccctaaaca ctctaaacct tagtggaacg ctatcatgcc    102420
     gatcaagaag aggagcatca ggtcctatat tgaagtaatg cctgtcatgc ttactatttc    102480
     cgacaacagc gctaaagttt tttgaataca tatcagtttc gaatcgtctg aagacaaatg    102540
     gtgatagggt caccataata ccttcagaaa tatatccatt gacggatata tcatccataa    102600
     gcttaatacc aaaaagccac actccttccc gcgaagtcca ttttttatca aaatgttcca    102660
     gacttaaggt gggacgtaaa ctcccccaca gagcactaca ggctaattct ccttttatga    102720
     tgtagccaac atctttaatc aacggatagg gccatactac aacccgaaga tgtaggatat    102780
     tttcattagt acatggactg tctcctatat tcaaatgtga ctttgcagca gtcttgacag    102840
     attcagtctg aaccaggagc gattcagagc gaacaagcac atcggaagta tagtctttaa    102900
     ttttatcccg aaaaatcagg taagatacgc tctcagataa tacaaaaaaa atataccagc    102960
     tgaaagaatc gataaagaga ggactgatag attatgtatc cactttccag ggctaatcaa    103020
     acgttccagc ttacgactaa ctgatgtagc cccctgaaac accggacagt agctgtatct    103080
     ccagataaga gataggcttg aatatatgtc taacactaac gccaattttg agatgaccgg    103140
     gatcctgtta gggcaagaag cccgtaaacg taaaactcct caggagaaga tcgccattat    103200
     ccagcagacg atggagccgg gcatgaatgt ctcccatgtc gcccgcctgc atggtatcca    103260
     gcccagcctg ctgtttaagt ggaagaagca atatcaggaa ggcagcctca ccgccgttgc    103320
     ggccggagag gaagtcgttc ctgcttctga gcttactgct gctctgaagc aggtccggga    103380
     acttcagcgc cttctgggca agaagacgat ggaagttgag atcctgaaag aagccgtgga    103440
     gtacggccag tcgcgaaaat ggatagcgca cgcgcccttg ttgccaaagg acggggaata    103500
     gccctggtca gccgcaccat gggcgtgtcg cgtgcgcagc tgtcactgcg gattaaccgt    103560
     tctgccgact ggcaggacaa gcgctgtaac cggcgtaatg acgaagcaga cgaagaaata    103620
     ctgtcggcta tcctcgacat catcagcgat atgccgagtt atggttatcg acgcgtgtgg    103680
     ggcatcctgc gcaagcaacg tcgcacagag ggacagccac ctgtgaacgc caaacggctc    103740
     tacaggataa tgagcgagca taacctgttg ttgttgcatg acaaaccaga gcgaccgaag    103800
     cgtgaacata agggcaagat agcggtggca gaaagcgata tgcgctggtg ttcagatggc    103860
     ttcgagttcg gctgcgacaa cggcgaaaaa ctgcgggtaa cgttcgcgct ggactgctgc    103920
     gaccgtgagg ccatagactg ggcagcaagc acgggaggct atgacagttc aaccgtgcag    103980
     gatgtgatgc tgaggtcggt ggaaaagcgc ttcggcgaca ggttgcccga tacagcggtg    104040
     cagtggctga cggacaacgg ttcagcgtat accgcgtatg aaacgtggag gttcgcgaga    104100
     gagctgaatc tggagccctg cacaacagcg gtgagcagcc cgcagagtaa tggcatggcc    104160
     gaacggttcg tgaaaacgat gaaagaagac tatatcgcgt tcatgccaaa accggatgtg    104220
     agaacagcac tgcgaaacct tgcagtagcg ttcacgcatt acaatgaaaa ccacccgcac    104280
     agcgcgctgg gatatcactc cccgagggaa taccggcggc agcggacatc gttaacttaa    104340
     gatacaaaag ctgttcggag atggagggtc aagatcacca gcttacgact aaccatgcag    104400
     atctcccctc aaattgaaaa gatataaagc tatattttcg ccaacttcac agaccgatta    104460
     gctggcactg aacatactat tccagtatac ctattcttgc cttactcatc ccgggtatga    104520
     atcaaataat gtgacatggt tcggatagat actggttatg atttacagag ataattcatg    104580
     cgttattaat agcctcgtga aggctccaga tgcatggtgc aacttttaag cgatgcatgt    104640
     aatgcggttt tttacccact agtatagaac gaatattcat ttcttgctgg gcgatcgcac    104700
     actaaggtgt acaccaaaat aaagacactc ttttttgaaa aaaacagagt aaaatgttgt    104760
     gtgacatcgg cattacaaaa cgaaaattca tgttataatc gggttattat tgataatgtt    104820
     acgcattgca acgtgtaacc ggatatctgc atttgggtga agatagctta agatggataa    104880
     aaaatatgat ttttcgctca gttatgaagc cttaacacgg gtatgtgaaa atgcaatatg    104940
     tgaacatatt cgcagagcag gttctctgga agggttaggt ttcgcacttg aatatacaaa    105000
     ggcctatgct atcctggaag tatggtctct gctggcagct gctggcgata catttccagc    105060
     tctcattgag aaagacagaa tatatctgtt gcaactaatt tccgggaaaa ataatataga    105120
     gctacattaa atcataaatt atttggcaga acatctccgt ttttacttaa cgcccgccgg    105180
     aatcactgac gtgaggaaaa tgaaatttgt tgtgcaataa taattctgat tattctggtc    105240
     agtcggattg gccgtagagt ttcagtattc ttgtgcgatg acaaggcggg ataactaccg    105300
     tcatcgcgcc ctgtctggaa tcaatgactt cagttttaga tataaagaaa aaacaatata    105360
     cacattagat aaaagtgaga aaaactcgtc ctgtataaca tcaggtagag taaagcattt    105420
     atcattaact tactgaagac ggaataacta catttatacc cgaaagctat tctctttgaa    105480
     tctactttag atttctatta tttctgattg ccataggctt ttttacagta ccctgtgatt    105540
     tccttgactt cactttatat tttattatca tcccatataa taaaaccagc gaaatagaca    105600
     aaacaacata caataacata aaaatacctg tgttaacaat taaaaaagga gattaggtcg    105660
     agtccgtgag tgattttaac atatacgcga attgatacaa ctcatatgtg ctagccagtt    105720
     tcatcttttt ctttatttct tttataggct ttgttgaata aatcagattt cgggtaagtc    105780
     tcccccgtag cgggttgtgt tttcaggcaa tacgcacgct ttcaggcata cctgctttcg    105840
     tcattttgtt cagcgctcgt accagggcca tagcctccgc aacctgacca tcgtagtcac    105900
     gcagcgtcag tgcccccccg aacagctgtt ttacccggta catcgccgtt tccgctatcg    105960
     agcgacggtt gtaatctgtt gtccatttcc accgcgcatt actcccggtc atttgctgat    106020
     tagccactgc acggttacgg tctgcatatt caccgggcca gtaacccgca ccttttcggg    106080
     gtgggataag cgcgctgatt ttcttacgcc gcagttcatc gtgacagagc cgggtgtcgt    106140
     aagcgccgtc tgccgatgct gccctgattt ttctgtgagt ctgccggata agacccggga    106200
     aggcttctga gtccgtcaca ttgttcagcg acaggtcagc gcagatgatt tcatgtgttt    106260
     tactgtcaac ggcgagatgc agcttacgcc agatacggcg gcgttcctgg ccatgctttt    106320
     tgactttcca ctcgccttca ccgaagacct tcagcccggt ggaatcaatt accaggtgtg    106380
     cgatttcacc ccgggtgggc gttttgaaac tgacattaac cgactttgcc tgcctgctga    106440
     cacagctgta atccgggcag cgtagcggaa cgttcatcag agaaaaaatg gaatcaataa    106500
     agccctgcgc agcgcgcagg gtcagcctga atacgcgttt aatgaccagc acagtcgtga    106560
     tggcaaggtc agaatagcgc tgaggtctgc ctcgtgaaga aggtgttgct gactcatacc    106620
     aggcctgaat agcttcatca tccagccaga aagttatgga gccacggttg atgagggctt    106680
     tattgtaggt gggccagttg gtgattttga acttttgctt tgccacggaa cggtctgcgt    106740
     tgtcgggaag atacgtgatc tgatccttca actcagcaaa agttcgattt attcaacaaa    106800
     gccattttgg gactggatat tcctctctca actatctaag agaatttcca tttgatgcga    106860
     ttaagttaga cagaacattc attagtggta ttgcccacgt tgcacgggac ttatctattg    106920
     taagaagcat agtgtctctt ggaaaagctt tcagtttagg tatagtcgca gaaggtgtgg    106980
     aaaataatga acagtttgaa ttgctaaaaa atatgaattg cgatgaattt caaggttatt    107040
     attattcgaa gcctttgtca ggtgatcaac tgattgattt tttgaggggc caaaaaaaat    107100
     agggctgtat gtcctatttt ttcatatact atcgttttcc ctttttaatt tcatacattc    107160
     tttcgtctgc atcctgcatg atagcagagc attcagtatg aattttctca tcatattcaa    107220
     taatccctgc agaaaaatct atgttgtatt ttttttgaga attaagattg tagctggtaa    107280
     tcccggccct caatttatga aggaattctt ctgcttcttt ataggttgac tcgggtaata    107340
     gaacaccaaa ttcatcacct cctaatcttg caacaacgct ttttgaacta ctaagatctt    107400
     ccagcatatc tgcaaaattg caaagtactt cattaccttc tgaatgaccg aagttatcat    107460
     tgattggttt aaaattatcg agatctatga tcagaacaca gaatgttttt ttcttttttt    107520
     tggcttttct taacgattca tccgtcatta gggcgaaaga acgccggtta catatacctg    107580
     tcaaaggatc agtagttgct tcgtttatta ttctaaactc atcctctacg atttctgcta    107640
     aatctttaag caataagaag tcatctctgg ttaatactct tggttctgta tcaataatac    107700
     atattgttcc agctatctca ccatctggca gtcttacggg atgccctgca taaaaccgga    107760
     tataaggatc atttttaact aatttatttt ctttgaatct tggatcaagg cttgcatcgg    107820
     gcactattaa tggttcacta agatctactg ctattgtaca aaatgaatca cttctatctg    107880
     tctcttttat cttcagccca taacatgact taaaccattg cctgtctcta tcaattaatg    107940
     aaacaagtgc tattggtaca tcaaagagtt tggtggcaat cctcgtcaat ctgtcaaatc    108000
     gttcttcata ttttgtatca aggatcccca tagaatataa tgataataac ctgttctctt    108060
     ctttatggtt tgtcataatt ttcatcttga gtggttattg cagggtagtg ttggttatcg    108120
     ctatcttatc agaattgtcc tggaactcaa taatcccaat atctcataat catataaaac    108180
     ttaacaagtt tccaataaat catgatgaat agtgaactgt tacatctaat catctgtgac    108240
     ctgaagcgct cattatacac ttccatgtat tcagaatgca taatgatttg tatattaaaa    108300
     atcgccataa cttacaatga cttatttttt gtggcacaat taaagcgcat ctgttcaaat    108360
     aaatgtaaag acattaatgc ttgatcttca tggtttctta tgaaaaccag tggctgaaga    108420
     aacgtatggc agttctgaat ctgaacaaga cgagacggca tgaaaggttc aagaaaattg    108480
     tccaggaagg tacatagttt ccttatccaa tattttctac tgagggtata ttgtatcagc    108540
     ttaagacagg aactgttgat acagaacaga aaagttcaac acagcctgaa tctgcgcgac    108600
     gctaaatttt ttccttctgg cgaaccaaca aacagcccgt ttatagagag attctgcaga    108660
     cgacaaaagg attaatccct gaaattgcac tgaattgtca cctgaagatg tgcaggacaa    108720
     gccagattac tcttacaagg gataccatcg taatttagca aaaacaccta agacctaaac    108780
     gacagctaag tacatagtgc cggacggatc atgatttttt atttaactta cggacttcat    108840
     ttttcagcaa ttatcttttc tcttctgttg taaacttatg aaagcgttac gcgaaatccc    108900
     gcaaggttac aggggtgtac caggccggaa atcgcgtagc gctctcttct cttctgtttc    108960
     ctgcctaaca tgtacatcct ggcattactc caattctccc aaaaaccgta aaacagccat    109020
     caacccgcgt cattactggc ttcatggagg atctgagcag aaaaacgatc ctttacgcat    109080
     ttggttttac ccgcaataat gcgggataag acaacaaaag gatccgcgcg ctgcgattta    109140
     ttgtcatggc aggatcggcc cgtcaggtgc aaaatacctg tatccataaa cagtgcgtgc    109200
     gctacgtgaa aaataactca tgaacagcat cattcccttg cagaattcac cagaacgcgt    109260
     ctctctgctg ccgatcgccc cgggcgttga ttttgcgacc gcggtggcac tccggcggat    109320
     ggccacctca acaggtgcca cgccggctta cctcctggcg ccggaagtga gcgccctcct    109380
     ctggtatatg cctgaccagc gtcaccacat gttgttcgcc accatgtgga ataccgggat    109440
     ccgtatcggt gaagcccgga cgctcacccc ggaatcgttc gacctggatg gtctgcgccc    109500
     ttttgttcgg gtgctgtcgg aaaaagtgcg ggcacgtcgt ggccggccgc caaaagatga    109560
     agtgcgtctg gtaccgctga cggatgccag ttttgtgcgt cagatggaga gctggatggt    109620
     gaccacccgc ccccgccggc gggagccgtt atggccggtc acggatgaga caatgcgcaa    109680
     ctggctgaaa caggcggtga agcgggctga agctgacggc gtgcattttt cgatccccgt    109740
     gacgccgcat actttccgtc acagctatat tatgcacatg ctttatcacc ggcagcccag    109800
     gaaggtcatc caggcactgg ccgggcataa ggatccgcgc tcgatggaag tctatacccg    109860
     ggtatttgcg ctggacatgg ctgccaccct ggccgttccc tttaccggtg atggtcgaga    109920
     tgccgcggag atccttcgct ccctgccccc ggccggctga gattgacggc cctggcatga    109980
     cgtcctgtat tccgctaata cggaatacag gagcagagag cattcagccc cctccctgct    110040
     ccagcacacc aggccatcat gctgatgact gaaccgccat ggtcttaccc ggtgacctgc    110100
     aatcctgcag gcatcaacat accgcagtca agacagggca caatgcaggc atactggccg    110160
     tgcatcccac tgtgcgtttt tcctggaagc tcagcaaatc atcccgttaa ccgcgaaagt    110220
     cattcaccat ctgtggccaa cacctttctg ccatccggct cccgtttcct aatcgcattt    110280
     agcagtgtga agctggcgcc gggttataca gacagctgca gtctcatcct gccgggctaa    110340
     acctgcagta cacaggggaa cggataccgt caggtaacat gaccgtctca gcacccgatt    110400
     gagattttcg taaggggtat agagctttac tgaaaaattg actgtggcat gttatcaccc    110460
     atggaatggt taacagacca gggattaccc ccatttaacc cgcatgccgt agtcaatatc    110520
     tgcgtatcac gaccccaaat cacatattac agtcaatatt gttcgatccg ggcagagatg    110580
     atagagaata aatattgact gcggtatgcg tgatgcatat cacagtcaat ggaatgtcct    110640
     tagcggcata cggcagtcat gatatgcata tcgcagtcaa ttttctggct tcatcgctga    110700
     gagggcttca gccagtttaa gaggatcgat gccagcagcc ttcagcgcct taatgacttc    110760
     gtcataattt tgctctggcg ccttctcttc ttccgctttg cgcggaacct tcacaggacc    110820
     actgatgagt ttggggttgc gataatgcac gctgaaatag gtggctcggc cacgtttaaa    110880
     ctcggtgtaa tccagataac caatatcccg cagctgctcc atcgccttac gcaccgtgtg    110940
     gttctgcgta tagacatttg aggtgagatt cagccggtca cgcatccgtt tcatggaaat    111000
     aggtgcagga ttctggggaa gactttcgat gtaggtataa agcgcctggg ctgattcctt    111060
     gcgctgcagg gcgtcaatgg ctttcagccg cagcagtacc cttctgtcca tgtggtaaag    111120
     ctcaaacagc ttaggttcag cctttatctc aacgatatcc tcggtgatgt cataataggc    111180
     tgactgcacc agatgggtgg tccatccttt ggtctcgctc tggaacttca gcgtaaccga    111240
     ggcaagttta aacagggaat tactgatgcg atcgcgcatt tttttgtttg aacgacggga    111300
     gttaaatccg cacatcttaa cgaattcgac gaacgacagt tccagggtgt cactttttac    111360
     cccatactcc gacatggagc gaattatccc cagccagact ttaaaatccg tgtccatatc    111420
     aagacgcgaa ccggtgatct taacgtcagt gtacccttcg cttttggcaa tagacagctg    111480
     tacaagctcc tcagtcgcgt ctgtaacgtt tttccggttc gccttgctct tccctgttga    111540
     tttcagagtt gggacgaaga gaccgagtct catgagcgct actggctgca cggtactggt    111600
     gctgttgaca tccagcttaa caacttcgcc ggttgtctta tcaacttcct gaaggttcag    111660
     aagtaagctg ttattttcgc tcgtcatctt gatcctcaac ggttatccac aaaaggatgt    111720
     agtaatacgt atcgcagtca acggatatac atacctcagt aaataccgtt gcatatcaca    111780
     gtattagatt atgcatataa cagtcaacat tttacattcc gcagtcgatc cagacagacg    111840
     ttaaagccag ttacagcgca tgctggagcg atccggggat ctcttttgga tctcactatg    111900
     atctccttgg gatcaattat tggatcgaga ccttgaataa ctcagataca aggccggaag    111960
     cgccacacca ggtatccaga accctggcct gattttcctg aatacgctct ggaagattga    112020
     gatctacagg tacaacaatg aaacattgac tgcggtatgc tgagtcgtct ttcctctttc    112080
     tcgacacaga tacagtaagt atcatgccac agtcaatata ttacatatcg cagtcaattt    112140
     cattataact ggctgatccc gagccatctt aagcaacccg acgtacgtgc aatctgtgaa    112200
     ttctgtgatt ttccgcttcc tcgccgcttt ctcactccgt gagatcgctt actgcggcga    112260
     gcggcagtga ttaatattgg ctgcggtatg tactcttttg tactcccctg cggtctttgc    112320
     atcacccaat gcggttcact ttgcactttt tcgtgcactt tgcgttttta ttgttgcttt    112380
     gcaataaatt ccaagattta ataaaataat gcaaagtgat gattaaagga tgttcagtat    112440
     gggactcatg gatacactca accagtgcat aagtgctggt catgaaatga cgaaagcaat    112500
     cgccattgcg cagtttaatg atgacagtcc ggaagcccgg aaaataaccc ggcgctggag    112560
     gattggtgaa gcagctgatt tagttggcgt gtcatctcag gctatcaggg atgccgagaa    112620
     agctggccgg ctgcctcacc ctgatatgga aacccgtgga agagttgagc aacgcgttgg    112680
     ttataccatc gagcaaatca atcacatgcg ggatgtattt ggtacacgac tgcgccgtgc    112740
     tgaagatgcg tttccgccgg tgattggtgt tgctgctcac aaaggtggtg tttacaaaac    112800
     ctccgtttct gttcacctgg ctcaggacct ggccctgaaa ggattacgcg ttctgcttgt    112860
     cgagggtaat gatcctcagg gcacagcctc gatgtatcac ggatgggtgc ccgatcttca    112920
     tatacacgcg gaagatactc tcctgccctt ttatcttggt gaaaaggatg atgccagtta    112980
     tgcgataaaa ccaacctgct ggcctggcct tgatatcatt ccgtcctgcc tggcactgca    113040
     tcgcattgaa actgaactga tgggcaaatt tgatgaagga aaactgccca ccgacccgca    113100
     tctgatgctc cgccttgcta ttgaaacggt cgctcatgac tatgatgtga ttgttatcga    113160
     cagcgcaccg aacctcggta ttggcacgat caatgtcgta tgcgctgctg atgtgctgat    113220
     tgttcccacc ccggcagagc tgttcgatta cacttctgca ctgcagtttt tcgatatgct    113280
     tcgtgatctg ctcaggaatg tggatcttaa aggctttgag ccggatgtcc gtattctcct    113340
     taccaaatac agtaataaca atggttcgca gtcaccgtgg atggaagaac aaattcgcga    113400
     tgcatgggga agcatggttc ttaaaaatgt ggtacgtgaa accgatgaag ttggtaaagg    113460
     ccagatccgc atgagaaccg ttttcgaaca ggcgattgat caacgttctt cgaccggcgc    113520
     atggcgaaac gcactttcaa tctgggaacc tgtttgtaat gagatttttg atcgtctgat    113580
     taaaccacgc tgggagatta gataatgaag cgtgcccctg tcattccaag gcataccaca    113640
     catactcaat cgactgaaga tacttcatca ccggcgccgg ccgcgccgat ggtggattca    113700
     ttaattgcgc gcgtgggtgc tatggcccgc ggtaatgcta tctctcttcc ggtatgtgga    113760
     cgggaagtaa aatttaccct tgaggtgctc cggggagact ctgttgagag cgcctcacgc    113820
     gtatggtcag gaaatgagcg tgatcaggaa ctacttaccg aagatgctct ggatgatctc    113880
     ataccttcat ttttactgac cggtcagcag actccagctt tcggccgccg ggtttctgat    113940
     gtcatagaaa ttgcagacgg cagccgtcgc cgtaaagccg caatcctgac ggaaagtgat    114000
     tatcgcgttc tggttggtga actggacgat gagcagatgg ctgcattgtc ccggctgggt    114060
     aacgattatc ggccgacgag tgcttatgaa cgtggcctgc gttatacaag ccggctgcag    114120
     aatgagtttg caggaaatat ttctgcgctt gccgatgcgg aaaacatttc tcgtaagatc    114180
     attacccgct gtattaatac ggccaaactg cctaaatccg ttgttgccct gtttgcacat    114240
     cctggagaac tgtctgcccg gtcaggtgaa gcccttcaga aggcttttgc agataaagaa    114300
     gaattactga agcagcaggc tgagactctc cacgatcaga agaaagcggg actaatcttt    114360
     gaagctgaag aggtcattag tcttttaaca tccgtactga aacaatctcc cgcatcaaga    114420
     gttaatctga gctcacgtca tcagtttgct ccaggggcaa cagcattgta taagggcgat    114480
     aaaatggtgc ttaacctgga taagtcccgc attcctgcgg agtgtataga gaaaatagaa    114540
     gccattctta aggagcttga gaaaccagga gtctaatgcg gacacgcttt agtctacggt    114600
     tatctccctt tacttcattt cctttctcac aggccagaaa acataactgg cctgaatatt    114660
     ctctctggga ccacggtccc acctgcatcg tcggtcaggt tatctgcctg ggaccacggt    114720
     ctcacctgcg tcatcggtca ggttatctgc ctgggaccac ggtcccacct gcgtcgtcgg    114780
     tcaggttatc tgtctgggac cacggtccca cctgcgtcat ctgtcaggta atctgtctgg    114840
     gaccacggtc ccacctgcgt catctgtcag gtaatctgtc tgggaccacg gtcccacctg    114900
     cgtcatcggt caggttatct gactgggacc acgggcccac ctgcgtcgtc ggtcaggtta    114960
     tctgcctggg accacggtcc cacctgcgtc atcggtcagc ttatctgtct gggaccacgg    115020
     tctcacctgc gtcatcggtc agcttatctg tctgggacca cggtcccacc tgcgtcgtcg    115080
     gtcaggttat ctgtctggga ccacggtccc acctgcgtca tcggtcaggt aatctgcctg    115140
     ggaccacggt cccacctgta tcgccggtca ggttatctcc ctgggaccac ggtcccacct    115200
     gcgtcatcgg tcaggttatc tgcctgggac catggtccca cctgcgtcgt cggtcagctt    115260
     atctgcctgg gaccacggtc ccacctgcgt catctgtcag cttatctgcc tgggaccacg    115320
     gtcccacctg catcgtcggc acattattag ttagggataa cggttcaatc aatgcctgtc    115380
     acgaacaggt attggcttgt cgccagcaac ccgatgagcg gagtaatcac gcagcagggc    115440
     ggctattaca ggcgatggtg aaagctctat tgggatctga acgaagcatg ttgagtgaaa    115500
     tttgcaaaat ttcgcagagt atgcagctta atctttaagt ttccgccggc atttttaaag    115560
     ccagctaccg acgctgcgcg ttggccggcc cttcgtccgg cgggtaacca gtaccggccg    115620
     atcttacgac cctggatgaa catcatcccg tcagcagcgt ctccactgtg atgtcgtttt    115680
     tcacactgtg cgatcacaaa atagaacggg gagggacaac atatggtagg aaaagcaact    115740
     gccagagaca caatatattg attatccaca gtaacggggg ataaccgtgt gggtaacata    115800
     ttgaaagtcc gtcacgttat cgtattaatt gactttgtag acaccactgg accataaaaa    115860
     gaatccgggg gaatcatcac agcgcataaa cataccgttt gtttttgggg gacggcaaga    115920
     ggcccctgtt atccagtgcg ccgtaaaacc ccgaccttca gggcggggat ataaggcgcg    115980
     gttttccgac taacttcggt taaaatagcc tcatgaaacg acttcaagcc ttcaaattcc    116040
     agttaagacc gaatggtcag caggagcgcg atatgcggcg cttcgctggg gcttgtcgct    116100
     tcgtctttaa ccgtgcgctg gcgcttcaaa acgaaaacca tgaagcgggg aacaaatatg    116160
     tttcctacac caaaatggct tcatggctca ttgagtggaa atcacaccct gatacccagt    116220
     ggctaaaaga cacgccatca ctgccgttgc agcagtcgct caaagatctg gagcgcggct    116280
     acaagaattt cttccagaag cgtgcagcat tccctcgttt caagaaacgc ggccaaaacg    116340
     atgcccgcaa ggcgtgaagc tcgatcagac caacaatcgt atatcgcttc ctaagttggg    116400
     ctggatacgc tatcgcaata gccgtgaagt catcggcgaa gttaaaaacg tcacggtcat    116460
     ccagtcatgc ggcaaatggt acgttagcat ccagacggaa tacgaagtgc ctgaacaggt    116520
     tcataaggca gcgtcaatgg tcggtttgga cgccggagtc acgaaacttg ccacgctttc    116580
     tgatggcacc gtataccagc cagtcaacag cttcaaagca agccagcgta agctggctat    116640
     gcttcaacgg cagttaagcc gcaaagttaa attcagtgcc agttggcaga aacagaagaa    116700
     aaaaatccag cgtctgcact cacacattgc caatatccgg cgcgactacc ttcacaaagt    116760
     caccagtgaa atcagcaaaa accacgcgat gatcgtcatt gaggacttga aggtcagtaa    116820
     catgtcgaaa tcggcaaaag gtacggcaga gcggcccgga cgaaacatca gagccaaatc    116880
     aggcttaaac cgttcgatac tggatcaggg ctggtacgaa atgcgcagac agcttgagta    116940
     caagcagctc tggcgtggtg gtcaggtact ggcgatacct ccggcataca caagccagcg    117000
     ttgtgcctgc tgtggtcata cggcgaaaga aaaccgtcaa acgcaaagta aattcgtgtg    117060
     tcaggtatgc ggctataccg agaacgccga tatcaacgga gcacgtaaca ttttagcggc    117120
     aggacatgcc gtgcttgcct gtggagggat gatacagtcg ggccgcccgc tgaagcagga    117180
     acccaccgag gcgagtcagg ctccggtctg aacgctgtag gaatcctcgc ccttcagggc    117240
     ggggaggatg tcaacaattg caccaggtct ttttcgtcca gcgcatcgag catttgttca    117300
     tacagagccg cgggcacaca ataaaaaaca gggcggttgc ggtcaataat cgcgaccggg    117360
     tagccgccgc cggcactggc ggtggccacc ggatcgtttt taagttctca gacgctggca    117420
     gtcacatcac acagaatgat gtttgtcatg gttccctcct gagacaagtc atctgtatga    117480
     tcggtaaagt aagctctggc ggcaagtccc gtctgtcatt tcgacggtca gaaacgggca    117540
     accggcagct ccttccagcg ggtggtatat gccggtgaca gcatctcccg tttcatctgc    117600
     cagtccggcg caataccccg tccggcaaac cagactttcc cgagtccgga atgattaatg    117660
     ccgtcgagta ccttcatcag cgcatcgctg tgcggccgtg gctgcacgtc atcgaacaga    117720
     ttcagctgcg cgacgccgtt cggactgaaa tcattgagca ttatccccgc ttttgcgtag    117780
     cggtggccat cgagccagat cctgtccaga gacctgaccg ctgccgcgat aatgtcccgg    117840
     gtgtcacggg taggggtgtt cagtttttcc gtggccacgt taccgtaata cggctcatta    117900
     accgcaaaag gggatgtctt gatgaaggtg ctgatatgcc ggcagtactg tcgctcaccg    117960
     cgcaactttt ccgacgcgcg ctcggcatac tggcagacgg cctggcgcat ttcttcgtag    118020
     gtggtgatcc gctgcccgaa gctacgactg cagacaatct gctgtttcgg cggcggcgct    118080
     tcctccagtg aaatgcaact ctcgccgttc agctcacgta ccgtgcgctc cagcactacg    118140
     ttgaagtttt tccggataaa tgtggggttc gtcagcgaca gctgcagggc ggtggtgatc    118200
     cccataacgt gcagcttttt cgctatccgg ttccccacgc cccagatttc ttccaccggc    118260
     tgcaggctga gtaattttgc cgttctgcgt ggattttcgg gcgacagcgc cagtaccccc    118320
     ctgaattgtg gccattcctt tgacgcccac tgcgccgatt tggccagtgt ttttgtggcg    118380
     ccgaagccga caccgatcgt cagtccggtt ccactgagaa catgcccacg cagctgcctg    118440
     ccaaaatcct ccagatccat acagtggcca attccccggg catccaggaa acattcgtca    118500
     attgagtatt gttcgacgcg gggcgacagc tcttccagca gggcgaccac acggttactc    118560
     aggctcgcgt agagctcgta gttgctggaa aaaacgtaca atttttcagg aaactgcgcc    118620
     tctttgagct ggaaccaggg ggttcccatc tttataccca gcagtttggc ttcagcactc    118680
     cgggcaataa cgcagccatc gttgttactg agaacgacga caggtttgcc gcgcaaatcc    118740
     ggcctgaaaa ccttctcgca actggcgtag aaggagttga cgtcagccag ggcgaacatc    118800
     agtctgccct ccgggtttta tgaatgaagg ctgtcaccac gccgaaaatt tgcagcgttt    118860
     ccggatccgg gtacagggaa gggaagtccg ggttcatcgc ctgcagggct ggccgcggcg    118920
     tcagaagcag gcgttttacc gtaaattcac cctcaatttc cgcgataaca atatccccgt    118980
     gccgcggctg ttctgcttta tccacgacca acagatcgcc ggaatagagg ccaatatcag    119040
     tcattgagtt gccaatcgcc ctgacaaaat aggtggagtg gcgccggtga atgcagtact    119100
     cattcagatc cagttcagac tcagtgtagt ctgatgccgg tgacggaaaa cccgcagggc    119160
     atcgctctgt gaacaaagga atttttacta tgctggcttc tgatactgca ggaatgaact    119220
     tcatcgtttt tttcctcgct taaagctgta tatatataca gtgtgcgccg ggagaccggt    119280
     tagagatcaa ggggtgaaag tccccgacca ttgaaggacc agcaatccac aaggtccccg    119340
     agtcatgcgt tgcataccgc gaggtatggg gcgaagcgtt gacaggggtg ttgacaggcc    119400
     agccattgag ccacgaaatg tatattaaat taccgggtgc cgacgttgta ctgttaacgg    119460
     aaggcaacat catagggtgc gatactgcga gtgccacatg gacccggcgg ggtctgagac    119520
     cctggcatgt caatacgatc tctacgcggg aaccgggaga tctcccctct gaccatctgc    119580
     cagtgtcgga gatggcccgc accgggaaga cgaggagtca tagccggtga tgtacggaga    119640
     ggagaagtcg gactcgctca tagtagcggc gaagcaggcg aacaacccga aaggagcgga    119700
     gtcagtggag cgaaggagcg gggccaaggg gaacgcggaa cagccacaca tgcgccggac    119760
     acagagccgg gaaagcatgt cacagaggct gtcacgcgtg cgggaagctg cgaagcagcg    119820
     gaagaaagaa cggtttacag cattgttcca cctgctgaca gtcgaagcac tggaagccgc    119880
     attcctctcc ctgagcagga aagcggccgc cggagtggat ggcatcaggt ggatggacta    119940
     cgccggaaac atgaagaaca acataacaga tctgcaccgg aggctacatc agggcagcta    120000
     cagggcgcag cccggcaggc gtcactacat cccaaaagcg gatggaaaac aacgcccgct    120060
     cggcatcgcc tcgctggagg acaagatcgt ccagtatgcg ctggtgaaaa tcctgaacgc    120120
     agtctatgaa aacgacttta tggggttctc atacgggttc agacccgggc gaagccagca    120180
     cgatgcactg gacgcactgg ccacagggct ggtacgcact aacgtaaact gggtactgga    120240
     tgccgacatc agtcagttct tcgacagggt gagccacgaa tggctgatca ggttcacaga    120300
     gcatcggatc ggcgaccgga gggtaatcag gctcatacgt aagtggctca cagccgggac    120360
     gtcggaggag ggtcaatggc gagcaacgga ggaaggcacc ccacagggtg cggtcatctc    120420
     accgctgctg gcaaacatat acctccacta cgtcttcgat ctgtgggcgc atcagtggcg    120480
     acgtcgctat gccacaggca atgtggtaat ggtcagatac gccgatgaca tcgtcatcgg    120540
     gttcgacaaa cgatacgatg cccggcgctt ccgtatagcc atgcagcgca gactgaggga    120600
     gttcggactc acggttcacc cggagaaaac ccgtctgatg gagttcggcc gcttcgctgc    120660
     cgaaaaccgt gccatcaggg gaaaaggcaa accagaaacg ttcaacttcc tcgggttcac    120720
     gcacatcagc gggaaagatc gcaacggcag gttcatgctg atacgaaaga cccgccggga    120780
     tcggatgacg gcaactctga aagccatcaa agacggtctg cgaaggcgct ggcattactc    120840
     aatccccgaa cagggaaaat ggctcaggag agtggttcag ggatacctga actatcactc    120900
     ggtaccgggc aacttcccca ccatgcagaa gttcaggaca cacgtaacaa acctctggcg    120960
     ccgggcgctc aggcgcagga gccagaagga tgatacgacc tggacgaaag caaacaaact    121020
     ggcagccgca tggctaccaa gggttcgggt tcttcatcca tggcctgtgg agcggttcac    121080
     cgccagacac ccgaggcagg agcccggtgc gtaaatcgcg cacgccggga tctgtgcggg    121140
     gggtatccgg taacgggtat ccctaccgcg acattatttt gcggaggccg tttttattca    121200
     agtcatcttg ttgccgttgt ctgtaaccat ttgctgttcc tgcaaaaaca gggaaatttc    121260
     agaaggatcg ctgccagtcc ggagaatcgt tatctaataa aatgtaatat actgaagtac    121320
     agtgcattta ttctgagtgg agtgattatg aatacgggtt taaggcaggt tctgcgatat    121380
     gcaggcgtcc cggttgacgc cgctgaaccg gtgcgccggc aattcggtag ccgcctgatt    121440
     ttaatcgtga cggttgctct tcttccgctg ttgattgttg acgtccctct gtggctattt    121500
     gtgctctctc agattatctg gggaagcggt atgtacattg gtatctccgt ggccagtgat    121560
     aaaccagatc gccgataagc tcagaacgag aggtctcccg ggccgcctgg tgacgggcag    121620
     ctgataaact ggcgccatgc catcaacacc ggataaggac gtcgccggct tgtctttgcc    121680
     gccggctccg ctttgtccgg ccccctccct ccggtctgcg gcctttatac gcagccatcg    121740
     cgtcgcgatg ccagcttctg cttttctccc tgcgctcgta aaccgcgaca ggggacctca    121800
     tgttgtatct cctgcatcgc ttcgggtagt gccgtgcctt cactttagcc cggccgctgc    121860
     agatgcaagg gttcgctggc gccgccatcc tcgcccggtc gcagtttttt tatgaagctc    121920
     gccgttcttc ccgtcgtttt ctcgctcagg tttcgctcta aaaccgtcca gaccagcttc    121980
     gtgctttatc tgcgctgcgg cctccggtgt cgcccttgca tcttccgctt tccgccgggc    122040
     tgtcgtgtcg gcacggcaca acccggtgcc gcaatcttat gaacctgtgg aggttgctat    122100
     gtatcatgcc cgtcaaacca tgctgaatgt agaggagtcc gaccgtctct cgttcctgcc    122160
     ggatctgttt ggtaacgatt ttctggccgg agagatgcag gtctatgcgc tcgctgagaa    122220
     acacatcacc gattactgcg gaggcttctg gcatttcatc cgtattccgg agggcggcgg    122280
     ctacatgatg cctgacggtg accgtttcca tctgactaac ccggataact ggtttgatcg    122340
     gtccgtcagc gcggatgcgg ccggagttat cattacggcg ctggcgatca accgccgtat    122400
     ctggctgcac catgaacgcg gtgatgctgc cctgacacgc cacctgatgc tgcgggaatc    122460
     gcagctgtgg aatttcattg actctcatga cgaatgcgct gctatttacg cggctctgga    122520
     ctgatactat atcggggcgc ccgacgcccc gtttaaggtc tgagacggca cgatctgtga    122580
     ggagcttacc cggctttgca gatcggtgcg gccgcgcgaa aatcctggca ggcttcgcct    122640
     gccggtgagg cggttcgcca cacctgcggc gctgcgtact ggcctcacct caacaggtcg    122700
     ccagttaagg attaagagcg taatatctgc gtaccttttc ttcttttgct gaatttgcgt    122760
     atgtcgcagt ggaatattgc ctctttttca aaggaggagc aggacaaagt tgccgtcgat    122820
     aaggtggctg ctgatgttgc ctggcaggag cgcatgaaca agcccgtcat gccggaactt    122880
     gttgaacggg aacagcctga acacctgcgc gaatatttcc atgaacggtt ccgcgtacat    122940
     cgactgaaca gtcagcagct gccgcgcgca aatgcacccg aatataataa accgggcgat    123000
     gatcagcaga attgattttc ttactcagtg tgtccaggga gggtaatctg tgcgtatgtc    123060
     tctgatgttt gctgccgtga cgcttttaac aggtattaac ctgtttttta ttccgtttca    123120
     gcctgttccg gctctgtggg gggctatcct ggccgttgct tttgttctga ttaatgtcgt    123180
     ggcggataag ctgcgcctct ggagtggtat tgcgtggatt atcgttgccg gcatcatcat    123240
     aacgctgatg ctgaagggga aagagccggg tgacgaattt cgtgtcctga tcaccgtttt    123300
     cgctttcctg gcttcaatct ggtatagcgt tgcgcagttc aggaaggaaa ataagctccg    123360
     ttcctgacgc cccgtctggt atgccgccgg tttatcatgg cttctttccg gcggcatgaa    123420
     aaacatattc tctccagcct gcatctttac gtttccggct tgctccctgc tgtctgtctg    123480
     ctttctcttc ttcttcctgc tgtgatgtct ctttttaacc cttaaaggct ttaaaagcac    123540
     acccgcactg gacaccttcg gctcccggcc agctgcgctg tccagtcttc gagccacact    123600
     ccgctaaccg cgaaaagacg cggtaagctc cgccgaaccc gctacgcggt ttcgggcctg    123660
     ccggctagtg tctgatgtct gaggtcaggg tcaacggcag cgcttgctgc gaccgttccg    123720
     gccgcgccgc tttcaccgtg ccggcgaagg actgccggca ctctgcaggg caacgccgtt    123780
     tcgcgcccgc gctcttcgtc gttgcggcgg gtgcctgctc ctttcccctg gcgccgtatc    123840
     acccgtttga gtccattcgc cggggctgag acaagcacaa cccgtcttgc tgtccagggg    123900
     acggcagagc ctttcgcaat aaatttttcc cggccattcc gctgccgctt cattagaccg    123960
     aaaaaaattt cccgctcacc cccggacatc tgcaccgggc cgtgctcgtt tacgccctcg    124020
     cggcgaacgg ctctcaaacg ggtgaagtta ataccagggg gcaggttcag caggtccccg    124080
     cacaaagtca aaaccgcggc cccggcaact caacgggtga tgttctttaa aaatcaggaa    124140
     aaagaaaaat gcaggatcct tcattgcgaa cgtatcggat cgcatttctg ggacgcaatg    124200
     ccagcggcaa tctgccgatg tttacccggg tgcaggccac gaccggaaaa cgggcgataa    124260
     aagcgtttat tgaacgctgt gaacccgtca aaggctggtt tctgggcgca cctgaagaca    124320
     ttaccgatca agttaagaag gaggaagaag aggcgggaag caaaccgcag gtatgaaaaa    124380
     agcagggtaa accctgcttc tcccacgccg taaaaatcgc acgaacggtt tttccggctt    124440
     cgttaactac cataaggagt caactttatg atcgtttcta ttttttcacc ttccgcaggc    124500
     gctgtaaagc cccgtcgtca ttcgcgcatt ctgcgcgcag atatcaccgc acctgagatt    124560
     gatcccgctc taagagcttt cgggcgtcat atcgccagaa gtcaccgcaa agggcgcggt    124620
     gtccacatcc ccgcgatgaa aaattccgcc ctcgggcagg tactccgcac gctggaactg    124680
     aaacgcgcat ttaactgatg aggtgagccg ccccgcgagg ggcggcaact gcaggaagga    124740
     gaaaacacaa tgacaccgac taccgcacag atcatgacgg aaaataccgt cagccagact    124800
     taccgggcaa cctattcacc agatgataat aaattgcgac tttacgcatc attacggctc    124860
     gatgaagaaa cgtattccct gatcaacaaa gcaggctttc gctgggcgcc caaacaggaa    124920
     ctttttgtgg cgccagcctg gacgccgggg cgggaggatg tcctgctttc cctcgccggt    124980
     gatatcgagg acgaggacag caccctgttt gatcgccagg agcagcgcgc cgggcggttc    125040
     agtgactaca gtgaccggcg ggcggttgaa tcggagcagg cgcttgcgca tgttgattcg    125100
     ctggcatcgg ctgtcccgct gggacagccg atcctggtag gccaccacag cgagcgccgc    125160
     gcgcgccggc atgcgcagaa aattgagaac ggcatgaaac gtgcggtgat gctgttcgag    125220
     cgcgccgaat actgggaaca gcgcgcgcag gcctctctgc ggcacgcgaa atacaaggag    125280
     cgtccggatg tgcgttaccg ccgtatcaaa aaaatcgagg cggaattacg caagtcccaa    125340
     aagcacatta cccggtctga agagtatatg acgatgtggc gtgcgcagac gctcgatctg    125400
     aaaatggcgt tactggtcag taattatgac catatttatg cctgcttcac gctcgacaaa    125460
     tacccccgcc cggcagagaa aagccagtat gagggctcga tgtctctcca ttctgccctg    125520
     tctgaggaga tcattacttt tgaacaggcg cgtgatattg cgatccgctg tcatgagcgc    125580
     acgattagcc accaacagcg ctgggttaat cattaccaga accgcctggc ctacgaacgc    125640
     gcgatgctca atgaaaatgg tggcgttgtc acccgaacac aggaatttga accaggcggg    125700
     caggtactga gccggggaga atggttaacc attctccggg ttaaccggag taagggggag    125760
     gtgagttcag tcgaaacgcc cggttatcgc tttctgggct acagcggcac gatgaaactc    125820
     acgcccgacc gtatcacgga ctacaaagcc ccgacagcgg aggaagccag cgacgcgaag    125880
     aaagcggcga agcgcccacc gatcgtcaat tatccggggg aagggttccg ggaaatgaca    125940
     aaagccgagt gggcgaaatt acccgctgat tataaaggcg tgcggggtgc tgcagaaacc    126000
     gaaacacacg gcgcctaccg cttccgccgg tgcatgacgc acggttgtac gctcgtgaat    126060
     gtgtatatca cagacatgaa aaccgttgaa attccgaaaa aataacagga aggctccccg    126120
     gcatcttgcc ggggaggtca gggagtacat tcatgcatca tggccttaaa caccgtattc    126180
     aggcgatgcg ggacaaactg gaagggcgcg cccctgtcgc tgaaattcag ggtagttcgc    126240
     agctttttgt caccccctcc ccggaatgtc gccggctggt tgagctggct gatgtccggg    126300
     aaaccgatcg cattctggaa cccagcgccg gaacgggcgc catactgcag gcgatcaggg    126360
     atgcagttcc ccgggcgaag tgtgacgccg tggagctgca cgccgggtta gcccgtcacc    126420
     tgcaggcgca tttcccggag gtccggatct ggtgcggaga ttttctcgaa tatcatccgg    126480
     agcgccggta tacacgaatt atcatgaatc cgccgtttca tcgcggtgat gatatccggc    126540
     atatccggcg ggcattaact ctgcttgagc ctggcgggat tctgactgga atatgtctgg    126600
     acggcccgcg tcagcaaaag gcgctggagt ccctggcgga cgtctgggag ccgttgccgc    126660
     ggggaacatt cacgtatacc caggtagcga ccgccatcct cagaataacc gtctgatgac    126720
     acgttaagcc ggcggggcac ctgtccccgt ctggccgcgc ctcgaaagac cgcgcgcctg    126780
     cggcgccggg aaaaccgggc cgcgctgacg cgccgcccgc atttcctttc cgcgtcttcc    126840
     ctgtttgctg cctgctgtct gtctgcttcc tcttcttctc cctgctgtga tgcctctttt    126900
     taacccttaa aggctttaaa aacataccca cactggacac cttcggctcc cggccagctg    126960
     cgctgtccgg tcgtcgagcc acactccgct aaccgcgaaa agacgcggta agctccgccg    127020
     aacccgctac gcggtttcgg gcctgacggc tagtgtctga tgtctgaggt cagggtcaac    127080
     agcagcgctt gctgcgaccg ttccggtcgc gccgctttca ccgtgccggc gataaagctg    127140
     ccggcactct gcagggcaac gccgtttcgc gcccgcgctc ttcgtcgttg cggcgggtgc    127200
     ctgctccttt cccctggtgc cgtatcaccc gtttgagtcc attcgcctgg gctgagacaa    127260
     ccacagtcgc catcatccgt ccagggtaaa tggcacgcgg taaaccgcgc cctggacagc    127320
     tgccgtcgcc cgtgctcgtt tacgcccttg cggcgaacgg ctctcaaacg ggtgaaggtt    127380
     ttatccaggg ggcaggttca gcaggtcccc gcacaaagtt aaaaccgcgg ccccggcaac    127440
     tcaacgggtg atggttttaa aaggcaaaac aacggattaa ggagattcat catggcagca    127500
     cgtggcgtta acaaagtcat tctggttgga catctgggac aggacccgga agtgcgttac    127560
     atgcccaacg ggggcgcagt ggccaatctg acgctggcca cgtctgaaac atggcgtgac    127620
     aagcagacgg gagagatgcg cgaaaacacc gagtggcacc gtgttgtcat gttcggcaag    127680
     ctcgcggaag tggcgggcga atacctgcgt aaaggcgcac aggcctacat cgagggccaa    127740
     ctgcgcaccc gcaactggca ggacgatgcc ggagtcacgc gctacgtcac cgaggtgctg    127800
     gtcgggcaga acggcaccct gcagatgctc ggcggccgcc gtgaatccgg agtgcctgag    127860
     agcgccgcgc agccgcagaa tcctgccacc ccggcacaac ctgctcaggc cgcagctaaa    127920
     tccccgaaag cgaagggcgg taagaaaggc cgtcaggatg ccgccccgtc tcagcaaccg    127980
     cctcagcctc tcccgaatga tttcccacca atggatgatg acgcgccctt ttaaaccacg    128040
     atgaagacgc cccgttcagg cggggcagaa aaggagaaac acatggacca taacgttttg    128100
     tccccgcttg tatccctgcc ggatggcacg tttacccgcg agcaggctca ggttgtcgca    128160
     gcgcagtatc agaatgtggc gattgaagat gaccagggga cccattttcg ccttgtcgtc    128220
     cgtcataagg atgacggcag catgatctgg cgcgtatgga attttgaacc gggcggcgag    128280
     gacataatga accgctacat ccgggactac ggagtacgca aaacgaagta agcagtaaga    128340
     agaaggccgg acaggtgggc tgtccggcag acattcatca atagctaaga ggtatcaatt    128400
     atgtctgcaa cagagtctaa ggtaaaaact gcaccgaaaa ccagcaaaaa aacacttaag    128460
     tctgccgagg ctgaggcgct taaagtggct ctcgatgccg cacaggtcga gtatgtcccg    128520
     gtgtctgcac tggtgaagtc tcccctgaac gtcaggacca ttccctatcc ggcggagaaa    128580
     gtctgttcaa tggctgattc cattgaagcc attggcctgt tgcagaatct ggtcgtgcat    128640
     aacctcccgg atggtcgctg tggtgtggct gccggtggtc gtcgcctgaa agcgctgcag    128700
     ctcctgcaga gtgaaaaccg tatcgatgcc ggatatcagg tgatggtgaa aaaggtacct    128760
     gatgaactgg ctgttgcggc atcaatggca gaaaacgaac agcagatggc aatgcatccg    128820
     tctgaacaga tcgccgggtt ccgcacactg gcagagcagg ggaaaacccc cgcgcagatt    128880
     ggcgatttgc tggggttcgg tacgcgtcat gttcagcgca tgttgaaact gaccgaactg    128940
     gctcccgaaa ttctggcggc gctggcgaag gatgaaatca ccaccgaaca ctgccaggca    129000
     ctggcgctcg aaagcgatca gaaacgccag gtggaagtgc tggaatccgc ccgcaaacgg    129060
     tcctggaata atgaagtatc agtttcctcg atccgtaacc tcattacctc agaagaggtt    129120
     tccacaaacg gcgacaaatt ccgctttgtg ggagaggccg cattcagtcc ggatgaaatc    129180
     cgggttgatc tcttcagcag cgaaaaccgc ggctatgtca aaagtgcatc gctcgatacc    129240
     gccctgctgg aaaaactgca gaacatcgcg gagcacctcc gcgaagcgga aggctggtca    129300
     tggtgtgatg gtcgtcttga cccgatttca cactacggga aggacactaa aatctggcgc    129360
     ctgcatgctg tcccgcctgt ggaatatacc gaagccgaat cagaacgtct tgcagagttg    129420
     gaagctctgg aagctaagta tgaagacgag aaccccagcg tgaatgatga cgtcgtggcc    129480
     ggggctctgg aagccgtctg ggaagaacag cagaccatcg cgcaccgggc aaaacaccgg    129540
     gcatggacgg atgaaatgaa gcaatctgcc ggagtggtgg tttcctggac tggccaggag    129600
     gtgaaagtac agcgcggtgt ggtgctgtgc gccgatgaaa aaatggagga gaaggatgca    129660
     tccaccgatc aggcacctga aaaagtcgat ccgctggacg ccgtcagtgt cccgttgctg    129720
     acccgccttt cttctgaacg cacactggcg gttcaggcgg ccctgttgca gcagccgcag    129780
     aaagccgtcg cgctgatggt ctggaaaatg tgtaactcgg ttttccatac cacaacgtcc    129840
     gtcaaagagc cgttctgcat tagcgtgagt gtgtcgcatt acgcgctgac ccgtgaagca    129900
     cctgacggtg aaaacagcgt tgcgtttcag gccatccagt cagaaaaaga acgtcttgaa    129960
     gccctgctgc cggaaaactg gcgaaaggat atgaccacct tctttacgct cgatggcgca    130020
     accctgatgg cactgatggc tttctgcacc gcctgttcca tagatggtgt acagggcaag    130080
     gatgaatttg gtcgtaaaca ccagagttcg ctggatgggg tggaaaacgc cattcagttt    130140
     gaccttcgtg actggtggaa accgacggct gataaccttt tctcgcacat gaagctgcca    130200
     cacattgtac aggcactctc tcagaccgga ctggctggcg cagcacagga cgccgcgaag    130260
     atgaagaaaa aggatgccgc tgaacatgca gagcacttcc tctcaaaaat ccgttgggtt    130320
     ccggaatgga tgaccagtgc tgacaaccag aaacagcttg ccgcaaagtc tgaactcagt    130380
     ctggcaacaa gtcagaacga taccgacgtt gatgccggcg accgtcaccg accataacaa    130440
     cccggcctgc gccgcctgat aacggagacg ccgccctgcg gggcggcgat aaggagactg    130500
     aaaatgaaaa cgttactgac tctggatgtc ctgaaaacca tgtcttctga tgagctggaa    130560
     gactaccgcg ccgccggtga agactttcgc cgggagctga gtcacgctgt catgcgcgat    130620
     ctgacctcac cgtccggctg gtccgtgaat gccgaatacc ggtgcgaatt tggcggcttc    130680
     tttcctgtcc agatccgttt taccccccct catggtcact ttgatgtggc ggtatgcagt    130740
     tcgggggagc tgaatcctcg ctggatagtg gtctttgtta cccgtgacgg tcagccgttc    130800
     tctgtcgttc gcgtgatgga tgcattcaac cctgaactca tcacccatac tctggatctc    130860
     atcgagtgtc ttgacgccgg tggctactcg tttgccagca tcatcagcac gctgtcacag    130920
     gagggcgcac aatgatcccg tcatccagtg ctcttgtatc cctgaaacca gcccgtcagg    130980
     cagcgctgca ggccatcatg acggtggaag aggctcgcca gcgcggcgca cgtctgccat    131040
     cgatgccaca cgtccggaca ttcctgcgcc tgctgacagg ctgtagccgg attaacagtg    131100
     acgttgcccg ccgtattcct ggcattcacc gtgatccaaa agaccgcctt tccagcctga    131160
     aacaggtaga agaggcgctg gatatgctta tctccagcca cggggaatac tgtccgctgc    131220
     cgctgacaat ggatgtgcag gctgaaaatt ttccggaagt ccttcatacc cgaacagtac    131280
     gcaggctaaa acgtcaggac tttgccttca cccgaaaaat gcgccgtgaa gcccgtcagg    131340
     tcgagcagtc ctggttactg cgtcagaacc tgctgggaca ggctgtcaca gaactgaatt    131400
     ttcagtcacc ggaaaccgtc tgcacctggt acacccggtg gagcgacgag tttgacgcgg    131460
     cagagcttgc agcaccgttc tggcgctggc agtcgcgatt cgcatcgctg aaggaacttg    131520
     actggcttcg catcagcggt gagccgctgt atgcagtgat gtacgaaatt ccgtttattg    131580
     tccgggaaac acctgagcat attcgtgttg ctgaacgctg gcaggtgcca aataagctgg    131640
     ctgatcggag tggtgtatga agtggcgcta ttctctgcgc tggaaactgc cgcacaggcc    131700
     ctgcccaggt ccacgggaac tgatttccgt tgtcgtggag gctgggcagg cggcacctga    131760
     agaggtgatg tcacgctggg tggctggctc aggttacgct gtatgcgtgg attttctcgg    131820
     ccagaaacag atccaacgct ggagcgatga acggaaagca gcggtgagaa ggcgcaacat    131880
     gcaggcacgt attaatcgtg ttgccccttt gtttgccgac gagttaatcg agcgtgaact    131940
     ggctgcgcgt ccggagtatt tcaatggcaa gtccgcccga tgaataagta caatgctgtc    132000
     tgacaactca gatggccaaa tacaaggaaa gcagaactat gaggtactgg ttgctcgtta    132060
     tcttaatgaa cgtgctgttc tattttatcg tgaagcatgt tgctccggaa tggtatggtt    132120
     ccccttgtta ttatgcaggc caaatcatct gcacactaat agctgcggtc atcacatggc    132180
     gtgatccgcc tgactggtta gatggaatcc tgctcggcgt aataaaattc ggcgttctga    132240
     ttgccgggat tatattcttt gtctggggca tcgggtacaa gctggcattc tgggggcaac    132300
     atgatcctaa taccatatat gcaagtgcaa acgatgttat tttgcctaat cttgcgctgg    132360
     gcacgggcgt cttgatcgcg ggatgggtat acattagata tttaaagcgc taagcagcat    132420
     aaagcgtgga tatacctggt aagaaatagc accggcccgg tataatcgac gtggcgcttg    132480
     aggctttttg cctcatgacg tgaaggtggt ttgttaccgt gttgtgtggc agaaagcaga    132540
     aagccccgta gttaattttc attaacccac gaggcccact gaatgtctag tcaacaccag    132600
     tatggcctct taccgtgcaa tttgcaagga ggtgtatggg tccaccacat attgcaattt    132660
     ttactctcac gtaaaatata gtccactggc gtcatcagtt cgagtgattt atgtggcctt    132720
     ttgctgttat acagcaccag atattcagcc attctttgat taaacaaatt caggtcctca    132780
     aaaagcaaca attcattgaa ttcaataaat tgttctctaa gtgtccggtt aaatcgctca    132840
     caggtcgcat tcattttcgg tgtgtacgga taggtccaga tgtgtttaat cgaggcttcc    132900
     tgtagcgttt tatcaaagtt accgaggaac tccttaccgt tgtcagtgac aacttgtctg    132960
     atagcgacag gaaagagctt tgtggccttg ctgaagaaat ggctggtaat atcgctgttg    133020
     agtgaaggga ccgccagggc cagcgcatag tcgctgtgct cgtcgatcat ggtaatgata    133080
     tagcggcgta ggtcccccat cctgagttca atcgcgtcca tccctatgag ttcgcctgtt    133140
     tttaccgggc ggtattgttt tggtcttctg ggcttcactg agcgtttttt tatcaaccgg    133200
     gctttgcccc tggcgctgag gcgtacgggg atcatccgca ttttatcgtg agcaccagca    133260
     atgattcttc caatggttga cgtgctggga caggtaaaat gccgcgcttc acaccatggt    133320
     ttcagcctga caaaaatctg ctctttgccg agattgggta actcagttct cagacgcctg    133380
     atctccttga gtacatcagg atgccagtgc cttgaacggc gaaccagagg ggctttgctt    133440
     cttggaatta gtgcttctgg accaccggtg cgcagtaacc ggcgccacca gtagagtgtt    133500
     cgcgttgata cgtcaaaagc atcagctgcg gcacggatcc cgtgcttatc ccagaagttc    133560
     agagccttca ttcttaactt cgcaatctcg ggcataagag agtgtttcat cgcataagca    133620
     gttgctcggt aatacccaaa atagccgaca ccgatatgct gcatcaacat ctggcaatcc    133680
     ctcctttagt gttctgaggc aattgcaata tctgtgtgaa cttacacagg aggagtaaac    133740
     catgaaacta ccgcgaaacg ccctggtctg gtgcgtatta atcgtctgtt taacgctctt    133800
     gatattcaca tgcctgaccc ggaaccgctt atgcgaagtc cggctaaagg acgggaacag    133860
     ggaggtcgcg gcaagcctgg cttacgaatc caacggtaag tagcaacctg gaggcgggga    133920
     atactccgcc ttttcagggc tgcgttggtc tgacatgcct gaagcgcctt tatgaagggg    133980
     ttgccggttc gccggtagcc cctttttcct gtaagcagga aaaaaaaccc gcgcgacagg    134040
     cgggcaaaaa tctttcatct acctacaaca cagattcaat gaatcgcaag tcacattaac    134100
     atccttcatt cttcgtaaca ccctgtcatc agtctgaaaa aaatagtgat tgattgtgaa    134160
     catttgggtt ctggtgataa gttctctctg tagcgtagcc ctctttacgg aggggtggaa    134220
     acagcaacgg cagagttaaa agaccacgag tcagtgaggc tgtccaaagg ctccccgggg    134280
     aaacccggcg ctacatcagg ttgcatagca cttaacccgc ccgcctgccg ggcgggtttt    134340
     ccttccggaa aagtgctgct ataacttatt cgtgcaatgc gcggtatccg ctttcctggt    134400
     aaatcagtcg cccggtctgc caggtgatac tgcagttcat tccttatatg atccagtgat    134460
     gttcgcctgc tttttaagca ggcttttttt tgttgattat gtatgacatc tgtcatacag    134520
     ttgattgcgt aatgaacaga aattgttcca cttaactcag tgaggcgaag cgcagtcgcg    134580
     ggtgagccaa aggagagcca gcatgaactt cacgataaca tcccgtaaaa ccggcgaaat    134640
     tttcagtttt tacgcacccg acagtggcgg ttatgttcac ctggagtccc cgggacattc    134700
     tggtaacacc ggcgcccaga tttgctgtgg tggagggttc atggggagta cgctttcctg    134760
     tggcgcttct gaggacgatc tggccagtgt tgcccgtaaa tggtaccgac agttcgtgag    134820
     ggagcggcgc aaattcttaa tgatgtcggg ccagtattct gaggataacc agtgaaaaaa    134880
     gagatctccc gcaacccctc tttcacacct tcgcctaagc tgcgagcaca tctgaactcc    134940
     caccgggaag gggtgactga acggctgaat aatatctttg atcgctatgc gcatctggtt    135000
     cgcgcctgtg cccttcctct cgatgacgac gaaacacagg ttctgcttaa tgtgctgaat    135060
     ggctccgttg tggaacccgc ctttattgaa tatctggctc aggaaattcg ggactcggat    135120
     gattatctgg aagggatacc cgcagctaaa tcactgtacg aaaagtgtca gtcagcgacc    135180
     tatccgcaat tgctggccac cgtcgaacgt ctggaacgat aagaaaggca taacaacact    135240
     ggaccccttc ggctcctggc cagctgcgct gtccagtcgt cgagccacac tccgccaggg    135300
     cagctgctgc gcacctgccg ggctccgccg aacccgctac gcggtttcgg gcctgacggc    135360
     tagtgtctga tgtctgaggt caaagtcaac ggcagcgctt gctgcggccg ttccggccgc    135420
     gccgctttca ccgtgccggc gaaggactgc cggcactctg cggggcaacg ccgtttcgcg    135480
     cccgcgctct tcgtcgttgc ggcgggtgcc tgctcctttc ccctggtacc cgtatcaccc    135540
     gtttgagtcc attcgccggg gctgagacaa gcacaacccg tcttgctgtc caggggacgg    135600
     cagagccttt cgcaataaat ttttcccggc cattccgctg cgcttcatta gaccgaaaaa    135660
     aatttcccgc tcacccccgg acatctgcac cgggccgtgc tcgtttacgc cctcgcggcg    135720
     aacggctctc aaacgggtga aggttatatc cagggggcag gttcagcagg tccccgcaca    135780
     aagtcaaaac cgcggccccg gcaactcaac gggtgatggt tttaaaaggc agaaaaacag    135840
     acaaaggaga aagctggatg agcacacaaa acgtcaacga aaaaccctcc accaaagaaa    135900
     gcacaaccct ccggactgac ggttttgtgc gcaacattca ttcccgaaac ccgttcgatg    135960
     ttatccgcgc cgatgtagtg cttgaacgta tcgagaaaaa ggctggtcgg agctgcggta    136020
     tgcattacga gctgtatcag gcccatctgc tgggtggtgc gctggattat ctggatgcgc    136080
     tgccgttgaa agaccgtccg gtgttaatgg gcgctgcggc aaagcgcggc tatctgctga    136140
     cgctagccga agaggaacgc gcgctggaag cacgggatgt actgatgagt gaactggcgg    136200
     caaacgactg ctgagaaata aacacggatg gcggcgtatc gctgccatcc cttaaagacc    136260
     agaggtaacg caaaatgaaa gtatacggcc atcaacactc atcagaggct ttcttccggg    136320
     aaacttcccc atcctgtttt gaaccaaaag cggaaaaggt gatcgctttt catggaaagg    136380
     atgccagtta cgcctataac gtgctggccg atctgaaagc cgcaggtgct tcatatacgc    136440
     gccggaatat catcgccgat atgttccgcc gtctgggtgt gaaatgaggt ctgggcaatg    136500
     gaacacgtga aaggaaaaat ccagcagggg gcagggaacg cctattttgc agggatgcag    136560
     tggcgcggta ttacacttgg acacgccgat gctgcagcgc ttaatcagtt tgatatcgat    136620
     atcagcaaag ctcaggcacc cgaagcacgc acctggttgc ttcagaacaa agcagaattc    136680
     atcgctctga tcctgggcat tgaagtcgta aaggtcgggt agtgagaagc cagctaactt    136740
     agctcttgag ctaagttagc ttttgagcta atatgtgcac atacggacca gagattacat    136800
     tcatgttcac agtcatcttt catgatgagg ctgaaaaaga gtttacggct ctgcctgctg    136860
     ccattcgtgc aaaaatggcc aggctactca tgaagctgga agcaaaccct cgccagctac    136920
     gcgagccaga taccaagccg cttggaaacg gccttttcga aatacgtaca atgggggcag    136980
     atatcgcccg cggaatctgg gtatatcaga gtggtgaacg tatttttcta cttcggatct    137040
     ttatcaaaaa atcgccaaaa acgcccccgg cagaaataga tcaggcactt cgcagactgg    137100
     aggaaatgca gaatgaaata taaaaccctt agccaggttc ataccgaagc aatgaacgat    137160
     catgagtaca gcgcggcatt cgaggcagaa gaagcctcgg agctacttcg ggaaacctta    137220
     gcaacatgga gaaaagaagc gggtttgacg tcggcacagg ttgcagaacg tatgggcatc    137280
     aaagcgccta ctatctcacg tatggagaag aacgcttcgc gaatgagtat tcagacgctg    137340
     gttcggtacg ccagagcctg cggtgttaac tttaaaattc agcaggtttg aatgattagc    137400
     gatgccaata aagcggtgaa tgacctggcg agtattgtcc ctctgctggg tggcagttcg    137460
     tcccgcaaag attacgaaga ggcacgtaaa ctcgttgaat atcttctgga acatgatccg    137520
     ggcagcccgc tggttgatat gctgactgcc cgcatcgatg cctgggaaga taacgcggtg    137580
     gaatttgaag aatttaatac gcgcttcgaa gcaggcaaaa acggtgtatc gttgctgcgg    137640
     gttcttatgc agcaatacgg gctttctcag tccgatttcg aaaacgagat aggtaataaa    137700
     tcgctcgtca gccggttcct cagtggtgaa cgcagtctga cctttgatca catgcgggcg    137760
     ctggcaaatc gatttcaaat cccggtctcg atgtttgttg actgattcgg gaacagagca    137820
     ggcgaagggg gcatcggtcc ccgtctggcc gcgcctcgaa agaccgcgcg cctgcggcgc    137880
     cgggaaaacc tggccgcgct gacgcgccgc ccgcatttcc tttccgcgtc ttccctgttt    137940
     gctgcctgct gtctgcctgc ttcctcttct tctccctgct gtgatgcctc tttttaaacc    138000
     ttaaaggctt taaaagcata cccacactgg acaccttcgg ctcccggcca gctgcgctgt    138060
     ccggtcgtcg agccacactc cgccagggca gctgcttcgc acccgccggg ctccgccgaa    138120
     cccgctacgc ggtttcgggc ctgacggcta gtgtctgatg tctgaggtca aagtcaacgg    138180
     cagcgcttgc tgcggccgtt ccggccgcgc cgctttcacc gtgccggcga aggactgccg    138240
     gcactctgcg gggcaacgcc gtttcgcgcc cgcgctcttc gtcgttgcgg cgggtgcctg    138300
     ctcctttccc ctggtacccg tatcacccgt ttgagtccat tcgccggggc tgagacaagc    138360
     acaacccgtc ttgctgtcca ggggacggca gagcctttcg caataaattt ttcccggcca    138420
     ttccgctgcg cttcattaga ccgaaaaaaa tttcccgctc acccccggac atctgcaccg    138480
     ggccgtgctc gtttacgccc tcgcggcgaa cggctctcaa acgggtgaag gttatatcca    138540
     gggggcaggt tcagcaggtc cccgcacaaa gtcaaaaccg cggccccggc aactcaacgg    138600
     gtgatggtta aaaaattaaa caggtgaagg agaataatat gcgtttagca tcccgatttg    138660
     gacttactca ttccattcgt caggaacgcc cactgactaa cgatgaattg gtcaaggttg    138720
     taccttctgt gttttcagaa gaaaagcata attcacgtag tgatcgctat acctatattc    138780
     caaccattac actgctggat aaattacgtg aagaaggttt ccagccattt tttgcctgtc    138840
     agtcacgagt aagggatgag gataaacggg ggcatactaa gcatatggta agacttcgcc    138900
     gtgaaggggc caataaagga acagaagtac ccgaaatcat tcttcttaac tcgcatgatg    138960
     gatcgtccag ttatcaaatg atcccgggta tgttccgttt tgtatgcaca aatggccttg    139020
     tgtgcggtac gtcgtttggt gagattcgtg tacctcataa aggtgatatt gtgggaaggg    139080
     ttatcgaagg tgcttacgaa gttttgggaa ttttcgataa aataactgaa ggcgttgatg    139140
     tcatgaagtc tattacctta accaaggaag aacagagtct gtttggacaa gctgcattaa    139200
     cctaccgata tgaagatgaa aataaatctc cggtcagtat tgaacagata attcatccgc    139260
     gccgttatga agataaaaaa tatgacatct ggactacata tcaaagggtc caggaaaatc    139320
     tgattaaagg cggtttgcct ggccgaactg aaaaagggaa aagaacaaca acccggccag    139380
     taaaagcaat tgatggtgat gtcaaactca ataaggcatt gtggttaatt gcggagaaat    139440
     tccgcactct taaaggctaa ttataagcgc cgggcagctg tccggcgttt tgatggtggg    139500
     aatacttatg tttgaattta aagctgtctg tatcagtatt tcacatatgg aagaaggtga    139560
     tatcagagtt cttcaggtgc tttcatcaac aaccaattat ctaacttgcg atagttactt    139620
     agagtggata catgatacac cttatggttg tgttataagg atgtatgatt tcaaacgcca    139680
     tcttctggcg ctaaaaagag gtggggtgtc aaaattttta cgcaaaaatc tcatactaat    139740
     gcaccgggag ggcgggtatc tgctttttca ttttgatagt gatgccgatt attatccagg    139800
     tatagatgcc gtagattttt aagaaattca agccttctta tatcagaagg ctttttagtt    139860
     catggcgatt ttctgatctt tagaagaagt tcgtttgctt gctttgatag ccgtgtagta    139920
     gtaatggatc ttcttcgcat actcgtaacg tcttgctgcc tggcgcgggg tctttttgaa    139980
     gcctgcattg tatgccccga ctgcatccca cgaaacgccc cactttttaa acgcctgagc    140040
     cagataatag gctccggtgt agatgttaag acaagcatcg ctaagaagat gatccggttt    140100
     tattccatat cgcgacagtt cgttgaaatg ctgcgagtca atttgcatca agcctgatcc    140160
     ataacccgta acaggattac gaccaatcgc atcaatttta aatcgtgatt cttgccatga    140220
     tatagcacgc aggagatccg gatcaatttt gtaatccctg ccagccatat caaagcagtc    140280
     tgctgccatt gatgacaatg gtattaaaga caggatgata ccaaacgctg ctcccttcat    140340
     gaattcccct ccgtgccaaa tcccggaata accttaaccc atccaagacc gagactcaac    140400
     atatatgcac tcctcaccac aaaatgacca caccccacgc aaaattaaaa ttttgcagat    140460
     ttattattta aaccatagag ttatggtcaa ctaaattaca ctatctttca ttatgtaata    140520
     taaatatgaa tcgcagatga atcgctaacg attcacttat aaatcgtggg tgaatcagta    140580
     acgaatcaac cttatgaaat ctagctttat tggcgaattg actctagatt caattcgtgg    140640
     tgtgattcgc cttatgaatc gagtttcaag gcggtgaatc tagattcgaa tcgcgaattg    140700
     aatcgttggt gaatcgtctg aatcggttgg ctgtaaatag tatcaagatt tctttttata    140760
     ttaagggatg gatatggcaa agatacaggc atatgttagc gatgaagttg ctgaaaaaat    140820
     taatgccatt gtggaaaaac ggaaagctga gggcgccagg gagaaagatg ttagtttttc    140880
     cagtgtgtct acgatgcttg tcgagttagg cttgagggtt tatgaagcgc aaatggaaag    140940
     gaaagaaagc ggctttaatc agatggcttt caataaggtt ttgcttgaaa cagttttgaa    141000
     gacacaattt gcaaccaaca aaattttggg aatttcttgt ttgagtccac atatctctgg    141060
     caaccaaaaa tttgagtgga gatttatgat tgataccatt ctggaagaca ctaaagaagt    141120
     ggtcgataca ttctttccag aatcagaaga tggtgaagaa gagtaaacta cacagcattc    141180
     agttataaag attattaaac taaaatataa aatataaaaa ataaaagcgg aatgatctgc    141240
     gtatttttag tgacagggaa gtgggttaca tttatcatag tttgagaggc tcaggtctca    141300
     caaaatttga gaatcgctga tgtgaagggt tggccccctt cacatcagct gcccatagaa    141360
     tcctgttgag gaggctccta tgtgttcgat ggatcgtatt gaaaacacca actgtagtca    141420
     attggatttc tttcgtgaaa tgcaattaac tgtcaacctt tctagccatc ctgcttgtat    141480
     aaggctccgt gatggatcct tttcccattt caatcattct ttcgctacaa cttttctgca    141540
     caatattaac gttaacatat ggtttaaccg tctggaaatc tcctcttctt tacgtctgtc    141600
     agctcttgac gccgaagttt actcaggcga tcgaaaaatg cttattgagg aaaatttgcc    141660
     cattaatggg aaccgatggg attttataat agaacggatg tcatttgatg gaacggagtt    141720
     cactctgtgg aagttctgtc atcttcaacg aggcggtttt ttactgtctc ctgttcgttc    141780
     tggttttata aaaaaactca acgaatttaa gaatgcactc ggttttttaa ctgatgttca    141840
     gattgagact ctggctctat attcttttgg tgcctcccac aatcagattt cagaggtttt    141900
     aaatatagcg gttggaacat cgaagaacag agttaatcgt attcttgcag ctttaccaat    141960
     ccgcacgaga gaagaggttt tttatttttt attcgccagt ggaatggcct tttcattctg    142020
     taaggttgtt acagaattaa ttggaagtcg cgttaataaa ttgttaacta aatagtgacc    142080
     ttttgtctat tgtgttaagg ggttttattt gtgagactac tcctattgaa aagtagagtg    142140
     gaggtgcaag tgaggcgaat gactactcgt ccggcattag gtccatgcgt aagttttaaa    142200
     cttgatgaag atacgcatct gaaattggta aacgccaaag agagaagcgg acgtagtaag    142260
     gctggggagg ttgtgcttag ggttaaggat caccttttac gctatccaga tttttatcca    142320
     actgtaactt ataagagtgt gagttttggt cctgttgtta tggcccgctt tgatgaggat    142380
     acaaacaaaa aactgattgc agctaaaaat aaaagtaaca gaagcaagtc gcatgaagtt    142440
     tatcttcgtc tcaaagcgca tctgttcgaa tttcctgatt tttatagctc tgaagtcgaa    142500
     gtgataagga ggtctgtatc tgaaacataa gtagtcccga aggtattacc atttaaacat    142560
     tatctattta aaaggaaata aatatgaatg ctgtattaag tgttcagggc tctgctgtcc    142620
     ctgaaaaaac caaaccatct tttatgtccc gcgttttcaa taaaaagaaa gccctgaaag    142680
     ccgctaaagt tgcgctgccg gttgctgctg tggcggcgtt cttcccggat gctgcgatgg    142740
     ccaccaccac ggcaaccgac ctgatgaagt ccggggatgc gaccgttaaa ggcacgtttg    142800
     gtaagcagtc cagcgtcgtc aaatgggtgg ttctggcaga agttgtcgcc ggcggcatca    142860
     tgtacatgat gaccaaaaac gtgaagttcc tgtttggctt cgcgattatt tccaccttta    142920
     tcaccatcgg tatgtcggtc gccggttact gacaggaagc acgtgatgac gggagacgaa    142980
     ttaaagcgat accgtttccc ggaaacactg actaaccagt cccgctggtt tggcttatat    143040
     ctcgatgaac ttatcccggc cgtgatttgt ctcggctggg gtttctggac cagcaagttc    143100
     atttttggta tggctgcagc ggcactggtt ttctggggta tcaagaaact gaaaaaaggg    143160
     cggggcagtt cctggctacg cgacctgatt tactggtatc tgccaacctc ccttcttaaa    143220
     ggtttctttc atgatgttcc ggactcctgt ttccggcagt ggattaaata aatcaacggg    143280
     gaaataacat atggaacatg gtgccagaca aaataccacc cgcgttatcg ctgtgggatt    143340
     tatcagtctg gggacactcc tgaccctcag tcttgcgacc aatattatcc agggcataaa    143400
     taattaccgt ctgcagacgg aacagaaagt ggcggtgaca ccgatgttat tccgagcccc    143460
     ctttgcggtg tctcagaacc aggctgacgc ctcttatatt gagcagctgg gcctgtcctt    143520
     tgttgccctg cgtctgaatg tcacgccgga aacggttgat gcccagcatc agcagcttct    143580
     ccggtatgta ttacccgctg cgcagaacag cctaaaggtc cagctggctg aagatgcgaa    143640
     acgcattaaa gacaataacg ttaatgccac cttttatatg acctcgatcc gtgcgtggcc    143700
     ggcagagaac cgcgtggata tccggggtga gctgaaaacg tggattgggg attccaaacc    143760
     ctacagtgaa attaaaagtt atgtcattca gttcagtcgt gtcgatggtg tcagctggct    143820
     ggcgcgtttt ggagaaataa ataatgaaaa aaattaaccc gttatttatt tcaggctgtc    143880
     tgctgttggt cgcccccgcg atgtcagcga cccttagcgg aacgctggcg ccgacagtgg    143940
     ttcccctgac caatggcggt caggcaaata ttgccgtgag taacaccgat ccgaatctgt    144000
     tcacagtacc tggagatcgc atcacggcga taaacagcct ggacggcggt ctgacaaacc    144060
     aggagcagac cgacagcggc ggcgccattc tggcgaccgt cagtaaaaaa ccattcacct    144120
     tcattgtgga aaccgaacgc ggactgaact tctccattcg tgccgtgccc cgtgcgggct    144180
     caggccggac aattcagctg gtcagcgagc tggcagggac acccggtccg gcaaaagcct    144240
     gggaggagtc gaacccctat gaatcgttac tggtttcgct gaatcgcgcc gtgcgccagg    144300
     gcagcgtacc cgatgagtat cagtctgtcc ccgtcacttc tgaagtgctg caggtgccgg    144360
     ctggtctgcg cgccactgcc gatcgggtct gggtcggtca tcacctgaaa gttgtccgtt    144420
     acagtctgga caatgtctcc ctgtcggccc gtatggttcg tgaaagcgat ttctggcagc    144480
     ccggaacacg tgccgtcatg ttcagtaccc cggcaggcct gctgactgcc ggtggtcgca    144540
     tgcagatctg ggtcacgacg tcagatgaag gagtggagcg ctgatggcca acttcaacac    144600
     gctgatcaaa cgtaagcaat atatctggct gggactcatt ctggcgggcg gcgcggcagc    144660
     cgtcggaggc gggctgtatc tgtcagatct gaacatgagc tctgatgagg aagccccggc    144720
     tcagggcgaa cccgcaccgg atatgaccgg ggtggtcgac agcagcttca acagtaaggt    144780
     ggagcagcac gcgacaacag aaatgcaggc gactgccgct gatctcaaca agcgttttga    144840
     ctccctgcag ggggaagtgg acctactgag taaggcgcga agcgctgacc agatacgtat    144900
     cgacaaactc agcagtgaca atgaagccat gcagaatcag ctgaaggcgc tgggcgtgaa    144960
     accggctgtc tctggtggcg agcccgcgcc gactcctccg tcaccgccac ccggtccgga    145020
     aggggagccg cagccagcca gttatccgcc gcaaaccggc gccgcggtac cgcctccgac    145080
     ggcattctat ccggggaatg gtatgacacc gccgccgcag gtcagctacc agtctgtacc    145140
     ggtaccaaac cagatacagc gtaaaacgtt cagttatgac aaaggaaaga aagcgaagtc    145200
     attgccgtac attccgtcgg ggagctttgc aaaaagcatg cttatcgagg gggcagatgc    145260
     caacgcgtct gttaccggga atgaatccac tgtaccgatg cagctgcgta tcaccggtcg    145320
     cgtggaaatg ccaaacagca aaacctatga cctgaccggc tgctttgtgg ggcttgaagc    145380
     ctggggtgat gtatcgagtg agcgcgccat tgtccgtacc cgtaatatca gctgtatcaa    145440
     aggtgataaa accatcgatc agcccattaa cggccacgtt tcctttatgg ggaaaaacgg    145500
     ggttaaggga gaggtggtga tgcgtaacgg aaaaatcctc ggctgggcat ggggggccgg    145560
     ttttgttgac gggattggcc agggcatgga acgcgcttca cagccggcag ttggcctggg    145620
     ggcaaccgca tctgttggcg ccggtgatgt tctgaaaatg ggtgtcggcg gtggtgcatc    145680
     taaagctgcg cagacgctga gcgagtacta catcaaaagg gctgagcagt atcacccggt    145740
     cattccgatt ggtgccggta acgaagtgac tgtcgtgttc caggatggat ttcagctgaa    145800
     aaccatcgaa gagctggaag cggaaaagaa cgggcaacag caggctcaga atcaggaggc    145860
     ggagccggca ccgcaggctg atgcacatca tcagtcaggc ggcggtatga acggattcaa    145920
     tactgacgag atgctgaaga agctgggcaa acttgatccg cgtgagttct ctccgggcgc    145980
     agcgccgcag ggggaaaata atggctaagt ctctcattac tgctgttctg tcagtactgc    146040
     gctgggctca ctggctggtt aagtgtgcgg tggtgtatcc gctggccatg atgatgttac    146100
     tggttgttct ggtgttccgg acgggaccgt acacgttcgg ccagacgctg gtgaaaaccg    146160
     tagagtccgt gcagcaggag ggatatgtca ttcaggactg cacggggccg aaagaactca    146220
     atagtgatgc ggtgaacgca ccactgcctc cgcttttaca ggaagactgc accaccgtca    146280
     ttacagatgc agcagggtat gcagcctata tcgaccagag ctatacgcat aatattctct    146340
     ggctctggct gctgatggcg gtggtgttta ccgggatcgc tgtggttttc cgtcggactc    146400
     ctgtccgcag ggggatcata cggaaaaacg gtgttgtcgt cggagagtct gttttgggtt    146460
     cttcagggct gattctagcc cgatctgatg tcagccagat taagcgtgtt tacgatgaaa    146520
     tgagtccggg tgaaggggat aaatttgttc ggacgattaa ggaaaatacc caaatcagga    146580
     tgaacctgaa gaaataaccg ataaatagcg agaaatatca tgaaggaatt aatgctgtta    146640
     attcctctgg gcagcgcttt gctcttaacc gggtgtgcgg gcacagagac cgaatttcaa    146700
     tgtaatgcca cgacgtcgga tacctgtatg acgatggaac aggcaaatga aaaagctaag    146760
     ctgaaagagg aacgcagtga cgcaaagccg gctgcggccg gattgccacg actggctgac    146820
     ggaaatttca gaacgacgtc gccaaactca tatccgctgc cgccacagcc agtaattaat    146880
     ccagggcgta atacagcgcc atctgtgacg gtgagtaata aacccgggtt cctgaatacg    146940
     gtaccggtca attatgatga cgtcctgaga acacggactg ctccggtata tatcaggcca    147000
     gttagtctta gtacttatac ttctccggcg acaattccgg gtaattatcc ccgaccatta    147060
     agaaacgggg aggagacaac gtcattgtgg atagcgccgt atgtggatgc agatgatgta    147120
     tatcaccagc cggcaacggt tctttttgtc gtaaaaccat cggcgtgggg acaacctcgc    147180
     cttaattgat ttacagcgcc attactggcg ctgcagtaag ttttcatttc tgaattaaaa    147240
     cgagtgccct ctgcgttgaa agggatgggc ggtagcgtgt gaaatgaacg tcggtaacga    147300
     aaaatgaaag gatttgaaaa atgactgact caatgaaata tctatggctg cttttgcgcg    147360
     aggattcgtc atatattttt atgttgatgc tggttattgt cactaccgta gtaatgtctt    147420
     tctttttgca gaggttgttt gtgtcctggt ggggtaagtc aatcattctg ataatgtgta    147480
     ttgtcgtcgc gattacagaa gtttttggct ttcttgagcc tgagtcaaca tacaaacaga    147540
     ttcaaaccag aaaacaggat gtcatctata cgctgaaaaa ctgcagaatc tccgcatttg    147600
     aagcgcagca ggcagggttt ctggctaaag caaaagatgc ctggtcttgc ccggatggcg    147660
     taacacggta tatggatgtg agatacagag ataaggcaga gattaataaa ctcagtacgg    147720
     agggtaagta acgttatgga tgaattattc aaatggctgc ttgctctggc ttctttattt    147780
     ttagtatatc tctttctctt tacttccagt aatgaccctg taccagaggc gctcgcgcac    147840
     cactggactc atgactgccg gttgcttgag actaatattg ataaagggtt tttctctcct    147900
     gcgcaaaatc gacttcagtg tggtgatgtt attgaaaatg tcagcaaggc tgattatgac    147960
     agagcgataa gtggcgataa gcaaacaact ctcgcagaga caatgaaaga aatattcatt    148020
     cgttaatata taaacagagg caataaagta tgcatgcctt tatttttctg gtgctgatga    148080
     cgccgagtag tggcggtggg atttgggata ttactcccat gcctaataca gatgtctgca    148140
     taaaaatgct acgggtactc gaagcacgtg gaggcagagg ttacggaagt aatacaggag    148200
     agtgcattga aattaaaaca cgcgagcctt tgaacagcgt gatggaaaca ttgagtgagg    148260
     gtgggtaaat ggctgaatct ctgttaagtt ttgatagtga tggttatgta cgactgtttt    148320
     ttgcaatggc aatcattatc tgtggttacg gctatgtaat tatgggtgtt tttataagag    148380
     atgcgcttgc ctatatttta atgttgtttg ggcttacagg tctcagtgct ttattttctt    148440
     tcatggtgtt catggataaa aacatgtggg ccggttctcc tgatttgacg ctgtcagtaa    148500
     taacgggatt ttttacagcc acagtgatct tttatatgtt ttatgtcttg atttattcct    148560
     ttgatcagat gggggcaggt gaatagtaag accgatggtc agtattaaca atctcacgtt    148620
     atttgaaagt atgcagcata aggaataaga aagtgaaaac gtactatata cttggacata    148680
     acgttgcatg gcttaacggt atatgcctga ttctttttgt tattggtgtg gtcggtgcgc    148740
     tggcaatggt tgccatccct gaaaaattca atcttggagt taacagaggt gatacattca    148800
     tatactgtgc acttatagcg gtggttgggt tttgcgggat gttcgttatc tccattcact    148860
     cattttcgat ggatgaactt gaagcaggta gacactggaa aaacgactgc aagacacttg    148920
     aagtaaacat accgacaggc gcttttacca gccctgttaa taaactggac tgtgatggca    148980
     tcatcattaa tgtgccaggt gagcggtatt atgcgtatat ccatcagtgg gaattatacc    149040
     aggcgaataa aaaatgaaag taaacgtcgc gagcgcggtt aaaaacattg ttaactgggc    149100
     ctttccactc ttttttttgg ggtggtctgc tgtatcttgt ttacgatgat tacagagata    149160
     acggtacagc gactgaagaa cagttattaa tgatttctca tgcaataccc tgtgccggtg    149220
     aggattttcg aacggcactc cgtaatagcc agggaccatt aacccttcgc gatgcgaaga    149280
     aaattgccgc taaatgtaac gagaaatata aacaacttaa ctcactgaac gctataagca    149340
     aataatcaga ggatggatat gatgctgttt tttagaaagt atggattttt gtttatccct    149400
     ccagtctact ggctcatcta tctgggagct aggctgactt acaatggact ggcaggagag    149460
     tattctcctg atttctttca gggtattcga catgaaggca tctatattat ctgtagtttg    149520
     tgtatctttt attttttctg cttagaggtg gaagttagtg atggggagtt ctcagcgaac    149580
     attctgttcc tgattgtttt ctttcatgtg gttttattat ttatcactct gcttatttgt    149640
     ttgtggcaag gggcgatgtt gttggatgcg atctttatgg gtcagattat tgcctccatg    149700
     tgtttattgt ttttcattcc tgtgctttcc attataagaa ggagtttcta gtgcggctat    149760
     gaatattctt cttgccattt attacccttg ttgttttgaa atgcttttaa aggaacgacc    149820
     gcatgagtaa taacatcatt gataccgtca cccaggctgt gaattcactc gtatcagcac    149880
     tgaagctgcc cgacgaatcc gctaaagcca atgacacgct gggcagcatg aatttccccc    149940
     agttcagccg tattctgccc tataaggatt atgattccgc gaccggtctg tttattaata    150000
     acaaaaccgt cggttttatg tttgaggcgc gtcctttacc cggtgcggat aaaagtatcg    150060
     tcgccacact ggagcattta ctgcgcagca aacttccccg gggcgtcccg gtcagttttc    150120
     atctggtctc cagcaaactg gtcggcaatg atatcgacta tggtctgcgt gaattccgct    150180
     ggagtggtaa acaggctaag aagtttaacg ccattaccca ggcctactac ctccgggcag    150240
     cggagacgaa gttccccctg cctcctgatc tggatttgcc cctcacgctg cgtaactacc    150300
     gcgtgtacat ctcctgctgc gtacccagga agaagaactc caccacgcaa attgtcgaga    150360
     tggagaacca gataaaaatc ctgcgggcgt cactgggcgg tgcctatatt ccgacgcgta    150420
     tccttgatgc gtccgggctg gtcgaactga tgcgtgagct gataaacccg gcccgcacga    150480
     aatgtaccgc gtaccgtata agctggaccc ctatcaggat ctgaactatc agtgtgtcga    150540
     tgacagcttt gatatgcagg tcaccgctgg tcatctgaaa attggccgcc tggggcgcga    150600
     cgggaaagag tgcgtgaccc gggtgacgag ctaccatctg gagagtgatc cggaaatggc    150660
     cttcctctgg accgctgcgg acaactacgc caacctgctt aacccggagc tctccatttc    150720
     ctgccccttt gtcatcacgc tgacgctgat ggtggaggac caggtgaaga cccagaacga    150780
     agccaacctg aagttcatgg acgtggagaa gaaaagcaaa acctcctacg cgaagtactt    150840
     tccgaacgtg ataaaggaaa tgcaggagtg gggcgatatc cgccagcgac tgtcgaccaa    150900
     ccagacctcc ctggtgtcct atttctttaa tatcaccacg tacaccgcag acagcacaga    150960
     ggcctctctc gccgctgaac agcaggtgct caacagctac cgtaaaggcg gtttccagct    151020
     tatcccggcc cgctaccatc acctgcgtaa ctttctggcc atgatgccgt tcaagtgtgg    151080
     tgagggtctg tttaaagagc tgcaggcggc aggcgtggtt aagcgggcgg agacgttcca    151140
     ggtggctaac ctcctgccga tcgtcgctga cagcccgctg gcgccggcgg gactcctggc    151200
     gcccacctac cgaaaccagc tggcgttcat cgacctgttc tacgagggaa tgaacaatac    151260
     caatttcaac atggcggtct gcgggacgtc cggggcgggt aaaaccggtc tgattcagcc    151320
     cctcattcgc agtgtgctcg actccggcgg gtttgcctgg gtgttcgata tgggcgatgg    151380
     ctataagtcc ctgtgtgaaa acatgggggg cgtatatctc gatggcgata ccctcaagtt    151440
     taacccattc gccaacgtgc tggatgatgc tcacttcgac atgtcagcag aacgtatacg    151500
     cgatcagatg tcggtgatgg ccagtccgaa cggcaacctc gatgaagtcc atgaaggcct    151560
     acttctgcag gcagttcagg cggcctggtt aagcaaacgt aatcaggcac gcgttgatga    151620
     cgtagtgcag tttttacagg acgcgaagga cagcgatgaa tatgctgatt ccccgacaat    151680
     ccggggccgt ctggacgaga tgataatcct gctcgatcag tacacggtga atgggatcta    151740
     cggggactat ttcaactcag ataaaccaac actccacgat gatgcccgga tggtggtact    151800
     ggaactcggt ggcctggagt cgaggccctc tctgcttatc gctgtgatgt tttcattgat    151860
     tatttacatc gagaacagga tgtatcagtc accgcgtggc ctgaaaaaac tgaacgtcat    151920
     cgatgaagga tggaagctcc ttgatttcaa gaatgaaaaa gtggggcagt ttatcgagaa    151980
     aggctaccgt accgcgcgtc gacataccgg cgcatacatc accatcacgc agaacatcgt    152040
     cgacttcgac tccccgaccg cctccagcgc cgcacgtgca gcgtggggga actcatcgta    152100
     caaggccatt ctgaagcagt cagcgaagga atttgccaag tataaccagc tgtacccgga    152160
     tcagttcagc aagctggaga aagacatgat taacggcttc ggttcggcca aagagcagtg    152220
     gttctcctct tttatgctgc aggtggaagc gaactgctcc tggcaccgcc tgttcgtcga    152280
     cccgctcagc cgggcgatgt actcctccaa aggcccggat tttgagtaca tgcaagcacg    152340
     ccggcaggag ggggtcgata tccacgatgc ggtatacgga ctggcgtgcc gcaactttaa    152400
     agacgaaatg gctgagcttg aatcccgaat accggtgaat gacatggagg ataaacagtg    152460
     atgaaaaaca acaccgaaca accggtcagt acgacctctc atacctttcg ccggatatct    152520
     gtcatcgttg ctctcgtgct tttcgccctg gcaaccagcg cgtttctctc acgcgtggtt    152580
     ctggagtact ccacgccgcg agtggtggct tttgatatga agaagacgct cgacagcttt    152640
     atggacagtg tcagtcagaa gcagctgaca gaagcgcagt caaaagcgct ctctgaccgg    152700
     tttaacgacg cgctggagaa gagtctggcg gagtatcagc agcagcatca tgtggtcatt    152760
     ctggtttcac ctgccgtggt tcagggcgcg cccgatgtga cccgcaacat ccagcacgac    152820
     attgcccgcc ggatgaaagg agaacagtaa tgatacgact gaaagactgt ctgctcgccg    152880
     cctgcctggt atcgccgctg actcaggcgg ctgatctcgg tacctggggg gatttatggc    152940
     ccgtccggga gcaggacatg ctgcagctca tcacgcagcg tctgcagtca ctgcaatcct    153000
     ctggccagtg ggaccagacg atggatgcgt ttaagcagcg ggttatcgag aacagtcagc    153060
     gcccggcacc ggtggagggc attaagcgtg cggagaaata cgagcagcgc tggtttgatc    153120
     ccagcatccg cctgaccgaa gacctgaagg acaatgaggg gcgggtgttt gcccgcaagg    153180
     gcgatgtggt gaacccgctt aaaaccgtac cgtttgtcca gaccctgtac ttcatcaatg    153240
     gagacgatgc cgaccagctg gcctggatga agcgtcaggt gccggaaacc ctgatgagca    153300
     aaattatcct ggtgcgtggc agtatcccgg acacctccgc agcgctggac agccggatct    153360
     atttcgacca gaacggcgta ctgagcaagc gatttggcct gacggcggtc ccggcgcgga    153420
     tcacgccggc gccatccggt gaacgcctga atattgagac cttccctgta aaataaggat    153480
     gtttctgtga aaaccctgac gcttttcctg agtgccctga tgttgtgggg gtacagcctc    153540
     agtgcggctg ctgatccctc ctgtgagggc cggtttgtta acccgatcac cgatgtgtgc    153600
     tggcgctgca tcttccccct gtcgctcggc agcgtgcagg ttggtaaagg cgatctgcct    153660
     gataccagca atccgggtag tcccctgcag ctgtgtccgg cgccgccacc gatttttgtt    153720
     cgacccggcc tggccatcgg gtactgggag ccgatggcca tgacggacgt cagccgttcg    153780
     cctggctgta tggtcaatct ggggggcttc agtatcaatc tcggcaagac cggcatgggg    153840
     accgcgagaa aggacgataa gcaggtgaac ggcgccttct atcacgttca ctggtacaag    153900
     tacccgctga cgtactggct gaacatcatc acttcggcag ggtgtctgga aggcggagac    153960
     atggatatag cctatctgtc cgagattgac ccgacctggg tggacagcag cctcaccacc    154020
     attctgaatc cggaagccat cctgtttgcc aaccccatcg cacagggggc gtgcgcggct    154080
     gacgctatgg ccagcgcgtt tcatatgcca ctcgatattc tgttctggtg tgccggctct    154140
     cagggttcga tgtacccgtt tagcggctgg gtaagcaacg agtccagtcc gctgcagtcc    154200
     tcgttacttg tcagcgagcg catggcgtac aagcttcacc ggcagggaca aattatggag    154260
     agcatcggga aggacaaggc ggtctgctat gagtatccgt ccccgatcat ccccaaagag    154320
     cgctggcgct atcagatggt gaacatgtac ccggacagcg gccagtgcca tcccgtgggg    154380
     cgcagcgtga tgcgctggga ggccggtaaa aatccaccca acacccgtaa gaactatggc    154440
     tatctgatgt ggcgtaaacg caattgtgtc tttctctgac aggagtctct catgaaatta    154500
     atgaatctgt ttatggtcat gcttttgctg accggacgag cggtgttggc tgaaacctcc    154560
     tctgttacag acagagaatg gctgaagcag caggagaccc tcagcgaaca gctgcgccag    154620
     catccggata aacagctgca gcaggagctt gaggcgcaaa tcaaccgtaa tcctctgccc    154680
     aaatcagacc gccagtttat cgataatctg gtcagccagc agaaagcggc gaatcaggaa    154740
     aagccagcag aaggggcgct gtactttgtc tccttctcga tacctgaaga ggggctgaag    154800
     cggatgctgc acgaaacccg gcagtacggc attccggcga cactgcgtgg gctcgtcaat    154860
     aacgacatga agaccaccac tgacgcggtg ctgcagctgg tgaaggatgg cgtgaccgac    154920
     ggcgtgcaga tcgacccgac actgtacacg cagtacagca tccggagtgt gccgtctctg    154980
     gtggtacggt gtcaggccgg atatgacgtg gtacgcggta acattcacgt caaacaggcg    155040
     ctggagaaag tggcacaaac cggtgactgc gcacaggtgg cccggcaaat acttgatgcg    155100
     ccctcgaatg ccgccgggag ccagccatga aagacagacc gtacttcata gcgttaccgg    155160
     aaatggtgag ggatgaggga gggcagaaat gaagacggtt atttccgtgc tgactgcgca    155220
     tttttttgtc ctgagcgcct ttatctggct ggcatcccca gcctgtgctg acagaggaag    155280
     cgactataaa gctggttcgg attttgcgaa acaggtgcag ggcaatggtc tgaactcact    155340
     gaaaaatttc agtggtgagc aaaacctgcc ggggtatacc gacagccctg atcagacaaa    155400
     atactatggc ggcgtcactg ccagcggaga cagctctctg aaaagcgatt cagccctgga    155460
     gttcagccag ggagataccg gcaaagcgat tacggagtcg ttcacgaacc ggccaccgga    155520
     tcagatatct caggatgcgc cgtttattca ggccgcaaag gatacagaat cccgtgccga    155580
     cagcattgtc ggcgataccg gacagtcctg taccgcccag gttgtgaacc gcagtgagtt    155640
     cacaaaccat acctgcgaac gtgatctgca ggtggaaaat ttttgcacac gggaagcgac    155700
     cctgaaggat aacgccacca cacagaaagt taaccgaacc tatcagcagg tggtgacgct    155760
     gaattatgcc cggagtaccc ggcaatggag tggcaacctg acgatcccga ccaacggtcg    155820
     tctgctgaat gcctcggtgg atggtgagcc tctggtgatc ccctggattg aagaatgcga    155880
     ttccgaaggg aaggtgcggg atagctgcaa gagtgcagtg agtgaaagcc tgaccctctt    155940
     tgaacgaacg ttccccattg atgtgatcaa ctggccacgt tcagaatcga tgtgttcagg    156000
     cggtcagaac acgcattgta cgaaatatac ctatgacggg aaggggaaga ttcatcagtc    156060
     gtttggtgtg gacaaagcgg tcactgctgg gcagaacttt tcagtaagca aaacatcacg    156120
     gaccgtatca tcggccagcc agaaacccgt acaggtcacg gtcaccctgg tgatggaaga    156180
     aaccgaaacc gtctatgcac ctgaagtcgt ctgggttgaa agctgtccgt tcagtaagga    156240
     tgaaggaaaa aaaacgggcg aggaatgtat cagtccggga ggaacgcgaa ccatcaccct    156300
     cggaggcagg gattactcgt tcacggaggc ctgctggaaa tataaggata cctggctcac    156360
     gcagccggcg gacaacggct cctgtgaaag cctgatgaaa aatacggcct gtactctgtc    156420
     atcccgccag tgcgccttct ccagcgagga aggcacgtgc ctgcatgaat atgcaacgta    156480
     ttcctgcgaa accaggacga gtggcaagca aatgatctgc ggcggtgatg tcttctgcct    156540
     tgatggtgaa tgtgacaaag ccacgtccgg gaagagcaac gactttgggc aggcggtgtc    156600
     tgagctggcg gcactggctg ccgcggggaa ggacgtcgcg gcactgaacg gggtggatgt    156660
     ccgggcattc accggaaaag cgaagttctg taagaagttt gctgccggct tcagtaactg    156720
     ctgcaaagac agcggctggg gccaggatgt ggggctggca cgctgcagca gcgaggaaaa    156780
     ggcgctggcc aaagcgaaaa aagacaagct gacggtcagt ataggggaat tctgctctaa    156840
     aaaggttctg gggatttgcc tggagaaaaa aaggagctat tgccagttcg actcaaaact    156900
     ggcgcagatc gttcagcagc agggaagaaa cggtcagctg catatcggtt ttggcggcgc    156960
     cagcagtcct gactgtcgag gcattaccgt cgcggaactc caggggattg attttaacaa    157020
     gctggatttc accaacttta tggacgacct gatgaaaaat caaaaaatac cggaaaacga    157080
     tgtgctcacc aataagacca gagaacgaat taaggaaatc atgagtcagc aatccgcgca    157140
     ataaaccatg ctgcctaata aagagaccga taatcatgaa aatgagtttt cacaaaaagc    157200
     ctgttattga ttttgtcctg agattaacgc taacaataat cattatttct ccggtgattt    157260
     atttctcctg ggatgccgtc aaagggacgt cgggaagtga ttatgtcgaa agtgtggtct    157320
     ttattcttat ggctgggttt gccatgtctg tgtgttattt gtttttctca gtcctggaga    157380
     aagttataaa tgcaaggaaa agcaaagatg aatcgatata tcacgattga gaaatttata    157440
     gacattctga atgaagagaa tttaccccag gagcatcatg ttatggtgct ggctgttctt    157500
     gcggatatct ctctgcatac agacaggttc ctgattaact cgtccgaact ggttcagatg    157560
     gccgctcagt actcacctgc tttccagaaa ctgccagcgg accggcaggc ttttatatct    157620
     tcagtactga gcatgccgct attccttatt atgtgaccag gagagtcaat ggaagagaaa    157680
     aaagcatacg ggctggtcat ggtgtttgtc ggggtgtttg tctttctcct ggtcagcatt    157740
     atgtcgtaca gcctgtggcg ggacaggcag gttaacgcat ttatgacaac caaccgggcc    157800
     tgggggatcc agtgcgacac tgtttctcag gccgcgtggg tgatcaggga cggggagcgg    157860
     gtggaccttc agataaatta tctgcctctg tactgcagcg gttatcgctt tgaagcccgt    157920
     gatgatgcag gaaaggtaca gcgccagctc gataaataca gtgtctatca gcatctgtca    157980
     cgccagtcgc attaattcat aaaagggtat ttgccatgcg aacaatacat gccgccatgc    158040
     tggcggggtg cctttgctgc gccctgatgc cggctttcgc caaagacgcg ggctggcagt    158100
     ggtacaacga gaaactgaag ccccgtgatg aggacaggaa agccgtacca gcggcaccac    158160
     cgccgcaaat ggatattctg gagaaactcg ccacactcca ggcggccacc aaacggtcgt    158220
     tgtacgaagc cattctgtat ccatcgtctg aaaacttcgt gaagtatttc cggctgcaga    158280
     actactggac gcagcaggca ggtttgttct cgatgagtgc gaagaaagcc atgctggaaa    158340
     accccgaact cgattacaac ctgcagtaca gccactacaa cggcacggta aaaaaccagc    158400
     tcgctgccga ctatgccgaa cagcgacagg ctatctccac cctcgcacag cactacggcg    158460
     tgatgttctt ctaccggggc cgggaagcga tcgatggcca gctggtccag gtgattaaaa    158520
     attttcgcga aacctatggc ctgagcgtga taccggtgtc ggttgacgga gtgattaacc    158580
     ccatgctgcc cgacagccgg acggaccagg gccaggcaga gcagcttggc gtgaagttct    158640
     tccccgcgat gatgctggtt aacccgaaaa gtggccaggt gaagcctctc agttacggct    158700
     ttatcagtca ggacgacctg gcgaaacagt tcctctatgt ctccagcgac tttaaaccga    158760
     atttctaagg agtgtgtcat gcgaaatatt cgttttccgg atttagatat caccgggatg    158820
     tgggtgctgg ccgtgggcgt gtttttccac ctgatagccc ggcttgtcag aaaacagcct    158880
     gagctggccg tccaggccgg ggaaatcttc gggctgggta tggtggtgtt cgggggatac    158940
     cgcattctaa acgccctgat tgctgaagcc gaaaaagagg agaaagcctg tgaaaaacag    159000
     cctgatgaac ctcgctaaga cgccgctggc ggcactggct ctttcccttg cactggctgg    159060
     ggtggcacat gcgggaacgc tcgatgaggt gaagtcgctc tgggatccgc ggggtatctc    159120
     cggtactgaa acggcctccc cgcagagcga cactccccag gcggtgagcg gggcatctca    159180
     gccacgctgg ttacgactca gcaacggaaa gcaggtggac ctgcgcgact ggaaagtggt    159240
     gctgttcatg cagggacact gtccctactg tcataagttt gacccggtgc tgaagcagct    159300
     ggccggacag tatggcttct ccgtgttctc ttacaccatt gacggacagg gtgatgacgc    159360
     gtttccggaa gcgctgccgg cgcctcctga cgtgatgcag acctttttcc ccaatatccc    159420
     ggtggccacg ccgactacgt ttctggtgaa cgtaaacacg ctggcagcgt acccaatcct    159480
     gcagggcgcc acggatgcac agggctttat ggccagagtg gatacggtat ttcagatgat    159540
     gcactgagtc tctgttatat ccggtcttag caagtgatta aggaaaatag ccatgaacaa    159600
     atatatacgt tcgacgggac tgtatgcgtt tttatttcca gccagtttaa aggactccgg    159660
     gcagacagca gcagaaaaaa tagaacaact gaagccggaa tttatccacc gggaaaggcg    159720
     tctggaaatc tatctggaat tattcattgt gtttctcact gcaggtgctc tgctgttatg    159780
     gataatgaga tttttattta atctctgcgt ggatgactgg atagccagcg gtgacctgcg    159840
     agtaaaagac ctgtggaata ttatgatgta cgccatccct tatgcgctga tcgctgttgg    159900
     ggtggggttc tttgttgccg gagtgacatt agcaatccgc aattttttca gttatcacct    159960
     taagaccctt tttattctga gaaatgacag agttaaaaag aatgctgtgc gtaatggagg    160020
     actggatgcg aattaaactt ctgtcactct tctgcggtgc cgtgcttggc ctgtcattta    160080
     gcgccgccgc cgacgtgaat ggcgatatga acaacttctt caataagctg ggctttgcgt    160140
     ccaataccag ccagccgcag gtctggcagg gacaggctgc gggttacgcc tccggcggtt    160200
     cgctgtatgc cagaacgcag gtgaaaacga tccagctggt cagcatgacg ctccctgata    160260
     ttaatgccgg ctgcggaggg attgatgcct atctggggtc attcagctat atcaacagcg    160320
     agcagctgca gaggttcgca aaacaaatca tgagcaacgc cgcggggtac ttttttgatc    160380
     tcgctttgca aaccacggta ccggagatta aaaccgcaaa ggacttcctt caaaagatgg    160440
     ccactgacat gaacagcatg aacctcagtt cctgccaggc tgctcaggga attgtgggtg    160500
     gcctgtttcc tcgtacccag gtcgctcaac aaaaggtctg ccaggacatt gccggtgaaa    160560
     gcaatatctt ttcggactgg gccgcgtcgc gccagggttg tacggtgggc ggcaagatgg    160620
     acagcgtcca ggataaggcc agcgataaag acaaagaacg tgtgatgaaa aacatcaaca    160680
     tcatgtggaa tgccttatcg aagaaccggc tcttcgacgg caataaggag ctgaaggaat    160740
     tcatcatgac gctcaccggt acgctgattt tcggggagaa cagtgaaatc acgccgctgc    160800
     cggcacgcac cactgaccag gatctgatta gagccatgat ggagggcggc acggctaaaa    160860
     tctaccactg caatgattcg gataagtgtc ttaaggtcgt tgctgatgcg accgtgacca    160920
     tcacttccaa taaagcgcta aaaagccaga tttccgcttt gttaagcagt atccagaata    160980
     aagcagtggc tgatgaaaaa ctgacggatc aggagaaagg gtttatctcc agcaccacca    161040
     ttccggtatt caaatacctg gtcgatccgc agatgctcgg ggtgtctaac tcacttattt    161100
     accagctgac ggactatatc ggctacgaca tcctgctgca gtacattcag gaacttatcc    161160
     agcaggcccg ggcgatgatt tcaaccggta attatcccca gtcgacaatg gatatgatca    161220
     tggaaaacct caatcaggcg agtgtccaga ttgccgcttt tcagtcccgt gttcaggttc    161280
     agcaggacgc cttgcttgtg gttgacaggc aaatgagtta catgcgccag caggtctctg    161340
     cccgcatgat gacccgctac cagaataact atcattttgg ggggaatctg taatgcttga    161400
     gatatatgcc attgctggcg gcgactggtt acggggcaac ctgaacgcga ttgcggcgtt    161460
     tatggggacc agcacatggt cgactataga aaagatgtgt atcgccatct cggtactcat    161520
     tgtggcgggg aactgggtaa aaaaacacaa cgtaatggac cttattggct gggtcttttc    161580
     cctcaccctg gtctctatgc tggttgtcat tcgtacccct gtgcagatca tcgattacag    161640
     taacgttgcg caggtctatg aagtcgataa tgttcctatt ggtcttgcca ttcctgcgtc    161700
     gctgacaacg agggtgggaa acgcgcttat ccagagttat gagatggtct tcgcgctgcc    161760
     ggacagcgtc acgtacagta aaacggggat gttatttggc agtaatctgg tcgcgaaaag    161820
     tacggatttt ttgtcacaaa atcctcagat tacgacgctg ttttccgatt acgtacaaaa    161880
     ctgtgtgatg ggcgatattt tcctcaatca taagtactct tttgaagaat tactgaattc    161940
     tcctgatccg tataccctga tttttgctaa cccgagtcca ctgcgtggcg tgtttgataa    162000
     aaacaaccag ttccagacat gcgaggaggc ctcacgggat ctgaaatcgg ctcttgcgct    162060
     ggatactcag acaggcggta aaacctggaa ctactatgtt cgtcagctgt ttggcggcaa    162120
     acctaatccc gatctgctgt tcagccagat gattggcgac agctacaatt acttctacag    162180
     ctcgggacag agcgccgggc agattatccg ccagaacgtc acgatgaacg ccctgcgcag    162240
     cgggatccag agttatgcag cccgcagcgg cgataccgcc agtctggtca atatcgctaa    162300
     cacctcatcc cttgaaaagc agcggctggc acaggccaca atggggcacc aggcgcttcg    162360
     cacacttccg ctgatgcaga ccgttatcat ggggataatg attgggatgt tcccgatcat    162420
     ggtgatggcc gccatgttta atatgatgac gctgcaggtg ttaaaggggt atgtgtttgc    162480
     gcttatctgg ctgcagacgt ggccattact gttcgccatc ctgaacagcg caatggccta    162540
     ctatgcgaag caaaatggcg tcccggttgt tctctctgag ttgtcgcagg ttcagctcaa    162600
     aaactcggat attgcgacca ccgcgggtta tattgccgtg atgataccgc ctttgtcgtg    162660
     ggggatcgtg aagagcatgg gagccgcctt ctccagtgcc tacagccatt tttcttcttc    162720
     cgggcttggt gcaacatcgc aggcggcttc cggcgtggtg gatggcaatt actcgtttgc    162780
     caacatgcag atggagaacg tcagcggcta cagctggggt accaacagca caaccagttt    162840
     cggacagatg tcgcggcagc tggcgaatgg aggcatgagc acgcagacgc gggatggctc    162900
     gatggtctgg gacagtggtg gtgcaatgtc aaaactgccg gtggatatca acgtcggtcg    162960
     tcagatagcc agtgcgcagc aacagatggc ccgtgaggct gatgtccagg ccgaaagcgc    163020
     gctgcatggc tataacagca gcgtgacaag tgcctggaat gttttaaagc agtttggtac    163080
     caacagagga accagttcct caatgacgac tggagcagat aatacagagt cgtcgcaaga    163140
     cacaatggct aaaagtaaga tgtggaatgc ggtggttgct aatgcaaaag caaataatat    163200
     atctaatgag cagtcctttc agaatctcat ggatgaatcc actagaggta cagttacagg    163260
     tgaagcccat gtgggtgcaa gatggagttc aggagatcag cttgctggta aaattgggaa    163320
     attggctaca ggcgccagtg tagaaggtgg cataaaagga tcaataagtg ggagcggcag    163380
     cacaggatca actgatactg ttggccagtc tggtcgacat tccagcgata gcagacatga    163440
     tataagtagt caggccgcta aagattttag agaggcaagt gattatcttg ttagccataa    163500
     aactaatact tcaggtaata taactgataa caatgcaagc tctcgtgtcg atcagtttgc    163560
     tgcttcactt tctagtgcta aaaatagtta cgaccagtac acaaccagta gaacacgcag    163620
     ccatgaatat agtgaaatgg cttcaagaac tgagagtttg actggccaga tgagcgagaa    163680
     tctcactcag caatttgcga actttgttca gcatcgtgct ccacaggatg ctgaggccat    163740
     tctgaccaat acaagctctc ctgaaattgc agcgcagcgt gagatgctgg cacgagagtt    163800
     tgtgaaagct caagtagaac cacgaatcga cagttccttt gaacaaggaa gaaatgatat    163860
     aggtaatggt atggcaagtg tttccgggac gccaggtgac caaactgttg ttagcgattt    163920
     tggcaagcac agtggtgata ttgagtcaat gtcacgaaat tctggtatta aagagaacgt    163980
     aagaaatcaa gtggattcta tggtggaaga taacaccagg ataaataatg ctggtaaaat    164040
     caatatcaaa gagcaaggtg aagggattaa acaacagaat gcagattttg agatgttaca    164100
     taaaaaagaa ggaaatgact ttaatgagcg atataataag gaattgaatg gtcaagtgaa    164160
     caatccacta agcaacacga ctgaggagtt caggaagaag gctgaagaat ctgcaaggaa    164220
     aatggatggt aaattaccat aaaagggtat aaacatgatt actaacaaac agatacttac    164280
     tgaggtcgag caactgtcac gtctattcaa agatggggaa gctgatattc cttcaatgtg    164340
     gaattgcttc tggccaggcc ttgctgcaat gttttggcta ctattatggc ctatcgccat    164400
     gtttagttat aagttatttt ttgtagaatt accaaatgca gctcagatgg ggatagcagc    164460
     ttctgtattg gtggcttttg ttgctgggtt gtttatgatg ttgtatatag taaatttcag    164520
     agcattgtac ctctccattc ctgacacata tcgtaaacaa tcagcattat gtcagtttat    164580
     agtaggtaag gctaaatttt actgtcgtgt atacttattg acgtatgttt ttttaattat    164640
     ctcttgtacc tatccggttt atggggctat atactcgacg gtattattta tttgtttctc    164700
     attttgtttg atgcaaattg ttaatgttga tttgagccgt tatcaactta cagccttaac    164760
     atcgcttctc gagaccttca agacaagtaa gagtgaaaaa taagcaccgc atagcctatt    164820
     aattctggta gtttgttaat aggctaaaag ttcatgcgtg aaatcattag tctattaact    164880
     ttgataagtt tccactcaaa ttaaaagttg gatatagtat ctgcgcattc tggatgcaga    164940
     aatggaatgt gtatgtctca taatgattat ggtacaagga atttgtatgc aatttaataa    165000
     attgatgact gttatggttg tcagctctgc gctggcgttg tctggatgta gtgcaatggg    165060
     aaccgctatt aaaaagagaa atctggaagt gaaaacccag atgagcgaaa caatctggct    165120
     ggaaccttca aataataaga cggtttatct gcaaatcaaa aatacctccg ataaggatat    165180
     gagtggcctg caggcaaaaa ttgccagcgc cgtcacttca aagggatatc aggtcgtcag    165240
     taacccggat acggcgggct actggatcca ggctaatgtg ctcaaggccg ataaaatgga    165300
     ccttcgtgaa tctcagggtt ggttaagccg gggttatgag ggggcagtga ctggcgccgc    165360
     tcttggggcg gggattaccg cttacaactc cagttctgcg ggagcgaccc tgggggtagg    165420
     gcttgcagcc ggtctggtgg ggatggcggc tgacgcgatg gtggaagatg tgaactacac    165480
     catgatcacc gatgttcaga tcgcggaaag aaccaaaaca caggttcaga ctgataacgt    165540
     ggccgtatta cgtcagggaa catctggcgc aaaagtgcag acaagtacgg aaacgggtaa    165600
     tcagcataaa taccagactc gcgtcgtctc taacgctaat aaagttaacc tcaagttccc    165660
     tgaagcccag cctgttcttg aagaccagct ggcaaaatcg atcgctaata ttctgtaagc    165720
     gttctattcc acggcccggg tactccgggc cagactggca tcacctttct ggcgtgtcag    165780
     aattcattcg tcaaataatc agttaattcc acatctaaac ggtgaacagt tgcgcaattt    165840
     atttgtgcat ctgtgaggcg ttgccgcctt cggcggagtt tttcgtcttt atttgaacag    165900
     aggttattta tgacaatatc tgagcctgtc aggtctcttg atacacatga actgatgcct    165960
     ggcgatattt acccacatcc tgcagtgggg gaaagttatt ccctgtcaca ttgcgaggtc    166020
     tgttctctct tcagtgacca cttcatgtat atctgcagcg cgttagttat tcttctgctt    166080
     gttttcattg caggtgtatt ttttagaaaa ttaatgacgt cttccacggg gcgtaagcga    166140
     gacacggtgt cagttattcc cgatacaaag ccagaagcac agagcaaacc ggaatacttc    166200
     catctttcca tatgtgtgga aggcccggcc agcacggatg actccgcctt gtcctctctt    166260
     gcctcccgtg ttgtccgcga agcagaaaat ctgtatatcc ccggcgtcaa tcgccgcgac    166320
     agcgctgacg acgtgtttgc ctggtccgtg cagactcagt ttccttctga caggctcttc    166380
     ggcacacgga ttttcccgtc gaccggctgg tttgaacgtc cggatatgat taaacctccg    166440
     gtgaaatgct actgcgtctg cctgcagtac acggctgaaa cattgccatc cacactgcat    166500
     gccctggtcg atgaggccgg acggcaggtg gcgaagtcgt atattaaagg cgggcactgc    166560
     cctggctcag agggctattc cttctgcata acctcttaat agcaataagt atccggcctg    166620
     gtcatctatg gatccgggca tgactgtaat cctgttttct gtgccggtgt atttccgctg    166680
     attaatttgt ccttccgacc ctaatacttt actgacggat tagtgccatg agtttcaatg    166740
     ccaaagatat gacgcagggc ggtcagatcg ccaatatgcg ctttcgcatg tttggtcaga    166800
     ttgccaatat tattttctac gtgctgttta ttttattctg ggtgctgtgc ggactgatgc    166860
     tgatgtaccg gctcagctgg caaacctttg tgaacggctg cgtatactgg tggtgtacga    166920
     cgctgggtcc gatgcgcgat attattcgtt cccagccggt atacaccatt cagtattacg    166980
     gccagtcgct ggaatatacc tcagaacaaa tcctggccga taaatatact atctggtgcg    167040
     gagagcagct gtggactggt ttcgcctttg ctgccgtggt ttctcttgtt atctgtatcg    167100
     tgacgttctt catcgccagc tgggtgctgg gccgccaggg gaaacagcag agtgaggatg    167160
     agaacaccgg cgggcgccag ctttccgata agcccaaaga agtggcccgc cagatgaagc    167220
     gtgatggagt ggcctccgat attaagattg gcgacctgcc tattcttaaa aactccgaaa    167280
     ttcagaactt ctgcctccac ggtaccgtgg gttccggtaa atccgaagtt atacgccggc    167340
     tactgaacta cgtgcgtgcc cggggcgata tggccatcat ttacgatcgc tcctgtgagt    167400
     tcgtcaaaag ctattacgac ccgtcactgg ataaaatcct caacccgctg gactcgcgct    167460
     gtgcagcctg ggatttgtgg aaagagtgcc tgacgctgcc ggacttcgac aacatctcca    167520
     acacccttat cccgatgggt accaaagaag atccgttctg gcagggctcc ggtcgcacta    167580
     tctttgccga aggcgcgtat ctgatgcgcg aagacgacga tcggagctac gagaagctgg    167640
     tcgataccat gctgtccatt aagatcgaca agctgcgcgc ctatctgcag aacacgccgg    167700
     cagcgaacct ggttgaagag aaaattgaga aaaccgccat ctccattcga gctgtgctga    167760
     ccaactacgt caaggctatt cgctacctgc agggcattga gaagaacggc gagccgttca    167820
     ctatccggga ctggatgcgc ggcgtccgtg aggaccgacc caatggctgg ctgtttatct    167880
     cctccaatgc tgacacccat gcctccctga agccggttat ctcgatgtgg ctgtcgattg    167940
     ccatccgcgg cctcctggcg atgggcgaga accgtaaccg gcgtgtgtgg atcttcgctg    168000
     acgaacttcc cacgctgcac aagctgccgg acctggtcga aatcctcccg gaggcgcgta    168060
     aatttggtgg ttgttatgtg ttcggtattc agtcttatgc ccagctggaa gacatctatg    168120
     gcgttaagcc tgccgccacg ctctttgacg tgatgaacac ccgggccttc ttccgctccc    168180
     cgagtaaaga gattgcggag tttgctgccg gtgaaattgg tgagaaggaa atcctcaagg    168240
     ccagcgagca gtactcctac ggtgctgacc cggtgcgtga tggtgtatcg accgggaaag    168300
     aaaaagagcg ggaaacgctg gtcagttact ccgatattca gacgctgcct gacctgtcct    168360
     gttacgtcac gctgcccggg ccgtatccgg ccgtgaaact ggccctcaaa tacaagccgc    168420
     gtccgaaaat tgccgaggga tttattcctc gcactctcga tgcgcgggtg gatgcacggc    168480
     tcagtgcgct gcttgaggcc cgggaagctg aaggcagcct tgcccgggcg cttttcacgc    168540
     cggatacgcc ggaacccggg ccagctgata cagacagtca cgccagtgaa caacctgagc    168600
     cggtcagccc gcctgcgcca gcagtaatga cggtaactcc tgcaccggta aaatcgccgc    168660
     cgacaacaaa gcgtccggca gcggagcctt ccgtcagagc aacggagcct cccgtcctgc    168720
     ggggcacgac cgtaccgttg atcaaaccaa aagcagccgc agcggccact gctgcctcaa    168780
     cagcatcctc tgccggtgcc cctgcggcag ctgcaggcgg gacagaacag gaactggcgc    168840
     agcagtcagc ggaacaggga caggacatgc tgccggccgg catgaacgag gacggcgtca    168900
     tcgaggacat gcaggcgtat gacgcctggc tggcagatga gcagacacag cgggatatgc    168960
     agcggcgtga agaggtcaat atcaaccaca gccaccgcca cgatgaacag gatgatgtcg    169020
     agattggggg gaacttctga tgatgtcgat tggctccgtt aaatcggcgg gcagtgccgg    169080
     taattactat acggataagg ataattacta cgtcataggg agcatggacg aacgctggca    169140
     gggtaagggg gctgaggcgc tggggatcga cgggaaagcc gtggataagg cgctgtttac    169200
     ggaactgctg aaagggaagc tgccggatgg cagcgacctg acccgaatac aggacggcgc    169260
     caacaggcac cggcccggtt atgacctgac cttctcggcc cccaaaagcg tgtcggtcat    169320
     ggcgatgctg ggcggcgata aacgccttat cgatgcccac aaccaggcgg taaccgaagc    169380
     ggtgcggcaa ctggagacgc tggccgcgac ccgtgtcatg acggacggta aaagcgaaac    169440
     ggtgctgacc ggaaatctga ttgtggcgaa attcaaccac gacacgaacc gtaaccagga    169500
     acctcagata cacacccatg ccgtcgtcat taacgccacg cagaacgggg acaaatggca    169560
     gtctctcggc acagataaga tcggtaaaac aggttttatc gagaacgtgt acgcgaacca    169620
     gatagcgttc gggaagcttt accgggaggc gttcaaaccc ctggttgaga agcttggcta    169680
     tgagacggaa gtcgtgggca aacacgggat gtgggagatg aaaggggtcc ctgtggaacc    169740
     cttctccacc cggtctcagg aggtcaggga ggctgcagga cccgatgcct ccctgaagtc    169800
     acgggatgtg gccgcgctcg atacccgcaa gtcgaaagaa gccatcgatc cggcagagaa    169860
     gatggtggag tggatgaaca cgctgaagga gaccgggttt gacatccggg ggtaccgtga    169920
     ggccgccgat gcgcgagccg cagagctggc ccgtgcacct gccgcgccgg tgaacactga    169980
     cggtccggat atcacggatg tggtgacgaa agcgattgcc ggtctcagcg accgcaaggt    170040
     gcaattcacg tatgccgacc tgctggcacg cacggtcggc cagctggagg cgaaggacgg    170100
     tgtgtttgat ctggcgagaa agggcatcga tgccgccatt gaacgggagc agcttatccc    170160
     tctcgatcgc gagaaaggcc tgttcacctc aaacatccac gttctcgatg aactcgccgt    170220
     caaagccctg agtcaggagg tacagcgcca gaatcatgtc tccgtcacgc ccgatgcgtc    170280
     tgtggtgcgc caggtccctt tcagcgatgc cgtcagcgtg ctggcgcagg atcgcctggt    170340
     aatgggtatt gtttccggtc agggcggtgc aaccggccag cgggagcggg tggccgagtt    170400
     aaccctgatg gcccgggagc aggggcgtga cgtccatatc ctggcggccg ataaccgctc    170460
     acgtgatttt ctcgccggtg atgtgcgtct ggccggggaa acggtgaccg gtaaatccgc    170520
     cctgcaggac gggacggcgt ttattccggg cggaacactc atcgtggatc aggcggagaa    170580
     gctgagcctg aaggaaacga tttccctgct cgatggcgcg atgcgccata acgtgcaggt    170640
     cctgctctca gacagcggga agcgcagcgg gaccggcagt gcgctgacgg tgctgaagga    170700
     cagcggcgtg aatacgtatc gctggcaggg cggccaacag accacagccg acatcatcag    170760
     tgaaccggat aaaggagcac gctacagccg gctggcacag gagtttgccg tcagcgtacg    170820
     tgaagggcag gaaagcgtgg cccaaatcag cgggacgcgt gaacagagcg tactcaacgg    170880
     ccttatccgt gactccctca gacaggaggg ggtgctgggt gagaaagaca cgaccattac    170940
     agccctgacg ccggtgtggc tggacagtaa aagccggggc gtgcgggatt attaccggga    171000
     ggggatggtg atggaacgct gggatccgga gaaccggacg cacgatcgct ttgtcattga    171060
     ccgggtgacc gcgagcagca atatgctgac cctgaaagac cgggatgggg tccgtctgga    171120
     tctgaaggtt tccgcggtcg acagccagtg gacgctgttc cgggcagaga cactgccggt    171180
     ggcagagggg gaacgtctgg cggtgctcgg gaagataccg gacacacgcc tgaagggcgg    171240
     ggaaagcatc acggtgatga aagtggagga agggcagctg acggtacagc ggccggggca    171300
     gaaaaccacg cagaccctgg ccgtgggcgc gggcgtgttt gacggtatta aaatcggcca    171360
     cggctgggtg gaaagtcccg gcaggtcggt tagcgagacg gcaacggtct ttgcgtcggt    171420
     gacgcagcgt gagctggata acgccaccct caaccagctg gcgcagagcg gaagtcatct    171480
     ccggctgtac tcggcgcagg atgcggcgcg tacgacggag aagctgtcgc ggcataccgc    171540
     gttcagcgtg gtctcagagc agctgaagtc ccgatccggc gagacggacc tggatgcggc    171600
     cattgcgcag cagaaggccg ggctgcatac cccggcagaa caggccattc acctggccat    171660
     cccgctgctt gagagccagg acctgacctt ctcccggccc cagctgctgg cgacggcaat    171720
     ggaaaccggg ggcgggaagg tttcgatggc ggacatcgac acgaccatcc aggcacaaat    171780
     caggtcgggg cagttgctga atgtaccggt ggcgcacggc tacggcaatg acctgctgat    171840
     ttcccgtcag acctgggacg ccgaaaaaag catcctgacc cacgtgctgg aaggtaaaga    171900
     cgcggtggcc cccctgatgg accgcgtgcc ggccagtctg atgacggacc tgaccgccgg    171960
     acagcgggcg gcgacccgga tgattctgga aagcacggac cgcttcacgg tggttcaggg    172020
     gtatgccggg gtggggaaaa ccacccagtt ccgggcagtc atgagtgcca tcagtctgct    172080
     gccggaagag acccgtccgc gcgtcatcgg tctggcgccg acgcatcgcg cggtcgggga    172140
     aatgcagagt gctggcgtgg atgcgcgcac gacggcatcg ttcctccacg acacgcagct    172200
     gctgcagcgc aatggccaga cacccgattt cagcaacacc ctgttcctgc tcgacgagag    172260
     ctcaatggtg gggctggccg atatggcaaa agcccactcc ctcatcgtcg ccggcggtgg    172320
     acgggcggtg tccagtgggg ataacgacca gctgcagccc atcgcgccgg gccagccgtt    172380
     caggttgatg cagcagcgca gcgccgccga cgttgccatc atgaaagaga ttgtacgcca    172440
     gatgcctgag ctgcgaccgg cggtctacag cctgattgag cgggatgtgc accgcgccct    172500
     gaccaccatc gagcaggtca cgccggagca ggtgccgaga aaagaaggcg catgggcgcc    172560
     gggcagttct gtggtggaat tcacgccaaa gcaggaaaag gcgatagaaa aggcgctgag    172620
     cgaggggaaa accctgccgg aaggtcagcc cgcgacgctc tacgaggcgc tggtgaagga    172680
     ctataccgga cggaccccgg aggcacagtc gcagacgctg gtgatcaccc atctgaataa    172740
     ggaccggcgg gcgctgaaca gtctgatcca tgacgcacgg cgggagaacg gggaaaccgg    172800
     caaagaggaa atcaccctgc cggtgctggt cacgagtaac atccgtgacg gtgaactgcg    172860
     caaactgtcg acctggacgg ctcacaagga ggcggtggcg ctggttgata acgtatacca    172920
     ccgtatcagc aaggtggata aggataatca gctgatcacc ctgacagaca gtgaaggaaa    172980
     ggagcgattt atctcacccc gggaggcatc ggcagaaggc gtcacgctct atcgtcagga    173040
     aaagatcacc gtgtctcagg gggaccgaat gcgcttcagc aaaagtgacc cggagcgcgg    173100
     ctatgtggcc aacagtatct gggaagtgca gtctgtttcg ggtgacagtg tcacgctgtc    173160
     tgatggcaaa atcacccgta cgctgacccc gaaggcggag caggcacagc agcatatcga    173220
     cctcgcctac gccatcaccg cccacggtgc ccagggggcc agcgaaccgt atgccatcgc    173280
     gctggaaggg gtggccggtg gtcgggaaca gatggccagc tttgagtctg cctatgtggc    173340
     tttatcccgc atgaaacagc atgttcaggt ctacaccgac aaccgtgagg gctggataaa    173400
     ggccatcaag aattcacctg agaaagcgac ggcgcacgat attcttgaac cccgtaacga    173460
     ccgggcggtg aaaacagccg atctgctgtt cgggcgggca aggccactgg atgaaaccgc    173520
     cgcgggccgg gcagccctgc agcagtccgg tctggcacag ggaagttcac caggaaaatt    173580
     catttctccg gggaaaaagt accctcagcc gcatgtggcg ctgccggcat ttgataaaaa    173640
     cgggaaagcc gccggtatct ggctcagccc gctgaccgat cgggacggac ggctggaggc    173700
     tatcggcgga gagggacgaa ttatgggcaa tgaagacgcc cggttcgtgg cgctgcagaa    173760
     cagccgcaac ggagaaagcc tgctggccgg gaatatgggg gaaggcgtca gaatggcccg    173820
     cgacaatccc gatacggggg tggtggtgcg gctggccggt gatgaccgcc cctggaaccc    173880
     cggggccatg accggtgggc gggtatgggc tgaaccggcg ccggtggctc cggtaccgca    173940
     ggccggggct gacattatcc tcccgccaga ggtactggca cagcgggcgg cagaagaaca    174000
     gcagcgccgg gaaatggaaa aaaaggcgga acagactgcc cgggaaatgg ccggggaggc    174060
     gcgtaaagcc ggcgagccgg cggaccgggt gaaagaggtt atcggggacg tcattcgcgg    174120
     actggagcgt gaccggccgg gtacggagaa aacgacgcta ccggatgatc ctcagttccg    174180
     gcgccaggag gaggcgattc aacaggtggc ctcagaacgt ctgcagcgtg agcgtctgca    174240
     ggctgtggag cgggacatgg ttcgtgacct taaccgcgag aaaaccctcg ggggcgactg    174300
     acgcgcctgc ggcttgtctg ctccggcagc ctccccgatt aaaatcgggc agtctgccgg    174360
     agcgctaaaa ggaaaaaaac atgagagcac aacacacatt tccaggtgcg acagaccgct    174420
     ggcttcatcg cctgctgacc tgggcaccgg gacaaacgga tatgattaaa acggtcgcac    174480
     tggtactgat ggtgactgac cacaccggct tactgctggc cggaaacaat gaagtgatgc    174540
     gcctgctggg acggggctgt tttccgctgt tcggtctggc atggggaatg aatctggccc    174600
     ggcacgcgga aatacgccag tcgcagctga acagcctgtg gggctgggcg ctggtcgccc    174660
     aggtgtcgtt tatgctcatc gggtacccgt ggtattccgg gaatattctg tttgcctttg    174720
     ccgtcacggg ccaggtcctg cggtgggtca gccagccgtc ctggtattac accctcccgg    174780
     cggctggact gctggtcgcc tggatacccc tgtcaaccgc cagctacggc atggccggag    174840
     tgggcatgct caccgccagc tggctgcttt gtcgcgcaca gcatgcacag gaacggctgg    174900
     gatacggggt gctgtgggcc ctcatggtgt tgctgatgaa tatgcatgac gtgagtgaat    174960
     cagtggccgg gctggcgatt gcgctgctga cgctgatggt gtgctcatct gccggagaac    175020
     gtgtgaaacg cttctggccg cggcagttct tcgtgatgtt ctatgcggtg cacctggcgg    175080
     tactcggtat tgtcgtctcg atgtaaaaaa aaaaccggac acaggtccgg ggggcgggca    175140
     cattgcccgt aaacgtgaca aaggggacat catcgttgtg tccactgcat tgcgaggtga    175200
     aacgatgata ccgttagcgt atcgtatagc acagacctgt agcttttatt gatatggccc    175260
     cttatgagtg aagaaaaacg ccctgtactg agcctgaaac gaaaaccggc ggagaacagt    175320
     acggcccccg cagaggcaac ccctgctcct ggtgtggtgc gccgaaagaa ggtcgtggtg    175380
     gtctcgtccc cgccggcctg gaaggcaaaa aaagagaaac ttgagaaggt taaacaagcg    175440
     gccgaagccg ccgcgcgcaa cgctgcgccg gtgccggtta aagcggtaaa gacgccacct    175500
     ccggtgcgtt atcttcgcct gctgccgccg gaacaggcca ttatgacgct gaaggcattc    175560
     tggccacagc tgttcgacgg aaactcaccc cgtctgctgg caacgggcat gcgcgaacag    175620
     ctgtttgccg acattgtgaa ccgtgacctg ccgctgtcgc ataaacaggt gattaagtgc    175680
     ctgaagagtc tgacccggtc tgcgggctat ctgtcccgga tgaaggaggg agccgcccgc    175740
     tatgatctgc aggggaacgc cgtcgcgacc gtcactgcag gggaagcgca gtacgccagc    175800
     gagcgcatga tgaaagaact cctgcgaact gagcgtatgc ggagccagtc agctggctga    175860
     atacaatcga ggagaggaa                                                 175879
//

If you have problems or comments...

PBIL Back to PBIL home page