(data stored in SCRATCH zone)

EMBL: CP000654

ID   CP000654; SV 1; circular; genomic DNA; STD; PRO; 157749 BP.
XX
AC   CP000654; AAVF01000000-AAVF01000039;
XX
PR   Project:PRJNA17461;
XX
DT   20-APR-2007 (Rel. 91, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Enterobacter sp. 638 plasmid pENTE01, complete sequence.
XX
KW   .
XX
OS   Enterobacter sp. 638
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Enterobacter.
OG   Plasmid pENTE01
XX
RN   [1]
RP   1-157749
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Kiss H., Brettin T., Bruce D., Detter J.C., Han C.,
RA   Tapia R., Gilna P., Schmutz J., Larimer F., Land M., Hauser L.,
RA   Kyrpides N., Kim E., Taghavi S., Newman L., Vangronsveld J.,
RA   van der Lelie D., Richardson P.;
RT   "Complete sequence of plasmid of Enterobacter sp. 638";
RL   Unpublished.
XX
RN   [2]
RP   1-157749
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Kiss H., Brettin T., Bruce D., Detter J.C., Han C.,
RA   Tapia R., Gilna P., Schmutz J., Larimer F., Land M., Hauser L.,
RA   Kyrpides N., Kim E., Taghavi S., Newman L., Vangronsveld J.,
RA   van der Lelie D., Richardson P.;
RT   ;
RL   Submitted (06-APR-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 0850488f2ea60c659c61c46be4ca3569.
DR   BioSample; SAMN02598394.
DR   EnsemblGenomes-Gn; EBG00001122023.
DR   EnsemblGenomes-Gn; EBG00001122024.
DR   EnsemblGenomes-Gn; EBG00001122025.
DR   EnsemblGenomes-Tr; EBT00001712529.
DR   EnsemblGenomes-Tr; EBT00001712530.
DR   EnsemblGenomes-Tr; EBT00001712531.
DR   EuropePMC; PMC2869309; 20485560.
DR   EuropePMC; PMC3771936; 24069314.
DR   EuropePMC; PMC5533749; 28754999.
DR   RFAM; RF01089; PK-repBA.
DR   RFAM; RF01396; isrN.
DR   RFAM; RF01794; sok.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4002721
CC   Source DNA and bacteria available from Daniel van der Lelie
CC   (vdlelied@bnl.gov) and Safiyh Taghavi (taghavis@bnl.gov)
CC   Contacts: Daniel van der Lelie (vdlelied@bnl.gov)
CC             Safiyh Taghavi (taghavis@bnl.gov)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..157749
FT                   /organism="Enterobacter sp. 638"
FT                   /plasmid="pENTE01"
FT                   /strain="638"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:399742"
FT   gene            78..4817
FT                   /locus_tag="Ent638_4201"
FT   CDS_pept        78..4817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4201"
FT                   /product="outer membrane autotransporter barrel domain"
FT                   /note="TIGRFAM: outer membrane autotransporter barrel
FT                   domain; PFAM: Pertactin; Autotransporter beta- domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4201"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62806"
FT                   /db_xref="GOA:A4WGH6"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGH6"
FT                   /protein_id="ABP62806.1"
FT                   /translation="MNEVNYSKIKDYVQKVSANSFAKVFSLLLISLPISFEAKSSSCNT
FT                   SDGTNGGTTVTSGDTCSIPADYNPSGNDTLVGAAAVTGGDAITLTGTGTGIQAGNRGIQ
FT                   ANTLGSLNPEANGLERLLIGAQTLGVNTLDPVTGSNIVVAAYNSSAFNTSDWGQFNGLN
FT                   TQTPTNVGDNQYINARFGTVQNGTLRVNIGDVGQLPSADVNTINMAAKQTMLTMAQGAG
FT                   STLIWESKNKILMGDALVASPGTTTQSTTIDIPVYAGTFTGFNGQTWTVSNATDLQQYN
FT                   NALIDALQNGQLSSQAAYDQAFSQAVSFTSRIINYSYTINSGDDITQSAGNNYSMYASG
FT                   TGAQAIIQTGGQIDQRGASVAAVNGASAEIQAGAQLSGHFNSLFIGSGSTGVNNGVISG
FT                   GYFAENGWDTTGPGNYSNEYGEAYTVTVDGIGSNFSNDGIINVAGWTQFQGYSPDSWGI
FT                   RVQSGSTASNAGIINTGVNNGSFSNSISGVIVANGGASNFTNMATGTIYLGRAAQYDVA
FT                   NPESVIDIANTIPQYGILLSDGQAVNNGIIEIGTLTENATAMAAVASSPTGLLVNNGAI
FT                   HIRGAAGDNPLQNTGILAQNNGQTVVQNAGNITIAGVNGVGLKVISTTGTASASSVSGS
FT                   LIEVAGGIDPTSGTRNYGVWAQGVNSSASLAGDIILSGQGGIGVLAREGATVNVGVGSA
FT                   VEFNEAVDPLGCPNNCSNQIGYLIYGAGSSITNQSQQLDVASSGSTLFRIEDGASFSGN
FT                   GQSLTASGRNSNIITGSGLNTTINTDAGVLTVNGEGATGIRIDGGASGNIQSGTIINLN
FT                   GTGAIAGQVDGRKINISGVPGSTVYPSTLTNNAVIQSAARDAVGFITQYQGELTNNSSI
FT                   SLTSIGENTGVIVRDGGILNNNNMILVANGTGVLVEGSTALSALNNQGSITAENGVAGI
FT                   HLRKGANLNMTGSGDVHSSGTADGILMGTDAVGISLASVNVNVTGSGSGVHNVQQGTTS
FT                   NLTGMTITTASGAAILNEQSSSWSLSGTRLNSSSGWAVQNSGGDAVFMVANTVLTGAEG
FT                   ALLTENNASTQLNASSSTLNGRILTTSGKSNLALVDGTLWNMSADSNVTNLINASSTVN
FT                   YTSDNVFKLLTVNQNYIGDDGFLNMNTALGDDNSPTDRLLVQGNTSGTTLVSVNNVGGA
FT                   GAETVNGIELITVNGDSAGIFSQSGRIVAGAYDYSLARGAGGNNSNWYLTNRKTQEIPV
FT                   TPGLPVDPGGPDTPKPAGPQVDPGGKLVLRPEGGSYAANIAAANTMFVMRLHDRLGETQ
FT                   YTDVLSGEEKVTSMWMRNVGGHTRFRDSSEQLKTQANRYVVQIGGDIAQWSSDGADRIH
FT                   LGVMGGYANQHSNTRSHLSGYDSNGTVKGYNTGVYATWYQNAEEHTGFHIDSWLMYSWF
FT                   DNTVKGEGLPSESYNSQGMTASLESGYTYHLADYFGSQGSINRWYMQPKVQIILMDVKA
FT                   DDHHEVNGTKVQGEGDGNIQTRLGLKTYVNGHHEMDNGNQRVFQPFIETNWIHNTRDFG
FT                   ASMNSVAIIQEGSRNIGELKMGVEGQINLRLQVWGNVAAQVGDAGYSDTSAMMGIKYSW
FT                   "
FT   gene            5846..6451
FT                   /locus_tag="Ent638_4202"
FT   CDS_pept        5846..6451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4202"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62807"
FT                   /db_xref="GOA:A4WGH7"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGH7"
FT                   /protein_id="ABP62807.1"
FT                   /translation="MAKGSRMDVHVRSHSSYLTYSIKDLVSEIDIGLIGNTQHLLVIDF
FT                   SSERNYFSMIELISERAEWLAKPETKVIIIGDRDVYGGVEQKSIIYIRLNASLEEWRKK
FT                   LKAALQAPALNVSRLITMAGRANYEALTSSEKDVIACIRTNMCMGNIIARQGITTKTYY
FT                   ARIYSIKRKLSLRSAREVYLNIEKIYNKIKQISDQSKG"
FT   gene            complement(6810..8372)
FT                   /locus_tag="Ent638_4203"
FT   CDS_pept        complement(6810..8372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4203"
FT                   /product="integral membrane sensor hybrid histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region, ATPase domain protein domain protein; histidine
FT                   kinase A domain protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4203"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62808"
FT                   /db_xref="GOA:A4WGH8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGH8"
FT                   /protein_id="ABP62808.1"
FT                   /translation="MALSYVSMIALFFGEYTWDYLFIALYYLGFLLTSILLRFIIKRNP
FT                   GIFLVRRMFTMIHDYVAISVGLAVGEEKTLPIYAVMVWVTLGYGVRYGAFYLLAATIMS
FT                   FISLSVIVFYNDYWSNHLYMVLALLLTTVVIPVYAKTLLTQVRQASTRALKATHTKAQL
FT                   LAQVSHDLRQPIHAIGIYITCLREENLNPSGLKMVDNIDRSLVSVSHIFHSMLNFYTLD
FT                   SGGINLKPEVFRLRNMLEECIKEHTVAAHEAGSQIRLDVEECWVKSDVSILIIIINNLI
FT                   SNAVKYGEGKLISLRSFHKNGSIMLAICDKGSGIEEKHLLHIFDEFFRIKKNRDKDLEG
FT                   IGLGLSIVKRACSLAGLDINLVSRVGLGTCAVISNLKIASTPVVQDKPQEKLLMQLSGT
FT                   RVFLIEDNPEMLDATQMLLQRWGCEVLPLESQDPTLLDTQCECDVIIADYDLGTKISGI
FT                   EYIQAIRNMKAEQIPALLITGHDVTNISIFVKDLNIEIVSKPIKPVELRSVLTDIVRKT
FT                   KAI"
FT   gene            complement(8519..9127)
FT                   /locus_tag="Ent638_4204"
FT   CDS_pept        complement(8519..9127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4204"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR; response regulator
FT                   receiver; Sigma-70, region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4204"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62809"
FT                   /db_xref="GOA:A4WGH9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGH9"
FT                   /protein_id="ABP62809.1"
FT                   /translation="MTIIIADDHPLFRDAMAKKLAQQNDPDIIEAGSFSELESVLETFP
FT                   APDILILDLQFPGLDSLSKLVTLKNKLKRTALIIVSMNTDAALVQAVMATGVDGYISKN
FT                   VPPEQLLSDIADIQNGNIVVNYIPGTLPNLRVTPAELDLLTERQREVLQLLVQGKSNKQ
FT                   IAQSLNISPFTVRIHVSQVLHVLGVPTRTVAIAQYSHLI"
FT   gene            9731..10303
FT                   /locus_tag="Ent638_4205"
FT   CDS_pept        9731..10303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4205"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62810"
FT                   /db_xref="GOA:A4WGI0"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGI0"
FT                   /protein_id="ABP62810.1"
FT                   /translation="MRITIYSDSEFFKFGFQCLVNDCDLVWPDDGLHLHIVDLMDKSDS
FT                   LSFVKMLDVSPLDFSATNNIILIMSAGLYVSGSRLRGVTMVSGNSTLKQLRYWVRKAIK
FT                   GECVNVEHIHQLSRKVPPCQFSPYDRQLIYFMKKNMSPAAIASAQKVSIKTLYSRMSSL
FT                   KQKCMLASTRELYLNAEYIYQQISEAA"
FT   gene            10472..15256
FT                   /locus_tag="Ent638_4206"
FT   CDS_pept        10472..15256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4206"
FT                   /product="outer membrane autotransporter barrel domain"
FT                   /note="TIGRFAM: outer membrane autotransporter barrel
FT                   domain; PFAM: Pertactin; Autotransporter beta- domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4206"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62811"
FT                   /db_xref="GOA:A4WGI1"
FT                   /db_xref="InterPro:IPR004899"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGI1"
FT                   /protein_id="ABP62811.1"
FT                   /translation="MKSRNKCVFMLHAEPIVLTKMKPLSILIASLLGIAVFPMLPVSKV
FT                   IASECMTANGTSNGASVSSGGTCSFTSGYTPVINDNQVDGANINSGDTITISGLGTDII
FT                   SGDRGIQQNSLGTLNSATNGLERLLLGSRTSGVNTLDPVTGSNIVVATYDSNSFASSDW
FT                   GQYNNVATQTPKNAGDNQYIDARLGTVQNGTMIVSIGDSGQLPSSDVNTINMAAKQTIL
FT                   TLATGINSTIEWNSKNRVLMGDTMVAAAGATTKTIQIEVPVYAGTFKAYDGGTWTVSNA
FT                   NELKVYNNALINALQSGTLSTQAAYDEAFAKAVTFSQKDIDYNYSIYAGDDVTADTGVN
FT                   YTMYADGAGAKAVLKSGGQIDQRGAGVAVVNGATAIIEEGAQLSGHFNSLFIGSGSNGE
FT                   NNGVISGGYFAEDGWDTTGKGNYFDEYSEAYTVTVDGENSHFNNNGIINVAGWTQYEGY
FT                   SPDAWGIRVQSNASATNSGIINTGVNNNSLSHSISAVRVANGGKSQFINTSTGEIYLGH
FT                   AAQYDTANPEAVVDVANALPQYGILLTDGQATNEGKILIGSLTENAVGMAAVASSPTGS
FT                   LINKGSVLVKGNANSAPLQNVGILALNNGQTQVLNSGTVTLSGVNGIGMKILATSGTAT
FT                   ATSDANSAIVVAGGVDPESGTRNYGVWTEGEKAAANIQGDIELSGRGAIGVLARDGAAV
FT                   VVGSDSAVRFHEVTNPSCTENCSEQIGYLVYGKSSSINNQAEQLEVSSSGSTLFRIEDG
FT                   ATFDSNGKTLTASGKNSTILAASGKGAVVTASSGTLNVSGPGATGVHVDGGATGQIDEK
FT                   TSINLLGQGSTAGMVDGRKTGLSGVTGTEELKSSLTNNAKIQSAIQDVVGFVAQYGGTV
FT                   VNNGEISLSSDTNSTGVIVREGGQLINNEAITITKGTGILVDGGASASTLTNQSSISVH
FT                   DGIAGIHLQNGAKLNALGSGRIITDGTADGILLGTGATGAELGANLITSQGSGSGIHNI
FT                   QSGTSIILNGTTIVSSSGSAILNDANATFAGSNVTLDSSRGWAIQNNQNQADIRLANSV
FT                   VSGETGVLLTNPGAITNLDVTSGTLNGRIVTDNAKANVTLKDSSIWNMTADSNVTSLNN
FT                   DKGSINYTHGGAFNTLTVNGNYAGNDGLLRMSTALGDDNSPTDRLIVEGNTSGSTLVSV
FT                   TNAGGSGASTINGIELITVKGDSRGVFSQSGRVVAGAYDYSLVRGQAEKDKNWYLTNYV
FT                   KPVEPTIPIDPTTPVDPTAPVDPVEPTNPAVPVTPTKPSEPVFRPEMGSYSANLAAANN
FT                   MFVLRLHDRLGETQYTDMLTGENKVTSMWMRHVGGHTRFKDQSGQLNTQSNRYVLQIGG
FT                   DVTQWSNNGNDRTHLGLMAGYGNEHSNTRSHQSHYRSDGSVNGYSVGAYGTWYANDEDK
FT                   NGLHVDSWIQYSWFDNTVTGEDIDPEKYKSKGLTASLESGYTFSMGTFKGSQGSTNEWY
FT                   IQPKAQVIWMGVKADSHKESNGSTVTGEGNGNIQTRAGLRTYIKGHHKMDDGKQREFEP
FT                   FIEANWIHNTREFGTTMNGVSNKIDGSRNLGEIKTGVEGMINPNLNLWGNVAVQVGDKG
FT                   YSDTSAMIGVKYSFK"
FT   sig_peptide     10472..10615
FT                   /locus_tag="Ent638_4206"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.743) with cleavage site probability 0.380 at
FT                   residue 48"
FT   gene            16579..17844
FT                   /locus_tag="Ent638_4207"
FT   CDS_pept        16579..17844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4207"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4207"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62812"
FT                   /db_xref="GOA:A4WGI2"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGI2"
FT                   /protein_id="ABP62812.1"
FT                   /translation="MHIKKSFPATLYWILSNTSWLTLERIIYLLSVTYTSILSIKYIGP
FT                   YYYGIISIFNNALLISLVISKFGSDAFFSREWKKAYSKYLIGNMILLRFFAGMILNTGI
FT                   VLLSAVLGEIDVRCFYYILSISIAMMIQGTDITLIYNRANGFYRNDTMISIMTMMLTSL
FT                   FKFIIVHYRLSFALLSIPIIFEALIPALYRQCSANAIKARFVIKKKIALYLIKHSVSYL
FT                   FPSLSMLINQRAVFFILGIFNGQYLVGVYSVAFFISNAIFMLPNIITMTSLVKLNKISD
FT                   YTERAEKAISTIRLITLLSLLIIVVSHFCGEYMIPKFLGEGYEKLNDIVTLIIFSFYVA
FT                   SVGVLSIKTLSKEECEGYYSVKYTLIIVLNIVLTVVLSLKYGIIGATCGFLFTEILSST
FT                   IANYLISKKIFYLHLKLFFNRS"
FT   gene            17848..18774
FT                   /locus_tag="Ent638_4208"
FT   CDS_pept        17848..18774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4208"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62813"
FT                   /db_xref="InterPro:IPR029465"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGI3"
FT                   /protein_id="ABP62813.1"
FT                   /translation="MISVIRNLYHKIPWTIKDRIEYYRIFGTFPNLTHPVKFSEKILYR
FT                   KKHSCRANDNYAFYADKLRVREYIESIIGPQFLIPLLGTYHNVSDLQRDLYSLNKCILK
FT                   PNNASGSVIFVDDFLMPAEVAEVMDIASKWLVRDYSKQKGEFHYKKIPSAIVVEKNIAE
FT                   KDKRPNDYKIHLFRMEHNKLFYVLQMIEYDNNEGRGNKGASFFFVNNLCCPFDGEVKEL
FT                   SFEEKNALNHAVQNSAALLGELEYARFDWYITKQGVYFGEITLTPCAGFCKGFPKELDL
FT                   LMGAVWILPEKRSAGRTDGQYRKKFVN"
FT   gene            complement(19102..19671)
FT                   /locus_tag="Ent638_4209"
FT   CDS_pept        complement(19102..19671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4209"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4209"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62814"
FT                   /db_xref="GOA:A4WGI4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGI4"
FT                   /protein_id="ABP62814.1"
FT                   /translation="MHDMSLFDLLDRLSSLTRMWFRQHPLLSELQPVQLSALMYLARCN
FT                   RYSNTPLGVTEYLGLTKGTVSQSLKLLEAKGLIARTQDVRDKRSVHLQLTETANMLLTE
FT                   LLPPQFLVNGEVGLGSRADSLKMLLLDLLREIQRTNNVPSFGLCRSCRFHQHVNGIPLC
FT                   NLTKEPLGIDEGLLICREHQSKENDV"
FT   gene            19784..20014
FT                   /locus_tag="Ent638_4210"
FT   CDS_pept        19784..20014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4210"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62815"
FT                   /db_xref="GOA:A4WGI5"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGI5"
FT                   /protein_id="ABP62815.1"
FT                   /translation="MSTARFYHAGCTVCVSAEETLLSHLSPNVKVEVVHLGEQPNRVEE
FT                   AERAGVRSVPALVIDGNVLHINFGASIEALK"
FT   gene            complement(21502..22362)
FT                   /locus_tag="Ent638_4211"
FT   CDS_pept        complement(21502..22362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4211"
FT                   /product="Phosphomethylpyrimidine kinase type-1"
FT                   /note="PFAM: Phosphomethylpyrimidine kinase type-1"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4211"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62816"
FT                   /db_xref="GOA:A4WGI6"
FT                   /db_xref="InterPro:IPR004625"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGI6"
FT                   /protein_id="ABP62816.1"
FT                   /translation="MISRVTQAQGLARTADIISIQSQVVYGSVGNSIALPALIKHGWHT
FT                   LAVPTFLLSNTPDNQGCYGGEISDAWFCGFLQSIQERRQDTQLRAVITGYLGSTSKAER
FT                   VFAWLNQIATQNPGILIVVDPVMGDDDTGYYVDPDLTFWYRNHLLPLATGLTPNRFELE
FT                   CLMGKTLITEQEIISAALTFLNDKTQWVVVTSASHTENSQMLKIICVSASIVHIVEHAA
FT                   LPNAPKGTGDLFTAELTAGLLRGFSLENAVKTASELTRVCVMNSLIDGTDMLDIQRLES
FT                   GELKC"
FT   gene            complement(22367..23176)
FT                   /locus_tag="Ent638_4212"
FT   CDS_pept        complement(22367..23176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4212"
FT                   /product="alanine racemase domain protein"
FT                   /note="PFAM: alanine racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4212"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62817"
FT                   /db_xref="GOA:A4WGI7"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGI7"
FT                   /protein_id="ABP62817.1"
FT                   /translation="MKNTENSTKLLTLRDTQPRCEMHNRWPRAESVQDFIDNLAAVQSR
FT                   IDAACQRSGRNVSDVRLLPVSKTMDEKHIRMAHQAGCNFLGENKVQEAWRKSQAMLDLT
FT                   DLKWSVIGHLQSNKAKLVARFASEFQALDSFNTAEILDRRLQVEGRTLNVFVQVNTSAE
FT                   PSKFGLAPETVVDFMAQLSTLKNIKLIGLMTLAEFTSDAERVRSCFIRLRKLRDQLANV
FT                   YGNLQLSMGMSGDFEIAIEEGANIVRVGQAIFGARSLPDEYFWPKGE"
FT   gene            23246..24544
FT                   /locus_tag="Ent638_4213"
FT   CDS_pept        23246..24544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4213"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH;
FT                   aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4213"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62818"
FT                   /db_xref="GOA:A4WGI8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGI8"
FT                   /protein_id="ABP62818.1"
FT                   /translation="MNINGKTAGDIFEQIRAMIQAGELVPGMMLPTLRELAGELGINRN
FT                   TVALAYKRLTDAGFVISRGRNGTIVREHIMLTDIEGSASNLVLRDLASGNPAVTLLPSM
FT                   SQLAVHIQNTPGLYGETVIRPELEALGLEWLKQDIGSPFDLNLTNGAVDAIEKVLTSYL
FT                   IAGDRVAVEDPCFLSSISTLRHNRFQVAPVEIDVEGMKIESLSRQLSAGVKAVIITPRA
FT                   HNPTGFSLSFKRAEGIRTLLASHPHVLVIVDDHFSLLSTHDYYHIVPGNTRNWVLIRSM
FT                   SKSLGPDLRMAFVASDADTSQRLRLRLNSGTNWVSHILQDMVVGHMHSSGFQKSILSAR
FT                   ESYFEKRELMVNALKQHGVKVPDHHDGLNVWIPLTQNSAPIVMQMAQRGWLIRGGEGFN
FT                   LNNSGSGVRITISDLDATETKLIAKSLAEILTQ"
FT   gene            24609..25328
FT                   /locus_tag="Ent638_4214"
FT   CDS_pept        24609..25328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4214"
FT                   /product="glutamine amidotransferase class-I"
FT                   /note="PFAM: glutamine amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4214"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62819"
FT                   /db_xref="GOA:A4WGI9"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGI9"
FT                   /protein_id="ABP62819.1"
FT                   /translation="MHVHFIVHEDFEAPGAYEIWARNHGHDVTFTRVYDGDKLPQEAEN
FT                   IDFLIVMGGPQTPITTQEDCAHFNSKNEQILIDSAVKTGKAVIGVCLGSQLIGEALGAP
FT                   FDHSPEKEIGKFPITLTEDGCKDEMFSHFAKTLEVGHWHNDMPGLTPDAKIIAYSEGCP
FT                   RQIVAYTDRVFGFQCHMELTRDVVEMLIANSEKDLSCAADFRFVNTPEELRSHDYNEMN
FT                   QVLFSFLDKLEARYKSF"
FT   gene            complement(25475..25771)
FT                   /locus_tag="Ent638_4215"
FT   CDS_pept        complement(25475..25771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4215"
FT                   /product="plasmid stabilization system"
FT                   /note="PFAM: plasmid stabilization system"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4215"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62820"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGJ0"
FT                   /protein_id="ABP62820.1"
FT                   /translation="MKEIELTPKAEEDLEAIWDNSFRQFGVVQADAYIGRIAAVFDVLA
FT                   MHDIGTHRAELGENICSLPVEQHMVYFLSSHSVVTIIRILSQSQDTMRHEPWR"
FT   gene            complement(25758..26018)
FT                   /locus_tag="Ent638_4216"
FT   CDS_pept        complement(25758..26018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4216"
FT                   /product="putative transcriptional regulator, CopG/Arc/MetJ
FT                   family"
FT                   /note="TIGRFAM: putative addiction module antidote protein,
FT                   CC2985 family; PFAM: CopG domain protein DNA-binding domain
FT                   protein; protein of unknown function UPF0156"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4216"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62821"
FT                   /db_xref="GOA:A4WGJ1"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR022789"
FT                   /db_xref="InterPro:IPR038296"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGJ1"
FT                   /protein_id="ABP62821.1"
FT                   /translation="MARTMTVDVGDELREFIDALVKAGDYRTQSEVMRDALRLLREKQA
FT                   ESRLQTLRDLLAEGISSGEAKPWNKDAFLKNVRARVANERD"
FT   gene            26572..27816
FT                   /locus_tag="Ent638_4217"
FT   CDS_pept        26572..27816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4217"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62822"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGJ2"
FT                   /protein_id="ABP62822.1"
FT                   /translation="MTSLLKDRQPSPLQKRVLIVLAALDARHPGTPVPTRLIERLLTEG
FT                   GHGPVYGPNLRASCRRMEMAGWLRTLRAQNLQLAVELTDAGRKLATPILAEEQASQMAE
FT                   QRATEVRVLPLATHSQADEADDRPVELDDRWHLVCRGDYVIRLDGTTCLQLWNTAGQVT
FT                   RLEGDPLQVAAWLQACHDAGIAVRVQINESAAPEEGSPDGTAPADLTGTWYRQLDTALQ
FT                   ALGITGLTEDIRLAVVSPEASLRMLPAPARLLHVLRDADPLTVATYEEDTEAALADLLT
FT                   RAGFTGDQAQELQWHRIRWPLMDQEEADRRELNSLLDELEQRQLYCNRGQLTEIVFSPV
FT                   RKPGERWTDRMQWLLMTDAFGFRSPLSRDAGSRALAILAGYTGQEVADHLARVIVWNDA
FT                   GAVAGTSSFPRPHEE"
FT   gene            28765..29100
FT                   /locus_tag="Ent638_4218"
FT   CDS_pept        28765..29100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4218"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62823"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGJ3"
FT                   /protein_id="ABP62823.1"
FT                   /translation="MNDFHILSLCIRNKDVAGAMHVLRDKSEFAARKILKKIKVTVTSL
FT                   TGRVFWHDVQRWLLNACRQENTQHEPSGSRRPWGQLGKRKISYAKTNFLADSFVRKADS
FT                   KIICDSI"
FT   gene            complement(29162..30070)
FT                   /locus_tag="Ent638_4219"
FT   CDS_pept        complement(29162..30070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4219"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; AraC-type transcriptional regulator domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4219"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62824"
FT                   /db_xref="GOA:A4WGJ4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGJ4"
FT                   /protein_id="ABP62824.1"
FT                   /translation="MQEFSVEQSLKMLAEKISEIAQYDGDFTTAVPSLSVHRRNAPTTP
FT                   VHCIYGIGLGVVIQGSKELVLGGKVTGYRAGQTLLTTLELPVVSHVATATASAPFLGMM
FT                   VTIEPAALMQTAAMIPFRPAAKSPGFDPLAVNELDAGLADTLRRLLSLNDEPRLIQHLA
FT                   PLIQQEIIIRLLTGPYGSALRHIASPGSPGQQISGAVAWLKQHFTQPVSIDELASRSSM
FT                   STSSFRHHFRSVTGMSPLQFIKKLRLQEARQQMLNSRLDAVSAAIKVGYESASQFSREY
FT                   SREFGESPQRDIRRLREEISQ"
FT   gene            30258..31352
FT                   /locus_tag="Ent638_4220"
FT   CDS_pept        30258..31352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4220"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4220"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62825"
FT                   /db_xref="GOA:A4WGJ5"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGJ5"
FT                   /protein_id="ABP62825.1"
FT                   /translation="MTGLFSSFSLKDITLRNRIAVSPMCQYQAVDGFINDWHSAHYSML
FT                   ARGGAGLVVVEATAVAPEGRITPGDVGLWSDEHTAGLSSIAAAIKTAGAVAGIQLAHAG
FT                   RKAGCTPPWQGGAPLDRDDALAWEPVGPSAVPFVPGNDYIPREMTKDNIRQTQQDFARA
FT                   AERACQAGFQWLELHFAHGFLAQSFLSPQSNTRSDEYGGSLEGRARFLLETVAEVRKFW
FT                   PDNFPLTVRLGVVEFDDCPEHSFSESLKVIGWLKDAGVDFVDVGLSLATPGENIPWAAN
FT                   FMVPWAARVRREKNIPVGTSWMITQAKEANEFIQDGKVDVIFFARTLLANPHWPYRAAR
FT                   ELEITDPHAVLPTPYAYWLQNWSE"
FT   gene            31444..32616
FT                   /locus_tag="Ent638_4221"
FT   CDS_pept        31444..32616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4221"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4221"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62826"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGJ6"
FT                   /protein_id="ABP62826.1"
FT                   /translation="MSQPKTRPAQRTESISAFSRRNFLSSSALMGAGLIMGSLPDRAHA
FT                   TSSEPTAKPAQARQGSQTMPTRKLGSMVVSALGAGCMSISANYGAAADKSQGIRTIREA
FT                   HARGVTLFDTAEVYGPYTNEELVGEALAPVRNQVFIASKFGFDIQHGGLNSQPKHIRKV
FT                   LEASLRRLRTDRIDLYYQHRVDPGVPIEDVAGTIQDLIKEGKVLHFGLSEASPSTIHQA
FT                   HAIQPVTAVQTEYSVMNRDPEHNGVLDTCEELGIGFVPWGPIGMGYLTGTVSVNTHFDP
FT                   KTDLRSTFERFTPENLANNWPFVEKLKAIADSKGATPSQIALAWLLAKKTWIVPIPGTR
FT                   NINHLRENHGALEIQLTTTELSEMDKAMSGLRVYGGRMNSAQMDLVEPKA"
FT   sig_peptide     31444..31575
FT                   /locus_tag="Ent638_4221"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.944) with cleavage site probability 0.776 at
FT                   residue 44"
FT   gene            32658..33386
FT                   /locus_tag="Ent638_4222"
FT   CDS_pept        32658..33386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4222"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4222"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62827"
FT                   /db_xref="GOA:A4WGJ7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGJ7"
FT                   /protein_id="ABP62827.1"
FT                   /translation="MNIEKKKRVAVVTGASSGIGEALARELAGNGIQVVLLARRFERID
FT                   VLASELGHGAIAIKADVTDRESIVAAANQVEQTLGGVDILINNAGVMLTGPFDSSQLDE
FT                   HRQMVETNLLGAMTVTEVFLPQLRRNKGDLVNISSVAGRVAPSGFAVYAATKWGINGWS
FT                   EALRVELQPDIRVMVIEPGAIATELADHITHEESQSVAKSALDWAIPPSDIAEVIAFAV
FT                   NLPKRTSINEILIRPTVQMM"
FT   sig_peptide     32658..32732
FT                   /locus_tag="Ent638_4222"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.954) with cleavage site probability 0.944 at
FT                   residue 25"
FT   gene            complement(33460..34044)
FT                   /locus_tag="Ent638_4223"
FT   CDS_pept        complement(33460..34044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4223"
FT                   /product="Resolvase, N-terminal domain"
FT                   /note="PFAM: Resolvase, N-terminal domain; Resolvase
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4223"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62828"
FT                   /db_xref="GOA:A4WGJ8"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGJ8"
FT                   /protein_id="ABP62828.1"
FT                   /translation="MSRVFAYCRVSTLEQTTENQRREIETAGFAVKSQRLIEEHISGSV
FT                   AASERPGFSKLLDRMQNGDVLIVTKLDRLGRNAMDIRKTVEQLAASDIRVHCLALGGVD
FT                   LTSPAGRMTMQVISAVAEFERDLLLERTHSGIARAKAAGKRFGRPSVLNEEQQLTVIVR
FT                   INAGISISTIAREFNTTRQTILRVKSGHQQS"
FT   gene            34205..37189
FT                   /locus_tag="Ent638_4224"
FT   CDS_pept        34205..37189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4224"
FT                   /product="transposase Tn3 family protein"
FT                   /note="PFAM: transposase Tn3 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4224"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62829"
FT                   /db_xref="GOA:A4WGJ9"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGJ9"
FT                   /protein_id="ABP62829.1"
FT                   /translation="MPRRQILSSEEKERLLVVPDDDVLLTRMCFLSEPDLALINKHRRP
FT                   ANRLGFAVLLCYLRGPGFPPDKNMSPHDGVVSRLAAHLKLQPDLWAEYASREVTRWEHL
FT                   AELYRYLELSPFNRALQKTCIRHLYPHAMRTDRGFLLAEEMLSWLHNNNVIFPSVDVIE
FT                   RTLAEAATLADRAVFSALITQLEPGHKAALDRLLVSEGEQPSRLAWLLQPPGKINGKNV
FT                   LQHIDRLNAIEALALPDGIALSVHQNRLLKLAREGRKMSSRDLAKFTDVRRYASLVCVI
FT                   SEARATLTDEVIDLHERILGSLFSRAKRTQAERLQQTGKLIQSKLKQYVTIGQALLNAR
FT                   ESGEDPWAAIEDVLPWQEFINSVEETRFLSRKDNFDPLHLITEKYSTLRKYAPRMLSAL
FT                   QFRAAPAALQLSDALDTVREMYRKQLRKVPPSAPTGFIPESWRKAVITPTGIDRKYYEF
FT                   CVLNELKGALRSGDIWVKGSRRYRNFDDYLIPSDDFEKSLRDNQLSLAIPTDCHEYIKN
FT                   RMTLLTSRLEEVNAMALAGDLPDVDISDKGVKITPLDNSVPSAVSPFADLVYGMLPHPK
FT                   ITEILDEVDGWTGFTRYFTHLKNKHVRPKDRKLLLTTILADGINLGLTKMAESCPGTTK
FT                   SSLEGIQAWYIRDETYSAALAELVNAQKQRHLAAFWGDGTTSSSDGQNFRVGSHGRYAG
FT                   QVNLKYGQEPGVQIYTHISDQYSPFYTKVISRVRDSTHVLDGLLYHESDLEITEHYTDT
FT                   AGFTEHVFALMHLLGFAFSPRIRDLHDKRIFIQGKAERYPGLQSVISTTPLNLKDIETH
FT                   WNEVLRLASSIKQGTVTASLMMKKLASYPKQNGLAKALRVIGRIERALFMLDWFRDPSL
FT                   RRRVQAGLNKGEARNALARAVFMHRLGEIRDRGLENQSYRASGLTLLTAAISLWDTVYI
FT                   ERAIDSLRRKGIPINEQLISHLSPLGWEHINLSGDYVWRTNLKLGQGKYRSLRSVDSGL
FT                   YKKQA"
FT   gene            complement(37754..38581)
FT                   /locus_tag="Ent638_4225"
FT   CDS_pept        complement(37754..38581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4225"
FT                   /product="transcriptional regulator, LysR family"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4225"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62830"
FT                   /db_xref="GOA:A4WGK0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGK0"
FT                   /protein_id="ABP62830.1"
FT                   /translation="MRRKNVNDYQAFIAVAREKSFTKAAAQLGVSQSALSYTVRTLEAD
FT                   LGLRLLTRTTRSVSVTEAGERLLSRVGPHFDEIESEIAALSGLREKPAGTVRITAVEHA
FT                   ADTILWPKLVPVMLEYPDINIEIISEYGLKDIVAERYDAGVRLGEQVDKDMVSLPLARD
FT                   FRFAVVGAPSYFMGKAFPGTPRDLNDHSCIRLRLPTHGGFYTWEFRKDETEIKVRIDGR
FT                   ATFSTINMMRQAALDGLGLAYLPLDTVENYLENGMLVQVLTDWCPPCMNRAHG"
FT   gene            38858..39097
FT                   /locus_tag="Ent638_4226"
FT   CDS_pept        38858..39097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4226"
FT                   /product="addiction module antitoxin, RelB/DinJ family"
FT                   /note="TIGRFAM: addiction module antitoxin, RelB/DinJ
FT                   family; PFAM: RelB antitoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4226"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62831"
FT                   /db_xref="GOA:A4WGK1"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGK1"
FT                   /protein_id="ABP62831.1"
FT                   /translation="MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLP
FT                   FKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL"
FT   gene            39097..39204
FT                   /locus_tag="Ent638_4227"
FT   CDS_pept        39097..39204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4227"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62832"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGK2"
FT                   /protein_id="ABP62832.1"
FT                   /translation="MAYFLDFDERALKEWRKLGSTVREQLKKKLAEVLE"
FT   gene            39235..39384
FT                   /locus_tag="Ent638_4228"
FT   CDS_pept        39235..39384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4228"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4228"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62833"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGK3"
FT                   /protein_id="ABP62833.1"
FT                   /translation="MHDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGKRERSEVYSEAV
FT                   KHIL"
FT   gene            complement(39764..40753)
FT                   /locus_tag="Ent638_4229"
FT   CDS_pept        complement(39764..40753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4229"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4229"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62834"
FT                   /db_xref="GOA:A4WGK4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGK4"
FT                   /protein_id="ABP62834.1"
FT                   /translation="MILMPQDDPALNVIPAGLSPEDDFLPVLAGGELPLSPARAYLLSL
FT                   NSPRSRQTMASFLNIVAGMLGAASLETCSWGSLRRHHVMGVTELLRDTGRATATVNTYL
FT                   SALKGVAKEAWMLKLMDVESFQHIRAVRNLRGSRLPRGRALPAEEIGKLFAVCEADATY
FT                   LGVRDAALLGVILGCGLRRSETVGLSLSDVVTHERALRVLGKGNKERLAYMPAGTWQRL
FT                   QTWIDQVRGEAAGPLFTRIRRFDTLTNDRLTDQAVYHILQMRQRQAQIERCAPHDLRRT
FT                   FATAMLDNGEDLITVKDAMGHASVTTTQQYDRRGEERLRQARDRLNLT"
FT   gene            complement(43065..43541)
FT                   /locus_tag="Ent638_4230"
FT   CDS_pept        complement(43065..43541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4230"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62835"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGK5"
FT                   /protein_id="ABP62835.1"
FT                   /translation="MKIRLIALSLLVSATLLNHAIAAPPDPELLFNCDLSNGKGVVVRL
FT                   NNDVPTYYYGTIDKVEMTLPKSEGDKTQVRAGQVPFSGGGASYYRFINGVYSYVVYSGI
FT                   GKGWEFTGLKVYKNAKLLMKKECTNGGFLSQTYRGENLVQESDTGDDGTYGYSD"
FT   sig_peptide     complement(43473..43541)
FT                   /locus_tag="Ent638_4230"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.931 at
FT                   residue 23"
FT   gene            complement(43598..44080)
FT                   /locus_tag="Ent638_4231"
FT   CDS_pept        complement(43598..44080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4231"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62836"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGK6"
FT                   /protein_id="ABP62836.1"
FT                   /translation="MRYLLLAVGALLLSGCATDARDCDPTTGDVSIVNKFNCNYSGTWD
FT                   KRVDDKQNTLAHEQILNAEFKAVNEAIEKEKAQSHASVASKRQSQQALQSSLNKLVAQL
FT                   KTKTAGRADAQKQVTDLEKSIKEAQNRPSDSVMQKQMELQKLQGQLAELQTTLASQ"
FT   sig_peptide     complement(44018..44080)
FT                   /locus_tag="Ent638_4231"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.965) with cleavage site probability 0.809 at
FT                   residue 21"
FT   gene            complement(44091..44795)
FT                   /locus_tag="Ent638_4232"
FT   CDS_pept        complement(44091..44795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4232"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62837"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGK7"
FT                   /protein_id="ABP62837.1"
FT                   /translation="MVTFKALRTAAVAGLMVVLAGCQSSGSSSSGGVDPRLANNQDVEF
FT                   FNKSGWQACAGGAALGALACAVSNSSNKAVCMAAAAVAGCGVGIGANAYLDNQRKKYAS
FT                   KELQLDAAIKDVENENARIQNATNVAKSVIASDKQTLASIEKEMAAKTAKKEVVQKQIK
FT                   GVDANIAYLRNTITDMKKHEKQWQDVSASMDKTGSDTKNLDSKIALMHDKIGSLQGELD
FT                   SLYTQRTALKVG"
FT   sig_peptide     complement(44703..44795)
FT                   /locus_tag="Ent638_4232"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.425 at
FT                   residue 31"
FT   gene            complement(44819..46354)
FT                   /locus_tag="Ent638_4233"
FT   CDS_pept        complement(44819..46354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4233"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4233"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62838"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGK8"
FT                   /protein_id="ABP62838.1"
FT                   /translation="MKFKLALGLSLMGLGYSCAVQATWDEKFWNPKPLADDVILPMPCD
FT                   GAMAFRKVAIPQNKPLEDYNIVLGQEGDAWGFVEQSRQEHIAGSFPDPKNKGRYYLIAK
FT                   YELSDLQFRALSGECPKPDIKGRLPKVSIGWMDAMAFANQYNLWLRKEKLASLPKDDGQ
FT                   PGFLRLPTETEWEFAARGGLAVSPSEFRDQSFPMPEGLNGYVWFAGAQSANGKLQLTGM
FT                   LKPNPLGLHDIMGNVAEMMFEPFRLNKLDRLHGKAGGYVVRGGSYVTTQGDIRSALRGE
FT                   EPYYTDSGENVSKTTGVRLVMVSTTLTSRDRVKEIEKEWQALGSGQKTAAKGKAPDSLQ
FT                   NLNAISAKVQDDGLKKELEKLRGELRANSQLRDEQRDQAIRTSLQLGAFLCTKMKDDGE
FT                   FLERLNQLYSKTCAADSQLDANCARRQEQLGQHQKALDFISSYYADTLVDMGSTYNKPL
FT                   IDPQIAVVQQQMAARGKTNLNGYLDTYWNNLQGYWKDGKVARDAWLMACKKNN"
FT   sig_peptide     complement(46286..46354)
FT                   /locus_tag="Ent638_4233"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.858 at
FT                   residue 23"
FT   gene            complement(46344..47576)
FT                   /locus_tag="Ent638_4234"
FT   CDS_pept        complement(46344..47576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4234"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4234"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62839"
FT                   /db_xref="GOA:A4WGK9"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGK9"
FT                   /protein_id="ABP62839.1"
FT                   /translation="MSSYPVDRPSERGLLWRMALRDLVHDRKVALCIIFSLIAVIAPLL
FT                   LLFGLKNGIVSQLRHQLLDDPRTREVRITGNGNYDFSWLEQLAERPEVGFSIPLTRSLN
FT                   TQADLVRDGQHFVAGAEVIPTGSGDPLLSDVVVPRQDNQVVLSASAARRLDLKPSDSFR
FT                   LMVNRKVEGQNQRAAFALTVSGVLDDARFARPGAFVTLPLLVALEDYRDGYQVPLLQVS
FT                   EGKPPRERTRFSRARVYASSLDDVPVLARWLEEQHIEAVTQAAQIEAVQAIDRVLGVIF
FT                   GVIAWISATGCIASLIGAFIANIDRKRKDMAILRLLGFRRRAVTLFIVIQALFLTSVAF
FT                   AAGLVLYLLGSTLFNRVLGTSLPDQAFVCHLEPLHYFAALLCVLVVALSVAAIGALRAL
FT                   KIEPAESLREI"
FT   gene            complement(47557..48243)
FT                   /locus_tag="Ent638_4235"
FT   CDS_pept        complement(47557..48243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4235"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4235"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62840"
FT                   /db_xref="GOA:A4WGL0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGL0"
FT                   /protein_id="ABP62840.1"
FT                   /translation="MLHIRDMDIRRGGAQGFYVSLPALTLRPGEVAALTGPSGCGKSTL
FT                   LEMTGAILRPGTLGAYQLGERDIAAPLLAEDEPALAAIRARDLGFMLQHGGLLPWLSVM
FT                   ENITLARRLAGLTTQSSWLETAIDTLGVRHLLKSLPSRLSIGERQRVAFIRAIAHQPRL
FT                   LLADEPTAALDPDNASRLFALIVDMVRTLEMTAIVVSHDWQRVEQFGLQRYTASIEEGK
FT                   SVFLPG"
FT   gene            complement(48243..50198)
FT                   /locus_tag="Ent638_4236"
FT   CDS_pept        complement(48243..50198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4236"
FT                   /product="von Willebrand factor, type A"
FT                   /note="PFAM: von Willebrand factor, type A"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4236"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62841"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGL1"
FT                   /protein_id="ABP62841.1"
FT                   /translation="MKKSYGFSGLLCAAALSLPAHAADTKPLLQEGKHTLFQRVLTYPG
FT                   CMLAAKAGEAGKEQPAFSRFYVYQREKQGQDEWLQVGPDSFGHVSGWMKSSCTVDWKVQ
FT                   LTLAFTNPAGRHPMLFFKEKGDVESLLNNAKPAAALEPMIASLNQKKPVPQVLAREPDY
FT                   MVDQLKNFYLLPVLGSDDIFTDTGFQVRVLNVASVSENGSATTSAKATDEKNMMKGFSA
FT                   SVVFVIDSTISMGPYIDRTKEAIDKIYKQIEKEQLQDKVKFGLVAYRSSVKAVPGLEYD
FT                   AKMYVDPNTVKDGKDFLAKVHDLKQATVSSSKVDEDAYAGVMTALDKVDWTQFGARYVV
FT                   LITDAGALDGTDSLSSTHLGAEQVRQEAAYRGVALYTLHLKTPDGKKNHASAAAQYQEL
FT                   TLNPFLHKPLYYPIDSGDVNSFGTIVDSLSNAITAQIKTAWSGEETAGSALGASPEYAG
FT                   KKADPLLSDAEKLSKAMRLAYLGEKQGTQVPPVFKSWISDRDLVNQNLPATEVRVLLTK
FT                   SELSDLNDVMKKIVNAANEGMISPDDMFASLRSLAATMGNDPNQAKGKNATRLGEMGLL
FT                   GEYIESLPYLSEVLSLDEETWKSWDGLEQERFIRRLNTKLNYYQRYNEDADRWIALAPD
FT                   SDPRDNVYPVPLENLP"
FT   sig_peptide     complement(50130..50198)
FT                   /locus_tag="Ent638_4236"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(50208..51143)
FT                   /locus_tag="Ent638_4237"
FT   CDS_pept        complement(50208..51143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4237"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4237"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62842"
FT                   /db_xref="GOA:A4WGL2"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGL2"
FT                   /protein_id="ABP62842.1"
FT                   /translation="MIKPELKPLNPVNPGYATLLLKGWKGGIVGVEISILRNQDNLYLD
FT                   SRGGWVSGEMFLGLPALGLVDDVPAVQVGPSFIDPLLANRQAAYRIAIKDSGARDMGIL
FT                   AITDGLLSSQAGGENPLAANSQTLDVTTPAQPAPVVEAPAPDPVVDVPAAPAKSKAPMA
FT                   IILAVIALLLAAAAAGWWFMRQPAPAPAAPVAKISGPCGDDLMNSGNAMDFVKGCLRSQ
FT                   PSSAQLLDVITKAKADKKCDVAQRLYAYKAQSGDSQMAMRYAQEYDPKSAQAEGCFSPD
FT                   PQTASYWYEAVVNQDPQNAEAKARLAELKK"
FT   gene            complement(51150..53795)
FT                   /locus_tag="Ent638_4238"
FT   CDS_pept        complement(51150..53795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4238"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4238"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62843"
FT                   /db_xref="InterPro:IPR017030"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGL3"
FT                   /protein_id="ABP62843.1"
FT                   /translation="MSTHNSANIIQGWQGVEQGAGQAIDWIAAVRQDAPRLNTEADRLT
FT                   LNLRRSRNKARRLAQAAARPMTIGFFGLSQAGKSYLISALAAGENGKLGTVLGGHQLDF
FT                   LTHINPPGGGKEATGLVTRFSRLKHNDDQNWPVRLQLFSEVEMAKILANAFVHDFNQEK
FT                   FDWNYDEGRISDLLATLEKRRRPTRVPGVTEDDVVSFWDYLVRHAEKTQSRFALHYWPQ
FT                   AVNLAPWLTTDDRAQLFSVLWGEVPELTRAYGHFAQTLQRLGGAQEVRAPLSTLVVEEN
FT                   GLLIQKNSIMNVDMLEHLNQPHDPRIEVCPVQEDRLAAPVAISLAELTVLTAELHVPLS
FT                   APTTAPLFDKVDLLDFPGYRGRMSIDTFNAKSAEGEGGSRLAELILRGKVAYLFERYTE
FT                   NQEMNVLVLCTPSARQSDVSDVGDALDEWISRTQGADADVRSRRLPGLVWALTMFDNRV
FT                   TGALGHEEALLRQYWGQGGMIKMAMLEKFGKYSWMSEWKTGETFNNTFLVRKPGMPTPF
FT                   IRMSSGSEVALSEDNAEQLMLMRKTFLEDDAVNRYIASPADAWDAMLNLNDGGMNRMAS
FT                   YLSKVARPENKLERIAEQLEESRNELVQGGLGNWYQPDGDEEVAKKARIAQEIVAAVKK
FT                   RNGMHGELLARLVPTRRSLHALYMQQVSLPGAAEEDVFDIGLDDAHGSASSVKSHSHEV
FT                   AFARQSVQHWINHLRGLPETPAMLNYIGLPRATAEELVDELITGLLRLRAEEALVAVMQ
FT                   NTDQAGVRRDWMVDRQVSRVLHVMSDFMTWLGYQIVPEKKRPTRQNQPDQPIFTRPAQC
FT                   DSVVWKDDERLVSLTPQQLNYSGYFILDWLIGLEALITENAGHSAGREISVAQNEKLGA
FT                   ILNLIQRSQE"
FT   gene            complement(53795..56797)
FT                   /locus_tag="Ent638_4239"
FT   CDS_pept        complement(53795..56797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4239"
FT                   /product="virulence protein SrfB"
FT                   /note="PFAM: virulence protein SrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4239"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62844"
FT                   /db_xref="InterPro:IPR009216"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGL4"
FT                   /protein_id="ABP62844.1"
FT                   /translation="MLAELTDFKKQVKIIRDSGIQFLDFAFTLPARKEYGDFLRQNGDG
FT                   AILRLVYNEREDKLQIPAADNAAPQFAESDYSLTTEESLHLYQGLWLPLPFFRFNPPRA
FT                   FAHGPTNWARVQFHELAEPDEKGNTWRAILIFDTKIFPDRDNTQYLAPSEDDVRSGAGF
FT                   ALALHPHEMGDFLTLPWVDEWLREVFSTQARDVLRQHAEDIDEKLGQKEHQAHYLNLLN
FT                   ILDATVAIPEVQVNDVKIRDSAIPVDLVLDIGNSRSCGILIEEHRDDNKGLSQLYQLQL
FT                   RDLSQPQNVYNEPFDSRLEFAQAEFGKQDFSLKSGRSDAFTWPTIGRVGDEAFRMAAQR
FT                   LGTEGSTGISSPKRYLWDDQPYSPGWRFSQAFVKSDREPLATAAPLLYMLNDQGKLLIR
FT                   LPEDERMPVFSPVYSRSSLMTMMLSEVLSQALMQINSPAQRLKMNHASTPRRLRNVIMT
FT                   VPPAMPKPERAIFEQCMLDAIRLVWKALGWEEMDDESEDNEQLKHPRPGVHVKWDEATC
FT                   GQLVYLYNETQTYFGGRTDEFFAATRRPDNAPAANAPRSLKVASIDIGGGTTDLVISRY
FT                   TLDDGEGINVRITPKQLFREGFKVAGDDILLDVIRLYLQPAVKAAIVKVGHSDMTAESM
FT                   MSQLFGSESIEAGKQVLRQQLTLQIFAPLALAILHRYEEYSPESGREQLSFTFRDLLTE
FT                   NMPTQKVQDYVNDVVRMGQLSSEALFSILDVPLEIDLANLHNEFINPRSGRMNICHSLR
FT                   ALCEVLWHYNCDVLLLTGRPSRLPGIQALIRQLQPVPPSRVLPLHGYETGGWYPFNKKG
FT                   CIDDPKSTASVGAMLYLLAENSRLSSFFFRTQNFVPYSTIRYLGMLDGNNLIKDSNVFY
FT                   RDIDLDAPAFQLPQGQSFDARGEVRIGFRQLDNERWPASALYTLKIANPNLASELAGDA
FT                   MMRIELTAEQGRPRNGIEAVSPEKFRIESLETDHARRNYNRKDVAFQLNTMVGNGLSET
FT                   HYWLDSGSIKS"
FT   gene            complement(56798..58195)
FT                   /locus_tag="Ent638_4240"
FT   CDS_pept        complement(56798..58195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4240"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62845"
FT                   /db_xref="GOA:A4WGL5"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGL5"
FT                   /protein_id="ABP62845.1"
FT                   /translation="MFLCSDKLDKYQSMGENGQAVHISALQLRETLRLRKQSAVADTLA
FT                   IPQVNEYGDRIDWYAPATGDVIPWSASTESERQAALSQLENSHAVLRQFSSEYSQHSNP
FT                   EQRLFGQLLEKAMQFPDQNHVWLVGGKPVMSFWGFVNARHPSRVDPLDCLRPPVPLAPA
FT                   VATPAAPVVAEPLTERPVTRRGWWWTLPAWLRWLLPLLLLALLIMLLLRSCVPGFSIPG
FT                   FSATLPGLPDAHLKMPSVNTDLPGTTGTGGNGLSLNGSGASLPDSSLPSANLSANGKIP
FT                   ANGEPPAAPALPDEAPAENPSPVDPVAPESAAQTPIPDATPGLTQPDVTPGNSLPGVKA
FT                   PLTIPTDALAQGNTDFLNGRWHAGAGIQDQRTGKPLSLNYQINDGKGEVQMVRGDGVTC
FT                   RGAVNAAIQSGNLAINNQGEAQCSDGSVYQMPEVQCAPGAQNIADCKGRYDANTLFPIS
FT                   MKQEASK"
FT   gene            complement(58466..59671)
FT                   /locus_tag="Ent638_4241"
FT   CDS_pept        complement(58466..59671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4241"
FT                   /product="von Willebrand factor, type A"
FT                   /note="PFAM: von Willebrand factor, type A"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4241"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62846"
FT                   /db_xref="GOA:A4WGL6"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGL6"
FT                   /protein_id="ABP62846.1"
FT                   /translation="MIRITRTVEHSESVQNYINLYPSFISLVEQHLSAGYKNLFARPHQ
FT                   ASDGAIEWYSDINGQPVSLIALPPAEKEHARVLLQQKLVVIDQLYQKLSMNNSAPVDVM
FT                   QVLSLASCQSDERGVWVVDGQPVITAWCESPAVPVSPVASKGRRWWWLLLALLVLLAFL
FT                   LLRGCMPTAKLPVQGAPAPAPLPIKQICPAKRTKQQAPEMVLIFDASGSMSISMDITPD
FT                   ELRRLMQDRPVKNFDREPRRISLAHRSAKQLIDEVPKDMDISLVSAATCQQVSVTPALS
FT                   FAQRDELKYAIDNIQPVGKTALAEALEKAGKLVDGVDRDAIIVLITDGEETCGGDPCVV
FT                   AQQLKQQKPRLQVNVVDIMNTGAGNCIASQTGGSVYAVNNTHEFNEMMNQAIKEYIPEA
FT                   CD"
FT   gene            complement(60386..60868)
FT                   /locus_tag="Ent638_4242"
FT   CDS_pept        complement(60386..60868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4242"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4242"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62847"
FT                   /db_xref="GOA:A4WGL7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGL7"
FT                   /protein_id="ABP62847.1"
FT                   /translation="MGRVTAPEPLSSTHQLAEFVSGETVLDDWLKQRGLKNQAFRTTRT
FT                   FVVCKTDMKQVAGFYSLATGSVNHVDSTGSLRHNMPDPIPVIILARLAVDVSFRGKGIG
FT                   ADLLQDAVLRCYRVAENIGVRAIMVHAMTEEAKSFYVHHGFTASQTQERTLFLKLP"
FT   gene            complement(60856..61122)
FT                   /locus_tag="Ent638_4243"
FT   CDS_pept        complement(60856..61122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4243"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4243"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62848"
FT                   /db_xref="GOA:A4WGL8"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR014795"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGL8"
FT                   /protein_id="ABP62848.1"
FT                   /translation="MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACQAAEHV
FT                   ILDRRVFNFNDEQYAEFIDMLDAPVADDPAIDKLLARKPQWDV"
FT   gene            62692..63126
FT                   /locus_tag="Ent638_4244"
FT   CDS_pept        62692..63126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4244"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4244"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62849"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGL9"
FT                   /protein_id="ABP62849.1"
FT                   /translation="MYKSILVPIDVSEDELTRQVIPFVQAHAVINISKVHFLTVIPSFP
FT                   YYSTLGLAYSVEMPEQRELQLKAEEKLNDIVKLFKLPELKVQVHVVSGSPKDQILRLAE
FT                   TIEADLIIIASHRPDISTYLLGSNAAAVVRHAKCPVLVVR"
FT   gene            63709..72291
FT                   /locus_tag="Ent638_4245"
FT   CDS_pept        63709..72291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4245"
FT                   /product="glycosyltransferase 36"
FT                   /note="PFAM: putative carbohydrate binding;
FT                   glycosyltransferase 36; glycosyltransferase 36 associated"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4245"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62850"
FT                   /db_xref="GOA:A4WGM0"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR009342"
FT                   /db_xref="InterPro:IPR010383"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR019282"
FT                   /db_xref="InterPro:IPR033432"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="InterPro:IPR037820"
FT                   /db_xref="InterPro:IPR037824"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGM0"
FT                   /protein_id="ABP62850.1"
FT                   /translation="MNINPRAWLRRPRPLTQTPGWAPFPVNDPAGEIPLRPELFSTPQM
FT                   ERYGQKLARTHKISPDKLPYYLLKRLGENEAVITQNCYELNARKKTTIMPAGEWLLDNY
FT                   YLIEEQIRIVRQHLPKSFGKGLPSLSSPHRCPRIYDIAAEAIAHGDGRWDIASLTSYIT
FT                   AYQTVTPLTLGEVWALPGMLRLSLIENLRRVSAEVVQAQQERSLADTWITRIFECAEND
FT                   PADLIMVIADMARSRPPLSSAFVAELVRRHQGHGNALALPLTWVEQRLAEQGVTTEILI
FT                   HRFNQQLAASQLSVSNSIAGLRLLSETNWADFAETISVVEQTLRLDPAGIYSRMHFDTR
FT                   DHYRHVVELLARQSHFTEPEVANHVLALSRETTPGTQAHHIGHYLAGEGRQQLEIQLLA
FT                   ETSRLIRLRHSFNKIPLLSWLGSLSLLTTATTAGILHETAHQGMGWLLLLLALPLIVAV
FT                   SQLISDMLSEITTRFRIPLPLPRMDFSAGIPADCATMVAIPCLLTSHESICKLLTSLEV
FT                   CWLGNQDENLCFALLTDFADSPSESTEENQALLNQAITETQNLNRRYPGSRPNFYLLHR
FT                   KPEWNPLQGVWMGYERKRGKLALLNDWLRHPAAQFASVEGMPADQLPGHIKYVITLDSD
FT                   TVLPRDTAHKLIATMAHPMNKPEYDPLKLRVVKGYGILQPGLAEEIPRNGQGRYAALSS
FT                   SVPGNNPYSMMSSDIYQDLFWEGSFVGKGIYDVDIFVQATANTCPENLVLSHDLLEGCY
FT                   ARSGLLSEVLLYEQYPNNYLSDVARRTRWIRGDWQLLNWLRPHVRKADGTSVKNPLSVL
FT                   SCWKLFDNLRRSLVAPSLLVLLFCALIWVPNPFYWLGVVTLVWLLPAVLSITHDLLRKP
FT                   PRRSLRQHLSLVVASALKRLSRIALNFAILPHEAGYTLYAIGVTLWRLAISRRNLSQWA
FT                   SHNPVSDQVKVSAVRFYRAMWLNVISGIALTGLTFQFAPQLLAIALPVSILWCLAPLLM
FT                   SWLSRQPVRKVFSPNKEQKELLRQTSREIWAFFETFATAKENWLPPDNYQEIPEPTIAH
FT                   RTSPTNIGLSLLANLTAWDFGYLPGGEVLQRITQTLDSLDKMEHFRGHLYNWYDTRTLA
FT                   PLSPRYVSSVDSGNMAGHLLTLRQGLSAMRKQPVLNGEQILAGLNDTLSILERHWGQNT
FT                   PTSLRLLRKQCLSAMSLPPTHIFSALKKMRTQSNHLKMLYNQEDSFVVRWTEHLEHQLV
FT                   QLCHEWTHLLGWLTPLYKDQTLPSLNWLATATYSGEGTPTASVITQARLRLDIITELEQ
FT                   RLDDHARMDFAFLYSEATSLLSVGYNCDTNTPDKSHYDLLPSEIRLTSFLAIATNQLPL
FT                   KSWYTLGRLFTTIDNETALMSWSGSMFEYLMPNLVMPVWPGSLLDEMSQSAVMRQISWG
FT                   KERGVPWGVSESGYHAFDVQHNYQYQAFGVPGLGLRRGLADDMVVAPYATLLALPVSPQ
FT                   KACENLFRLKKTGAHGEYGFYEALDYTPSRLATGQLYAVVQSWMAHHQGMAFQALAHVL
FT                   LDAPMTARFMSSTAFQSASLLLQERVPDAVDLYSPRRHFESHEGRVKPVRYEPRIFTAA
FT                   DSPVPEVQLLSNSHYHLMMTAGGGGYSRWNNLALTRWRSDTTRDNWGAFCYISDPQTGE
FT                   IWSNTWLPTGDDSGDSDEVIFTDAGAEFRRNFGSLSVRTQIVVSPEDDIELRRVTLVHR
FT                   GRLPRTLELTTYAEVVLAPYASDLSHPAFSNLFIQTELDPDRDAILCHRRPRSEHEKSP
FT                   CLFHMMVVHGDKPKSVSFETDRAKFLGRGRSPADAMANSENGPLSNTSGSVLDPILAIR
FT                   HAVTLQPGQPITIDIVYGISESRQQSQTLLEKYRDHPIADRVFELAWSHSLVVLRQMNA
FT                   SEDDATLFNRLASAVLYPSQEWRADGQVISRNRRGQSGLWGWAISGDLPIVLLSIAREE
FT                   SIASVTTLIQAHRYWRLKGLEVDLVILNNSPGGYQQVLQAQMMDLIYAGSGASLLDKSG
FT                   GIFVRNGEHLSADDKQLLMSVAYLYLDDRAGGINEQLSLRMNTSKTPARAFISYTMTGR
FT                   NQHTDWTPDTSQLRHFNGYGGFSQDGREYQIVLKENAPTPAPWSNVLANRCIGSVISEA
FT                   GQAYSWYENAHEYRLTPWENDPVSDRSGEAFYLRDEESGAFWSPTPLPVRGKGDYLARH
FT                   GFGYSVFAHRESGIDTELTVLVAEKDPVKIAILTLSNNSGRTRKLSVTGYVEWTLGESR
FT                   TRTAPHIVTHSASIPGGCSVMANNFYGANGGGRTAFFAVSGIHCSLTGDRREFIGRNGS
FT                   LQNPTAMKQHSLTGKTGAGLDPCGALQSMVTLIDGDQRTFIFVLGAEENQAQAQATLAR
FT                   YLNEDAAHQELNRVHDYWHSVLDKIVVTTPDSTVDLLVNGWMLYQTMACRLMARSGYYQ
FT                   SGGAFGFRDQLQDSLALSHAAPERLREQIVLCASRQFIEGDVQHWWHPPHGNGVRTRCS
FT                   DDYLWLPLAVCHYVETTGDTAVLEQSIPYLEGRLLQPGEESVYDSPVISNIEETLWLHC
FT                   VKAIQHGLRFGQHGLPLMGAGDWNDGMNQVGIEGRGESVWLGFFLYDILQRFATLAEQQ
FT                   QDASVALMCRSQALQLQKNLETSAWDGEWYRRGYFDDGTPLGSKGSQDCRIDAIAQSWS
FT                   VLSGAASPDHSRRAMQALDKYLVDSDAGLIKLLSPPFDNHGPNPGYIQGYLPGVRENGG
FT                   QYTHGAIWAVMAFARMGNKARAWQLWSMINPINHTLNAGEVAKYKAEPYVMSADVYSVE
FT                   PHTGRAGWSWYTGSAGWAYRLLTEELLGIKQYGTSFTLHAQFPDEWSSFGLTYQHGYSQ
FT                   YHITVSRGGTEYKVLMDGVILPDDRIPLLDDGQNHTVDIIQK"
FT   gene            complement(72310..72546)
FT                   /locus_tag="Ent638_4246"
FT   CDS_pept        complement(72310..72546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4246"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62851"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGM1"
FT                   /protein_id="ABP62851.1"
FT                   /translation="MMKSEDTLDWYPAQLSPVKIILGNAVLEVAKQGRPINTRTLLEYL
FT                   QVMQEKQKRRDDKIAMQTAIDVLRDNQRINGRR"
FT   gene            74166..74642
FT                   /locus_tag="Ent638_4247"
FT   CDS_pept        74166..74642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4247"
FT                   /product="protein of unknown function DUF892"
FT                   /note="PFAM: protein of unknown function DUF892"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4247"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62852"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR010287"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGM2"
FT                   /protein_id="ABP62852.1"
FT                   /translation="MNISTLEDLFSHDLSDVYSAEKQILRALPKMSRAASDPQLISAFE
FT                   QHLEETRGQIERLDRLAEMTDFVSITGMTCHALEGLAEEAQEIMDSVDAGPVRDAGLIG
FT                   AAQKVEHYEIAAYGTLHALALKLGLNEAAELLAETLQEEKETDKKLTAIAGLQA"
FT   gene            complement(74970..75146)
FT                   /locus_tag="Ent638_4248"
FT   CDS_pept        complement(74970..75146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4248"
FT                   /product="GnsAGnsB family protein"
FT                   /note="PFAM: GnsAGnsB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4248"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62853"
FT                   /db_xref="InterPro:IPR012563"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGM3"
FT                   /protein_id="ABP62853.1"
FT                   /translation="MMDNDELVRKAEEEIAALIVKKTVELRKKTGKELSSIEFIPKETM
FT                   AGLEGYQIKINLL"
FT   gene            77908..78768
FT                   /locus_tag="Ent638_4249"
FT   CDS_pept        77908..78768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4249"
FT                   /product="initiator RepB protein"
FT                   /note="PFAM: initiator RepB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4249"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62854"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGN6"
FT                   /protein_id="ABP62854.1"
FT                   /translation="MTDNNFIPAQITNEGETHQLTVTSNSSVQPAILLRLGVFVPASRA
FT                   IPKGLKSGIDVSSSFSQLEFARKEGYDEVRIFGERLNISTDFSVWMGIIGAFSKYGLKS
FT                   NTIELPFTEFAALCQYDSRQFNKRLRDTIFDALTRIGTKTVQFNSKKTGDKFFTQLLKS
FT                   GKYTKDTDTITLQADERLHELYQIDYNILLRKRPYHMLKGKEVAQTLYTYIASLPDNPA
FT                   PIRFDRIIERLNLTSPVKEQNRLIKAALKQLHDIGYIEYSIVKDGRTLTVLIHKRNKKL
FT                   KELQP"
FT   gene            79308..80474
FT                   /locus_tag="Ent638_4250"
FT   CDS_pept        79308..80474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4250"
FT                   /product="Cobyrinic acid a,c-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4250"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62855"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGN7"
FT                   /protein_id="ABP62855.1"
FT                   /translation="MGLMNTLDQCIAAGHEMTKAIAVAQFNDDSPEARKITRRWRVGEA
FT                   ADLIGVSSQAIRDAEKAGRLPHPDMEMRGRVEQRVGYTIEQINHMRDVFGTRLRRPNES
FT                   VPPVIGVAAHKGGVYKTSVSVHLAQDLALKGLRVLLVEGNDPQGTASMYHGWVPDLHIH
FT                   ANDTLLPFYLGERDDASYAIKPTCWPGLDIIPSCLALHRIETELMGRYDEGKLPTEPHM
FT                   MLRLAIETVAQDYDVIVIDSAPNLGIGTINVVCAADVLIIPTPAELFDYTSALQFFDML
FT                   RDLLKNVDLQGFEPDVRILLTKYSNNNGSQSPWMEEQIRDAWGSMVLKNVVRETDEVGK
FT                   GQIRMRTVFEQAIDQRSSTGAWRNALAIWEPVCNEIFDRLIKPRWEIR"
FT   gene            80474..81442
FT                   /locus_tag="Ent638_4251"
FT   CDS_pept        80474..81442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4251"
FT                   /product="parB-like partition protein"
FT                   /note="TIGRFAM: parB-like partition protein; PFAM: ParB
FT                   domain protein nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4251"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62856"
FT                   /db_xref="GOA:A4WGN8"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR040873"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGN8"
FT                   /protein_id="ABP62856.1"
FT                   /translation="MKRAPIIPKSSPAITPAATTAAPAAPMVDSLIARVGAMAKGNTIT
FT                   LPICGRDVKFVLETIPGKLVEKATKVWAGNERLQDLLNEDSLDDLIPSFLLTGQQHPAF
FT                   GRKIIDGIEIADGSRRRMTAILTSSEYRILVGDLDDEQMDSLCKLGNDYRPTSAYERGN
FT                   RYTFRLKNEFNGNISALADAENISRKIITRCINTAKLPRDLIALFSHPGELSARMGDNL
FT                   NRLFSDDEALLISTTDELLKKRQSGIVYETEEIIEALTRSLKASKGSASVAPVKREFVP
FT                   GAMAQYKGNKVVFTLDRTKISKDCIEQMENILEKLEKLGSR"
FT   sig_peptide     80474..80560
FT                   /locus_tag="Ent638_4251"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.720) with cleavage site probability 0.342 at
FT                   residue 29"
FT   gene            81538..82359
FT                   /locus_tag="Ent638_4252"
FT   CDS_pept        81538..82359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4252"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62857"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGN9"
FT                   /protein_id="ABP62857.1"
FT                   /translation="MVPTLHLGPWSQPYIWDRGPNPTSGTVVPTLHLGPWSQPYIWDRG
FT                   PNPTSGTVVPTLHLGPWSQPYIWDRGPNPTSGTVVPTLHLGPWSQPCIWDRGPNPASGT
FT                   VVPTLHLGPWSQPCIWDRGPNPASGTVVPTLHLGPWSQPCIWDRGPNPASGTVVPTLHL
FT                   GPWSQPCIWDRGPNPASGTVVPTLHLGPWSQPCIWDRGPNPASGTVVPTLHLGPWSQPC
FT                   IWDHGPNTTSVLLVKFMIYAYEQNVKYYSWRFLAYSRALPGRAAAASTISL"
FT   gene            82652..84115
FT                   /locus_tag="Ent638_4253"
FT   CDS_pept        82652..84115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4253"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62858"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGP0"
FT                   /protein_id="ABP62858.1"
FT                   /translation="MFESVILLCSVSLCVNVKWFILSSYFTKGCELLNRKSRMKLVWKE
FT                   TPRGRIERYLSITEKESVLHVFSHSRKPSQADLRITNVILEEMDRKELWIECDCVEREQ
FT                   DMKGPYNCEVKRAYLRHVKTSMRHDETCPLYRMKKERDADSKSNEGKTSPLNPIGGDDW
FT                   LPDRKEKARAKQSKELPHPRKKRRKTLKPVPALGRKLLTLIQAAGLNQIELGTHYKPPG
FT                   LATAVQFVKDVLNTHTMRNGTILADLISCSPWVAIEKIEEMLKKLEVNGGINSLDKELC
FT                   VYVVGLAAEVSRESVTFSVRGKAFTHSPETRVTINGENYLNAGSRGPYWTILEYRRDGK
FT                   GIVYCHDAYAHAAFTLDNPVPVDSNLEKSTLKTIINACEFASRQTNRPESLSLSKPLFT
FT                   LRTFEDGVEEVIHPDFILNVAPVNQKTVTTLIIETMGYDLADYIERKSETHNLMRQEGT
FT                   LLTDPPDWPEPSKTTFNSVLLKHIFRAAK"
FT   gene            complement(84349..85044)
FT                   /locus_tag="Ent638_4254"
FT   CDS_pept        complement(84349..85044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4254"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4254"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62859"
FT                   /db_xref="GOA:A4WGP1"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR014063"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGP1"
FT                   /protein_id="ABP62859.1"
FT                   /translation="MEQFPVLNTECFDQHIAERLHLQEPPRIQILYGSVRERSYSRFVA
FT                   EEAGRLLTAMGAEVKFFNPSGLPLPDDAPDTHPKVNELRGLVRLCDGMVWSSPERHGAM
FT                   SAVMKAQIDWIALSEGAVLPSQGKTLAVQVCGGSQSFNAVNQMRILSRWMRMFTIPNQS
FT                   SVAKAWQEFDENGRMKPPSWYDRIVDVAEELFKMTLLLKGQNGYLADRYSERKESHQAL
FT                   SERVNQGKI"
FT   gene            85128..85448
FT                   /locus_tag="Ent638_4255"
FT   CDS_pept        85128..85448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4255"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein, ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4255"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62860"
FT                   /db_xref="GOA:A4WGP2"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGP2"
FT                   /protein_id="ABP62860.1"
FT                   /translation="MLHPVQLFKILSDETRLAIVMILRESGEMCVCDICTATSESQPKI
FT                   SRHMAILREAELVIDRREGKWIHYRLSPHIPAWAAEIIATSWQCLREDVREWLQKAACT
FT                   SC"
FT   gene            85493..86782
FT                   /locus_tag="Ent638_4256"
FT   CDS_pept        85493..86782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4256"
FT                   /product="arsenite efflux membrane protein ArsB"
FT                   /note="TIGRFAM: arsenical pump membrane protein; PFAM:
FT                   Arsenical pump membrane protein; Citrate transporter; TC
FT                   3.A.4.1.1; TC 2.A.45.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4256"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62861"
FT                   /db_xref="GOA:A4WGP3"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGP3"
FT                   /protein_id="ABP62861.1"
FT                   /translation="MLLAGSIFLLTLVLVIWQPRGLSIGWSASIGAVLALGTGVIHIAD
FT                   IPVVWNIVWNATAAFIAVIIISLLLDESGFFEWAALHVSRWGNGRGRLLFTWIVLLGAA
FT                   VAALFANDGAALILTPIVIAMLLALGFSQGTTLAFVMAAGFIADTASLPLIVSNLVNIV
FT                   SADFFGLGFTQYASVMVPVDVAAIAATLAMLHIFFRRDIPATYDVSLLKTPASAIKDPA
FT                   TFRAGWIVLLLLLVGFFVLEPLGIPVSAIAAAGAAVLFVVAKRGHAINTGKVLRGAPWQ
FT                   IVIFSLGMYLVVYGLRNAGLTEYLSGVLSLLADKGLWAATFGTGFLTAFLSSVMNNMPT
FT                   VLIGALSIDGSTATGVVKEAMVYANVIGCDLGPKITPIGSLATLLWLHVLSQKNMTITW
FT                   GYYFRTGIVMTVPVLFVTLAALAWRLSVTL"
FT   gene            86795..87220
FT                   /locus_tag="Ent638_4257"
FT   CDS_pept        86795..87220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4257"
FT                   /product="arsenate reductase"
FT                   /EC_number="1.20.4.1"
FT                   /note="TIGRFAM: arsenate reductase; PFAM: arsenate
FT                   reductase and related"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4257"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62862"
FT                   /db_xref="GOA:A4WGP4"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGP4"
FT                   /protein_id="ABP62862.1"
FT                   /translation="MSNITIYHNPACGTSRNTLEMIRNSGNEPTIIYYLDTPPTRDELI
FT                   KLISDMGITVRGLLRKNVEPYEQLGLAEDKFTDGQLLEFMLQHPVLINRPIVVTPAGTR
FT                   LCRPSEVVLEIIPEPQQGAFTKEDGEKVIDETGKRVN"
FT   gene            87429..87587
FT                   /locus_tag="Ent638_4258"
FT   CDS_pept        87429..87587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4258"
FT                   /product="Hok/gef cell toxic protein"
FT                   /note="PFAM: Hok/gef cell toxic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4258"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62863"
FT                   /db_xref="GOA:A4WGP5"
FT                   /db_xref="InterPro:IPR000021"
FT                   /db_xref="InterPro:IPR018084"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGP5"
FT                   /protein_id="ABP62863.1"
FT                   /translation="MKLPRSSLIWCVLIVCLTLLIFTFLTRKSLCEIRYKDGDREVAAF
FT                   MAYESGK"
FT   gene            87903..88232
FT                   /locus_tag="Ent638_4259"
FT   CDS_pept        87903..88232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4259"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62864"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGP6"
FT                   /protein_id="ABP62864.1"
FT                   /translation="MIALAGMIIRNAVILISEIDSIYLAHRHSSLHVVTDLLKGALTFA
FT                   ESAVQHTITGHVTNAGFPPRGRRQRFWNEEYLMMTEQTDAFARASLDNFSGYGQCTMKS
FT                   KSLAD"
FT   gene            complement(88396..88821)
FT                   /locus_tag="Ent638_4260"
FT   CDS_pept        complement(88396..88821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4260"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein, MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4260"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62865"
FT                   /db_xref="GOA:A4WGP7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGP7"
FT                   /protein_id="ABP62865.1"
FT                   /translation="MKLLDIGEVAKVSGVSPSALRYYEETGLISPVARRGLRRQYSPDV
FT                   LLRLNLIIMGKAANFSLDEIAGMFSRDGKPEISRALCSAKALELNEKINDLTALRDTLL
FT                   HVASCPALSHMDCPTFRRLAGIAGKRHRGQKKRSKRA"
FT   gene            88964..90214
FT                   /locus_tag="Ent638_4261"
FT   CDS_pept        88964..90214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4261"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4261"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62866"
FT                   /db_xref="GOA:A4WGP8"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGP8"
FT                   /protein_id="ABP62866.1"
FT                   /translation="MMNITDKTVSLHKTGITVTLSLAMLLASLGTSIANIALPTLVQAF
FT                   MAPFDQVQAVVVVYLVALTLSAVIAGSLGDRFGLKRVLVMGLMLFAVACLLCAVMPDLR
FT                   LLVGARALQGVGAAFLMTLSMALMRQVAGSADIGRAMGILGTVSALGTALGPSLGGLLL
FT                   PLTGWRGVFWIQVPLAVLTIILAVTALPDEAIKCKPAGSGLKTPLSRKIISSLFVNMLV
FT                   AAVMMTTLVVGPFFLSSGLGMNSVHVGLVMTIGPVISIFSGIPSGRLVDRLGSRLIVAA
FT                   GISLLAAGTFLMAGLPQIMGVPGYIISLAVLTPGYQLFQAANNTAVLSDVRDDRRGTVS
FT                   GMLSFSRNVGLIAGASAMGAVFAHQVGTHDFTLASAEAIRDGMRGTFLLAGVLMLVAVA
FT                   VVFLSLFNRDSFARLTP"
FT   sig_peptide     88964..89068
FT                   /locus_tag="Ent638_4261"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.718 at
FT                   residue 35"
FT   gene            90619..90858
FT                   /locus_tag="Ent638_4262"
FT   CDS_pept        90619..90858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4262"
FT                   /product="addiction module antitoxin, RelB/DinJ family"
FT                   /note="TIGRFAM: addiction module antitoxin, RelB/DinJ
FT                   family; PFAM: RelB antitoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4262"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62867"
FT                   /db_xref="GOA:A4WGK1"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGK1"
FT                   /protein_id="ABP62867.1"
FT                   /translation="MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLP
FT                   FKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL"
FT   gene            90858..90965
FT                   /locus_tag="Ent638_4263"
FT   CDS_pept        90858..90965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4263"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62868"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGK2"
FT                   /protein_id="ABP62868.1"
FT                   /translation="MAYFLDFDERALKEWRKLGSTVREQLKKKLAEVLE"
FT   gene            90996..91145
FT                   /locus_tag="Ent638_4264"
FT   CDS_pept        90996..91145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4264"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62869"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGQ1"
FT                   /protein_id="ABP62869.1"
FT                   /translation="MHDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGKRERSEVYSEAV
FT                   KRIL"
FT   gene            91470..93563
FT                   /locus_tag="Ent638_4265"
FT   CDS_pept        91470..93563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4265"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: sulfotransferase; TPR repeat-containing
FT                   protein; Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4265"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62870"
FT                   /db_xref="GOA:A4WGQ2"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037919"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGQ2"
FT                   /protein_id="ABP62870.1"
FT                   /translation="MSNNTPLYPQQLTVHQAMELANAHWNAGQAAQAEQLCLRVLQVAP
FT                   SQPDALNLLGLMMHAYGKMDLALDYIRKAGQSPGAPAIVFSNLAELCRQRGLLQEAEQA
FT                   ARRAVEQEPQLALAWNNLGIILQEAGKFKASLECLQYVASLQPDNAEVHNNLANTWKRL
FT                   GDLQRAQESYQRALNLRPDYAEVYSNLASLLSELGCIDEAAASARQAIDINPQLADAYL
FT                   NLADIELSRMRYAEASHWVKALLEFSPRHAGALITLAHIMIANEHYEEAAFEARKALAI
FT                   APDRANAHMILGKALQALGQYEDADRAYSKAAVLPGTVAEEALIARAVLLMETGDKQAA
FT                   TAAFEQALKRFPDSARIVAARCDNKFYRAGDPDIDVMESALVSEPTPPLNEKMMLHFSL
FT                   GKAWLDVSDSERAFFHLNQGNALKRASFHYDAAQTRAWVNNIAEIFTPALMAQFNNAGT
FT                   ASERSVFVVGMPRSGTTLVEQILASHPGVYGAGELRALDRAVARAGRFPDDVPRWNNAD
FT                   FARIGTDYLEQVSHLAPEALRVIDKLPANFFYAGLIPLLLPGARIIHCRRNPVDTCLSC
FT                   YSKLFAGEQTFAYQLDELGQFYRDYEALMAHFRQILPADSFIEVDYETVVDDLEGQARR
FT                   LIDFIALPWDDACLTFHETRRIVRTASVAQVRQPIYTSSKGRWQQHAAHLGPLLKALGM
FT                   EQK"
FT   gene            93560..94729
FT                   /locus_tag="Ent638_4266"
FT   CDS_pept        93560..94729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4266"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62871"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGQ3"
FT                   /protein_id="ABP62871.1"
FT                   /translation="MNPEPTDNQTLFQQVDELLKAERWAQAEAVLSQALCSGSGPIPLW
FT                   RQLYVAYRQQGNIAGATQVLEMIVQATPGDLHSRFDLAEMLLLQGEFTRGWREYRFRYR
FT                   QDHTRMFERHIRQPRWEGQSIIGKTLFIHDEQGYGDTFQFLRLVEQAQMRSGAHVVLEV
FT                   NEEAYNLAHGVRGYHQLMKRGTLPPPFDFHCELMSLPAALGLQLSDLPGRVPYLFADPA
FT                   RVEKWRARLADLPRPLVGLVWAGRPTHANDKHRSLALADLAPLAQEGMTFLALQKGPAA
FT                   EQAVTPLAGMSLLSLSDEIHDFDDTAAILRVIDTLVSVDSSPVHLAGALGCPACVLLPF
FT                   QHDWRWLQQREDSPWYPEMRLFRQLAAGEWKTPLQNVAIALKKLKNKPE"
FT   gene            94915..97734
FT                   /locus_tag="Ent638_4267"
FT   CDS_pept        94915..97734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4267"
FT                   /product="outer membrane autotransporter barrel domain"
FT                   /note="TIGRFAM: outer membrane autotransporter barrel
FT                   domain; PFAM: Autotransporter beta- domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4267"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62872"
FT                   /db_xref="GOA:A4WGQ4"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGQ4"
FT                   /protein_id="ABP62872.1"
FT                   /translation="MSKNITNPTAIDRRKVLGLSIGSAIALLSSAEVYSACIALGNTAT
FT                   VTGTTGCVTWSGGNLTLTNAGTLISTGAAPVTATSAAGTLLNNGLLSGTSAAGVENTAN
FT                   ALIVQNNSTIISNTIGLNNNGTIVSLNNNAGGTISGSVAGVKNNSFIMSLSNNNIISGG
FT                   LGINNGGTLGSLANSGTLTGTTTGVYNSGLITNLSNSGSLSGTSYGIQSDNGSQILSLQ
FT                   NTSTGIIEGGTGVLVGNLTPSGTINVNTLTNAGQISGTTNVGVGTSSNGTIGSLNNTGT
FT                   LVGSLGGVGNAGTIGSLVNSGTISSSGYAVYNAGSGTFGPITNSGMIAGTIYNGATRSM
FT                   TINGSNDATFGTLTGASGGTGSADIGMLYSTSADLFFASGNLLLNDNIQAGSKTVNNTG
FT                   ATLQVNNILSITGNYVQRASAALVVGVGDVAVSNGVSADTGYGRLIVSGAATIDNGSTV
FT                   ALKSLNTYRFAPGQRYVVITAAQNGTNYNANSLNYLTSAYEGVTSGSVVDSGNTSSLVV
FT                   SLGAKATDSGTGTPGVPTNPGTGTPGVPTNPGTGTPGGGETPVTPGFATTGNAISSLSG
FT                   LKQYTGIAPGLLDLYNASLAIDSTRDANKVGEQLSPVQNSSASNVASVATFDAVGVVGQ
FT                   RVDSVRLAHTQGMSGVATGDDPTDWAAWGQVFGGHANQGMVDSVSGYKANYSGLVLGVD
FT                   RAMGDAWRVGGALTYSYTSVHGEDNLSGNKTGVDSYGLIGYASYTGDPWYVNLSASVTQ
FT                   QRYDTSRKVNMTGYSDSAWGKFNGQQYVTKAEFGYPLAVADTTTLTPLANLSYSYQTLD
FT                   SYKESSGNGSALSVESSHNNAFRSGLGAKLEKSFQTGIGDIVPYVQAVWTHQYDSKQST
FT                   TNASYAADTIGETSFTTFGASPVEDTADLSLGTTVLNSDTLSVTARYTAQFGEQYQGQT
FT                   VSLQVRKLF"
FT   sig_peptide     94915..95010
FT                   /locus_tag="Ent638_4267"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.892 at
FT                   residue 32"
FT   gene            97893..98045
FT                   /locus_tag="Ent638_4268"
FT   CDS_pept        97893..98045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4268"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62873"
FT                   /db_xref="GOA:A4WGQ5"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGQ5"
FT                   /protein_id="ABP62873.1"
FT                   /translation="MLRLILNYIADNERLLFKKMLLNDKDAELGEIVKERIRNPKPVRV
FT                   ILDDL"
FT   gene            98190..98312
FT                   /locus_tag="Ent638_4269"
FT   CDS_pept        98190..98312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4269"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62874"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGQ6"
FT                   /protein_id="ABP62874.1"
FT                   /translation="MSGWLETESDRLAESVDEHLKALEEQIQDWAQGPDSLNDD"
FT   gene            98566..98724
FT                   /locus_tag="Ent638_4270"
FT   CDS_pept        98566..98724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4270"
FT                   /product="Hok/gef cell toxic protein"
FT                   /note="PFAM: Hok/gef cell toxic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4270"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62875"
FT                   /db_xref="GOA:A4WGQ7"
FT                   /db_xref="InterPro:IPR000021"
FT                   /db_xref="InterPro:IPR018084"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGQ7"
FT                   /protein_id="ABP62875.1"
FT                   /translation="MKLPRSSLIWCVLIVCLTLLIFTYLTRKSLCEIRYKDGDREVAAF
FT                   MAYESGK"
FT   gene            complement(98946..99227)
FT                   /locus_tag="Ent638_4271"
FT   CDS_pept        complement(98946..99227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4271"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62876"
FT                   /db_xref="InterPro:IPR024493"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGQ8"
FT                   /protein_id="ABP62876.1"
FT                   /translation="MLNPGKKHTARFSLMSDNETEDDTDDMIYDEACRIIGQCCLMLAS
FT                   NGSETNRAQLTYQLKRLHWKVMEQTDFSHTGILLAIELLSPPEEGVKH"
FT   gene            99584..100357
FT                   /locus_tag="Ent638_4272"
FT   CDS_pept        99584..100357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4272"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4272"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62877"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGQ9"
FT                   /protein_id="ABP62877.1"
FT                   /translation="MHSAKTFCRQKLLSAPLSFLPSPLLLCPLPRENSPGRWTTIPTGE
FT                   NQDAHTKCQRQNRRSRIFQEDRGEAKRVVSRIKGQLSVATLEAQLTAAMAEEAHTHYGE
FT                   AFTTVDLFKSLMTGFFQGLRKPISHVIHKETKMQVLKAATSPKKVGASRDMVALLRIQA
FT                   TDTHVVEFDNVDTRFNDCTNWQVMEGDKRVLFSTRTHERFSDIKAGVLATIAVCENRAT
FT                   AFDSAMLESARAMMKVLDACPSFGALVAHPKRITD"
FT   sig_peptide     99584..99664
FT                   /locus_tag="Ent638_4272"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.751) with cleavage site probability 0.746 at
FT                   residue 27"
FT   gene            100427..102439
FT                   /locus_tag="Ent638_4273"
FT   CDS_pept        100427..102439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4273"
FT                   /product="ParB domain protein nuclease"
FT                   /note="PFAM: ParB domain protein nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4273"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62878"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGR0"
FT                   /protein_id="ABP62878.1"
FT                   /translation="MVTTHSTANKTAKATRSKKAAPDAAQTASQTLLQLLIATPVQLMP
FT                   YSRLSRTDLNVRRIPHTDKEVEELADSIEAVGILQNLIGVELPDGSVGVVGGEGRRRAT
FT                   GILVKKGITDADTPFVPVKVIPLELAVVASMTENGQRKNMHPAEQIVGFRTLEQEGKTV
FT                   SQISALLGYAPRHVQRCLKLANLAPSLLDTLARDEISLEQCEALTLADTHERQEQVWKE
FT                   AVEQWRDPAVQTLRKMVTNDKMAVSHPMFEFVGEEAYIAAGGTLTADLFSDRDSTFADA
FT                   AQVKSLLSGKLTVLAARIQQEQGWGWSEFRMSELGDNVTDREQYRFAMPDAVLTEEEKQ
FT                   RVSELEEKMEATDSHDDEYALQQEIDDIVCEATYREATPEFRAAHGVWVSWDGGNFKVQ
FT                   AGIHKVTDEERQEEEKALQERRDNVMTYTTPDIPADAYPATLVKAMSAERTLAVQVELA
FT                   GRPDVSVALLTWTLCLGLFDRRHGQRSEPLKASVSSNQYHLASLAPSGEEGKALMALRT
FT                   QKATFQATLPEHWHLGFTWLLSWSAEEVNTLLGFCAAHGIDGIQERLYNRTDKSALDGL
FT                   EAALDFDLRKWWQPDAESYFGKLKIAQIGKAYEQAGLTDKAGEVVKLKRRDAAKAAEQD
FT                   LNAVGWLPDWMVRPAPAAQAEESTETVADTTDHAA"
FT   gene            102476..102910
FT                   /locus_tag="Ent638_4274"
FT   CDS_pept        102476..102910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4274"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4274"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62879"
FT                   /db_xref="InterPro:IPR009385"
FT                   /db_xref="InterPro:IPR038131"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGR1"
FT                   /protein_id="ABP62879.1"
FT                   /translation="MTMKYDLTRINTLTASDMEFIRQQGEDARRALSDAVTGLLTTPEG
FT                   WRVCAEYRSEFGGFFPVQCRFSADGCDDWHLCVCSPGELSPYWLLVLLSSGGEVVRTLY
FT                   QNDTLQPEQVSQLIAQMAGMRRFNCTARTVATLMSGEVTA"
FT   gene            102907..103638
FT                   /locus_tag="Ent638_4275"
FT   CDS_pept        102907..103638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4275"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62880"
FT                   /db_xref="InterPro:IPR009713"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGR2"
FT                   /protein_id="ABP62880.1"
FT                   /translation="MIPSSHALVSLKPARQAAIQAISLVESSRERGARLPAMPYVRTFL
FT                   RVLTGSGRLNATVARQIPGLNWVPKNRHSNLKQVEAALDVMIATGGEACPLPLTLDVQA
FT                   ELFPDVMHTRTNRRLHRAEIRTTRQIRQESREVEQRWKLRQNLLAQAEVDLNFQSPESV
FT                   CTWYTRWSDEFDAGELAGMFWRWQTRFASLNALEWLRLRGDPLYAVMYEIPYIVRETPE
FT                   PVRQTERWQVPNKLTLWRTPA"
FT   gene            103635..103865
FT                   /locus_tag="Ent638_4276"
FT   CDS_pept        103635..103865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4276"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62881"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGR3"
FT                   /protein_id="ABP62881.1"
FT                   /translation="MRNNPYKTELKVARSQRNRLKTISARLKEMSCEWDGMSGWLETES
FT                   DRLAESVDEHVKALEEQIQDWAQGPDSLNDD"
FT   gene            complement(104501..104770)
FT                   /locus_tag="Ent638_4277"
FT   CDS_pept        complement(104501..104770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4277"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4277"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62882"
FT                   /db_xref="InterPro:IPR024493"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGR4"
FT                   /protein_id="ABP62882.1"
FT                   /translation="MLKPGKKHTARFSLMSDIHSEDDTDDIIYDEVCRIIGQCCLMLAS
FT                   KGAETHRARLTYQLKRLHWTIMEQTDFSHTGILLAIELLSPPDE"
FT   gene            105275..105589
FT                   /locus_tag="Ent638_4278"
FT   CDS_pept        105275..105589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4278"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62883"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGR5"
FT                   /protein_id="ABP62883.1"
FT                   /translation="MHTRNVNVKTAAHESSRKIGENPVMGLTYEQAADLFSWVVNAAKG
FT                   EPQPAIFNVPAESVELSLMYEDAPDYFSVWFLNGYPVAAGVPSEHYFRVITALINFSQE
FT                   "
FT   gene            105595..106416
FT                   /locus_tag="Ent638_4279"
FT   CDS_pept        105595..106416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4279"
FT                   /product="protein of unknown function DUF932"
FT                   /note="PFAM: protein of unknown function DUF932"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4279"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62884"
FT                   /db_xref="InterPro:IPR026325"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGR6"
FT                   /protein_id="ABP62884.1"
FT                   /translation="MVSFASRYRVPTSIRQNRPLTNDELQRFVPSAFSEDKHDSRSERY
FT                   TYIPTIVLLDRLRDEGFQPYYATQSRTRDIEKRDFTKHMLRLRRHDQLDGKEVPEIILL
FT                   NSHDGSSSYKMIPGMFRQICTNGLVAWKNFGEISVPHKGDIVEQVIEGAYTVLKTFDAV
FT                   TDNIDMMKGIQLSEPEQRLLSTVALDFKYDGKKPPVTPDQVLQSRRWEDKSPDLWTTFN
FT                   RIQENVIKGGISGRTAKGQRTRTREVTGIDGDIKLNQALWKMAEEFAKLKA"
FT   gene            complement(106444..106917)
FT                   /locus_tag="Ent638_4280"
FT   CDS_pept        complement(106444..106917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4280"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /note="PFAM: Lytic transglycosylase, catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4280"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62885"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGR7"
FT                   /protein_id="ABP62885.1"
FT                   /translation="MCFDQAGHDYRIDPLLLMSISIKESKLKAAAINGSNRDGTEDVCG
FT                   MQVNSSHYGKLKNFNITRERLLKDPCICVYTGAWVLAHNFRSYGKNWDSVGIYNTGPSK
FT                   KLITRRKAYAEDIKNIYRVLLARKTLLAQRSPQNGENDRTGPASKTAAMNSVQ"
FT   gene            107592..107978
FT                   /locus_tag="Ent638_4281"
FT   CDS_pept        107592..107978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4281"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62886"
FT                   /db_xref="GOA:A4WGR8"
FT                   /db_xref="InterPro:IPR007925"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR042073"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGR8"
FT                   /protein_id="ABP62886.1"
FT                   /translation="MPRKNIYFKDKIDREIQDILEIEIQKGATTSDMNYSSIVNELVRL
FT                   GLMVYKSKEEGSTFDLDGFRRDLIKKVSGSREGMMILTALVSEIYVTLKGPEAGVALDD
FT                   LINNNISAINVAEDNAERQHFLMD"
FT   gene            complement(108018..108659)
FT                   /locus_tag="Ent638_4282"
FT   CDS_pept        complement(108018..108659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4282"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62887"
FT                   /db_xref="GOA:A4WGR9"
FT                   /db_xref="InterPro:IPR005569"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGR9"
FT                   /protein_id="ABP62887.1"
FT                   /translation="MKVKEKMWEGRGRPRKFRPGEAVEWRLRAPDNLLMELRICARVGK
FT                   RSVNDEIIARLLLSLNYQPERAVIKTAEGERLISLAVKFETWLGQLLDRGERSGGEDIQ
FT                   NDDHAEQLWMWREGERVLIPGKTTGYSMRIPDNLAEEIRTMARVHKRSLNDEMLTRLMN
FT                   TLGYFTERILDQNEDGQALKLLCMEFEVFLKEKINQCEKEALPWEKESPQ"
FT   gene            108856..109209
FT                   /locus_tag="Ent638_4283"
FT   CDS_pept        108856..109209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4283"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62888"
FT                   /db_xref="GOA:A4WGS0"
FT                   /db_xref="InterPro:IPR008873"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGS0"
FT                   /protein_id="ABP62888.1"
FT                   /translation="MSIKDNALNVVKGWAVASLFRTALENRQMKKFLKNGGLILISLMV
FT                   AHPVLAAGTDLLAPQQATVNSTFGSGSSLIKWFYIAEIVMGLFIYIKARSPLVFVGIVG
FT                   CIIFTRVAFSIAS"
FT   sig_peptide     108856..109011
FT                   /locus_tag="Ent638_4283"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.987) with cleavage site probability 0.986 at
FT                   residue 52"
FT   gene            109209..109514
FT                   /locus_tag="Ent638_4284"
FT   CDS_pept        109209..109514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4284"
FT                   /product="TraL family protein"
FT                   /note="PFAM: TraL family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4284"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62889"
FT                   /db_xref="GOA:A4WGS1"
FT                   /db_xref="InterPro:IPR009838"
FT                   /db_xref="InterPro:IPR016382"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGS1"
FT                   /protein_id="ABP62889.1"
FT                   /translation="MMSGEEDKYYFPETLNQQERYFGLPLDEIIIVAPLIILGVLNNMS
FT                   TELSIIAGLLWASVRYLKKGQGSFWLLNFCYWHLPSLLFKVTFRKIPDSSFRHWRA"
FT   gene            109520..110101
FT                   /locus_tag="Ent638_4285"
FT   CDS_pept        109520..110101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4285"
FT                   /product="TraE family protein"
FT                   /note="PFAM: TraE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4285"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62890"
FT                   /db_xref="GOA:A4WGS2"
FT                   /db_xref="InterPro:IPR007973"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGS2"
FT                   /protein_id="ABP62890.1"
FT                   /translation="MELKIKGERDKQLSYAFIGLVSLLVLSGTGNVLTGSLAWYFATTQ
FT                   KTVTTPMTYNQPFTSDAVSADASGMTMFASSFIYWRLNVSPENIDNNQKMLLGFVPSTE
FT                   RDLLRKALDVEAERIKKGGITTRFDTKDIRVMTDGSVEFSGTLKSATTNGAITTPLKDQ
FT                   DKTYRLNISYQNGLVNLHSFEELQPVTTTN"
FT   gene            110113..110853
FT                   /locus_tag="Ent638_4286"
FT   CDS_pept        110113..110853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4286"
FT                   /product="TraK family protein"
FT                   /note="PFAM: TraK family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4286"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62891"
FT                   /db_xref="InterPro:IPR010563"
FT                   /db_xref="InterPro:IPR014126"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGS3"
FT                   /protein_id="ABP62891.1"
FT                   /translation="MKLRISPAAAAVLLASGIFTSGLRAATAPAAIPFENDAAFNVTLS
FT                   NTNPTKVVVDGELITSISGPTGAYDQSTTDDGALILSPLVGQNFTLFIQTDHGSSLSLN
FT                   VRPQAGNGKTLRFTPMSPPLRKNDDAKAWEEGQTYEKTLVALSRAVVNGQVPDDYVEYP
FT                   VSRMTAYTPSTPVRLTPERQFVGNHLRIVRFRMNNPGSITQSLRERDFWLKGVRAVMLS
FT                   QNQLYAGGEGYAWVVFSDDGVPRS"
FT   sig_peptide     110113..110190
FT                   /locus_tag="Ent638_4286"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.979 at
FT                   residue 26"
FT   gene            110850..112250
FT                   /locus_tag="Ent638_4287"
FT   CDS_pept        110850..112250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4287"
FT                   /product="TraB pilus assembly family protein"
FT                   /note="PFAM: TraB pilus assembly family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4287"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62892"
FT                   /db_xref="GOA:A4WGS4"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGS4"
FT                   /protein_id="ABP62892.1"
FT                   /translation="MSLNENLKTRRTQLAVLATVIAVGAATAGGVMWYGNHQEQQKHPA
FT                   PVAAPNMTGVVTASFNEQVNDAALAQQQAKTSALEQQYATLAQLVAQNKLTTEQKLAEK
FT                   DAEIQRLTDQVQKAPGSNTTTGQQSPPAGQNGTPLPGPVAAGQARPPEYSVTPNAPAAT
FT                   GVNMGQGAGFYPGGSGQRLTGGLSTTKFSYDSLKKKPTKLPWIPSGSFSDAVMIEGADA
FT                   NASVTGQQNTSPVTLRLQGNIQMPNNKEYSADGCFIVGEIWGDISSERGTVRTQSISCV
FT                   LKNGKHVDMEFQGHVSYQGKNGIRGKPVMRNGMIVGYAGAAGMLSGFGEGIKSAATPSV
FT                   GLGATADVGAGDVFKQGFGGGANKAADTLSQYWIKRAEQYHPVIDIGAGNQVTVVFQKG
FT                   FRLETLEDAEDAKAKEELQKAGNAAQNAVSPQPASQSTTSGTASVGNINPDDVLRQASQ
FT                   LRLGDTIN"
FT   sig_peptide     110850..110936
FT                   /locus_tag="Ent638_4287"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.957 at
FT                   residue 29"
FT   gene            112539..112901
FT                   /locus_tag="Ent638_4288"
FT   CDS_pept        112539..112901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4288"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62893"
FT                   /db_xref="GOA:A4WGS5"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGS5"
FT                   /protein_id="ABP62893.1"
FT                   /translation="MFSDLRHLAIPSLIFAIELTVWAVLIRNGYGEYGWKYWRAGLLAS
FT                   LVILLHTNMIFYGSKERIWHAAGVLAPWVILVPAFIVFCFIQTNQDLLTLDWFFTGVFA
FT                   SGVFQWLFNVLVRNFR"
FT   gene            112961..113518
FT                   /locus_tag="Ent638_4289"
FT   CDS_pept        112961..113518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4289"
FT                   /product="membrane lipoprotein lipid attachment site"
FT                   /note="TIGRFAM: membrane lipoprotein lipid attachment site"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4289"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62894"
FT                   /db_xref="InterPro:IPR014118"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGS6"
FT                   /protein_id="ABP62894.1"
FT                   /translation="MKKLLGAALLCSALTGCAGLNSDFDCNKTATDQCLTTGEANKLAA
FT                   QGKNLDSLAADKAAKKPAGETLPALRNTAPVVNPGRPVSVAATGTAIAKPIAPRPLATA
FT                   PSGSTGSLVTPLTTAGHVTPVTPVNTAGRVPVQRIPDATQRLWIAPWVDTDDNFHQPAV
FT                   VEFVKNKSHWDESYRVIGEGGE"
FT   sig_peptide     112961..113017
FT                   /locus_tag="Ent638_4289"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.424 at
FT                   residue 19"
FT   gene            113515..116115
FT                   /locus_tag="Ent638_4290"
FT   CDS_pept        113515..116115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4290"
FT                   /product="Type IV secretory pathway VirB4 components-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4290"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62895"
FT                   /db_xref="InterPro:IPR014117"
FT                   /db_xref="InterPro:IPR025955"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGS7"
FT                   /protein_id="ABP62895.1"
FT                   /translation="MSVLDNLMSLVNSRKREDGAATARANLEQTWGYPSLVAALPYRYY
FT                   DDVNELFINEGSAGFILEAAPLPGANEQVIAALDDMLRKKLPRKTPVSVLLLASKCVGE
FT                   RIARGVSSDMWKGDMSEYLNKITKAFWQRSALKGLANEREYPLYLRNYRIFIVYGKPAK
FT                   RFSQQVMDDLVQVRNTIRVSLGAARIETINTHVNSFLSVMREMMNYRQEQVMTSSGDYN
FT                   EDEKLNRQIVEPGIDVRVKPSYIRVELPDRIEENGTRLPASACRVVNMQLAKSPKRFAL
FT                   WQGADNLQNLRFPDLGIPCPFMLSWTTELEEQTATQNEALRKDMDLSKKANSAYGQLFP
FT                   STKRQAEEWRRNREQLSNNEIAFCRTYLNLTLFTPDNNTDAQACELAAVNVFRKNDLEM
FT                   VTVQYQQMRNWLGCFPFMMQEGMWEDLKMTGATLRCKSWNAVNLMPVVAERQLSHVGMP
FT                   LPTYRNQVAFFDMFGEENGSTNFNIAVTGTSGAGKTFLIQGILRDVLNAGGFAWVIDMG
FT                   DGYKNYCHQAGGVYLDGAKLRFNPFANVKDINQSAEGIVRLLTVLASPTEPLDGVCEAI
FT                   LQKAVMTAWEKKQHGARIDDVHNYLTDPAVNEAFADKPTIISRLAELAMLLDTYCTWGP
FT                   DGEYFNADSPTLDGETRFAVLELLSLEDKPKLLSSILFSLILAIQEKMYHSPRDLKKVC
FT                   IIDEAWRLLGGSNPHAARFIETGYRTVRRHRGAFITITQGIKDFSASKEAEAAWNNSST
FT                   KITLLQDTRAFKQYLADNPDQFSDMEKEVIRGFQPALLTGYSSLLVSAGEFSSFHRLFV
FT                   DPITRAMFSSRGEDFAFMQDAQRAGSTAEEAAYLLAQKKFGPELQELEEWIKAA"
FT   gene            116112..116528
FT                   /locus_tag="Ent638_4291"
FT   CDS_pept        116112..116528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4291"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62896"
FT                   /db_xref="InterPro:IPR014115"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGS8"
FT                   /protein_id="ABP62896.1"
FT                   /translation="MSENNEKPYDAESVRDGVTIATFFASRWVKGLLLGGAGLLAMTGV
FT                   AYVTAKAVTPDVVVFDMKGTVDLFMQQSAQLNLDEGKAKVLTSRFNTALSDSLNAWQTS
FT                   HNAIILVKPAVMSPQPDITADIRSDISRRIQEGQ"
FT   gene            116540..117160
FT                   /locus_tag="Ent638_4292"
FT   CDS_pept        116540..117160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4292"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62897"
FT                   /db_xref="InterPro:IPR014114"
FT                   /db_xref="InterPro:IPR025864"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGS9"
FT                   /protein_id="ABP62897.1"
FT                   /translation="MRCALTLLILSASAGAKDLGTWGNVFEPAEQDMLVFIQDRLKGME
FT                   QSGELERLKNEATERVKKHAVRPKPVDGLTRALKYRAFTFDPTFTVQETITDMQGNIIA
FT                   RKGDQVNPLDKVPFSQVLYFIDGDDKEQIAWAKQQIAGQTNIKVILVNGNIKETSDALD
FT                   ERIFFDQSGVLTRKFGFEHIPVRISRDGRALKVEEIPVREGKR"
FT   sig_peptide     116540..116590
FT                   /locus_tag="Ent638_4292"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.987) with cleavage site probability 0.971 at
FT                   residue 17"
FT   gene            117157..117507
FT                   /locus_tag="Ent638_4293"
FT   CDS_pept        117157..117507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4293"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4293"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62898"
FT                   /db_xref="GOA:A4WGT0"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGT0"
FT                   /protein_id="ABP62898.1"
FT                   /translation="MIFLLVLSVIAGMTGCVIATAGLPENLRWQGIQCGAITAIAQAGI
FT                   LHVIPLDRDGSGLLMAGGIMLAQCYSPRLAEDTRKLRVHFGIRSAPGYLLMYALCLVLT
FT                   GVCWLPIWMAIR"
FT   sig_peptide     117157..117222
FT                   /locus_tag="Ent638_4293"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.821 at
FT                   residue 22"
FT   gene            117932..118495
FT                   /locus_tag="Ent638_4294"
FT   CDS_pept        117932..118495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4294"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62899"
FT                   /db_xref="GOA:A4WGT1"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGT1"
FT                   /protein_id="ABP62899.1"
FT                   /translation="MAIISCFSQPESLRGVLVCLNDTGGIAGLCAVALGLGIWIVAQVR
FT                   SEAAAKKRLAKVMKYGQPAISSPPTFGGQQHAEAVHLFANRDYYQFLLSEFEKALLAQG
FT                   YELTADRARHVVPDSDSTRQVARAIMIARERYMAPLQSDATLEDKADECARAGYSHQWF
FT                   CLLAAGSERTGWYIARSTPTTGSE"
FT   gene            118924..119247
FT                   /locus_tag="Ent638_4295"
FT   CDS_pept        118924..119247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4295"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62900"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGT2"
FT                   /protein_id="ABP62900.1"
FT                   /translation="MTHPEHISPVTVTRDRNGFWTHPHYFQPADDEATPAEFGDWLHRY
FT                   NLTCATRWMENDAPPHVIRAWENGFSSIHEWQPSAPAGDGWFIGSIHDSEDGPLCVWLR
FT                   EAQ"
FT   gene            119244..120248
FT                   /locus_tag="Ent638_4296"
FT   CDS_pept        119244..120248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4296"
FT                   /product="TraU family protein"
FT                   /note="PFAM: TraU family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4296"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62901"
FT                   /db_xref="InterPro:IPR009649"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGT3"
FT                   /protein_id="ABP62901.1"
FT                   /translation="MTFRACLTALLLTVSCWTASLSSASAAASNAGEGRWVNPISDVCW
FT                   KCLFPMSVGNVKLASGPQPDTSNPSMPIQICSYGVFYRMGLAIGYWEPTAMTDVTREPG
FT                   VMVNMGGFKIDLGRTGTGTAGQSDRPAAGAFYHVHWYKYPLISWLSIMTSTGCFQGGDM
FT                   DIAYMSEVDPLWNDSTLSMMINPEAALFGNLIAQAACAADAVASTAGVPLSPLFWCAGS
FT                   QGSMYPFTGFTSGEFSPLESSLLVSERMAFKLHREGLVMNTVGADYAVCYQYPSPIVPK
FT                   ERWRYQMVNMFPETNSCHAFGASTQTWGTPHNSPQSKKNFGYLLWRKRNCVYS"
FT   sig_peptide     119244..119324
FT                   /locus_tag="Ent638_4296"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.355 at
FT                   residue 27"
FT   gene            120258..120878
FT                   /locus_tag="Ent638_4297"
FT   CDS_pept        120258..120878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4297"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4297"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62902"
FT                   /db_xref="InterPro:IPR014113"
FT                   /db_xref="InterPro:IPR019106"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGT4"
FT                   /protein_id="ABP62902.1"
FT                   /translation="MHNTLFRALLLSVLFGGAQTVLASEQASVSASDMAWMKQQQQPLD
FT                   SLKQRLQGQTMSLPAEQQALISRLQGDLARQQAERESGEKRTFPAMYFVSLGLPREGLL
FT                   PMLKEANRYGVPATLRGLVNNDLRQTASAMFELAKEDKNIGVQIDPTLYTEYHITTIPA
FT                   LVVTCPGRFDVIRGSLPLKQALEKVAESGDCAATAKQILEDGK"
FT   sig_peptide     120258..120329
FT                   /locus_tag="Ent638_4297"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            120875..122731
FT                   /locus_tag="Ent638_4298"
FT   CDS_pept        120875..122731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4298"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62903"
FT                   /db_xref="InterPro:IPR014121"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGT5"
FT                   /protein_id="ABP62903.1"
FT                   /translation="MKRLILAALLMTPCVVLSADPAFEAGASFGKGNASAGTGSLKNPD
FT                   AVTGSIPGYSAKPPESGYYGGVQGGDSGLSDKGQAALAGNDAAQSVISSGNSNPIPTID
FT                   PNAPFITIGKNAEAGSEGVLDGTNKQCTEVTVSKSTFENFQCDKDIASVEACTRTATAG
FT                   GHTTTTTVQKTLTLSAADAVISYGGGSSFSFAFVSPETGPIISAHFYWREGDTKAGKIN
FT                   FWGISEKMIGKQFDWAVPAAAGYQMSTNTPLPAATYTSTSCTSGNKNRCEAHIRDIIEG
FT                   FKNGQVSATIVITMNAVTQTFVPDVTWKTSCGLDMSKARKTTSTCTTPGGNHTVVNNGQ
FT                   SYQVYSDCWQYTDNYVVPSNSTGNCGTLMTNPKCTASASKCVESTDGQCTHMSYTYQCQ
FT                   KTWQSGGLVCGGDYICKTGDCNEANGAGSSGFDVAVAKLAGLASAADDVKDDQSQIDIK
FT                   AFTGKAMSCRKAFAGFSNCCKDSGWGQDSGLAACNSNEMAIGKAKAKKVTVIVGERCDR
FT                   QVLGACIQKSQVYCVFEGKLARIIQEQGRRDQLGVKFGSGDSPNCRGITIPELQNIDFD
FT                   KINFSDFYEDLMKNQKIPDTSAQVKLIKERIAAQVNQQGGNK"
FT   sig_peptide     120875..120931
FT                   /locus_tag="Ent638_4298"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.697 at
FT                   residue 19"
FT   gene            122728..123513
FT                   /locus_tag="Ent638_4299"
FT   CDS_pept        122728..123513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4299"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4299"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62904"
FT                   /db_xref="InterPro:IPR014110"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR039555"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGT6"
FT                   /protein_id="ABP62904.1"
FT                   /translation="MKRLMCGLLMVVTSLPAIAEEIITPADPFTGWSWYNEPKTPPDKY
FT                   PKPQQPAPPTTIPDLSKMTALEQAKVLKGYTMEALNRAILYPTRENTATFLRWQKFWTD
FT                   RGSMFSQSFAAAQLSHPDLDYNLEYPHYNSMAPFVQTRDQQTQQNAVAQLSQQYGLFYF
FT                   YRGSDPIDVQMAGVVADFAKTNGISLIPVSVDGQVAATLPQSRPDTGQSHTMNISHYPA
FT                   LFLVDAKSKNYRALSYGFMTQDDLSKRFLNVATGFKPHS"
FT   sig_peptide     122728..122787
FT                   /locus_tag="Ent638_4299"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            123804..124217
FT                   /locus_tag="Ent638_4300"
FT   CDS_pept        123804..124217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4300"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62905"
FT                   /db_xref="GOA:A4WGT7"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGT7"
FT                   /protein_id="ABP62905.1"
FT                   /translation="MSAWSRGQPFMGKFDRFYAEEFLDYGGEVRLRIRVYFPSTVSCRP
FT                   KAYFTRHTFGFGIAEKGKTRMKASLLAGLIFWGTIALVLSELITVSVSGTQTCLVWLSY
FT                   ALWGIAGAMVMRAGFVALRERRTRRSGVTGHEM"
FT   gene            124207..124809
FT                   /locus_tag="Ent638_4301"
FT   CDS_pept        124207..124809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4301"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62906"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR039555"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGT8"
FT                   /protein_id="ABP62906.1"
FT                   /translation="MKCKNILTALMCLIPVLASAGVREELMALESAKASPVTTLNPAAS
FT                   PVVLPPSLMQLPDGRRANMKDYAVVLFMQAHCQYSAKFDPLLKGWADEHNIRVYPYTLD
FT                   GGGDGSYPNPLVPRKTDPASPIADEIVTFFGNGLPIATPTAFVVNVNTLKAYPLTQGMM
FT                   EIPTLENRWASLIQADMDNVDPNALPPLPASAQVTPK"
FT   sig_peptide     124207..124269
FT                   /locus_tag="Ent638_4301"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.917 at
FT                   residue 21"
FT   gene            124827..125096
FT                   /locus_tag="Ent638_4302"
FT   CDS_pept        124827..125096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4302"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62907"
FT                   /db_xref="GOA:A4WGT9"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGT9"
FT                   /protein_id="ABP62907.1"
FT                   /translation="MTTNSYALSRTERVWLLFSVTLLVSAVFYGLLAARVVRALSRPDL
FT                   TMYLQDFPVLLLISLSGGFIVSAAGHYAMRVALNKPLQGEARHG"
FT   sig_peptide     124827..124946
FT                   /locus_tag="Ent638_4302"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.694) with cleavage site probability 0.366 at
FT                   residue 40"
FT   gene            125089..126453
FT                   /locus_tag="Ent638_4303"
FT   CDS_pept        125089..126453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4303"
FT                   /product="TraH family protein"
FT                   /note="PFAM: TraH family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4303"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62908"
FT                   /db_xref="InterPro:IPR010927"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGU0"
FT                   /protein_id="ABP62908.1"
FT                   /translation="MVKSLITAASIFMTGMAALPAQADVNGDLNGFFGSLGYSGNVSQA
FT                   QAWQGQAAGYYSGGSVYLRNPVKNVQLISMQLPSLNAGCGGIDAYLGSFSMISGEEIQR
FT                   FVKQIMSNAAGYAFDLALQTMVPELKQAKDFLQKLASDVNSMNMSSCQAAQGIIGGLWP
FT                   VTQVSQQKICQDIAGETNMFSDWASSRQGCTVGGQSNKVTDKAGDDQKDQVLKNKNLIW
FT                   DTLSKNGLLGNDRALKELVMSTVGSIIFNNNGDVTILTPLVDNRDLIKVLMRGGTAKVY
FT                   GCDEATLCLGPVVKDLTISESNALVTLVKNLMLSMQNKLVDDTALSNQEKGFVNTTSVP
FT                   VLKYLTNAQSMGMSATYLLQVADFIAQDLMIQYLQELVKQASLSLAGKNFPEEAAAKLR
FT                   DNIIHAQGLLADMKLQSAADQNALDGIDRNMQYLQQQVSTIVSGSYQSNYHWGDR"
FT   sig_peptide     125089..125160
FT                   /locus_tag="Ent638_4303"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            127223..130378
FT                   /locus_tag="Ent638_4304"
FT   CDS_pept        127223..130378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4304"
FT                   /product="TraG domain protein"
FT                   /note="PFAM: TraG domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4304"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62909"
FT                   /db_xref="GOA:A4WGU1"
FT                   /db_xref="InterPro:IPR012931"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGU1"
FT                   /protein_id="ABP62909.1"
FT                   /translation="MLEIYTIYGGGMWKTALDAVVTLIGANTFSTLMRMAGTFSVLAVL
FT                   LAFIKQRNPMVFVQWLAIFMLITTILVVPKRSVQIIDISDPAAVWKTDNVPVGLAAIAS
FT                   LTTSVGYKMASTYDMLMSRPDSVTYSKTGMLFGSQIVAETSDFTTQNPELAQMLPDYVE
FT                   NCVIGDILLNGKYTVNQLLNSTDPLALITSNPSPLRGIFKMTSSARQFLTCQQAATEIR
FT                   TLANIDVNPGSATFTWLTRKVFGNKLNGASLLSNAMGESYGYFYAGGLTAAQIMKNNIT
FT                   NSAVRQGIKGFAARSSDTANLLNLATENAATKQRLSWAAGNELATRTLPFAQSLLMLIL
FT                   VCLFPLMIALAASNHSLFGLNTLKIYVGGFIYFQMWPVMFAILNFASNFWLQSQTGGTP
FT                   LVLANKNIIALQHSDVANLAGYLALSIPVLSFFLTKGAAAIGSQVAGTVLSSAAFTSAG
FT                   VASTTADGNWSFNNMSMDNLSQNKLDTNLVQRQGQQTWQADNGSTQTQTAGGHTVIDGS
FT                   GAMSNLPVNMKLSQLASSGFQESARRAEQQAQTSLDGYNHSVTSGWSQLSQLSHQNGSS
FT                   DSVTQGSENSQATNATRGVSMMMSAAESYAKANNISTQEAYNSLMDISNQGSLSAGVKT
FT                   TVGGGLNVGVAKFGAEANAATDVRHATGSSRGIQNSDSHTQDMRHGNNSQAVNDFRQGM
FT                   DMVSSSRVTDGSNHTDNAATSNVQQFAATLNDAQSQYHQYTTSSTSSNEFSRMATLAQN
FT                   ESASLDTNYTQEFVDWAGNKYGDKAQAMLTSAPSAREAAMEFVNERLKPEIMGDYQQGR
FT                   ADLVSGNAHEPFSGAHIVPTTSVDSEPGYGSTRTAGDSGYIVEGNGGRTLHSNGQSAEN
FT                   NPSTVTSGGQHHLPERGTESDSSGQVRYEGPRSSTSGRNNINAETREGAASQVTDSGSS
FT                   GRVHSGGVNGEDMRSLYNENQARLKEHAGEYSGPQNEIQQKVAGQRSENEQNINKSAGE
FT                   IGKKQSTVQASSDILKGEDLSAQGKFLKGHKEAEIDQQMPIVDSAKRRELEQQLAELKN
FT                   KTR"
FT   gene            130387..131106
FT                   /locus_tag="Ent638_4305"
FT   CDS_pept        130387..131106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4305"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62910"
FT                   /db_xref="GOA:A4WGU2"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGU2"
FT                   /protein_id="ABP62910.1"
FT                   /translation="MKKGNFRLIAFVPMFVMYFGFPLIRDVVPFHDIYTYQDWFALLGM
FT                   YVIGTLLAAPLIYLLIKDSGKHLKLGLTVRWILFLVATLQVACMYYLWEQGAQLYLSMA
FT                   ITMGIISAIYAYGTKSTSIMRDKDTGNLYRVHRGKAHLLSEHDVQRYKSGLSDTGNSPY
FT                   EFSSSAIAGFDSHASENNLSFNSSMFSSDNFSSGMSINPSSGSPMVGGISGHDISGNSW
FT                   GTNFNEPTNTYDPNRGY"
FT   gene            131247..131978
FT                   /locus_tag="Ent638_4306"
FT   CDS_pept        131247..131978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4306"
FT                   /product="TraT complement resistance family protein"
FT                   /note="PFAM: TraT complement resistance family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4306"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62911"
FT                   /db_xref="GOA:A4WGU3"
FT                   /db_xref="InterPro:IPR008874"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGU3"
FT                   /protein_id="ABP62911.1"
FT                   /translation="MKLKQYAVVGLVASTLALSGCGAMSTAVKKRNLDVKTQMSQTIWL
FT                   EPSSEKTVYLQVRNTSDQDMSGLETQISNALTAKGYRVSHSPDDAYYWVQANVLKAEKM
FT                   DLRASQGFLSTGYEGAAAGAALGAGITAYNSTSAGATLGVGLAAGLIGMAADSMVEDVN
FT                   YTMVTDLQISERSKATVTTDNIAALKQGTSGVKVQTSSEQGNRAKYQTRVVSNANKVNL
FT                   KFEEAKPVLEAQLAKSITGIL"
FT   sig_peptide     131247..131324
FT                   /locus_tag="Ent638_4306"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.584 at
FT                   residue 26"
FT   gene            132170..132520
FT                   /locus_tag="Ent638_4307"
FT   CDS_pept        132170..132520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4307"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62912"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGU4"
FT                   /protein_id="ABP62912.1"
FT                   /translation="MIPERNERPGYSAEFWWLIHLESELMMTAVYLRVFGSLPEGKATT
FT                   DIAYWAGYEYTIQRLEPRSVHSARYADVAASVRAMAAGIDEKDWLSGCQQAEFELSLTD
FT                   DEETGQEFTRPD"
FT   gene            132674..135196
FT                   /locus_tag="Ent638_4308"
FT   CDS_pept        132674..135196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4308"
FT                   /product="Type IV secretory pathway VirD4 components-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4308"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62913"
FT                   /db_xref="GOA:A4WGU5"
FT                   /db_xref="InterPro:IPR014128"
FT                   /db_xref="InterPro:IPR019476"
FT                   /db_xref="InterPro:IPR022585"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGU5"
FT                   /protein_id="ABP62913.1"
FT                   /translation="MTAYRWRMFLQVNNWIGFWIFILFAVLASAIFFWRIPQETLDNGS
FT                   LWWFAWMNSSFIDLMPASAPKLYDIHYWYAPTQTPMVLKMTLAQIFTDPYMTAMGDQVL
FT                   SELQWAGLASGVFSMAVFLAVTWYIVGIGRRESEDEYLSGMTLTDKAADVNQLLRRNGE
FT                   LSDLRVGDLHMVRMAEVMNFLMHGTIGVGKSTLIRWLLDYIRKRGDRAIIYDSGCTFTE
FT                   THYNPDTDFILNAHDDRCANWQLWGECVDAVDYDNMASSLIPVEGESDPFWVSSSRTIF
FT                   ADLAIRMSVDPDRSIEKFLKTLLSLSMKSLREYLANTPSANLVEEKIEKTAISIRSVVT
FT                   NYAKSLRYLQGLDDGVKPPFTIREWMTKEEHDSSWLFISTQARHRKSVRPLISLWVSLA
FT                   TMMLQSMGENSDRRVWFIYDEIPSLQRIPELAETLAEARKFGGCFVLGMQNMAQLVHVY
FT                   GRELAKSIFDLMNTRMYGRSPSAEMAKVVEEELGNQRKRKIREQNSYGLDQVRDGVSLG
FT                   KDEVNNPIVDYEQVMRLPNLNFYVRLPGEYPVVRLKLKYREQKKHHPGLIERNIHDALS
FT                   PELEKVIQANERAASVAGLAFPTGDEVLEKGSNSETATTINTPATVRQTPVVAKPVTAS
FT                   AISQKPAPAVTAVNKPDEPVLPVKHSPVTPPATEPEKNNLVSLHSIRQTAPSPDSGLPV
FT                   AETPSEHAVSSAPSEAAASVVPSVALPAALQSLRNRPVSPEPAPTSALGMLQKARQRPV
FT                   NTESDQQGEDNAGGESMNLEMHVSERADGGLSITTAGHPPEPEHAAETHRVSRQLAQEE
FT                   ENILRHREPDDPGYSDYDQHYDDREPDL"
FT   gene            135196..140619
FT                   /locus_tag="Ent638_4309"
FT   CDS_pept        135196..140619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4309"
FT                   /product="ATP-dependent exoDNAse (exonuclease V) alpha
FT                   subunit-helicase superfamily I member-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4309"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62914"
FT                   /db_xref="GOA:A4WGU6"
FT                   /db_xref="InterPro:IPR009767"
FT                   /db_xref="InterPro:IPR014059"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040668"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGU6"
FT                   /protein_id="ABP62914.1"
FT                   /translation="MSVAPVASAGGAAGYYSNADNYYFLGNLQSLWLGEGAKALGLEGS
FT                   VRGDDLTAVLEGRLPDGSRLGKEINGNHVHRPGHDLTFSAPKSVSILGLIGGDKAMVEA
FT                   HNHAVRVAAGYVEKLISARDTKDGVTSIVHTDKMVAAAFTHDTSRNLDPQLHTHLLIAN
FT                   MTEQDGKWKALATDYIHNAGFIETVMKMQVTLGKIYRSALRQHVEALGHEVEEVGKHGM
FT                   WEIKGVPEDVRDEFSSRGREIQGAIGAEATLRSRDVAAKDTRQAKVDPSRLRLMDRWLN
FT                   QMKDKGYDLKAYQESVVPRDAGPREAAMPPERVPPAATVRTVPESLTPEKTPLTVKAPE
FT                   PQDVSPERETANNQTEAQSTDTLSQPVHAGPGKMPSTGTSLREPQLHTDAPLPELAEAV
FT                   RLAISQLSDSKTRFTFGELMLTAAELSDTLPDMNQVRQAIDVSLKEGMIVPLDSEKGVF
FT                   TSRIHLLDELSIQALSQEHLKSTAVVSFTRPEQYAPPALSVVEKDALVLMNAPSGVAGI
FT                   RDLTAQLTGISLAQGRDVQVLASSAERALSLEKSDALRDRLVSRQHVLSGDFHLKPQST
FT                   LIIEGAERLGLKETLVLLGEARAQDAQLVFLDSAGRQANGNAMSVLESAGIARSRRTEP
FT                   APGLEAEVVSITNKRDRYEALAIRYADLSGGAENVTAVVVGKREQTHLTGLIRDALQNA
FT                   GQLAREGVEIEARQPVWLDTKTRRMSGSYRPGMVLEDRSDKKERHSYVIDRVHEDTRML
FT                   SLIDGDGVLTRMKISEVTADWRLYNRETLSVATGERLMSVAGDREHNLKAKDRLEVTQI
FT                   SEKGIEVKRGDDILMLPKDQPLYVTHAYVSAPGGRDNDAGVVLAALNSRDISTQTMNSL
FT                   AQSGHRAEVFTAEDQDRAEARLQRMKTNASPVQLVRSLSGKEDVSEAVGRLHDSVRTEA
FT                   GLAVWRAINDQRHVTFSELTLASAAEKYHPDFDQIGDEISSMVKRGDLLKVSAGGEPLL
FT                   VARSTWEMEKAILRVVDEGKNTQQPLLDQVPSAVLNGLTGGQKQATSLVLGSTDQFTGI
FT                   QGYAGVGKTTQMKAVVAALETLPADARPALTGLAPTHQAVKEMSDVGVRAQTIKSFIVE
FT                   HDQATAAGEKPDYKSQVFLIDESSMAGNQDTAALFQAIAAGGGRAVSMGDIDQFEAVDS
FT                   GAPFKLMQERSPMDVAIMKEIVRQKDVQLRGAVHDIIDNRIDAALKRIEAQPVDRVARE
FT                   ADATPPDSAFHETETPVDDIVRDWTGRSPEARARTLIITQLNADRQSVNAGIHRQLRER
FT                   GELGNIAITVPVLDKITHTRHEFNKTQAWTAGMVVKRGDRYQDVLAVDRNGNTVTVRNE
FT                   EGKIGLYSPRELITGDVQLFKRNQIEVRQGDLLRFTATDREQGQTANQRFTVESVSEKG
FT                   DIRLRGEKGMVTINPDSVRAQQHLDYGWAVTGYGAQGTSTDYVISLEGTEEGRKALATR
FT                   RAFYISASRAKEHVQIYTDGKADWTKAVTRPERDIKTAHDALHPETQRQQARAIWAMGQ
FT                   PVSKTAIGRAWVRHQGMQDTSLTAKIIPATRRFPEPALALPVYDNNGKSAGLALVSLVS
FT                   SPEGRLTQGDTRMVMTERARGAVLQRSQSGHTHVVSDLGAALEAVKANPKDGVVWQTGE
FT                   ESPSSHLIKVTGGERQDAEERAAINVSRRETDIVLPETEKQKPEQAMSADTEKAREQEA
FT                   LRRIAEETLQIKPEFTGTEASQESNEPDRSTLKNIASSEDIAASDAARRHSEKAEIVQD
FT                   RTPEERAGASRVVSELANSERDIVRQPEPAERGRMPERDEQTLTHTIQKER"
FT   gene            140649..141437
FT                   /locus_tag="Ent638_4310"
FT   CDS_pept        140649..141437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4310"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4310"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62915"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041205"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGU7"
FT                   /protein_id="ABP62915.1"
FT                   /translation="MKPTALSSLLVTTYIFFVSTAHASTPAVVFSPEQEARIGEIAAEY
FT                   LTAHPDILVTVSMKLQEQKREREQLKFAVRVMDNQAALLNDPDTPSSGPANAGVAVIEF
FT                   FDYQCVFCSKMAPEMEAVMKSRPDVRYFFKEWPIFGERWENSTKAAGYGLSVWKQKGAE
FT                   AYVTYHNAVYATGHDEGKLTGQDIVQAAGLAGFTGPVRDDFSPLLARNDALARALGLTG
FT                   TPGIIVMPVKGATPKNITVFPEYVPAASLEAAIQKASTAH"
FT   sig_peptide     140649..140720
FT                   /locus_tag="Ent638_4310"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            142052..143071
FT                   /locus_tag="Ent638_4311"
FT   CDS_pept        142052..143071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4311"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62916"
FT                   /db_xref="GOA:A4WGU8"
FT                   /db_xref="InterPro:IPR003446"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGU8"
FT                   /protein_id="ABP62916.1"
FT                   /translation="MNENLTSVHWSNLPADEQVQFWQDIDAGKQDGFLVASVKTLTRRQ
FT                   RGDHSTKPKCENPAWYRPEHYKKLSGELDHAYNRLVQKDKETGQVSLRMHVSRHPLYVA
FT                   GRRKAGRKYGFRPERQRLLDALWPVLISFCDAGKHTVGMCISRLAKELSAKDSKGNVIP
FT                   ETEVTVSRLSRLIEEQVRFGVLGLAEERTWDRESRSWLPTYVYITLVGFQMLGVNVSKL
FT                   TREQDKKLKTSAERDQLIREGVMNEYDEISPHTARKRWYSQKQREALHYRRKKGAERKR
FT                   ANRLIKLPVDARIHAMSAWIYKTMPPDEAYWCTSERLRVLAIQHLYQLDLALSPAEQT"
FT   gene            complement(144003..144770)
FT                   /locus_tag="Ent638_4312"
FT   CDS_pept        complement(144003..144770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4312"
FT                   /product="TraX family protein"
FT                   /note="PFAM: TraX family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4312"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62917"
FT                   /db_xref="GOA:A4WGU9"
FT                   /db_xref="InterPro:IPR008875"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGU9"
FT                   /protein_id="ABP62917.1"
FT                   /translation="MNHSVPGLLHSLQTPGRVSPAALDMVKVLALLAMLGDHINTLFLT
FT                   PPEPLAYAAGRMAFPLFTLIWAMNVQRRPERLQVRANRQWIWAVITQPVFSLAFAGHQP
FT                   WWALNILFVFAGVTQLLALQYRYGKKGLMAGALVLGILVWPLSPASYGLAGIALATGMV
FT                   TATGGKTPGVQRAGIIVTVLSLCSLNGVSHLLSLPADTLLFATLPTLVFPLMAVSLSIQ
FT                   WCPAGDQRFMPRHFFYIAYTGHLLVLLILMQLW"
FT   gene            complement(145370..145801)
FT                   /locus_tag="Ent638_4313"
FT   CDS_pept        complement(145370..145801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4313"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4313"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62918"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGV0"
FT                   /protein_id="ABP62918.1"
FT                   /translation="MNKPSCGFLCSPGHNSHFAQELKPCSNHIFKLAEIDMYQEVLDAL
FT                   NEEKTTRQHMNKMEDFYNRATDPDLKKLIRAVGNEYANWLDRFKKLANQKTTNPISKQR
FT                   NVAKANAARKTKFIPSRPMEDGTVPLSVSALIAYCKSKI"
FT   gene            complement(146578..146865)
FT                   /locus_tag="Ent638_4314"
FT   CDS_pept        complement(146578..146865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4314"
FT                   /product="addiction module toxin, RelE/StbE family"
FT                   /note="TIGRFAM: addiction module toxin, RelE/StbE family;
FT                   PFAM: plasmid stabilization system"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4314"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62919"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGM4"
FT                   /protein_id="ABP62919.1"
FT                   /translation="MTYTVKFRDDALKEWMKLDKSIQQQFAKKLKNCSENPHIPSAKLR
FT                   GIKDCYKIKLRASGFRLVYQVIDDQLIIAVVAVGKRERSDVYNLASERMR"
FT   gene            complement(146862..147113)
FT                   /locus_tag="Ent638_4315"
FT   CDS_pept        complement(146862..147113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4315"
FT                   /product="protein of unknown function DUF172"
FT                   /note="PFAM: protein of unknown function DUF172"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4315"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62920"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGM5"
FT                   /protein_id="ABP62920.1"
FT                   /translation="MPNIILTDTSASVSELKKNPMATVSAGDGYPVAILNRNQPAFYCV
FT                   PAELYEKMLDALDDQELVKLVAERSNQQLHDVDLDSYL"
FT   gene            147245..148102
FT                   /locus_tag="Ent638_4316"
FT   CDS_pept        147245..148102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4316"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62921"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGM6"
FT                   /protein_id="ABP62921.1"
FT                   /translation="MIKFPALTANAIRQDNPDGTMTQKTLAERFDELELEYQEVISTTY
FT                   TAFSEFSGKNKEYVDSPKYKTWIARAKKLITDSYGKDSDFYTGFVEAESGFYASNHEIL
FT                   TKQLKPAFDAAKADLVYSIPAISNALANINDGLELIINILNKFPAFCRQLKKRHDGRPT
FT                   IEISDEYDVQDLVHSLLVLHFDDVRAEEASPSYAGSSSRQDFLLKKEKIVIEVKKTRKT
FT                   LSAGKIGEELIIDMARYCAHPDCDTLVCFVYDPDGWVNNPKGVISDLERGDTEGKTRVV
FT                   IAQF"
FT   gene            149107..150390
FT                   /locus_tag="Ent638_4317"
FT   CDS_pept        149107..150390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4317"
FT                   /product="YadA C-terminal domain protein"
FT                   /note="PFAM: YadA C-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4317"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62922"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGM7"
FT                   /protein_id="ABP62922.1"
FT                   /translation="MKSIKYAVAIAVCGVIFSSSVYAGQFMTVEAKAEAIQQIRNEANA
FT                   AKSIIDIYQAHPDNSMYNQLQLARDTFDGAALRIADIQATPAAPVATPSKLMNVPHQIP
FT                   VLAPQPNLITPVTPQPIALPVKPMATPAATPVKLQQVPQPMATPTPATVNVPNPIAVSP
FT                   KPMAIPLATPAAIPQKLQQTPVAMNVPQPQTAATPIPVPQPMVSLIPIVKGTSTPIATG
FT                   VSGPHTIVPILSSTAVKTVDAKPSTLTTGIINTQTTASTTFGAVDGKDGEKGDKGSDGK
FT                   NGVTTTITKMEVDTAMQAKVVANTAAIASTATQTATVAKDLQDAKQVLAQQQANSNAQF
FT                   KSLKNEIDGNKKEARSGVASAIAIASMPQVEAGQSVMFSAGVGSFKDEQALSVGASFHA
FT                   GEHAVIKAGISDSTNNDLSMGAGVGIGF"
FT   sig_peptide     149107..149178
FT                   /locus_tag="Ent638_4317"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            150732..151190
FT                   /locus_tag="Ent638_4318"
FT   CDS_pept        150732..151190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4318"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4318"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62923"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGM8"
FT                   /protein_id="ABP62923.1"
FT                   /translation="MKKLMMVVVSISILAGCSTEADRMAKCEAQGIDKPTCYLAEQNRT
FT                   TAINAAAEKQALENAANAVQHAQAAHVIDPMREATLTGPGVKATVSNGFFKATINNKKA
FT                   KVKRLNANYYEISGAGYIVSISLDKEGIQSASYTKQYSKTNGIMQVQQ"
FT   gene            151288..151455
FT                   /locus_tag="Ent638_4319"
FT   CDS_pept        151288..151455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4319"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4319"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62924"
FT                   /db_xref="GOA:A4WGM9"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGM9"
FT                   /protein_id="ABP62924.1"
FT                   /translation="MQIFCSARLKGDNSRDTAGSSDLIFGLFWLLGYQFSPRLADAGAV
FT                   STPVLVPRTF"
FT   gene            complement(151435..152229)
FT                   /locus_tag="Ent638_4320"
FT   CDS_pept        complement(151435..152229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4320"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4320"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62925"
FT                   /db_xref="GOA:A4WGN0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGN0"
FT                   /protein_id="ABP62925.1"
FT                   /translation="MSLRQACRTLSLSRTVYFYQPDTRRDEPVIQALTELAERYPRYGF
FT                   KKLFQVLRRHGNAWNHKRVHRIYCLLKLNFRRKGKQRLPVRNPTPLATPQALNQSWSID
FT                   FMHDALVCGRRFRTFNVVDDFNREVLAIEIDLNIPAQRVVRVLDRIVANRGYPLKMRMD
FT                   NGPELVSLALAQWAEEHGVMLDFIKPGKPTQNAFIERFNRTYRTEILDFYLFRTLNEAR
FT                   EITERWLAEYNSERPHESLNNLTPEEYRLMAENTEISKSAWN"
FT   gene            complement(152280..152546)
FT                   /locus_tag="Ent638_4321"
FT   CDS_pept        complement(152280..152546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4321"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4321"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62926"
FT                   /db_xref="GOA:A4WGN1"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGN1"
FT                   /protein_id="ABP62926.1"
FT                   /translation="MRKIRFTEHQIIAVLKSVEAGRTVKDVCREAAISEASYYNWKAKY
FT                   GGMEAADIKKIKDLEDENRRLKQMFADLSLECRALKDVIEKKL"
FT   gene            153162..153803
FT                   /locus_tag="Ent638_4322"
FT   CDS_pept        153162..153803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4322"
FT                   /product="plasmid segregation oscillating ATPase ParF"
FT                   /note="PFAM: Cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4322"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62927"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGN2"
FT                   /protein_id="ABP62927.1"
FT                   /translation="MSGGMMIIVLGSQKGGVGKSTLAVSLAAYLITLGKRVLIVDADDQ
FT                   KSVLTWYNNRPENLPHMPVTGATGNIKAMLKEHEKSYDFVIADCAGRDSAEMRSGLMAA
FT                   DVFISPLRPSQMDLDVVPHTCSVFTAAKDFNEAVRGYLVLNMTPTNMFVNEANQAAEVL
FT                   KDFPEMKLAEARVCDRKAHRDAWAESMTIFETQNVKAQEEIEALVKEIIL"
FT   gene            complement(154190..154963)
FT                   /locus_tag="Ent638_4323"
FT   CDS_pept        complement(154190..154963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4323"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4323"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62928"
FT                   /db_xref="GOA:A4WGN3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR016423"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGN3"
FT                   /protein_id="ABP62928.1"
FT                   /translation="MPGLITYNAQDTQAQLPVAIDYPAALALRQMSLVQDDLPKYLLAP
FT                   EVSALLHYVPDLHRKMLLATLWNTGARINEALALTRGDFSLAPPYPFVQLATLKQRTEK
FT                   AARTAGRAPAGSQAHRLVPLSDHQYVSQLEMMVATLKIPLERRNKRTGRMEKARIWEIT
FT                   DRTVRTWLSESVEAAAADGVTFSVPVTPHTFRHSYAMHMLYAGIPLKVLQSLMGHKSIS
FT                   STEVYTKVFALDVAARHRVQFHMSETEAIAILKRK"
FT   gene            complement(154963..155643)
FT                   /locus_tag="Ent638_4324"
FT   CDS_pept        complement(154963..155643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4324"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4324"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62929"
FT                   /db_xref="GOA:A4WGN4"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGN4"
FT                   /protein_id="ABP62929.1"
FT                   /translation="MADWFIATEGVKVVKDSASLWPQIITAVSSAGAALGGVCLTHHFT
FT                   RRREERAAADKAAAERLYLATELAFLLERYASGWTYLRWTHLEKLSQDNRIPVLDLSAA
FT                   SGDWRVLPPRQLFKIRSLEADYVALVSRISKLTDSNDDRFELILNFDCFQTAVRAFILS
FT                   ARLRREVGLPDSAHLRDKSGVLRGLREARQRSWSTEARLRRFENEAFESIQLRSYQQED
FT                   EGQQ"
FT   gene            complement(155679..156002)
FT                   /locus_tag="Ent638_4325"
FT   CDS_pept        complement(155679..156002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ent638_4325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ent638_4325"
FT                   /db_xref="EnsemblGenomes-Tr:ABP62930"
FT                   /db_xref="UniProtKB/TrEMBL:A4WGN5"
FT                   /protein_id="ABP62930.1"
FT                   /translation="MPDNSNENETNHGLSGLWDQLSDYPKLRLHQTMHFGYPLVHVLDE
FT                   EGRELARRIDSTGRWEWRESSPERWTPQPEEYLIEYEFEGDEERDCFQLDMLDRPFGAF
FT                   TRL"
XX
SQ   Sequence 157749 BP; 39268 A; 39117 C; 40657 G; 38707 T; 0 other;
     tatgattaga ctaatcttaa gtgtgaatca tcttgcaatg ttttgacatt ataattgggt        60
     gaaactggga gcgaaaaatg aacgaagtta actatagtaa aattaaagat tacgttcaaa       120
     aggttagtgc caatagtttt gctaaggtat ttagtttatt actaatatcg ctacctataa       180
     gttttgaagc taagtcatct tcttgcaata cgtcagatgg taccaacggc ggaaccactg       240
     tgacgagtgg agatacctgt tcaattccag cagactataa ccccagtggg aatgatacct       300
     tggttggtgc ggcggcagtc actggaggag atgctattac attgactggc acaggaactg       360
     gtattcaggc aggaaacagg ggcattcagg ctaatacgct cgggagtttg aatcctgaag       420
     cgaatggtct tgaaagactg cttataggag cacaaacatt aggtgttaat actttagacc       480
     cggtaacggg atcaaacatt gttgttgccg catacaactc gtctgcattt aatacatcgg       540
     attgggggca attcaacggc cttaataccc aaaccccaac caacgttggt gataaccagt       600
     atattaatgc taggtttggg acagtacaaa atgggacgct acgcgtcaat attggcgacg       660
     ttggtcagtt accttccgca gatgtaaaca ccataaatat ggctgccaaa caaaccatgc       720
     tgacaatggc ccaaggggca ggtagcacac ttatctggga atcaaaaaac aaaatactaa       780
     tgggggatgc gctagttgcc tcgcctggaa cgactactca atcaacgacg attgacattc       840
     ctgtgtatgc cggcaccttt acgggattta acggacaaac atggacagtc agcaatgcaa       900
     ctgatctaca acaatataat aacgcactaa tcgatgcgtt gcagaatggt caattatctt       960
     cacaggctgc gtacgatcag gcgttttccc aggccgtaag ctttacatcg cgtatcatta      1020
     attacagcta taccattaat tccggtgatg atattactca gagtgctgga aataattatt      1080
     ctatgtatgc aagcggtacc ggggctcagg ccattattca aacaggtggc cagattgatc      1140
     agcgtggcgc aagtgtagcg gcagtgaatg gtgcatctgc tgaaattcaa gcgggagctc      1200
     aactatcggg gcatttcaat tcactgttta tcgggagtgg ttcgactggt gtcaataatg      1260
     gagtcatttc tggaggttat tttgctgaaa atggctggga tacgactggc cctgggaatt      1320
     atagtaatga gtatggagag gcgtatacag tcacggtaga tggcatcgga agtaatttca      1380
     gtaatgacgg cattatcaac gtcgcaggat ggacgcagtt tcaagggtat tcaccggatt      1440
     cttggggcat acgtgttcag tccgggtcta ctgcaagcaa tgccgggatc attaatacgg      1500
     gtgtgaataa tggatcgttc agtaattcaa tatcgggagt gatcgttgca aatggtgggg      1560
     caagcaattt cacgaatatg gctaccggga ccatttatct tggtcgtgct gcacaatatg      1620
     atgtggccaa ccctgagagc gttattgata tcgcaaatac tataccccaa tatggtattt      1680
     tgctgagtga tggtcaggca gtaaacaacg gcataattga aattggcaca ctaaccgaaa      1740
     atgcgactgc aatggccgca gtagcctctt caccaacggg attgctggtg aacaacgggg      1800
     ccatccacat tcggggagct gccggtgata atcccctgca gaatactggg atccttgctc      1860
     aaaacaacgg acaaaccgta gtgcaaaacg caggaaatat cacgatagca ggtgttaacg      1920
     gtgtggggct gaaagtcatt tctacaacag gaaccgcatc tgcctcatcg gtttcaggca      1980
     gtctgattga agtagctggc ggtatcgatc cgacgagcgg tacccgaaat tacggagttt      2040
     gggcgcaagg agtaaacagc agtgccagcc ttgcagggga tattattttg tccgggcaag      2100
     ggggtattgg tgtgctggcc agagaaggtg caacggtaaa tgtcggggtg ggatcggcgg      2160
     ttgagtttaa tgaagcagtt gatcctctcg ggtgccccaa taattgcagc aaccagatag      2220
     gctatctgat ctatggtgca ggatcttcaa ttaccaatca gtcccagcaa ctagatgtag      2280
     ccagttcggg atctacattg tttcggattg aggatggagc ttcgttctca ggaaatgggc      2340
     aatctcttac agcatcagga aggaattcta atattattac tggtagtggc ctaaatacga      2400
     ccataaatac cgatgccggt gtcctcactg ttaatgggga aggggctacg gggatccgta      2460
     ttgacggtgg tgcatcggga aatattcaat ctggtactat tattaatctt aacgggactg      2520
     gtgctatagc aggccaagtt gacgggcgaa aaatcaatat atcaggagtg cctggtagta      2580
     cagtttatcc ttcaactctg actaataatg ctgtcatcca gtctgcggcc agagatgcag      2640
     ttggatttat cactcagtat cagggggaac tgacaaataa ttccagcatt tcacttacaa      2700
     gcataggaga aaatacaggt gtaattgtcc gggatggggg tatattaaat aataataata      2760
     tgattttggt ggctaacggc accggggttc tggttgaagg tagcacggca ctttccgctc      2820
     tgaataacca aggctcaatt accgctgaaa atggtgtagc gggtattcat ttgcgtaagg      2880
     gtgcaaacct gaacatgacc ggctccggtg atgttcattc gtcaggaact gcggatggca      2940
     ttttaatggg aactgatgcg gtgggtattt cattagcatc ggtcaacgtc aatgttacag      3000
     gtagcggaag tggcgtccat aacgtccagc agggaacaac aagcaatctc acagggatga      3060
     ccatcactac ggcgagtggg gctgcaatat taaatgagca gtcttcatcc tggtcgctat      3120
     caggcacacg tctaaattcc tcctccggtt gggcggttca gaacagtggt ggtgatgcag      3180
     ttttcatggt ggccaacacg gtgctaaccg gagcggaagg ggctttactg accgaaaaca      3240
     atgcatcaac acaactgaat gcatcttcat caacattaaa tggcaggatc ctgacaacgt      3300
     cagggaaaag taatctagca ctggtagatg gcacgttgtg gaatatgtct gctgactcga      3360
     acgttaccaa tttaataaat gccagtagca cagttaatta cacctccgat aatgtattta      3420
     agttgcttac agtaaatcag aattatatcg gtgatgatgg gtttcttaac atgaacacgg      3480
     ccctcggtga tgataattct ccaaccgatc gattgcttgt acagggaaat acatccggga      3540
     cgactttggt tagtgtcaac aatgttggag gtgccggggc ggaaacggtg aatggtattg      3600
     aacttatcac ggtaaatggg gattctgcag gcatttttag tcagtccggg cgtatcgttg      3660
     ctggtgccta tgattattcc ctggcccgcg gggctggggg aaacaatagt aactggtatc      3720
     ttacaaaccg taaaactcag gaaatccccg tgacaccagg cttgccggtt gatcctggcg      3780
     gtccggatac gccgaaaccc gcagggccac aggttgaccc aggaggcaaa ctggtactca      3840
     gacctgaagg gggaagttac gcggcaaaca tcgccgcagc aaatacaatg tttgtaatgc      3900
     ggctgcatga tcgacttggt gaaacgcaat atacagatgt gctctctggt gaagagaaag      3960
     tcaccagtat gtggatgcga aacgttggtg ggcatacccg gttcagagac agcagtgagc      4020
     aacttaaaac gcaggcgaac agatatgttg tccagatcgg tggggatatt gcccaatgga      4080
     gtagtgatgg agccgatcgt atccatttag gcgttatggg tggctatgcc aaccagcata      4140
     gtaatacccg ctcacacctt agcggatatg attccaatgg gacggttaaa ggttacaaca      4200
     caggtgtata tgccacgtgg tatcagaatg cagaggaaca tacagggttc catattgaca      4260
     gctggttaat gtatagctgg tttgataata cagtgaaggg agaggggctt ccctcggagt      4320
     cgtataattc acaagggatg acagcatcgc ttgaaagtgg gtatacctac catctcgccg      4380
     attactttgg cagtcaggga agcataaacc gctggtatat gcagcctaaa gttcaaatta      4440
     tcttaatgga tgttaaagct gacgatcatc atgaagtaaa tggaacgaag gtacagggag      4500
     agggagatgg aaatatccag acacgtcttg gattgaaaac atatgttaat ggccaccatg      4560
     agatggataa tggaaatcag agagtctttc aacccttcat cgaaacaaac tggatacata      4620
     acacccgtga ttttggggct tcaatgaata gcgtcgcaat tattcaggaa ggcagtcgca      4680
     atatcggtga gttaaaaatg ggtgttgaag gacagattaa tctgagacta caggtctggg      4740
     ggaacgtagc ggctcaggtc ggagatgctg gttacagtga tacatcagca atgatgggta      4800
     ttaaatacag ttggtagctt tttgcccgca ccgtgtattt tgaacattgt gcgggttttg      4860
     cttctggctg tgttcctcaa ttgcataatc gttggtaaaa gagccggatg cagccagttt      4920
     caccataaac agataatact tcaccgtttt gtcgtaacga gtgtcctgag tacgcattgt      4980
     ctacccgtac cgcatgacga cgacgcttca ttttgctgtt ttggcgctga acaccaatag      5040
     cagcgagaag acgtaacgca aactcttttt agtgagtctg tacgggattc agaacgatat      5100
     ttaacagtat gccgcttccg tctgtttcca tatggatttt ggtgccactg ccactgccac      5160
     tgccaccgcg acccaacacg ttatctccgg cgatatcgga tgtttttgat cgccgtcggc      5220
     acatttagtg cacggatatc gctcccattc aatgctgtgg caaaacagtc aacgagacta      5280
     tgcgcatcaa gagaagaatg tgaactattg gaaatgatgt ttatacactc gatttagacc      5340
     atcgattata gcgattgcaa atggctttcc acggaccatg ccgtacagat aaatcgcgtc      5400
     atggcgcacc ggaacacagt acccagaaca tgccagtgac gattttacca tgctctgccc      5460
     aggggtatcc ggctcgggga gatactagtt ctgctggcag taaggactgg atgatcgccc      5520
     atgctttatc gggaaggttg tagggagcca tgattcaatg tgctgtgaaa catgtagtta      5580
     ctatagctca gacaagtaaa gcacacagcc tagtgattga ctcttattat aatcaatatg      5640
     tgaaatttta ttttgcatgg accctataat ttgattcttt atccttttaa tagttcaact      5700
     agttcatatt agctattgcg taagacacta aaattcatga tatttatttt aatttatctg      5760
     aatatggttc gtatggcagt tttgattcgt taggagaaag gtgtgcctca gagcatctta      5820
     atggtgagca caataatgac agtaattggc gaaaggtagc agaatggatg ttcatgttcg      5880
     cagtcactcg agttatctta cgtattctat aaaagacttg gtttctgaaa ttgatattgg      5940
     attaattgga aacacacaac atcttttggt tatagatttt tcaagtgagc gaaattattt      6000
     ctcaatgatt gaacttataa gtgaacgtgc cgaatggctg gcaaaaccag aaaccaaagt      6060
     gataatcata ggcgatcggg atgtttatgg tggagtcgaa caaaaaagca ttatatatat      6120
     tcgacttaac gcttcacttg aggaatggcg caagaaactt aaagccgcat tgcaagcccc      6180
     agctctaaat gtctcccgat taatcacgat ggcaggtagg gcaaactatg aagcattaac      6240
     gtcatccgaa aaagatgtta ttgcctgtat cagaacaaat atgtgcatgg gcaatattat      6300
     tgctagacag ggtattacta ctaagactta ttatgcgcgg atatattcaa tcaaacgcaa      6360
     actatcttta cgttcagcaa gagaagtata tctcaacatc gagaaaatat acaataaaat      6420
     aaagcagata agtgaccaat ccaaagggtg agtattatgc atttttacct ttacctttac      6480
     ctttaccttt atgtagtaca caaggtttta agttcaacac ataccgagtg ttttcatgag      6540
     aatgaatgca aggaatacag tgaatgaaga agtgttaact gaaaaaaaac ctaaatagga      6600
     aggtgcaatc agggatgaaa atatagtaaa catcgtggtt ttattgtatg tggactataa      6660
     aaatagccct gatgaatgtc acgaaattga tagaagatta tacatgctat gcaaaataaa      6720
     tgatttgtgg atggaaaacc atgtgaatcc aagaagttac atccagattt aaaatatatt      6780
     tgagaaaatg gatgcctatt tctggtagtt taaatcgctt ttgtttttct tacgatatcc      6840
     gttagtacac ttcttagttc cacgggttta ataggcttgg aaactatctc aatattgaga      6900
     tccttaacaa agatactaat attagtgaca tcatggcctg tgatgagcag tgcagggatt      6960
     tgttctgctt tcatatttcg aattgcctgt atatattcaa tacctgaaat ttttgtgccc      7020
     agatcataat ccgcaatgat aacatcgcat tcacattggg tatccagtag tgttggatcc      7080
     tgtgattcta gtggtaggac ttcacatccc caacgctgaa gtagcatctg tgtggcatcc      7140
     agcatttcgg ggttatcctc aataagaaac acccgagtcc cggaaagctg catgagtagt      7200
     ttttcttgcg gtttatcttg gacaactggg gtactggcaa tctttagatt tgaaataaca      7260
     gcacaggtcc ctagaccaac acgggagaca agattgatat ctaaacctgc aagggagcag      7320
     gcacgtttta ctatggacaa accaagacca ataccctcaa gatctttatc tctgtttttt      7380
     ttgatgcgga aaaactcatc aaaaatatgc agaagatgtt tctcttctat gcctgaacct      7440
     ttatcacata tagctagcat tatacttcca ttcttatgga aactacgcag agatatcagt      7500
     ttaccttccc catatttaac ggcattactg atcagattat tgataattat tataagtatg      7560
     gagacatcag atttgaccca acactcttct acatccagtc gtatctgact tcccgcttca      7620
     tgtgcggcaa cagtatgttc cttaatgcat tcttcaagca tattacgtaa tctgaacact      7680
     tcaggtttca gattgatccc cccgctatcc agggtgtaaa aattgagcat tgaatgaaat      7740
     atatgtgaca cactaaccag agaacgatcg atgttatcga ccattttaag cccgctgggg      7800
     tttaaatttt cttctcggag gcaggtaata tagattccga tggcgtgaat gggttgccga      7860
     agatcgtggc tgacttgggc tagtagctgg gcttttgtgt gtgttgcctt aagggctcgg      7920
     gtggacgcct ggcgtacctg tgtaagaagt gttttagcgt atactgggat aacgacagtg      7980
     gtcagcaata aggccagtac catatagaga tggttagacc agtaatcgtt gtagaacact      8040
     attactgata aagaaatgaa cgacatgatt gtcgcagcaa ggagatagaa agcaccataa      8100
     cgtacgccat aacccaatgt cacccatacc attacagcgt atattgggag tgtcttttct      8160
     tctcctacag ccaggccaac cgaaatggcc acataatcgt gaatcatggt aaacatacgg      8220
     cgtacaagga aaataccagg attacgcttt atgatgaacc ttaaaaggat tgatgttaaa      8280
     agaaaaccca aatagtacaa tgcaataaac agataatccc aagtgtattc gccaaagaat      8340
     agagcaatca tactgacata acttagtgcc attatggcga tgaccacccg caatgttgcc      8400
     tggtttaatt ctgaaatgtg ctggctttga atttcatatt ctctaaatgg cattgccttc      8460
     accagtgagg atggagttta cggtgattcc cgagcgggag ccgatctatc aggtcaattc      8520
     agataagatg tgaatattgc gcaattgcga ctgttcgagt tggcacacct agtacatgaa      8580
     gaacctgcga aacatggatg cgtactgtaa acggtgatat gttgagcgat tgcgcaattt      8640
     gtttattcga ttttccttgc accagtaact gtagaacctc tctctgccgt tctgtcaaca      8700
     agtccagttc tgctggcgtc acccgcaggt tgggaagggt ccccggtata taattaacca      8760
     caatgtttcc gttctgaatg tcagcaatat cgctcagtag ttgttcagga ggaacatttt      8820
     tgctgatgta tccgtcaacc ccggtggcca tgactgcctg aacaagggcg gcatccgtat      8880
     tcattgaaac aataatcaac gcggttcttt tgagtttgtt tttcagtgtg accagttttg      8940
     aaagtgaatc cagcccagga aattgcagat caagaattaa aatgtcagga gccgggaagg      9000
     tttcgagaac cgactccagc tcagaaaaac tacctgcttc tatgatatcg ggatcattct      9060
     gttgtgcgag ttttttcgcc atcgcatctc tgaacaatgg atggtcatct gcgataatga      9120
     ttgtcataaa gtcaacctca aaaattctat cgtttaagta tggctgatga ctttaaactt      9180
     aaccagtcac ctgttgaaac ccctatagat ctaatgggtt aaatcgatta tatgcacata      9240
     tgcactacgg aatagtggct cccctaaatt taggatttct ctctttaacg tgtttatgaa      9300
     tggttattca ttttaaatgt gatgttagcg atacttttaa aatgaaagta gagagggatt      9360
     tgttaaatcc caaatgatat ttttcctgtc catttgaacc ctgcagaata atgtacagtt      9420
     aaaatccgaa gtaaatagta cacatgtact agatttcaga tgagaataaa taccaataaa      9480
     ctacataaga tgatatgaaa acatatgttt tcatttgttt tttttaattc ttatggatag      9540
     tatctttgag ctattgagca cttttccgaa tgtttgtaga ttacgcacaa ggttagatta      9600
     ttcctagcct gtggaagttc tgtttaaaca gaaataaggt atgtgcattt aaacatgggc      9660
     tgcctgcgga aaaatgagat gttagcaagc actatgtcaa catcattaat aagtatgcat      9720
     taggaaatct atgcgtatta ctatttacag tgattctgag tttttcaagt ttggttttca      9780
     gtgcctggtg aatgactgtg atctcgtatg gcctgatgat ggcttgcatc tccatattgt      9840
     ggatcttatg gacaagagtg acagcttgtc gtttgtaaaa atgctagatg tgagtccatt      9900
     ggatttttca gcaacaaata atattatttt aattatgagc gcaggcttgt atgtctcagg      9960
     ctcccggtta cgcggagtga ctatggttag cggcaattct actcttaaac agttgcgcta     10020
     ctgggtgaga aaagcgataa aaggtgagtg tgttaatgtt gaacatattc atcaacttag     10080
     ccggaaagta ccaccgtgtc aatttagtcc atacgataga cagctaattt actttatgaa     10140
     gaagaatatg tccccggcag caattgctag cgcacaaaaa gtctccataa aaacgctgta     10200
     ttctcgcatg agttcgttga agcaaaaatg catgctcgct tcaacccgag aactttactt     10260
     gaatgcggaa tatatttatc agcaaatctc agaggcggct taagaaactg agaagaacaa     10320
     atttctaaac gttttattaa ttgttgatat gcgtaaaata ttaactctat ttgtttaaat     10380
     gtctagcaat aacgaatttc aagagatggt tcgatccttt tcatctgtcg tgttgctaaa     10440
     aaatgtatcg taatattcag gaatgttatt catgaagtcc agaaacaaat gtgtatttat     10500
     gttacacgca gagccaattg ttttaacgaa aatgaaaccg ttaagtattt taattgcttc     10560
     attgctggga attgcagtat tccccatgtt gccagtttca aaggtaatag cctctgaatg     10620
     tatgacggca aacggaacct ccaatggtgc aagcgtgtcc agtggtggaa cctgttcatt     10680
     cacgtcaggc tatacgcccg ttataaatga taatcaggtc gacggagcca atatcaacag     10740
     tggtgatacc attacgattt ctggcttggg taccgatatt atctctggcg atcgtggtat     10800
     tcagcaaaat agtcttggaa ctctcaactc agctactaat gggcttgaac gtttgttatt     10860
     gggttctcgc acatctggtg taaatacact cgatccggtg actggatcga atattgtagt     10920
     tgcaacttac gacagtaatt ctttcgcatc ttctgactgg ggacaatata ataatgtcgc     10980
     cacgcaaacc ccaaaaaatg caggtgataa tcaatatatc gatgcgcgtc tgggtaccgt     11040
     tcaaaacggc acaatgattg tgagtattgg tgattcaggg cagttgcctt cttcagatgt     11100
     aaacacgatt aacatggcag caaagcagac cattcttacc ctggcgactg gcatcaacag     11160
     tacaatcgaa tggaactcta aaaaccgcgt cctcatggga gataccatgg tcgcggcagc     11220
     gggagcgacg acaaaaacaa ttcaaattga ggtacctgtt tatgctggta ccttcaaggc     11280
     atatgacgga ggtacatgga ccgtcagtaa cgctaacgag ctaaaagtat ataacaatgc     11340
     gttgatcaat gcgttgcaga gtggaacttt gtccactcag gcagcttacg atgaggcatt     11400
     tgcgaaagcc gtgaccttca gccagaagga tatcgactac aactatagca tatatgccgg     11460
     tgatgatgtc actgcggata caggtgtaaa ttatacaatg tacgccgatg gggcaggtgc     11520
     aaaagcggta ctgaaatccg gtggtcaaat cgatcaacgt ggtgcgggtg ttgctgtggt     11580
     caatggcgcg actgcaataa ttgaagaagg agcccaactg tcaggacatt ttaattcatt     11640
     atttatagga agcggctcaa acggagaaaa taacggtgtt atttcaggtg gatattttgc     11700
     ggaagatgga tgggacacta cgggcaaagg taattatttt gatgaatatt cagaggctta     11760
     tactgtaact gtcgatggcg aaaattctca tttcaacaat aacggtatca ttaatgttgc     11820
     aggttggacg caatatgaag ggtattcgcc tgatgcatgg gggattcggg ttcagtctaa     11880
     cgccagtgcg acaaacagcg ggattattaa cactggtgtg aataacaatt cattaagtca     11940
     ttccatttct gcagtcaggg ttgcaaatgg aggtaaaagt cagtttatca ataccagtac     12000
     cggagagatt tatctggggc atgctgctca atacgacacc gctaatccgg aggctgtggt     12060
     agatgtagct aatgccttgc ctcagtacgg tattttactg acagatggcc aggcaactaa     12120
     cgaaggtaaa attttaattg gttcgcttac cgaaaacgct gtagggatgg ctgcagtggc     12180
     atcatcacct actggttcac taattaataa aggttctgtc ctggttaagg ggaatgccaa     12240
     tagtgcgccg ttacagaatg tggggatcct cgcactaaat aatggccaga ctcaggtttt     12300
     aaacagcggg acagtaacac tctcaggagt aaatggcatt gggatgaaga ttctggcgac     12360
     aagcggaaca gcaactgcca cttctgatgc caatagcgcg attgttgttg ccggtggagt     12420
     tgatccagaa agtggcacca gaaactatgg agtgtggact gagggggaga aagcagctgc     12480
     gaatatccag ggtgatatcg aactgtcagg tcgtggtgct attggggtat tggctcgtga     12540
     tggcgcagcc gttgtagtag gttctgattc agcggttcgt tttcatgagg tcaccaatcc     12600
     cagctgtact gagaactgca gtgaacaaat tggttatctc gtctacggca aaagttcgtc     12660
     aattaataat caggcggagc agttggaagt ctccagttcg ggttctacgc tgtttcgtat     12720
     cgaagatggt gcgacttttg atagtaacgg aaaaacactg actgcttctg gtaagaactc     12780
     aaccattctg gccgccagcg gtaagggtgc cgttgttacc gcaagctccg gaacgttaaa     12840
     cgtcagtggg ccgggagcaa caggagtaca tgtcgatggc ggtgctactg ggcagatcga     12900
     tgaaaaaacc agcattaatc ttctcggcca gggttccact gcaggtatgg ttgacggacg     12960
     caaaacgggc ctttcaggcg taactggaac agaagagctg aagtcgtcat tgaccaataa     13020
     tgccaagatt cagtctgcaa tccaggacgt agtcggattt gtcgcacagt atggcggaac     13080
     tgtagtaaac aatggcgaaa tttcattgag cagtgatacg aacagcaccg gggtaatagt     13140
     gcgcgaaggt ggtcagctga tcaacaacga agccattacc atcacgaaag gaacaggaat     13200
     tctggtagat ggtggtgcgt cggcttcaac gttaacaaac cagtcatcta tcagtgtcca     13260
     cgatggtata gcaggtattc atctccagaa tggcgcaaag ctgaatgcct tgggcagcgg     13320
     ccgtattatt actgacggaa cggctgacgg tattttgttg gggacgggtg caactggtgc     13380
     agaacttggt gcaaatctga tcacatctca ggggtcgggt agcgggatcc acaatataca     13440
     gtcagggaca tcgatcatac tgaacgggac aactattgtt tccagtagtg gctctgcgat     13500
     cctgaacgat gcaaatgcaa catttgcagg gtcgaatgtc acgcttgact ccagcagagg     13560
     gtgggcaatc cagaacaatc agaaccaggc agatatccgc cttgcaaaca gtgttgtgtc     13620
     aggggaaaca ggcgtattgc tgacgaaccc cggtgcaatt acaaatctgg atgtaacatc     13680
     gggtaccctt aatgggcgaa ttgtaacgga taatgcaaag gctaacgtta cccttaaaga     13740
     ttccagtatc tggaatatga ctgcagattc gaatgtaact tctttgaata acgataaagg     13800
     atcgattaac tatactcacg ggggggcatt taacactctg accgtaaatg gaaactatgc     13860
     tgggaacgat ggtttgcttc gaatgagcac tgctcttggc gatgacaatt cgcctacaga     13920
     tcgactcata gttgaaggta acacatctgg cagcactctg gtatccgtga ctaatgcggg     13980
     gggaagtggg gcctcgacca taaatggaat tgaactgatc acggtaaagg gtgattctcg     14040
     gggggtattc agccagtcag gccgtgttgt tgccggagcc tatgactatt ctctggttcg     14100
     tggccaagct gaaaaagaca aaaattggta tttaacaaac tatgtaaaac ccgttgagcc     14160
     gacaataccg atcgatccta caacgccagt agacccgact gcccctgtag accctgtaga     14220
     accgacgaat cctgcggtgc cggtaacgcc aactaaaccg tctgaaccgg ttttcagacc     14280
     agagatgggc tcctacagtg ccaatctcgc tgcggcaaac aatatgtttg tgcttcgtct     14340
     gcatgatcgc cttggtgaga ctcagtacac cgacatgctg acgggtgaaa ataaggtgac     14400
     cagtatgtgg atgagacacg ttggtggaca tacgagattt aaagatcagt caggtcaatt     14460
     aaatacgcag tcaaaccgct atgttctgca aataggtggt gacgttactc agtggagcaa     14520
     taatggaaac gatcgtacgc accttgggct gatggcgggt tatggtaatg aacacagcaa     14580
     tactcgctct catcagagtc attatcgttc agatggttca gttaacgggt acagcgtcgg     14640
     tgcgtatgga acctggtacg cgaacgacga agataagaat gggttgcatg ttgatagctg     14700
     gattcaatac agctggttcg ataacacggt tacaggggag gatattgacc ctgaaaaata     14760
     caaatcaaaa gggcttacgg catccttaga gagcgggtat acatttagta tgggtacctt     14820
     taaaggtagt cagggcagca ctaatgaatg gtatatacag ccaaaagcgc aggttatctg     14880
     gatgggtgta aaggcggatt cacacaaaga atcaaacggt tcaacggtga cgggtgaagg     14940
     caatggaaac attcagactc gtgcaggtct caggacatac attaaaggcc atcataaaat     15000
     ggatgatgga aaacagcgtg aatttgaacc atttatagaa gcaaactgga tccataatac     15060
     ccgtgagttc ggaacaacaa tgaatggggt ttccaataag attgacggaa gtcgcaacct     15120
     gggtgaaatc aagaccggtg ttgagggtat gattaaccca aatctaaact tatggggcaa     15180
     cgttgccgtt caggttggtg acaaaggtta cagtgacact tctgccatga ttggtgttaa     15240
     atacagtttc aaataattgc attaaataat ccaactgcat cttaaatgct gaataaagcg     15300
     aagtaagatg cagtttttta tgaagtatat ctaggttcgg ccgataatcc tcaggttgag     15360
     ctagttataa aagccataga gaacatagat atttacatat tatagaacag atgaactacg     15420
     ttggttctta aaaaaaacac caagcattgc tttgtttatt aaaccatata tcatcataac     15480
     atcccgtagg ggaaattgct gtttcatatc ccatggtctt tttttttggt tctgataatt     15540
     agccatcgat ttgatggctc ctttttggag gaaaaaagga atgtgatgaa aaataatatt     15600
     accattctgg caattttata ctttcaagag attatcagtc ttatgttgct ttgtttccgc     15660
     attcgggtct gaaatttctg accaaggttc tatacaatga aagccatgaa aaaaatgaat     15720
     ttagtcgtta aaggaaaaaa taaatatgca gtattaggtg ggtattcaat tattcaaaga     15780
     ctcgattata gtagtttgcc cacggcgaag atttctatat atttttttga tgatggagca     15840
     aatgatattg atacaaacta tgcacttttt gctctttcat ttactcctgt gattattatc     15900
     tgtagcgagc gactacacta tgtattgtgc aaactgccca cagccatgaa caaattagtt     15960
     atcagtatga gagataacat tgaagtgatt gtggataaaa taacctgcta tcttattcag     16020
     tttaacaatg ttttcaatta ctcaattttt aagctgtggt gtgttaaaag ccttgttatt     16080
     tctcccaggg aaatgcagtt tattaggcat tttatagatg gtaagtgtca ttatgaaata     16140
     gtgatatgca cgagtttatc ctggcaaaga atatatgcaa ttaaaagatc tctgatgaca     16200
     aaaatcggtg caaagactga aaatgaaatg ttcatcattc tcaagtcgat aacttttttc     16260
     attagcatgc ttaacataga cttaatgtaa ttaaatgttt tctgaattag ggtataaatc     16320
     atgaagaaaa atgatgttgc atattcaaga gtggtattcc gacgccgtga catgatgtac     16380
     atttataaac tttcattctg gtatctaatt tcaattatta taattctatc cggttcaatg     16440
     ctggttggta tggcgtacaa tgctaaatca atacttttgc tattagattt ttatatttta     16500
     attatgattt tcacattatt atcggcagta gttaaaaaca gaaaaacggt gaagaccaaa     16560
     cgtgtaagac catattaaat gcacataaaa aaatcctttc ccgcaactct ttactggata     16620
     ctatctaaca catcttggct tacattagaa cgcataatat atctgttatc ggtgacatat     16680
     acatctatat tatctattaa atatataggc ccgtactatt atggaataat cagtatattt     16740
     aataacgctt tgcttatttc gttagttata tcaaaattcg gttctgatgc gtttttcagt     16800
     agagaatgga aaaaagcata tagtaaatat ttgataggga atatgatttt actgcgattt     16860
     ttcgcaggaa tgatactaaa cactggtatt gtgttattgt ctgctgtgct cggtgaaatt     16920
     gatgttagat gtttctatta cattttgtca atatcaattg cgatgatgat acaggggact     16980
     gatattacgt tgatatataa ccgagctaat ggtttttatc ggaatgatac aatgatcagc     17040
     ataatgacga tgatgttaac atcattattt aaatttatta ttgtgcatta ccgcttatca     17100
     tttgctctac tatcgatccc aatcattttt gaggccttaa ttccggcttt ataccgacaa     17160
     tgctctgcaa atgcaattaa agcccgcttt gtgataaaga aaaaaatcgc tttgtattta     17220
     attaagcata gcgtttctta tttatttccg agtttatcca tgcttatcaa tcaacgagcc     17280
     gtatttttta tcttgggaat atttaatggt caatatctgg taggcgtcta ttctgttgct     17340
     ttttttatat caaatgccat atttatgctc ccaaatataa taacaatgac ttctttagta     17400
     aaacttaata agattagtga ttatacggaa cgagctgaga aagcgataag tactatccgt     17460
     ttaattacgc tattgtcttt attgatcatt gtcgtcagcc atttttgtgg tgaatacatg     17520
     attcctaagt tccttggtga gggctatgaa aaacttaatg atattgtcac gttaattatt     17580
     ttttcttttt atgttgcgtc tgtaggggtt ttgtctataa aaactcttag taaagaggag     17640
     tgtgaagggt attacagcgt aaaatacact ctaattattg tattaaacat cgtattaaca     17700
     gtcgtgcttt cattgaagta tgggattata ggcgctacat gtggattttt atttactgaa     17760
     atactctctt caacgattgc gaactattta atttccaaaa aaatattcta tttgcatctg     17820
     aagttgtttt ttaacaggag ttagctcatg atatccgtta tcagaaattt atatcataaa     17880
     atcccatgga ctattaagga cagaattgaa tattatagaa tttttggaac atttccaaat     17940
     cttactcatc cagtaaaatt ttctgaaaaa atcctatata ggaaaaaaca ctcatgccgg     18000
     gcgaacgaca actatgcttt ttatgccgat aaactgagag taagagagta tattgaatca     18060
     attattggac ctcaattttt aataccgcta ttgggaacat accacaatgt tagcgattta     18120
     cagagagatt tatattcgct caataagtgc attttgaaac caaacaatgc ttctggttct     18180
     gtcatatttg tagatgactt cctgatgccg gctgaagtag ctgaagtgat ggatatagct     18240
     tccaagtggc ttgtgagaga ctactcaaag caaaaaggcg aatttcatta taaaaaaatc     18300
     ccctctgcga tagtcgttga aaaaaatatc gccgagaagg ataagagacc taatgactat     18360
     aaaatacatt tattcagaat ggaacataat aaactttttt atgtattaca aatgatagaa     18420
     tatgataata atgaaggacg agggaataag ggagcatcat ttttctttgt caataattta     18480
     tgttgtccat tcgatgggga agtcaaagag ctttcatttg aggagaaaaa tgcacttaat     18540
     cacgcagtgc aaaatagtgc agccttactc ggtgaattgg aatatgccag attcgactgg     18600
     tatataacta agcagggtgt ttattttggt gaaattactc tcacgccatg tgctgggttt     18660
     tgtaaaggtt ttccaaagga acttgatctc ttaatgggtg cagtttggat tttacctgaa     18720
     aaacgtagtg ctggtagaac tgatggtcaa tatcgaaaaa aattcgtaaa ttgatgtcgg     18780
     tagtagttta tgaattaatt tatcttttac tgttggcaat acctggctcc ttttctagtc     18840
     agaaagccag cccgtgctac tggctggcct tttcattatt gtaagacatc ttaaactgtt     18900
     aacacaaaaa ttactgtaaa tcagttatgc cacacaattg tttttaaatg gtgaacgatg     18960
     ttactatatg cgccgctaga atgttaatct aagttagaga aaaaagcaga cgaattgcac     19020
     acgagctata gaaatatctc aggtcctgac aggatctttt ataaaaattc atttgataac     19080
     tatgttttca taataatgtg attacacatc gttttctttt gactgatgtt ctcggcaaat     19140
     cagtagacct tcatcaatgc caagcggttc ttttgtaagg ttgcaaagcg gaataccatt     19200
     aacatgctga tgaaaacgac aggaacggca taaaccaaag cttggtacgt tattggttcg     19260
     ctgaatttct ctcagcagat ctagtaacaa cattttcaaa gagtcggcac gcgaacccaa     19320
     acccacttct ccattcacca gaaactgcgg tggcagtaac tcggttaaca acatattcgc     19380
     cgtttcagtt agttgaagat ggacactacg tttatcacgg acatcctgcg tacgagcaat     19440
     aagccctttt gcttcaagca attttaatga ttgtgacaca gttcccttag tcaaacccag     19500
     gtattcagtc accccgagtg gggtattaga ataacggttg caacgggcaa ggtacatcag     19560
     cgcgcttagt tgcaccggct gaagttcaga cagtagggga tgttggcgaa accacatccg     19620
     cgtcaggctg gataacctgt ctagcaggtc gaagagtgac atgtcatgca ttgtaaattc     19680
     ctccgtgatt atagtatcga ctaaaaacca tcttgacaaa ggataaaaca aacgtaatat     19740
     ctataaggta tcgagtcgat accaattcct gaggtgctta ttaatgtcaa cagctcgttt     19800
     ttaccatgca ggttgtacgg tttgtgtttc tgccgaggaa acgttactta gccatctttc     19860
     cccgaatgta aaagtggaag tcgttcatct tggtgaacaa ccaaataggg ttgaggaagc     19920
     cgagcgtgca ggagtgagat ctgttccggc gctggttatt gacggcaatg tgctacacat     19980
     caattttggt gcttccattg aggcgctgaa ataaaagatt ttcagccggt agtaatgaag     20040
     aagcgtggtg ttgcgcattg caggtatcca ttatgatata aatgcacgca acccggattg     20100
     gggaggtagc tctggcaatc tccctttatt agtgatttag agagggcgcg aggctatgga     20160
     agctcatgtt tttgacaccc atgtacagac tcaggatagt cgctacctgc attttgatat     20220
     tttgattgcc agaaaagatg aagccctggc aatgcggtat gccagagagt ggttggcacg     20280
     caatggggtc catgcaacag aaatctcaca agatctatgt cagttttgcc atagcgaact     20340
     tgcttctcag gagatggtct gtgcaatgtc tgggcaggga tatttcatta ttccgatgca     20400
     gggatgtgaa gaattccggt gataaactat cagcctatta attgcaacct tcacgattac     20460
     ctcgagatcg cttgtttgta ccggtactgg ttgcgtatcg aacttaatga tggtgcatgt     20520
     ttcgatggca aagcgatgac tacccgcaca accgcggaac gagaggagta tctggaaata     20580
     gagggtcatg aagtgcagtg gaaaatccgc atggattttc tttcagcaat cacccccctt     20640
     acagccagag ccgctttcgg cagaattata ttcaccagac agggtgagat cgacttacta     20700
     tagtggccag atgttaattt ttcatgtagc ccccggaaac aataggtaat agtagtatct     20760
     caagataaga gataggcttg aatatatgtc attactctaa tgacaatttt acgttaaaag     20820
     aattttgcac ctcatggatg aggggcaatc tgtgttttca tcgttacaga aacggtttgg     20880
     gaaaatgaat cttgaacaga tgattacaca caaagggtgg ctggcggact acggtctacg     20940
     aaatgcgggc gtttaaagtc tgcacaacat tggtgaaaag cctttaaagt aatggcatga     21000
     acgaatggtt cttgaagagg atgaaggaaa actatatcgc gttcatacca taaccggaga     21060
     ctgaaatagc actgtaaaac cttgatgttg ccttcacgca ttatcatgaa aactacccgc     21120
     acagtgcgct gggatatacc cctcaaggat tatccggcga cagcgagcat aataacttaa     21180
     gatgcaaaag ctgttgggat atggttgatc aagaagattg ttaatgttta tttgtagcca     21240
     tatcgcgcta gtaatatggc cgttgattca tttgaattca taattcgcgg aacagttttt     21300
     cgctactgat aagctttata cctgcagggc cactttcaag gatgcgtttc tcctgatccg     21360
     atataaatct gatcgaggtc caaccctctt cggcagaaag tacattctgt agttttctga     21420
     tgagcgtttc agcctgacag ctttcgcagt ccaggttgcc gatgaggatt tcattgaagt     21480
     acacgctaag gcggtgagtt tttagcattt aagttctcct gattctagtc tctgaatgtc     21540
     aagcatgtcc gtaccgtcaa ttagcgagtt catcacacaa actcgagtca gttcagaggc     21600
     tgttttaaca gcattttcaa gcgaaaaacc acgtaataaa cctgccgtca gttctgctgt     21660
     aaaaagatca ccagtgcctt ttggcgcatt tggaagtgct gcatgttcta cgatgtgcac     21720
     gatactggca gagacgcaga tgattttaag catctggcta ttctcggtat gtgaggcgct     21780
     ggtcacgaca acccattgtg ttttatcgtt gaggaaagta agagcagccg agatgatctc     21840
     ttgttcggta atcagcgttt tacccatcag gcactctagt tcaaagcggt taggcgtcag     21900
     acctgttgcg agtggtaaaa gatgattgcg ataccagaaa gtgagatccg gatcgacgta     21960
     atatcccgtg tcgtcgtctc ccatgaccgg atccacaaca ataagtatcc cagggttttg     22020
     agtggctatt tggttgagcc atgcgaaaac acgttctgct tttgatgtgc tacctaaata     22080
     acccgttatg actgcacgca gctgggtatc ttgtctacgc tcctgaatgc tctgaaggaa     22140
     accgcaaaac cacgcatcgg aaatctcgcc gccatagcag ccttgattat cgggtgtgtt     22200
     gctgagtagg aaagtcggta ctgcaagtgt gtgccatcca tgctttataa gtgcaggcag     22260
     agcgatacta ttacctacgc tcccataaac aacctgagac tgaatggaaa tgatgtcggc     22320
     agtacgggct agcccctgtg cctgggtaac tcgggatatc aagagcttat tctcctttcg     22380
     gccagaaata ttcatcagga agcgaacgag caccaaagat cgcctgacca acgcgcacga     22440
     tattggcacc ttcttcaata gcgatctcga agtcacctga cattcccatt gagagttgca     22500
     ggttgccata tacattagca agctgatcgc gcagtttgcg taatcggatg aagcaagatc     22560
     taacgcgttc ggcgtctgag gtgaactcgg caagagtcat cagccctatt agctttatgt     22620
     ttttcaacgt gctcaattgc gccatgaagt caactacagt ttccggtgca agaccaaact     22680
     tgctgggttc tgcggaagtg ttcacctgaa caaaaacatt gagcgttcgc ccttcaacct     22740
     gaagccgcct gtcgagtatt tctgccgtat taaatgaatc cagagcctgg aactcactgg     22800
     caaatctggc tactaatttg gctttattcg actgaagatg accaatcaca gaccatttca     22860
     aatcggtcag atctaacatt gcttgtgatt ttcgccaggc ttcctgcact ttattttcac     22920
     ccagaaaatt gcaccccgcc tggtgagcca ttcgaatgtg cttctcgtcc attgttttac     22980
     tgacagggag caggcgaacg tcagaaacat ttcgtcctga acgctggcag gctgcatcta     23040
     tccgtgattg aaccgcagcc agattgtcga tgaaatcctg tacgctttcc gcacgaggcc     23100
     agcgattgtg catttcgcaa cggggctggg tatctcgtaa agtgagtagt ttggtgctgt     23160
     tttctgtatt tttcatagca gatagacaag agctccgtac tcaattaata ttgtcctagg     23220
     ctaaacttaa atttgaacca ggtcaatgaa cattaacggt aaaacagcgg gtgatatttt     23280
     cgaacagatt cgcgcaatga ttcaggctgg cgaacttgtt cccggcatga tgcttcccac     23340
     gcttcgtgaa cttgcaggtg aattgggtat caatcgtaat acggttgccc tggcttataa     23400
     gcgacttacg gacgcaggtt ttgtcatatc cagaggccga aatggaacta ttgtacgtga     23460
     acacattatg ctcactgata ttgaaggtag tgcgtctaac cttgtgcttc gtgacctcgc     23520
     cagcggcaac cctgcagtca cacttctgcc ttcaatgagc caacttgccg tgcatatcca     23580
     aaacacgccg ggtctgtacg gtgaaaccgt gatccgccct gaacttgagg ctctggggct     23640
     tgaatggtta aaacaagata taggatcacc ttttgattta aatctgacta acggtgctgt     23700
     tgatgctatt gaaaaggtac ttaccagcta tttgattgct ggagatcgtg tggctgttga     23760
     agacccttgc ttcctcagta gcatcagcac tctgcgccat aaccgctttc aggttgctcc     23820
     tgtggaaata gatgtcgaag ggatgaaaat tgagtcgctt tcacggcagc tttctgctgg     23880
     cgtgaaagcg gtgattatta ctccacgtgc ccacaatcct accggtttta gcctcagttt     23940
     taagcgtgct gaaggtattc gtactctcct ggctagtcat cctcacgttc tggtgatagt     24000
     ggatgatcac ttttcattgc tctcaacaca tgactactac cacattgttc cgggaaatac     24060
     ccgcaactgg gtactcatcc gttccatgtc aaagagcttg ggacctgatt tacgtatggc     24120
     ctttgtcgca agcgatgcag atacctcaca gcgcttgcgc ctgcgcctga attcggggac     24180
     taactgggta agtcatattt tgcaggatat ggttgttggt catatgcatt catctggctt     24240
     ccagaagtca atcttgtccg cacgtgagag ttattttgaa aaaagagagt tgatggtcaa     24300
     tgcgctaaaa caacatggcg tcaaagttcc agaccatcat gatggcctca atgtgtggat     24360
     tccgttgaca cagaacagcg ctccaattgt tatgcaaatg gcccaacggg gttggcttat     24420
     tcggggtggg gaaggtttca acctgaacaa ttctggctcc ggggtgcgaa tcaccatttc     24480
     agatcttgat gcaacggaaa ctaaactaat cgcgaaatct ctggctgaga tactgacaca     24540
     atagtaatag attctcgcca tataaacggt ctgaacagac ctgcatattg ataatggagt     24600
     tatttgtaat gcacgtacat ttcatcgtac atgaggattt tgaagcacct ggcgcctacg     24660
     aaatatgggc tagaaatcac ggacacgatg tgactttcac tcgtgtttat gatggtgata     24720
     aactgccaca agaagccgaa aacattgatt ttctcatcgt tatggggggg ccgcaaactc     24780
     cgataacaac acaagaagat tgtgcgcact ttaactctaa aaatgagcag atattgattg     24840
     attccgctgt taaaactggc aaggccgtta tcggtgtttg cctcggatcg caacttattg     24900
     gcgaagcgtt gggtgcgccg tttgaccaca gtcctgaaaa agaaataggt aaatttccaa     24960
     tcacactaac tgaagatggt tgcaaagatg agatgttctc tcactttgca aaaacacttg     25020
     aagttggcca ctggcataac gacatgccgg ggctgacgcc agatgcaaaa attattgctt     25080
     atagcgaagg ttgcccacgt cagatagtcg catacacaga tcgcgtattt ggtttccagt     25140
     gtcacatgga acttacacgg gacgttgttg aaatgctaat tgctaattct gagaaagatt     25200
     taagttgtgc cgcagatttc cgcttcgtca acactccaga agaactacgt tcgcacgatt     25260
     acaatgaaat gaatcaggtg ctatttagtt ttctggataa gctggaagct cgttataaat     25320
     ctttttaaac ataaagtaag gaccatgtac atattgcggg gagtcgacgt tactaagaac     25380
     aattgtgtat gcggttaata tggtatttaa cataagatag attgtgcgaa ataagtcatt     25440
     gaaactaatg gagttaatat ataggctttc actattatct ccagggttca tgtctcatcg     25500
     tgtcctgaga ctggctgagt atacgaatga tcgttaccac cgaatgtgat gacaaaaaat     25560
     ataccatgtg ctgttccacc ggcagcgaac agatattttc tcccagctct gcgcgatgtg     25620
     tgccgatgtc atgcatggcc agaacgtcaa acaccgctgc tatacggccg atatacgcat     25680
     ccgcctgaac aaccccgaat tgtctgaagc tgttgtccca gatagcctcc agatcttctt     25740
     ctgcttttgg tgtcagctca atctctttca tttgccaccc tggccctgac atttttcagg     25800
     aatgcatcct tgttccatgg tttcgcctcg ccgctgctga ttccttcggc cagcagatcg     25860
     cgcagtgtct gaagtcgtga ttcagcctgc ttctcgcgta gcagacgcag cgcgtcacgc     25920
     atgacctcgc tctgggtgcg ataatcaccg gccttaacaa gggcatcaat aaattcacgc     25980
     agctcatcac ccacgtccac cgtcatcgta cgagccataa cccctccgtt tcttaatgta     26040
     agatttgttc ttacatcatt atatcaactt acccctctcc ttacatcccc gacattttag     26100
     ccaaaacaat ccggctgcag tctgaagatc cgacttagca tcttttcgga tctgtgcggc     26160
     gggcaacggg taaatgatat gattatcaag aaataacaac aaaatcatac tgaatttgat     26220
     gttcttcatt aaaaataaaa tcatatctga tattatttct accaattaac tgataaatca     26280
     tattaagtat gatttttgac taaaccggac attttcagac ggagcgtgca ggatggataa     26340
     cgaagtgacg ttttcactca gctatgaaca actgacagcg aggacgaagg atgtaatcca     26400
     agttttcgcg aaacgaagcc cttcaggcac tggtgttaac agagcttgtg ccgatgcggt     26460
     gtttctgttg tggtgcgatc tgacacagga aggacacctc gaagtacgtg atgcagagcg     26520
     gatacagaat gatgcccgtg aaataagtga actggtacac aggataaaaa aatgacgagt     26580
     ctcctgaaag accggcagcc ttcaccacta cagaaacggg tgctgattgt gctggctgcc     26640
     ctcgatgcac gccatcctgg aacgcccgtg cctacccgcc tcattgaaag acttctgacc     26700
     gagggggggc acggtcctgt atacgggccg aacctgcgtg cctcctgccg gcgcatggaa     26760
     atggcgggct ggctgcgtac cctgcgcgcg caaaacctgc agctggccgt ggaactgacg     26820
     gatgccggcc ggaagctggc cactcccatc cttgccgaag aacaggccag ccagatggcc     26880
     gaacagcgtg ccacggaagt gcgggttctg cccctagcca cgcacagcca ggcagatgag     26940
     gctgacgacc ggccggtgga gctggacgat cgctggcacc tggtgtgccg gggtgactac     27000
     gttatccgtc ttgacggcac cacctgcctg cagctgtgga acacggccgg gcaggtgacg     27060
     cgcctggaag gcgatcccct gcaggtcgcc gcctggctgc aggcctgcca cgatgcgggg     27120
     attgcggtcc gggtgcagat caatgagagc gccgcgccgg aggaaggttc accggacgga     27180
     accgcgccgg cggacctgac cggcacctgg taccgccagc tggacaccgc gctgcaggcc     27240
     ctggggatca ccgggctgac tgaggatatt cgcctggccg tggtcagtcc tgaagcttcc     27300
     ctgcggatgc tgccggcacc tgcgcgcctg ctgcacgtcc tgcgcgacgc ggacccgctc     27360
     acagttgcca catacgagga agacacggag gccgcgctgg ccgacctgct cacccgcgcg     27420
     gggttcacgg gcgaccaggc gcaggagctg cagtggcacc gcattcgctg gccgctaatg     27480
     gatcaggaag aagctgaccg gcgcgagctg aacagcctgc tggatgaact ggaacagcga     27540
     cagctgtact gcaaccgcgg gcagctgacg gagattgtgt tttcgccggt ccgcaaaccc     27600
     ggcgagcgct ggactgaccg tatgcagtgg ctcctgatga cggacgcatt cgggttccgg     27660
     agtccgctat cccgtgacgc aggctccagg gctctggcga tcctggccgg ttacacgggg     27720
     caggaggtgg cggaccatct ggccagggtg attgtgtgga acgacgccgg agcagtggcc     27780
     ggtacgtctt cattccctcg tccgcatgag gaatagaaaa ttgccagaaa atacatctat     27840
     ttatgtatca attattgcca tgataattgc attaaccgca atgctggtca gtattcatac     27900
     atggagaaga gcgaagagat acaaaattat atttaaaaag ctgaaacatg gggatgagct     27960
     ggatgacagg gaaattttac tccttcagaa gcttcgtaaa ccggctcgaa aataatgtct     28020
     gtctgttata aaacgcgacc tgacgtccat ctcatcgtca cctgcacgcg ccgcaaaact     28080
     gtggctgcag gtgatgcggt cttcccggat gaacgtgacg tggagggagc ttacaggctc     28140
     tggatggaaa gactggcgca ggcccgtcgc ggatcgcccc ccatgaccgc cggcgagcta     28200
     tatacaggcc agcactggag cagggcagct gcagctgcag ctgcggcgcg tagtggtgct     28260
     gagatgtgga ttttatccgc aggcctgggg ctacttgggg tcagtttgga gatcggaaat     28320
     ttttgtacgt taagaacatt atttaaccaa tccagatacg taagggattg atttatggtc     28380
     agtagctgtc atcgttaatt gaaattcaat cgagttatag taattttatt agcgtgacgt     28440
     ttattttgat atactgattg tctgtatttt cggtttatca gtaactctga tactgtccat     28500
     tactgatgac acttttggtc tggatgataa atatgaaaaa cacctcacgc aaaataaaaa     28560
     tcacctatgg cgatctgatg aatattacag caatgagtat agaaaccatc acgggaatac     28620
     cggttaactg atagtcaggg agagggtgat cagataacat ataatatttc atgttatgaa     28680
     ataaatatta acaaagaaca aaacatctta agctgaatat attgcgcctg ctgccgataa     28740
     taatattatt gagaagaggg tggcatgaac gattttcata ttttaagtct ttgcatcagg     28800
     aataaggatg tggcaggtgc catgcacgtg ctgcgtgata aatcagaatt tgccgcgcgt     28860
     aagattctga aaaaaataaa ggtcacggtg acatcgctga cgggcagggt gttctggcat     28920
     gacgtccagc gctggctgtt gaatgcgtgt cgccaggaga atacacagca tgagccttcc     28980
     ggttcccgac gtccttgggg tcagcttgga aaacggaaaa tatcctacgc taagactaat     29040
     tttctggcag acagctttgt tcgaaaagca gactcaaaaa ttatctgtga ctctatataa     29100
     aggatgacta cgtacaaagg acacagaagt acccttctga atttatgctg aggggaattt     29160
     tttactggct tatttcttca cgcagacgtc tgatgtcacg ttgcggcgac tcgccaaact     29220
     ccctgctgta ctcgcggcta aactgggaag cactctcata gcctactttt atcgccgcgc     29280
     tcaccgcgtc aagacggctg ttcagcattt gctgtcgtgc ctcctgaagt ctgagcttct     29340
     tgataaactg tagcggactc atccctgtca ctgaccggaa atggtgacga aaggatgacg     29400
     tgctcatcga cgagcgggaa gccagctcat ctatgctgac tggttgagtg aaatgttgtt     29460
     taagccaggc aacggctccg gatatttgtt gcccaggcga acccggtgat gcgatatggc     29520
     gaagcgcact cccatagggt cccgtcagca gccgaatgat gatctcctgc tgtatgagtg     29580
     gggcaagatg ctgaattaaa cgtggttcgt cattcagtga cagcagcctt ctcaacgtat     29640
     cagcaagtcc cgcgtcaagc tcgttaacgg ccaacggatc aaaacccggt gatttagcag     29700
     ctggccgaaa agggatcatt gccgccgtct gcatcaaagc cgcgggctca atagtgacca     29760
     tcatccccag gaacggtgcg gatgccgtcg ccgtcgcaac atgtgacacg accggaagct     29820
     caagtgtggt gaggagtgtt tgcccggccc ggtagccagt cacttttcct cccagcacca     29880
     gttccttact gccctgaata accacaccta acccaatgcc atagatacaa tgcacgggag     29940
     tggtcggtgc atttcgtcgg tgcaccgata acgacggaac tgcagttgtg aaatcaccat     30000
     cgtattgtgc aatctcgcta attttctcag caagcatttt aaggctttgt tctacggaaa     30060
     attcctgcat ctctcagtcc tgacacatct catgattcaa tagtaacgta aaaattaaaa     30120
     tatcatttat ggaagccaat aacccaattc aggaaaaata aatcatttca ggcaatgatt     30180
     gtggtgaagt gagcaagcca tcttcatgct ttgtggtcaa taatacttct atcatgtttc     30240
     tgcttatgga gtgccttatg acaggtttat tttcttcttt ttcgctgaaa gatattacgc     30300
     tacgtaatcg gatcgcagtt tctcccatgt gtcagtacca ggctgtcgat ggctttatca     30360
     atgactggca cagtgcccat tattccatgc tcgcacgtgg aggtgctggc ctcgttgtcg     30420
     ttgaagccac tgccgtagca cctgagggcc gaattacgcc aggtgatgtc ggattatgga     30480
     gtgatgaaca caccgcaggg ttgtcgtcca ttgccgcagc aataaagaca gccggggctg     30540
     tcgcagggat tcagcttgct catgcgggcc gtaaagccgg ctgtacgcca ccatggcagg     30600
     gtggcgcacc tctggatcga gatgatgcac tggcgtggga gcctgtcggg ccttccgccg     30660
     tccccttcgt acccggaaat gactatattc cccgtgaaat gaccaaagat aatatccgac     30720
     aaacgcagca ggactttgcc cgtgcggcag agcgtgcctg tcaggcgggt ttccagtggc     30780
     tggaactgca ttttgcccat ggtttcctgg cacaaagttt tctttcccca cagtcaaata     30840
     cccgttcgga tgaatatggt ggttctcttg aagggcgtgc ccgcttctta ctggagacag     30900
     tggctgaagt ccgcaagttc tggcctgata atttcccctt aacggtacgc ctcggcgtgg     30960
     tggaatttga tgactgtcct gaacattctt tcagcgaatc actcaaggta atcggctggc     31020
     tgaaggatgc cggtgttgat tttgttgatg tgggtctttc tctggcaacg ccaggcgaga     31080
     acatcccgtg ggcggcaaac tttatggttc catgggccgc acgtgttcgc cgggagaaaa     31140
     acattcctgt cgggacaagc tggatgatta ctcaggctaa agaagcgaat gaattcatac     31200
     aggacggtaa agttgacgtg atctttttcg cccgtacatt gctggctaat ccgcactggc     31260
     catatcgcgc ggcgcgggag cttgaaatca ccgacccgca cgctgtatta cccacaccct     31320
     atgcatactg gttacaaaac tggtccgaat gaccataaca ggttgcgtcg tcccggccac     31380
     gtaaccggcc ctcaccaggg gtacccgtcc tgatagtaaa acctttatta agcggagaac     31440
     gatatgagtc agccaaaaac ccgtcctgca caacgcactg aaagcataag cgctttcagc     31500
     cgacgcaact ttctgtcttc ttctgcctta atgggggcag ggttgattat ggggagttta     31560
     cctgacaggg cgcatgcaac gtcatcagag ccgacagcaa aaccggcaca ggccagacaa     31620
     ggttcacaga caatgccgac gcgaaaactt ggatctatgg tggtttccgc actgggtgcc     31680
     ggatgtatga gtatcagcgc taactacggg gcggcagcgg ataaatccca ggggataaga     31740
     acgatacgcg aggcacacgc cagaggcgtc acgctattcg ataccgccga agtttatgga     31800
     ccttatacca atgaagaact ggttggcgag gcgcttgctc ctgttcgtaa ccaggtcttt     31860
     attgccagca aatttggatt tgatattcaa catggcgggc tgaacagtca gccaaaacat     31920
     atccgaaaag tgctggaggc ctctctcagg cgtttacgca ctgaccgtat cgatctgtat     31980
     tatcagcatc gcgttgatcc cggtgttccc atagaggacg tagccgggac tatccaggat     32040
     ttgattaaag aaggcaaggt tctacatttt ggtctttctg aagcaagtcc ttctaccatc     32100
     catcaggctc atgcgatcca gcctgtcacc gcagtacaga cggaatattc tgtcatgaac     32160
     cgcgatccgg aacataatgg tgtgctggat acctgcgagg agctgggaat tggtttcgtc     32220
     ccctgggggc cgataggcat ggggtatctg accggaacgg tgagcgttaa cactcatttt     32280
     gatcccaaaa ccgacttacg ctccactttt gaacgtttta cgcctgaaaa tttagcgaat     32340
     aactggccct ttgtggaaaa gctgaaagct atcgctgaca gtaagggcgc gacaccgtct     32400
     cagatcgcgc ttgcatggct tctggccaaa aaaacctgga ttgttcctat tcccgggaca     32460
     cgaaatatca accatctccg tgaaaaccat ggtgctttag agatccagtt aaccactact     32520
     gagttaagcg aaatggataa agctatgtcc gggcttcgcg tctatggtgg tcgcatgaat     32580
     agtgcccaga tggacctcgt tgagcccaaa gcttaattcc cgcctgaggg taggcttaaa     32640
     ctattggaag aaattttatg aatattgaga agaaaaaaag agtcgctgtt gttaccggag     32700
     catcctctgg tataggtgaa gctctcgcac gtgaattggc aggaaacgga attcaggttg     32760
     tccttctggc ccgtcgattc gaacgtattg atgtcctggc cagcgaactt gggcacggag     32820
     caatcgcgat taaagctgac gtgacagacc gtgaatcgat tgtggctgcg gctaatcagg     32880
     ttgaacaaac gttaggtggt gtggatatcc tgataaataa tgcaggtgta atgctgactg     32940
     gtccttttga ttccagccag cttgatgaac accgccagat ggtcgaaaca aacctcctcg     33000
     gtgcgatgac agtaacagag gtttttctcc cacaattgcg tagaaacaag ggcgatcttg     33060
     tcaatatctc gtctgtagct ggtcgggtcg caccttcagg gtttgcagtt tatgcggcaa     33120
     caaaatgggg gataaatgga tggtcagaag cacttcgggt agaactacag cctgatattc     33180
     gcgtcatggt gattgaaccc ggcgctattg cgacagaatt agccgatcat attactcacg     33240
     aggaaagcca gtctgtggca aaatctgcac tggactgggc tatcccgcct tccgatatcg     33300
     ctgaggtcat agcatttgct gtcaacctgc cgaagcgcac gagtatcaac gagatattga     33360
     tcagacctac tgttcaaatg atgtaagaaa aaatatgcgg atcgcataaa tcctattcct     33420
     tatgcggtcc ctgccttcac agtcgataga ggtatatatt caagactgtt gatgccctga     33480
     ctttacccga agtatggttt gtcgggtggt attaaattcc cgcgcaatgg tgctgatact     33540
     gatcccggcg ttaatccgta caatcaccgt aagttgctgt tcttcattca gtactgaagg     33600
     acgtccaaac cgctttccgg ctgcttttgc tcgcgcaata ccagagtgcg tacgctcaag     33660
     cagcaaatct ctttcaaatt cagccacagc agagatgacc tgcatggtca ttcttcctgc     33720
     cgggctggtc agatccactc cgcccagagc gagacagtga acgcgaatat ctgaagcagc     33780
     cagctgttcc accgtttttc tgatatccat cgcattgcgc cccagtcggt ctagtttggt     33840
     aacaatcagc acatcgccat tttgcatccg gtcgagcagt ttagaaaaac ctggccgctc     33900
     actggcggca actgagccgc tgatgtgttc ttcaatcagt cgctgagatt taacagcgaa     33960
     acccgccgtc tcaatttctc ttcgctgatt ttcggttgtc tgctccaggg tagagacacg     34020
     acagtaggca aaaacacgtg acatagtgat attttctgta cgaaaaggat gtacgaatta     34080
     taacgcatgt acgatagtaa attcactgac tttcggacag cattgatgat aggtgtacga     34140
     aaccgaccgg tttcggtcag ggtaaagcga tatctaaaat gaactatatg cagaggaagc     34200
     atttatgcca cggagacaaa tactcagcag tgaagaaaaa gagcgcttgc tggttgtacc     34260
     ggatgatgac gttcttctga cgcgcatgtg ttttttgagt gaacctgacc tcgctcttat     34320
     taataaacac cgcagacctg ccaatcgcct gggctttgct gttttactct gttatttgcg     34380
     agggccgggg tttcctcccg acaagaatat gtcccctcac gacggggttg tttcccggct     34440
     tgcggctcat ttgaaacttc agcctgattt gtgggccgag tatgcatcaa gagaggtcac     34500
     ccgctgggag catctggccg aactataccg ctatctggaa ttatcccctt tcaaccgggc     34560
     gctgcaaaaa acctgcattc gccaccttta tccccacgcc atgcggacag acagaggttt     34620
     tttgcttgcg gaagaaatgc tctcctggct tcacaataat aatgtcattt tcccctcagt     34680
     tgatgtcatt gagcggaccc tggccgaagc agcaacgctt gcagacaggg cggttttttc     34740
     tgcgcttatc acgcagcttg aaccagggca caaagcggca ctggaccgtc tgctggtatc     34800
     tgagggtgag caaccctcac ggctggcctg gctgctccag cctccgggaa aaattaatgg     34860
     taaaaatgtc ctgcaacata tcgaccggtt aaatgcgatt gaggcgctgg cactgcctga     34920
     cggtattgca ctttccgttc accagaaccg gctcctgaaa ttggcacgcg aaggcaggaa     34980
     aatgagtagc cgggacctgg caaaattcac ggatgttcgc cgttatgcct cgctggtttg     35040
     tgtcatatcg gaagccaggg ccaccctgac tgacgaagtt attgatctgc acgagcgtat     35100
     tctgggcagt ctgttcagca gggcaaaacg cacgcaagcc gaacggcttc aacaaacggg     35160
     aaagctgatt cagagcaagc tgaagcaata cgttaccatc gggcaggcat tgcttaacgc     35220
     cagagagtct ggtgaagatc cctgggccgc aatagaagat gtccttccct ggcaggaatt     35280
     tatcaacagc gtggaagaga cgcgcttcct gtcacgtaag gacaactttg acccgttgca     35340
     tctgatcaca gaaaaataca gtacgctgcg taaatacgcc ccccggatgc tgtccgcgtt     35400
     gcagttcagg gctgcacccg ctgcattgca actcagtgac gcgctggaca ccgtcagaga     35460
     gatgtatcga aaacaactcc gaaaagtacc gccttccgcg ccaaccgggt tcatcccgga     35520
     aagctggaga aaggcggtga tcactcccac cggcattgac cgaaaatatt acgaattttg     35580
     cgtgctgaat gagctgaagg gagccttacg ttctggtgac atctgggtaa agggatcacg     35640
     ccgctaccgg aatttcgatg attatctgat cccgtctgac gactttgaaa aatcactccg     35700
     ggataatcag ctatcccttg ccattccgac tgattgccat gagtacatca agaaccgtat     35760
     gacacttctg acatcgcgcc tggaggaagt taatgcgatg gcgctggccg gtgatttacc     35820
     ggatgttgat atatcggata aaggcgtgaa aataaccccg ctggataata gtgtcccttc     35880
     agcagtatct ccttttgccg atttggttta tggcatgctg cctcacccta aaattactga     35940
     aattctggat gaagtggacg gctggaccgg ttttacccgc tatttcacgc atcttaaaaa     36000
     taaacacgtc agaccaaaag acagaaagtt gttactgacc accatcctgg ccgatggcat     36060
     caatctgggg ctgacaaaaa tggccgaatc ctgcccggga acgacaaaat cgtcactgga     36120
     gggcattcag gcctggtaca tcagggatga aacctattca gccgcgctgg ctgagctggt     36180
     taatgctcag aaacagcggc atctggctgc attttggggc gatggtacaa cgtcttcgtc     36240
     tgacgggcag aactttcggg tgggtagtca cggacgttat gcgggtcagg tcaatctgaa     36300
     atacgggcag gaaccaggcg tgcagattta cacgcatatc tcggatcaat acagtccatt     36360
     ttacaccaaa gtgatcagtc gcgtgcgcga ctccacccac gtacttgacg gtctgctata     36420
     ccacgaaagt gatctggaaa ttacagagca ttacactgat accgctggtt ttacggagca     36480
     tgttttcgcg ctgatgcatc tgctcggatt tgctttttcc ccaaggatcc gggatcttca     36540
     cgacaagcgg atttttattc agggaaaggc tgagcgttat ccgggacttc aatctgttat     36600
     atccacaaca ccactgaatc ttaaagacat tgagacgcac tggaatgagg tacttcgcct     36660
     cgcaagctcg ataaaacagg ggactgttac cgcatcgctc atgatgaaaa aactggccag     36720
     ttatcctaaa caaaatggcc ttgcaaaggc attgagggta atcggacgca tcgaacgggc     36780
     actgtttatg ctggactggt ttcgcgatcc atcactgcgc cgacgcgtac aggcagggct     36840
     gaataaaggt gaggcccgca atgcgcttgc acgagcggtc tttatgcacc ggttgggtga     36900
     gatcagagat cgggggctgg agaatcagag ctaccgggcc agtggtctga cgttgctgac     36960
     tgcggcgatc tccctgtggg atacggtata tatagaaaga gctatagatt ccctgagacg     37020
     aaaagggatc ccgattaatg agcaactgat ttctcatttg tccccgctgg gatgggagca     37080
     catcaatctg agtggggatt acgtctggcg gacaaacctt aagctgggac agggtaaata     37140
     ccgttcatta cgctcagtgg atagtggtct gtacaaaaaa caagcttagc gtaggatatt     37200
     ttccgttttc caagcggacc cctaaaaggg tgacaccagc gcccgccggt atgagtaaat     37260
     ttacccttga aatcggcact ccagacatca ttggggtgga cgacagtatg tagttcatga     37320
     ggtcgtgtgg atttaaaagc cggaggccga cgctttttaa ccagcccgtg aacccgaaac     37380
     agctctccaa tcgtactggc cgcaggcacg ccggtgatat tcaggttaag cagtcgctgc     37440
     ctgattttgt ccggacccca tagcgggtgc tgctgtttag tgtccagcaa cagctgcacc     37500
     atgggttcag gggttgagtt ctggtgatgg cgtgcccggg agcggtcagc cagggaggcg     37560
     gtatcatccg gtgaaaaacg ggccagccac ttgtaaccgg tcttacggct gatattaaag     37620
     cggcggcata cctcggcaac gggaaggttg ccttcaaggc aggccgcgac aaactgcaaa     37680
     cgttgcatgg taacagtctc agtccagggc acggcaaacc tccgtcagct gtttaccgta     37740
     ccgttataac ctgttaccca tgtgcccggt tcatacacgg tggacaccag tctgtcagca     37800
     cctggactaa catcccgttt tcaagataat tctccacagt atctagcggc agataagcaa     37860
     gtcccagccc atcaagggcg gcctgcctca tcatatttat tgtgctgaaa gtcgctcgtc     37920
     catcaatacg gaccttaatt tcagtctcat ccttgcgaaa ctcccaggta tagaatcctc     37980
     catgagtggg caggcgtaat ctgatacaac tatggtcgtt taaatcacga ggcgttcccg     38040
     gaaatgcctt ccccatgaaa taagagggcg ctccaaccac tgcaaaacgg aagtccctgg     38100
     caagcggcag ggaaaccata tccttatcga cctgttcgcc caaccgcacg ccagcatcat     38160
     aacgctcagc gacaatatct ttgagtccgt actcgctgat aatttcaatg ttgatatcgg     38220
     gatactcaag catcaccggg acgagtttcg gccagagaat tgtatcggct gcatgttcaa     38280
     cggcagtaat acgcacagta ccggctggtt tttctctcaa cccgctgagt gcggcgatct     38340
     cactttcaat ttcgtcaaaa tggggtccta cacgggaaag tagccgctcg ccagcttctg     38400
     tcacagaaac gctacgcgtg gtacgtgtaa gaagacgaag gccaagatct gcttcaagag     38460
     tccttaccgt gtagctcagt gccgactgcg agacacctaa ctgagcggcc gcttttgtga     38520
     aacttttttc acgggcaact gcgataaaag cttgataatc gttcacattt ttacggcgca     38580
     tttattgacc aggttctttt ggattaatat ttcttactta taaaataatt cctgacgtgg     38640
     aggtttgtct attggtaacg atccaacgtt cctcatccac gacaagtctc cattagcact     38700
     cactaatgct caatagaacc aaagcttacc aacttccgct cctggctgtg agttcaacct     38760
     tctgacgtct tgttttctgg cttccttcgt gacttgccct aagcatgttg tagtgcgata     38820
     cttgtaatga catttgtatt tacaagaggt gtgagacatg ggtagcatca acctgcgtat     38880
     tgacgatgaa cttaaagcgc gttcttacgc tgcgctcgaa aaaatgggtg taactccctc     38940
     tgaagcgctt cgcctcatgc ttgaatatat tgctgacaat gaacgtttgc cgttcaaaca     39000
     gacactcctg agtgatgagg atgctgagct cgtggagata gtgaaagaac gtcttcgcaa     39060
     tcctaagcca gtacgtgtga cgctggatga gctctgatgg catattttct ggattttgac     39120
     gagcgtgcac taaaggaatg gcgaaagctg ggctcgacgg tacgtgaaca gttgaaaaag     39180
     aagctggctg aagtgcttga gtaaccgcga attgaagcga acaagcttcg gggtatgcat     39240
     gactgttaca aaattaagct ccggtcttca ggctatcgtc ttgtatatca ggtcatagac     39300
     gagaaggttg tcgtctttgt gatttctgtt gggaaaagag agcgctcgga agtttatagc     39360
     gaggcggtca aacacattct ttgatgcgct gtacaagaaa ccgggatttc tgttacggga     39420
     agccaccctg atgttgagag tgaaatccag ataagccaga cactacgccg gctcggtgta     39480
     ccagtcctgc gaattgccca ttgcccggaa accctgacat ctgcagaccg ggtttagtct     39540
     cgggcaggtg ggtattttac ggctctggct catcagcaca cagttgatga tggagaccgg     39600
     gcttgcgatc ctgatgatga tgacaggtat aaaacagcct aaacgcacaa taattttcga     39660
     aatccagact accccacttg ctcatccata agctgttaca gggtttaaat catgaaaaga     39720
     aatgtccggg actcacttag catcttgtta acttaatcag atgttaagtc aggttcagac     39780
     ggtcacgtgc ctgacgcaga cgttcctcgc cacgccggtc gtactgctgg gtggtggtga     39840
     cgctggcatg ccccatagca tcctttaccg tgatcaaatc ctcaccattg tccagcatcg     39900
     cggtggcaaa ggtgcgccgt aaatcatgcg gggcacatcg ctcaatctgc gcctgccgct     39960
     ggcgcatctg cagaatatgg tacaccgcct gatcggtcag ccggtcattt gtcagggtat     40020
     cgaagcgccg gatacgggtg aacagaggcc ctgccgcttc gccgcgcacc tggtcgatcc     40080
     acgtctgcag ccgctgccag gttccggccg gcatgtacgc cagccgctcc ttgttcccct     40140
     tgccgagcac cctaagcgcc cgctcatgtg tgacaacgtc actcagactg agtcccaccg     40200
     tctcagaacg gcgcagtccg cagccgagaa tgacacccag cagggccgca tcccgcaccc     40260
     caagataggt ggcgtccgcc tcacacacgg caaaaagttt tccgatctcc tctgccggga     40320
     gggcccgccc ccggggaagc cggctgcccc gtaggttacg taccgcccgg atgtgctgga     40380
     agctctcaac gtccatcagc ttcagcatcc aggcttcctt cgccacgccc ttcagcgccg     40440
     agaggtaggt gttgaccgtc gccgtggccc ggccggtgtc gcgcagcagt tcggtgactc     40500
     ccatcacatg atgccgtcgc aggctgcccc agctgcaggt ctcgagggaa gcggcgccga     40560
     gcatgccggc gacaatgttg aggaacgacg ccatggtctg ccggctccgg ggggaattca     40620
     gggaaagcag gtaggcccgg gcgggactga gcggcagttc gccgcccgcc agcaccggca     40680
     gaaaatcatc ttccggggaa aggcccgccg ggatcacgtt cagcgccgga tcgtcttgcg     40740
     gcatcaggat catgtcaggc tccgtccgtg ccggaaaatc gccggcgcgc tgggtgaaaa     40800
     atcggggata cttgtgctga acaatcctat cgcagagagt ctactttttc aaatatacat     40860
     tttaataagt agactttata gagtactttc caggtcacat agtccttaag aaaatattca     40920
     aataggtgcc tgcacgacat aatgctgcta ttttagcaga atcaccttaa taaacaggaa     40980
     ggctaacaat gaatcagaaa tgggatgcag tgttattttc tgtattaaca ccatcggtgc     41040
     ataatatcag ggaacgtgcc agacaatact ctgcgattat ttaaactgat tggattagct     41100
     tatttttatt aaggtgatga gtgtaattac tcgtaataaa tcatcgggat tgaatcaggt     41160
     ggatgattta gtgttcactc caaaagataa ggatgcagac acaatgatag tcaaaaaaat     41220
     aacacgacta gttttcaggt atctgtaaac aatgtcggtg aactcggagt aggtaatagt     41280
     gatggcataa atcagaaaaa ctctatttca attagagaaa tttcatccct tgaaagagag     41340
     ctaataaatc acggtcatga tgatagcgat accacggaac taaagcaact tgttggccag     41400
     cctataccaa cttaaaataa cagtttaaaa acttctcggc tcatggattg gaaaaattac     41460
     tgaaaaggcg tttatagatg cgctaaaaat cgcgagtgcg aatgctcccg ctattcttac     41520
     tcatgctctt tgttacgatt tcgatattcc tatttaaatc aatatagtta gttcggcttt     41580
     agtttattat aaattactta acattttaca atcaggaaag tacttaatca cgattgaact     41640
     gactaaagat tcggcagagc agacaaaaca agcatttaaa gaaataattt caagcatctt     41700
     atggagttac gtcttttctc atggctaggt attaattgga aaaaacttcg caatactatt     41760
     catgagtagt gaaaagtcga agtgagaatt gctgaaagta cttctcatat ttgtctcata     41820
     ccttattata tggttttaca agtgactgtg gttgctgctt tagttgcgtt ttcaccatat     41880
     cttcagcaat ggttggcggc agcatacaaa agagcacaat aaaaaataaa agcaaataat     41940
     cttgctgaag agttgcgttt gattaacgta gatatgctta aaaaggaaaa actgattgaa     42000
     ctttcgaaag ttgcagagtg taccgaacaa agtgagaaag agaaatgtga gcaccagaat     42060
     gtcctaaata aaaacagaat ttctcttatt aaactacgtg aagcaactct aactaaatca     42120
     atcaaaaata ttgagagttt gcattctgag tcacaagtaa aacttaatga caccttaaat     42180
     taaattaagt taactaaaga gaactatcat ttgatagttg aagttataaa taatgctgca     42240
     aaattcaatc aatagctgag ctttattata aatatgacac ccttagcgac cgtgagaatt     42300
     tcgtggcatt acttaaggag ataaaaagta aaaatatttt ttggttcatc ttccttagac     42360
     catagattta attcaatgat tgaaagagaa attatctttg gaacattacg agaaagcggg     42420
     agaaaagaaa caacattata atgatagtaa actactaatt aggtcgcttt agttagacgg     42480
     cttccttttc gatttctgaa atttccatag tgcccccaag aacagaagtt gtagtgacga     42540
     aagtcattcc ggtgctcaca ccaggaagca agtatgatat caccggaaaa gtagccttaa     42600
     gcaaaaggag agataattct ttcactctta ttagccgccc ggtctgtata gttggtttga     42660
     accttcaacc ttcgcctgat ggtccttcgc agcgaaatca tattccggga acaggatgag     42720
     tggctgcggg tgtaggccaa cgaccttacc ctggcagaat ccatcgcgtt tcagcttccg     42780
     gatgagatta ttcgcataga cgtccaaggg agtatcgagg agggccaaag ggtgttgcac     42840
     tggcttgtta ggatgacgaa ggtataattc cgggatcaac gcagcacgga ctgcgaccgt     42900
     gataaatgat acgtcgctta caggacattc cattgcagtc agtgctgtca cgatttaccg     42960
     gcttacgttt tcggagcgat agacccatcc aataactgaa agaacagagg ggatagccag     43020
     catcgtacct actacgagct gtcgctttag tacatcacct gtcattaatc ggagtatcca     43080
     taggtgccat cgtcaccagt atccgattcc tgcaccaggt tttctccgcg ataagtctgg     43140
     ctcaggaatc cgccgttggt gcactctttt ttcatcagca atttggcgtt tttatagacc     43200
     ttcaggccgg taaactccca gcctttacct atgccgctgt acaccacata gctgtatacg     43260
     ccattaataa agcggtaata agaggcaccg ccaccggaga agggcacctg gccggcgcga     43320
     acctgggttt tatccccttc ggatttaggc agggtcattt cgactttatc gatcgtgccg     43380
     tagtagtagg ttggtacgtc gttattgaga cgcacaacca cccctttacc attggataaa     43440
     tcacagttga aaagcagttc agggtcaggc ggtgctgcaa ttgcgtggtt caggagcgtt     43500
     gccgatacaa ggaggcttag ggcaatcagt cttattttca tggtgttgtc ctgagaagaa     43560
     gaatcctgcc gggtcggtgc ccggcaggtc gtgcacgtta ctggctcgcc agggtggttt     43620
     gcagctcggc taactggccc tgcagttttt gcagctccat ctgtttttgc atgacagagt     43680
     cgctcggtcg gttttgcgcc tctttaatgc ttttttcaag gtcggtaacc tgtttttgcg     43740
     catctgcgcg tccggcggtt ttcgttttaa gctgtgccac cagcttattc agcgagcttt     43800
     gcagcgcctg ttgagattga cgtttgctgg caacgctggc gtggctctgc gctttctctt     43860
     tctcaatggc ttcgttaacc gctttaaact ccgcattcag aatctgctcg tgcgcgagcg     43920
     tgttctgttt atcatccacg cgcttatccc aggtaccgga atagttgcag ttaaatttgt     43980
     tgacgatact gacatcgccc gtggtcgggt cgcagtctcg tgcatccgtc gcacagccgc     44040
     tcaacagtag ggcaccaacg gccagcagta aataacgcat tcagctctcc ttaacccact     44100
     ttcagcgcgg tacgctgggt gtacaggcta tccagctcgc cctgcagaga gccgatcttg     44160
     tcgtgcatca gcgcaatttt gctgtcaagg ttcttggtgt cgctgccggt tttatccata     44220
     ctcgcagaga cgtcctgcca ctgtttttca tgctttttca tatccgtgat ggtgttacgc     44280
     agataggcga tattggcatc cacccctttg atctgcttct gaaccacctc ttttttcgcc     44340
     gtctttgcag ccatctcttt ttcaatgctg gccagcgtct gtttgtcgga cgcgataacc     44400
     gatttggcaa cgttagtggc gttctgaatg cgggcatttt cgttttccac atctttgatt     44460
     gccgcgtcta actgcagctc tttcgaggca tatttcttac gctgattatc cagataggcg     44520
     ttggcgccta tgccgacgcc gcaaccggca accgctgccg ccgccataca cacggctttg     44580
     ttgctggagt tactgacggc gcacgccagc gcacccagcg ccgcgccacc ggcgcaagcc     44640
     tgccagccag atttgttaaa aaactccacg tcctgattat tggccagacg agggtctacg     44700
     ccgccgctgc tgctgctccc cgagctctga caacctgcaa gaacgaccat cagacctgca     44760
     actgctgctg tgcgtaatgc tttaaaagta accattaact gctatctcct tgtcaacatt     44820
     aattattttt tttgcatgcc atcagccacg catcgcgcgc gactttgcca tctttccagt     44880
     agccctgaag gttgttccag taggtgtcca ggtagccgtt caggttcgtt tttccgcgtg     44940
     cagccatctg ctgctggacc acggcaatct gcgggtcgat cagcggtttg ttgtaggtgg     45000
     agcccatatc aaccagcgtg tcagcgtagt agctggagat aaaatccagc gctttctggt     45060
     gctgacccag ctgttcctgg cggcgcgcgc agttggcgtc cagctggctg tcggcggcgc     45120
     aggtcttgct gtagagctgg ttcagacgct cgaggaactc cccgtcatct ttcattttgg     45180
     tacataggaa tgcgcccagt tgcagcgaag tccgaatggc ctggtcacgc tgctcatcgc     45240
     gcagttggct gttggcacgc agctcgccgc gcagtttttc cagctctttt ttaagcccat     45300
     catcctgaac tttggcagag atggcgttca ggttttgcaa cgaatccggc gccttgcctt     45360
     ttgcggcggt tttttgcccg ctgccaaggg cttgccactc tttctcgatc tctttcacgc     45420
     gatcgcggga ggtgagggtg gtggagacca tcaccaggcg cacgccggtg gttttactca     45480
     cgttctcgcc gctgtcggtg tagtaaggtt cttcgccgcg cagggcgcta cgaatatccc     45540
     cctgggtagt gacatagctg ccgccgcgga ccacatagcc gcccgcttta ccgtgcagac     45600
     gatccagctt gttcaggcgg aaaggttcaa acatcatctc cgcgacgttg cccataatgt     45660
     catgcaggcc aagcggattc ggttttaaca tgccagtcag ctgcaacttg ccgttggctg     45720
     actgtgcgcc ggcaaaccag acgtagccgt tcagcccttc cggcatcggg aaggactgat     45780
     cacgaaactc agacggggac accgccagcc cgccacgggc ggcaaactcc cactctgttt     45840
     ccgtcggcaa acgcaagaag cctggctgcc cgtcgtcttt gggcagtgag gcgagttttt     45900
     ctttgcgtag ccacagattg tactggttgg cgaacgccat cgcatccatc cagccgatgc     45960
     tcactttcgg caggcggcct ttgatgtcgg gtttcgggca ctcaccggag agggcgcgga     46020
     actgcaaatc gctcagttcg tacttcgcga tcaggtaata acggcctttg ttcttcggat     46080
     cagggaagct gccagcaata tgctcctgcc gggattgctc cacgaacccc catgcatcgc     46140
     cctcctgacc gaggacgatg ttgtaatctt ctaagggttt gttttgcggt atggcgacct     46200
     tgcgaaacgc catcgcgccg tcgcacggca tcggcaggat cacatcgtct gccagcggtt     46260
     tggggttcca gaacttctca tcccaggtgg cctgcacggc gcaggagtag cccagcccca     46320
     tcaacgacag gcccagtgcc agtttaaatt tcacgtaaac tctccgcagg ttcgattttc     46380
     agggcgcgta aggccccgat cgcggcaacg ctgagtgcaa ccaccagcac gcacagcagc     46440
     gccgcaaaat aatgaagggg ttcgaggtgg cagacaaacg cctgatcggg cagcgaggtg     46500
     cccagcaccc ggttaaacaa cgtgctgccc agcagataga gcaccagccc ggcagcgaat     46560
     gccacactgg tcagaaacag cgcctgaatc acaataaaca gggtgacggc gcgacggcga     46620
     aaaccgagca gccgcagtat cgccatgtcc tttctcttgc gatcgatatt ggcgataaag     46680
     gcgccgatca acgaggcgat acaacccgtc gctgagatcc aggcaatcac gccgaagatg     46740
     acgcccagca cgcgatcgat tgcctgcacg gcctcaattt gtgccgcctg ggtgaccgct     46800
     tcgatgtgct gctcttccag ccagcgtgcc agcaccggga catcatctag cgaactggca     46860
     tacacccggg cccgggagaa gcgtgtgcgc tcccggggcg gtttgccctc gctaacctga     46920
     agcagcggca cctgatagcc gtcgcgatag tcctccagcg ccaccagcag cggcagagtg     46980
     acaaaagcgc caggccgggc aaaccgggcg tcgtccagca cgccgctcac cgtcagggcg     47040
     aaggccgcgc gttggttttg tccctccact ttgcggttaa ccatcaggcg gaatgagtcg     47100
     ctgggcttga gatcgagccg acgggccgcg ctggcgctca acaccacctg attatcctgg     47160
     cgaggcacga cgacgtccga caacagcgga tcgccgctgc cggtggggat cacttcagca     47220
     cccgcaacaa agtgctgacc atcgcgcacc agatctgcct gggtgttcag cgagcgggtc     47280
     aggggaatcg aaaagcccac ttccgggcgt tcggccagct gttccagcca gctgaaatcg     47340
     taatttccgt tgcctgtgat ccgcacttct cgggtgcggg gatcgtccag cagctggtgg     47400
     cgaagttggc tgacgatgcc gtttttcagc ccgaagagca ggagcagcgg ggcaatcacg     47460
     gcaattagcg aaaagataat gcacagggcg actttgcgat cgtggaccag atcgcgcagt     47520
     gccatgcgcc agagcaggcc gcgttcagag ggcctgtcaa ccgggtagga agacactttt     47580
     cccctcctca atgcttgcgg tgtaacgttg aaggccgaat tgttcaacac gctgccagtc     47640
     atggctgacg acgatcgcgg tcatctccag agtccgcacc atgtcaacga tcagtgcaaa     47700
     caggcggctg gcgttgtctg gatccagcgc ggcggtgggt tcatccgcca gcagcaggcg     47760
     cggttgatgg gcgatggcgc gaataaacgc cacgcgctgt cgttcaccaa tggagagccg     47820
     ggaaggcagg cttttcagca ggtggcgcac gccaagggtg tcgatggccg tctccagcca     47880
     agaggattgg gtggtgaggc ctgccagccg tcgcgccagg gtgatatttt ccatcaccga     47940
     cagccacggc agcagcccac catgttgcag cataaaaccc aaatcgcggg cgcgaatagc     48000
     ggccagcgca ggttcgtctt cggccagcag cggggcggca atgtcacgct cgcccagttg     48060
     ataggcaccg agggtgccgg ggcgcagaat cgccccggtc atttccagca gcgtgctttt     48120
     gccgcagccg ctggggccgg tcagcgccgc cacttcaccg gggcggagcg ttaacgccgg     48180
     cagcgagacg tagaagccct gcgctccccc acggcggatg tccatatcgc gaatgtggag     48240
     catcagggca ggttctccag cggaaccggg tagacgttat cccgcgggtc actgtcaggc     48300
     gccagcgcga tccagcgatc agcatcttcg ttgtagcgct ggtaatagtt gagtttggtg     48360
     ttcaggcggc gaatgaaacg ctcctgctcc agcccatccc agctcttcca ggtctcttca     48420
     tcgaggctca gcacttcgct cagataaggc aggctttcga tgtactcgcc cagaaggccc     48480
     atttcaccga ggcgggtcgc atttttacct tttgcctggt tcggatcgtt gcccatggtc     48540
     gcggccagag atcgcaggct ggcgaacatg tcatccggcg agatcatccc ttcgttggcg     48600
     gcattgacga tcttcttcat cacgtcgttc agatcgctca gctcgctttt ggtcagcagg     48660
     acgcggactt cggtggccgg gaggttctga ttcaccagat cgcgatcgct aatccacgat     48720
     ttaaacaccg gcggcacctg cgtaccctgc ttttcaccca agtacgccag acgcatggct     48780
     ttgctcagtt tctcggcatc gctcagcagc ggatcggctt tcttaccggc gtattccggg     48840
     ctggcgccca gggcgctgcc tgcggtctct tccccgctcc aggcggtttt gatctgggcg     48900
     gtaatggcat ttgacaggct gtcgacgatg gtgccgaagc tgttcacatc gccggaatcg     48960
     atcgggtagt acagcggctt atgcaggaac ggattaagcg tcagctcctg atattgcgca     49020
     gcggcggagg cgtgattttt cttcccgtcc ggtgttttca ggtgcagggt gtacagcgcg     49080
     acgccacggt acgccgcttc ctgccgcacc tgctccgcgc ccagatgggt ggaagatagg     49140
     ctgtcggtgc cgtccagtgc gcccgcatcg gtgatcaaca ccacatagcg cgcaccaaac     49200
     tgcgtccagt cgactttatc cagcgcggtc atcaccccgg cgtaggcgtc ttcatccact     49260
     ttgctactgg agacggtcgc ctgcttcagg tcatgcactt tggcgaggaa atctttgccg     49320
     tctttcaccg tgttcggatc gacatacatt ttggcatcgt attccagccc aggcaccgcc     49380
     ttcacgctgg aacggtaggc caccaggcca aatttcactt tgtcctgtaa ctgctctttt     49440
     tcgatctgtt tgtagatctt gtcgatcgcc tctttagtgc gatcaatgta cggccccatc     49500
     gagatagtcg agtcgatcac gaacaccacc gacgccgaga agcccttcat catgttcttc     49560
     tcgtcggtcg ctttagccga ggtagtggcg ctgccattct cactgaccga agccacgttc     49620
     agcacccgta cctggaaacc ggtatcggta aagatatcgt cagaacccag tacgggcagc     49680
     aggtagaagt ttttcagctg atcgaccatg tagtctggtt cacgagccag tacctgtggc     49740
     accggctttt tctgattcag actggcgatc atcggctcca gcgcggcagc aggtttggcg     49800
     ttgttcagca gcgactccac atcgcccttc tctttgaaga acagcatcgg gtggcgtccg     49860
     gcggggttgg taaaggccag cgtgagctgc actttccagt ccacggtgca ggaggacttc     49920
     atccagccag agacgtggcc gaaactgtcc ggcccgacct gcaaccactc gtcctggccc     49980
     tgtttttcac gctgataaac gtaaaagcgg ctgaacgcag gctgttcttt acccgcttcg     50040
     cccgctttgg cggccagcat gcaaccggga taggtgagca cgcgctggaa cagcgtgtgt     50100
     ttcccttcct gcagcagcgg ctttgtgtca gcggcgtgag caggcaaact taatgccgcc     50160
     gcgcacaaca ggccgctgaa tccataactc tttttcattc cttaatccta ttttttcagc     50220
     tcagctaaac gggctttcgc ttcggcgttt tgcggatcct gattcaccac cgcttcgtac     50280
     cagtagctgg ccgtttgcgg gtcagggctg aaacatccct ccgcctgggc ggatttcggg     50340
     tcatattcct gcgcgtagcg catcgccatc tggctatcgc cggactgcgc cttgtaggca     50400
     tacaggcgtt gggcgacgtc acattttttg tcggctttcg ctttggtaat cacatccagc     50460
     agctgggcgc tgcttggctg gctgcgcaga cagcctttga cgaagtccat ggcgttgccg     50520
     ctgttcatca gatcatcacc gcaagggccg ctgattttgg ctaccggggc cgcaggggcc     50580
     ggtgcgggtt gacgcataaa ccaccatccg gcagcggcag cagccagcag cagggcgatc     50640
     acggcgagaa taatcgccat cggcgctttg ctttttgcgg gggccgcagg cacgtcaacg     50700
     accggatctg gcgccggggc ttccaccacc ggcgcaggct gcgcgggcgt ggtgacgtcc     50760
     agcgtttggc tgttcgcggc cagtgggttt tccccgccgg cctgagagct gagcaggccg     50820
     tcagtaatcg ccagaatgcc catatcacgg gcaccgctgt ctttaatggc gatgcgatac     50880
     gctgcctgac ggttggccag cagtgggtcg ataaacgacg ggccaacctg cacggcaggc     50940
     acgtcgtcaa cgaggccgag ggctggcagg ccaaggaaca tttccccgct cacccaaccg     51000
     ccgcggctgt cgaggtacag gttgtcctgg ttgcgcagga tggagatctc aacgcccacg     51060
     atgccgcctt tccagccctt aagcagcagg gtggcatagc caggattgac ggggtttaag     51120
     ggttttaatt cgggtttgat cacgtccggt tactcctgtg aacgctgaat aaggttgagg     51180
     atggctccca gcttttcatt ctgcgccacg ctgatttccc gaccggcgga atgcccggca     51240
     ttctcggtga tgagggcttc taggccgatc agccagtcaa gaatgaaata gccgctgtag     51300
     ttcagctgtt gcggcgtgag gctgaccagt cgttcatcat ccttccacac cacgctgtcg     51360
     cactgggccg gacgggtgaa gatcggttga tccggctggt tctgacgggt tggacgtttc     51420
     ttctccggca cgatttgata gccaagccag gtcataaaat cgctcatgac gtgcagaacg     51480
     cgcgacacct ggcgatccac catccagtcg cggcgcacgc cagcctggtc ggtgttctgc     51540
     atcacggcaa ccagcgcctc ttcggcacgc aggcgcagca gaccggtgat cagttcatcg     51600
     acgagctctt cggcggtggc gcgtggcagg ccaatgtaat tgagcatggc cggggtttcc     51660
     ggcaggccgc gcagatggtt gatccagtgc tgaacgctct gacgggcaaa ggcaacttcg     51720
     tggctgtggc tcttgacgct ggaggcgctg ccgtgcgcat cgtcgagacc gatatcaaac     51780
     acatcttctt ctgccgcgcc aggcaggctc acctgctgca tgtacagggc gtgcagcgag     51840
     cgacgcgtcg gcaccaggcg cgccagcagt tcgccgtgca tcccgttgcg ttttttcacc     51900
     gccgccacaa tctcctgcgc gatgcgggct ttcttcgcca cctcttcgtc gccgtcaggc     51960
     tgataccagt tgcccagccc gccttgcacc agctcgttac gactctcttc gagctgttcg     52020
     gcgatgcgtt ccagcttgtt ctccgggcgc gcgaccttgc tcaggtagct cgccatacgg     52080
     ttcatcccgc catcattgag gttcaacatc gcgtcccagg cgtctgccgg tgaggcgatg     52140
     tagcggttca cggcgtcgtc ttccaggaag gttttacgca tcagcatcag ctgttcggcg     52200
     ttgtcttcgc ttaaggcgac ttcgctccca ctgctcatac gaatgaacgg tgtcggcatg     52260
     ccgggtttgc gcaccaggaa ggtgttgttg aaggtttcac ccgtcttcca ctcactcatc     52320
     cagctgtatt tgccgaattt ctccagcatc gccattttga tcatcccgcc ctgtccccag     52380
     tactgacgca gcagggcttc ttcgtgtccc agggcaccgg tgacgcggtt atcgaacatg     52440
     gtcaaggccc agaccagccc cggtagacgg cggctgcgca cgtctgcatc ggcgccctgg     52500
     gtgcgagaga tccactcgtc cagtgcatca cccacgtctg acacatccga ctgcctggcg     52560
     gaaggggtac aaagcaccag gacgttcatc tcctggtttt cggtataacg ctcaaacaga     52620
     taagccactt tgccgcgcag aatcagctct gccagacggc tgccgccttc accttctgcc     52680
     gacttcgcgt tgaaggtgtc gatagacata cggccgcggt agcccgggaa atcaagcaga     52740
     tccaccttat cgaacagcgg cgcggtagtc ggtgccgaga gcggaacatg cagttctgcc     52800
     gtcagcacgg tcagctcggc cagcgagatg gcgacaggcg cagccagccg gtcttcctgc     52860
     accggacaga cttcaatacg tgggtcgtgc ggctggttga gatgctccag catgtccacg     52920
     ttcatgatgc tgtttttctg gatcagcagg ccgttctctt caaccaccag cgtgcttaac     52980
     ggcgcgcgca cttcctgcgc cccacccagg cgttgcaggg tctgggcaaa atggccatag     53040
     gcgcgggtaa gttcaggcac ttctccccac agcaccgaga acagctgtgc gcgatcgtcg     53100
     gtggtcagcc acggggcgag gtttaccgcc tgcggccagt agtgcagggc gaagcgactt     53160
     tgggtttttt ctgcatggcg gacaaggtag tcccagaagg agaccacatc atcttccgtg     53220
     acgcccggca cgcgcgtcgg gcggcggcgt ttttccagcg tggccagcag gtcgctaatc     53280
     cgtccttcgt cataattcca gtcgaacttc tcctggttga agtcatgcac gaaggcgttg     53340
     gcgaggattt tggccatctc cacttcgctg aacaactgca atctgaccgg ccagttttgg     53400
     tcgtcgttat gcttcaggcg gctgaagcgg gtcaccagac cggtggcctc tttaccgccg     53460
     cctggcgggt tgatgtgggt cagaaaatcg agttgatgcc cgccgagcac cgtgcccagc     53520
     ttgccgtttt caccggcagc cagcgccgaa atcaggtagg acttacccgc ctgcgacaag     53580
     ccgaagaagc cgatggtcat cgggcgtgcg gccgcctgcg ccagtcggcg cgctttgttg     53640
     cggctgcgac gcaggttcag cgtcagtcgg tcggcttcgg tgttcagacg cggtgcgtcc     53700
     tggcgtacgg cagcaatcca gtcaatcgcc tggccggcgc cttgctcaac gccctgccag     53760
     ccctgaatga tgtttgcaga attatgggta ctcattagct tttgatactc ccgctatcca     53820
     gccagtagtg cgtctcgctg agaccgttac cgaccatagt gttcaactgg aaggccacgt     53880
     ctttgcggtt gtagttgcga cgggcatgat ccgtctcgag ggattcaatg cggaacttct     53940
     cgggactgac cgcctcgatg ccgttgcgtg ggcgtccctg ctcggcggtg agttcgatgc     54000
     gcatcatggc atccccggcc agctcgctcg cgaggttagg gttggcgatt ttcagcgtgt     54060
     aaagtgcaga ggcaggccag cgctcgttat caagctggcg gaaaccaatg cgcacttcgc     54120
     cacgcgcgtc aaagctttgc ccctgcggaa gctggaacgc cggcgcgtcg agatcgatat     54180
     cgcgataaaa gacgttgctg tctttgatca ggttgttgcc gtccagcatg ccgagatagc     54240
     ggatggtgga ataaggcaca aagttctggg tgcggaagaa gaagctgctc aaccgcgagt     54300
     tctctgccaa caggtacagc atcgccccaa ccgaagcggt agatttcggg tcgtcgatac     54360
     agcctttctt gttgaacgga taccagccac cggtctcata gccatgcaga ggcagcacgc     54420
     gcgatggcgg caccggctga agctggcgga tcagcgcctg aatccccggg agacgcgacg     54480
     gacgacccgt cagcagcagc acgtcgcagt tatagtgcca gagcacttcg cacagggcgc     54540
     gcaggctgtg gcagatgttc atgcggccac tgcgtgggtt aatgaattcg ttgtgcaggt     54600
     tggccagatc gatctccagc ggcacatcga gaatagagaa gagcgcttcg ctggacagtt     54660
     gacccatgcg caccacgtca ttcacgtagt cctgcacttt ttgcgtcggc atgttttcgg     54720
     tcagcagatc gcggaacgtg aagctgagct gctcgcggcc gctctccggc gaatactctt     54780
     catagcgatg caggatcgcc agcgccagtg gggcgaagat ctgcagggtc agctgctgac     54840
     gcagaacctg cttgcccgcc tcgatggatt cgctgccaaa cagctgcgac atcatcgatt     54900
     ctgcggtcat atcgctatgg ccaaccttca cgatcgcggc tttcacagcc ggttgcaggt     54960
     acaggcggat cacatccagc aggatgtcgt ctcccgccac tttgaagcct tcgcggaaca     55020
     gctgttttgg cgtgatacgg acgttgatgc cttcgccgtc atccagcgta tagcgcgaga     55080
     tcaccaggtc agtggtgccg ccgccaatat caatggaggc caccttcagg ctgcgcggcg     55140
     cgtttgcggc aggggcgttg tccgggcgac gggtcgccgc aaagaactca tcggtacgcc     55200
     caccaaagta ggtctgggtt tcgttgtaca gatagaccag ctgtccgcag gtggcttcgt     55260
     cccacttcac gtgaacgcca ggtcgcggat gtttcagctg ttcgttgtct tcactttcgt     55320
     cgtccatctc ctcccagccc agcgctttcc acaccagacg gatggcatcc agcatgcatt     55380
     gctcaaagat ggcgcgttca ggttttggca tcgcgggcgg gacggtcatg atcacattgc     55440
     gcaagcggcg cggcgtgctg gcgtggttca tcttcagacg ctgcgccggg ctgttgatct     55500
     gcatcagcgc ctggctcagg acttcagaga gcatcatggt cattaacgag ctgcggctgt     55560
     aaaccgggga gaagaccggc atcctctcat cttcaggcag acgaatcagc agcttgccct     55620
     ggtcgttaag catgtacagc agcggggcgg cggtggcgag cggctcgcga tcggatttga     55680
     cgaacgcctg gctgaaacgc cagccggggg agtaaggctg gtcgtcccac agatagcgtt     55740
     tcgggctgga gatcccggtt gagccttctg ttcccaggcg ctgtgctgcc atgcggaagg     55800
     cctcatcgcc cacgcggcca atggtcggcc aggtgaaggc gtcgctgcgt ccgcttttca     55860
     gcgaaaagtc ctgcttgcca aactcggcct gcgcaaactc caggcggctg tcgaagggtt     55920
     cgttgtagac gttttgcggc tggcttaagt cgcgaagttg cagctggtaa agctgggaca     55980
     gacctttgtt gtcgtcgcgg tgctcttcaa tcaggattcc gcaactgcgg gagttgccga     56040
     tatccagcac caaatcaacc ggaatggccg agtcgcggat cttcacgtca ttgacctgca     56100
     cttccgggat ggccacggtg gcatcaagga tattcagcag gttgaggtag tgcgcctggt     56160
     gctctttttg ccccagtttt tcatcaatat cttccgcatg ctggcgcagc acgtcgcgcg     56220
     cctgggtgct gaacacttca cgcaaccact cgtctaccca cgggagggtc aggaaatcgc     56280
     ccatctcgtg cgggtgcagg gccagcgcaa aaccggcgcc agagcgcacg tcatcttcgc     56340
     tgggagccag atattgcgtg ttatcgcgat ccgggaaaat tttggtatcg aagatcagga     56400
     tcgcgcgcca ggtgttgccc ttctcgtcgg gttctgccag ctcgtggaac tgcacgcgcg     56460
     cccagttggt tggcccgtgt gcaaacgcac gcggcgggtt aaagcggaag aagggcagcg     56520
     ggagccacag cccctgatag aggtgcagtg actcttccgt ggtcagagag taatccgact     56580
     cagcaaattg tggcgcggca ttatctgccg ccgggatttg cagtttatct tcgcgttcgt     56640
     tatagaccag gcgcaggatg gcgccatcgc cgttctggcg caaaaaatca ccgtactctt     56700
     tacgggcagg cagcgtaaac gcgaaatcca ggaactggat gccactgtca cgaataattt     56760
     tgacctgctt tttaaaatca gtaagttcag cgagcattta cttacttgcc tcctgcttca     56820
     tcgaaatagg gaaaagggtg ttggcgtcgt agcggccctt acaatccgca atgttctgcg     56880
     cgcctggcgc acactgaact tcaggcattt gatagaccga gccatcggaa cattgggctt     56940
     caccctggtt attgatcgcc agattgccgg actggatggc cgcattgacc gcgccgcgac     57000
     aggtcacccc atcgccccgc accatctgta cttcgccttt gccgtcgttg atctggtaat     57060
     tcagactgag cggcttaccg gtgcgctgat cctgaatgcc cgcaccggcg tgccagcgtc     57120
     cgtttaagaa gtcggtattt ccctgcgcca gcgcatcggt tggaatcgtc agcggtgctt     57180
     tcacgcccgg caggctgttg ccgggagtga catccggctg cgtcaggccc ggtgtggcgt     57240
     ccgggatggg cgtttgtgct gcgctttctg gcgccacagg gtcaaccggc gacggatttt     57300
     ctgcgggcgc ttcatcaggc agtgcgggcg cagccggcgg ttcaccgttg gcgggtatct     57360
     tgccattggc agacagattc gctgacggga gcgacgagtc cggcaggctt gcgccactgc     57420
     cgttcagcga cagaccgttg ccacccgtac cggttgttcc agggaggtcg gtgttgaccg     57480
     aaggcatctt cagatgcgca tccggcaagc ccggcagcgt ggccgaaaaa cctgggatag     57540
     agaaaccggg aacacagctg cgcagcagca gcatgatcag cagggccagc agcagcaagg     57600
     ggagtaacca gcgcagccag gcgggcagcg tccaccacca tccccgccgt gtgaccgggc     57660
     gttcagtgag gggttccgca accaccgggg cggccggtgt agcaaccgca ggggcgagcg     57720
     ggacgggcgg gcgcaggcaa tcgagcgggt cgacacggga cggatggcgg gcattaacga     57780
     acccccagaa gctcatgacc ggtttaccgc ctaccagcca gacatggttc tggtcgggga     57840
     actgcattgc cttctccagc aactggccaa acaggcgttg ttccgggttg gaatgctggc     57900
     tgtattcaga actgaactgg cgtaaaacgg cgtggctgtt ttccagttga ctcagcgcgg     57960
     cctggcgctc gctctcggtg gaggccgacc aggggatcac atccccggtg gcgggggcat     58020
     accagtcgat gcgatcgccg tattcattga cctgcggaat tgccagcgta tcggcaaccg     58080
     cgctctgttt tctcagacgc agtgtttcgc gaagttgcag tgcggaaata tgaactgcct     58140
     gaccgttctc acccattgac tggtatttgt cgagcttgtc actgcacagg aacatctctt     58200
     tcacgttggc ctgcccttgc tggtaattat ttgggttaac tctgctttat tgatatgtac     58260
     agcatcctcg agggtgacaa atcgcaagcg acgtgaatca ccttccgggc ggataaaaaa     58320
     atgagcagaa acattatcgg caggtgacag taaacgttta gccataaatt aaattttgct     58380
     ggcggtggct gttacctgca ggtaaaaaag cgttagtttc tcgctgaaac gctgtcgata     58440
     ttaatctgtc aaggcttttg atgtattagt cgcaggcctc ggggatatat tccttaattg     58500
     cctggttcat catttcatta aattcatggg tattgtttac ggcataaacc gaccccccgg     58560
     tctggctggc aatacagttt ccggcaccgg tattcataat atcgaccacg ttgacctgca     58620
     ggcgcggttt ctgctgcttg agctgctgcg cgaccacgca cggatcgccg ccgcaggtct     58680
     cttcgccgtc ggtgatgagc acgatgatag catcacgatc cacgccatcg accagcttgc     58740
     ccgccttctc cagcgcttct gccagcgcgg ttttccccac cggttgaatg ttatcgatgg     58800
     cgtatttcag ttcatcgcgc tgggcaaaag aaagggctgg cgtcacagag acttgctggc     58860
     aggttgccgc cgataccagg ctgatatcca tgtcttttgg cacttcgtcg atcagctgtt     58920
     ttgccgagcg gtgcgcaagg ctaatacggc gaggttcgcg atcaaaattc tttactggcc     58980
     tatcctgcat cagacggcgc agctcatccg gcgtaatgtc catactgatg gacatagaac     59040
     ctgatgcatc gaaaattaac accatttcag gggcttgctg tttggtccgt tttgccggac     59100
     agatctgttt tatcggcagc ggtgctggcg caggcgcacc ctggaccggt aattttgccg     59160
     tcggcatgca accgcgtagc aaaagaaacg ccagcagcac gagcaatgcc agcagtaacc     59220
     accaccaacg gcggccctta ctggcaaccg gcgacactgg cacggcgggg ctttcgcacc     59280
     aggctgtaat gactggctga ccatcaacca cccagacgcc gcgctcatca gactgacaac     59340
     tggcgagcga caacacctgc ataacgtcga caggcgcgga gttattcatc gagagctttt     59400
     gataaagttg gtcaatgacc actagctttt gctgtaacaa gacccgcgca tgctcttttt     59460
     ctgcaggtgg aagcgcgatg agtgaaacag gttgtccgtt aatatcgctg taccactcaa     59520
     tcgcaccatc cgaggcttgg tgtggtctgg caaataaatt tttataacca gcagagagat     59580
     gctgctcaac aagagaaata aaggaagggt agaggttgat ataattttgc acagattcgc     59640
     tgtgctcaac agtccttgtt attctaatca tcgaaatcac tgcgccatct gcacaaatcc     59700
     acagattaaa atatgaaggg gaaaaattaa ttttcaatta taagaatggc tgcagaaata     59760
     gataactact aattttaata gtaaatgcgg aatgactcca cagagatatt tgtgccgtag     59820
     ggctcgattg taaaacctca atgtaatcga atatatccat ccgggccaga ggctgggttt     59880
     gccggtatgc tttgttgttg atgttaatca tccactgtta gcgagaagct gatcttcttg     59940
     agcttgggca cgtacgagaa ttactatgat gatcaaaagc gacaccgcaa aaccgacctg     60000
     aaacctcggg atcgtcttgc ggaccgtatt cacggtaacg cgagagaaga cgttgactct     60060
     gacgatcgga gataccctag tgccgcgcgg ccatctgtat ggtctgacac cggtcgacaa     60120
     catcctgaat aattatgagt cggttcacat tgttgatcga gaaaaactcc gttccgtatg     60180
     ccgtcattgg tctcatcctc agaaagcggc gatcgctgtg gtgagactgt agcgcggaca     60240
     tgtctatctg gtcagatacg gacatctcaa tttagctatt acaatgttag tgcgcataac     60300
     aaagattatg ttaaatgaaa gaataaaaac atataaaatc aacacattac acttagcttt     60360
     ccgccctcat cttcccaaca ttaggttatg gaagcttaag aaacagcgtc cgctcctgcg     60420
     tttgcgatgc agtaaaaccg tggtggacat aaaagctttt ggcttcttca gtcattgcat     60480
     gaaccataat cgcacggaca ccaatgttct cagctacacg gtaacagcgt aaaactgcat     60540
     cttgcagtaa atcagccccg atcccttttc cacggaatga aacatcgacc gccaggcgag     60600
     caagtataat tacgggaatt ggatcgggca tattgtgcct gaggcttccc gtagaatcca     60660
     catggttaac actgccggtg gccagagaat aaaaaccggc aacctgtttc atgtctgttt     60720
     tacaaaccac aaacgtacgg gtggttctga atgcctgatt ttttaaccct ctctgtttaa     60780
     gccagtcatc gagcacagtc tccccgctga cgaactcagc cagttgatgg gtactggata     60840
     acggttctgg tgctgttaca cgtcccactg aggtttcctg gccagaagtt tatcaatggc     60900
     agggtcatct gcaacgggtg catcgagcat atcgatgaac tctgcatact gctcatcgtt     60960
     aaaattgaat acgcgacgat cgaggatcac atgctccgca gcctggcatg ccatttccag     61020
     gatgaagtct gtgcgtgatt tatgaagaat ctctgctgca gcatcaatga gtgctcgttg     61080
     agattccttg gctctaagat tgagttgaac atcggatttc atgattgcgc tccttgtata     61140
     gcaattgctt tacaaacata acacacgcag aacgtatagc aaacgctata caaacccact     61200
     taaggtaacc gtaatctatc taatattaaa atgattacaa gaattattca tttgactgaa     61260
     attcctggat aaccactaat ttttcaattg aaaaccaatc gactgtgatt tctttctcct     61320
     ggagccagtt ctcactgtga ggatgcatcc ctgccagaat agaacttgct ggagcccatg     61380
     ctttcactaa aactccaccc gatccgaagt tattgaaccc acgcgcaaat ccaatggcaa     61440
     cattctcatc ggtcgtccaa caaaaaccta actttccaga atggtaagta tccagatttt     61500
     cccctcgata caaccacagt ccctctcctc catacgcagg taacagtgca cgcagcacct     61560
     tcaataattt tcgatcgttt tttagccgtg aacgaatgaa atgcccacgc tcaatccata     61620
     gaagatgaaa agcttctttt agttcagatg tacattgccc tttccttgcc catttataag     61680
     caaatgctgg ccaagtacct tttctaaata tctgctccag taatatgcgc tccgggcttg     61740
     gcacatctcg ctttgtactg ctgggtgtaa tttatctgag tgactattat cgagaaggat     61800
     aattaagaag gtccggttgt aaaaacccat ccggcgtatc cagcaggtaa ctgatgagag     61860
     aggagtcgct attcagcttg aaaaagtgga gtcactgtct gaaataatga aacacaaagt     61920
     tatgtcgacc ccggcagttg tcgttgatga catcgttgta ctaaccggag gaataccatc     61980
     aagagacatt atcgaaagct ggctctgacc tgcaggcagg gaaataattc ctgtttgttc     62040
     actgccttaa atatcaagct ctgattcctg cagggacacc cggcagcccc cttttttaat     62100
     gaaaagttca gacaccagag atgaaggtgt gccttcatct ctgtcacggt actccgccac     62160
     accaggtaaa gtttacagtt tgatacctca cttatcatag ccagttcagg ttcgtttttt     62220
     gctctctaac tgctggccgt ctttctgcag tccctgtcca tcctttattt atcatattcc     62280
     tgacgcttat tcgtttaaag tctgaaactt cgcttcaagc tcaagtattc tgagacacat     62340
     ctgctcaata agttctggtg taatgatttt ttaaaaatag cgatgagttc agcatccgtg     62400
     tcatccataa tttttatggg tttatcaaat gcaaccaggc taagcagagc gagggccaga     62460
     agctcatcaa tcatatatgt ttatgcatat ttttaccttg actgctgaat ttacacgtta     62520
     ataacgtcat ttctgaatta aaaaataccc agtacagaaa aaaacaactt agcgaataat     62580
     tttcgatatc aaaaccgacc ccgtttagtc cagattttcc tgctgacgct caactttttg     62640
     tcagaaaaag agctaatctt gtattgcaca aaaaacaaac aggagactgc catgtacaaa     62700
     tctattctgg tacccattga tgtttctgag gatgagctga cccgtcaggt tattccattt     62760
     gttcaggctc acgccgtcat aaatatctcg aaagttcact tcctgaccgt tatcccgtct     62820
     tttccatatt attcaacatt aggactggcc tattccgtag agatgccaga gcaaagagaa     62880
     ttacagttga aggccgaaga aaaattgaat gatattgtga aactattcaa attgcctgag     62940
     ctgaaggtac aagtgcatgt cgtatcgggg tcgccgaaag atcagatcct caggctcgca     63000
     gagacaattg aggcagattt aatcattatc gcttcgcatc gtcctgacat ctctacttat     63060
     cttttgggtt cgaatgctgc agctgttgtc cgccatgcaa aatgtccggt acttgtggtt     63120
     cgataatggc actgaagcgg gctgtctgaa cgtgtcccat tatgagtcat ttcagacagc     63180
     aaatggggtc aatatatgtg gaagatatgt atctcaacgg tgtaaacagg cacgtctgag     63240
     ccatttaaga tggtctaaag agacgtgccc atgagtagta cgcgttatcc tgaagagttt     63300
     aaaatggtag tttaagagcg ttaaaaaaaa caaagagatt aaattttaat caaatgtgat     63360
     agggtaaggc acattcattg aaaggttaat catcatgtct atcatcgatt acgcaatgaa     63420
     actcatcagt ggtgcagcca cagtcacctg tcccatttgc gggtctaaat cgactcagcc     63480
     agtctcaaaa atccgtctga aacaggccat gctttgcccg ggatgcaaag ctctgtttat     63540
     accaacacga tagcgccttc cagagaatca tgcacaaact gatgttctat actcagatat     63600
     aaaccagcag ctgttaaatc cctgatgcct tacgcccatc ctgagagaac ccttctgaac     63660
     tgatttcgca actgctcctg cgcgttaacg tcgcatcaga gcaacgctat gaatataaat     63720
     cccagggcgt ggcttcgccg cccccgtccc ctgacgcaaa ctcccggctg ggctccgttt     63780
     ccggttaacg acccggcggg tgaaattcct ctgcggccag agctgttttc aacacctcag     63840
     atggagcgtt atggtcaaaa actggcgcgt acccataaaa tttctccaga taaactgcct     63900
     tactacctcc ttaaacggct cggtgaaaat gaggccgtca ttacgcaaaa ctgttacgaa     63960
     ctcaatgcac gtaaaaaaac gaccattatg cccgccgggg agtggttgct ggacaattac     64020
     taccttattg aggagcagat ccgtatcgtc cgccagcact tgccgaaaag ttttggcaaa     64080
     gggctgcctt cactgtcctc cccacaccgt tgtccgcgaa tttatgatat tgccgcagag     64140
     gccattgcgc atggcgatgg gcgatgggat atcgccagcc tgaccagcta tatcacggct     64200
     tatcagacag tcacgccgct tacgttaggc gaagtctggg ctttgccggg catgctccgc     64260
     ctgtccttaa tcgaaaacct gcgccgcgtc agtgccgaag tcgtacaagc ccagcaagaa     64320
     cgaagcctgg ccgatacgtg gataacacga attttcgaat gcgcagagaa tgatccggct     64380
     gatttaatca tggtgatcgc tgacatggcg cgttcacgcc ctccgttgag cagcgcattt     64440
     gtcgctgaac tggtacgccg tcaccagggc catggcaacg cgctcgccct acctctgacc     64500
     tgggtcgaac agcgcctggc cgaacagggc gtcacaacag agatcctcat tcatcgcttc     64560
     aatcaacagc tcgctgccag tcaactctct gtcagcaaca gcatcgccgg tttacgctta     64620
     ctgagtgaaa ctaactgggc tgattttgct gaaaccatta gcgtggtgga acagacgtta     64680
     cggcttgatc ccgcaggcat atattcccgc atgcactttg atacccggga ccattatcgt     64740
     catgttgttg agcttctggc cagacagagc cacttcactg agcctgaggt ggcaaaccat     64800
     gtcctggcac tttcccggga aaccactcct gggacgcaag cacatcatat tggtcattat     64860
     ctggcaggcg aaggacgtca gcagttggaa attcagctgt tggctgaaac gtccagactc     64920
     atacgtctgc ggcacagttt caacaaaatc ccacttctgt catggctagg cagcctgagc     64980
     ctgttgacca cggcaacgac agcagggata ttgcacgaaa cggcgcatca gggaatgggc     65040
     tggttgttgt tactgttggc attacccctt attgttgctg tcagccagtt aataagcgat     65100
     atgctgagtg agatcacgac ccgtttccgt atccctctgc cgctgccacg aatggatttt     65160
     tcggctggta tcccggctga ttgcgcgact atggtcgcta tcccctgttt actgaccagt     65220
     cacgaaagca tctgcaaact tctcaccagc ctggaagttt gctggcttgg taatcaggac     65280
     gaaaatctct gttttgcgct tcttaccgat ttcgctgatt cgcccagcga aagtactgaa     65340
     gaaaaccagg ctctgttaaa tcaggccatc acagagacac agaaccttaa ccggcgatat     65400
     cctggcagcc gtccaaactt ttatttgctg cacagaaagc cggaatggaa ccctctgcag     65460
     ggcgtctgga tgggttatga gcgcaaacga ggaaaactgg ctttactgaa cgactggtta     65520
     cgccatcctg cggcacagtt tgccagtgtt gagggcatgc cagcagatca gttacccggg     65580
     cacattaaat atgtcattac gctggacagt gatacggttc tgccgcgaga taccgcgcat     65640
     aagctgatcg ccaccatggc tcaccccatg aataagccag aatatgatcc tttaaagctg     65700
     agggtagtaa aaggttatgg aattctacag ccaggactgg cagaggagat tccacgcaac     65760
     ggacaagggc gctatgccgc cttgagcagc agcgtaccag gtaataaccc ctattcgatg     65820
     atgtcttcag atatctatca ggatctcttt tgggaaggat cctttgtcgg caagggtatt     65880
     tacgatgttg atatttttgt tcaggccacc gcaaacacct gccctgaaaa tctggtcctc     65940
     agccatgact tactcgaagg ttgttatgcc cgctccgggc tgttaagcga agtcttactc     66000
     tatgagcagt atccgaataa ttatctgtcg gatgttgctc gtcgcacgcg ctggatacgt     66060
     ggagactggc aactcctgaa ctggcttaga cctcatgtca gaaaagcgga tggaaccagc     66120
     gttaaaaatc cattatccgt gctgtcatgc tggaagttat tcgataatct gcgccgcagc     66180
     ctcgtggcgc cttctttact tgtgctcctg ttttgcgctt tgatttgggt tcccaatccc     66240
     ttttactggc taggagtggt aacactggtt tggctgttgc cagcggtctt aagtatcacc     66300
     catgatctct tgcgtaaacc tcctcgccgc tccctgcgtc agcatctgtc gctggtcgtc     66360
     gccagtgcgc tgaagcgact ttcccgcatc gcgcttaatt ttgccatact gccacatgag     66420
     gccggataca ctctgtacgc gattggcgta acgctctggc gcctggccat cagtcgacga     66480
     aacctcagcc aatgggccag tcacaatccc gtaagtgacc aggtaaaagt atctgctgtc     66540
     cgtttttatc gggcaatgtg gctgaatgtg ataagtggta tagcattaac ggggcttacc     66600
     tttcagtttg caccgcagct cctggcaatc gcattacctg ttagcattct ttggtgcctg     66660
     gcacctctgc tgatgagttg gctgagccgc cagcctgtac gcaaagtgtt ttcccccaat     66720
     aaggaacaga aagaactgct gcgtcagaca agccgcgaaa tctgggcctt tttcgagacg     66780
     tttgccacgg cgaaagaaaa ctggcttcct cctgacaatt accaggaaat ccccgagccg     66840
     acgatcgcgc atcgcacctc tcccacaaat attgggcttt ccctgcttgc aaacctgacg     66900
     gcctgggatt ttggctatct gcctggtggc gaagtattgc agcgcatcac ccaaacactc     66960
     gactcgctgg ataaaatgga acatttccgg gggcatttgt ataactggta tgacacacgc     67020
     acgcttgccc ccctcagccc tcgctatgtt tcaagcgtcg acagcggcaa tatggctggt     67080
     catttactta cactacgtca ggggctgtcc gccatgcgta agcagcccgt attgaacggt     67140
     gaacagatac tggccgggct gaacgataca ttgtctatcc tggaaagaca ctggggtcag     67200
     aacacgccta ccagcctgcg gctgttgcgt aaacagtgtc tcagtgcgat gtcgttacct     67260
     ccgacacaca tttttagtgc tctaaaaaaa atgaggacgc aaagcaacca tctgaagatg     67320
     ctatacaatc aggaggatag ttttgttgtg cgctggaccg agcatctcga gcatcagctg     67380
     gttcagcttt gtcacgagtg gacgcatctg cttggctggt taacgccact gtataaggat     67440
     cagacgttac cgtcactgaa ctggcttgcg acggcgacct attccggtga agggacacct     67500
     acggcatccg tgataacgca agcccgcctg cgcctggata taatcaccga acttgaacag     67560
     cgcctggacg accacgcacg aatggatttc gcctttctgt acagtgaagc gaccagcctg     67620
     ctcagtgtcg gctacaactg tgacacgaat acacccgaca aaagccatta cgacctcctc     67680
     ccatccgaaa ttcgactgac aagttttctt gccatcgcaa caaatcagtt gccgcttaaa     67740
     agctggtaca ccctggggcg actcttcaca acgattgata atgaaaccgc gctgatgtca     67800
     tggagcggtt caatgtttga atacctgatg ccaaatctgg tgatgcctgt ctggcccggt     67860
     agtcttcttg atgaaatgag tcagtcggcc gtaatgcggc agataagttg gggaaaagag     67920
     cgcggcgtgc catggggagt ttcagagtct ggttaccatg cttttgatgt tcagcataac     67980
     tatcagtatc aggcatttgg cgtccctggt ctcggccttc gccgtgggct ggccgacgat     68040
     atggtcgtcg ctccctatgc cacacttctg gcactgccgg tctcgccaca aaaagcctgt     68100
     gagaacctgt tcagactgaa aaaaaccggt gctcacggtg agtacggttt ttatgaagca     68160
     ctggactata cgccctctcg cctggcgacc ggtcagcttt atgccgtagt acagtcctgg     68220
     atggcgcatc atcagggaat ggcgtttcag gcgctggctc atgtgttgct tgatgcccct     68280
     atgacagcgc gtttcatgtc cagcaccgct ttccagtcgg cgagcctgct gttgcaggaa     68340
     cgcgtgcctg atgccgtcga tctatacagc ccgcgtcgtc acttcgagtc tcatgaaggg     68400
     agagtcaaac cggttcgcta cgaaccgcgc attttcaccg cagcggatag cccggtcccc     68460
     gaggttcagc tgctatccaa cagccattac catctgatga tgactgcggg cggcgggggg     68520
     tatagtcgct ggaataatct tgccctcacg cgctggcgca gcgataccac ccgcgataac     68580
     tggggggcat tctgctatat cagcgatccg caaacaggtg agatatggag caatacctgg     68640
     cttcccacag gggacgattc gggtgacagc gacgaagtga tatttaccga tgcaggtgct     68700
     gaattccggc gaaacttcgg gtcactcagc gtcagaacac agatcgtcgt ctccccggag     68760
     gatgatattg aactacggcg ggtcacactt gtgcatcggg gccgcctgcc gcgaaccctg     68820
     gaactgacga cgtatgccga agtcgtgctc gcaccttatg ccagcgatct gtctcatcct     68880
     gccttcagta atttgtttat ccagacggag cttgatcccg atcgcgacgc catactctgc     68940
     catcgtcgtc cgcgttcgga gcatgaaaag agcccttgcc tattccacat gatggtggtg     69000
     catggtgata agccgaagag cgtttcgttt gagaccgaca gagctaaatt tcttgggcgt     69060
     ggccgaagtc ctgctgatgc aatggctaac agcgaaaacg gaccgcttag caacacgtcg     69120
     gggtctgtgc tagaccccat actggcgata cgccatgctg tcacgctgca acccggacag     69180
     ccgatcacca ttgatatcgt ttatggtatc agtgaaagcc gtcagcaaag ccagacactg     69240
     ctggaaaaat atcgtgatca tcccattgct gaccgtgttt ttgaactggc ctggtctcac     69300
     agtctggtgg tgttacgcca gatgaatgcc agtgaagatg atgccacctt gtttaaccgt     69360
     ctcgccagcg cagtacttta tccaagtcag gaatggcgcg cagacggcca ggtaattagc     69420
     cgtaatcggc gtggtcagtc cggtttgtgg ggctgggcta tttcaggcga tctgccgatt     69480
     gtgctgctca gtatcgccag agaggagagt atagcctccg ttaccaccct tattcaggcg     69540
     catcgctact ggagactaaa agggctggaa gtggatcttg tcattctgaa taacagcccc     69600
     ggtggctacc agcaggtctt gcaggcgcag atgatggatt taatttacgc gggttcgggt     69660
     gccagcctgc tggacaaatc cggcgggatt tttgtccgta atggcgaaca tctgtctgcg     69720
     gatgataaac agcttttgat gagtgtggcc tatctgtatc ttgatgaccg cgcgggtggc     69780
     attaatgaac agctcagcct gcgaatgaat acgtcaaaaa caccggccag ggcatttatc     69840
     tcgtacacca tgaccggacg caatcaacat actgactgga ctcctgatac cagtcagctg     69900
     cgccatttca acggctacgg tggattttct caggatggcc gggagtatca aattgtcctg     69960
     aaggaaaatg cgcccactcc ggcgccctgg tccaacgtgc tggcaaatcg ctgtattggc     70020
     agcgtgatct ctgaagcggg gcaggcctat agctggtatg agaatgccca cgaatatcgc     70080
     ttaacgccct gggaaaacga tccggtgagc gaccgtagtg gtgaagcctt ttatttgcgc     70140
     gatgaagaga gcggcgcgtt ctggtccccc actcccttac cagtacgcgg gaagggggat     70200
     tatctggccc gtcatggttt cggctacagc gtgtttgcgc atcgtgagag tggtatagac     70260
     actgagctga cggtgttggt cgccgaaaaa gatccggtga aaattgccat cctgacgctc     70320
     agtaacaact cgggccgcac gcgtaaatta tccgtcacgg gttatgtgga gtggacgctc     70380
     ggggaatcac gaacccgtac cgcccctcac attgtgacgc attctgccag cataccgggt     70440
     ggttgcagcg tgatggcaaa caacttttac ggcgcaaacg gtggcgggcg aactgccttt     70500
     tttgccgtca gtggcattca ctgctcgcta accggtgatc gccgtgagtt tattgggcgt     70560
     aatggttccc tgcaaaaccc tacagccatg aaacagcaca gccttacggg gaaaacgggc     70620
     gccggtctcg atccatgcgg ggcgctacag tcgatggtca cattaattga tggtgaccag     70680
     agaacgttta tttttgttct gggagcggaa gaaaatcagg cccaggctca ggcgacgctt     70740
     gcccgttatt tgaatgaaga tgccgcgcat caggagctga atagggtgca cgattactgg     70800
     catagcgtgc ttgataaaat tgtggtaact acccctgatt ccacggttga tttactggtt     70860
     aatggctgga tgttgtacca gacaatggct tgtcggctta tggctcgcag cggttactac     70920
     cagtctggcg gcgcattcgg ttttcgcgat cagctacagg attcgctggc gctgagccac     70980
     gcagcaccgg aacggctgcg cgaacagatt gtgctatgcg cctcacggca atttattgag     71040
     ggggatgtgc agcactggtg gcatcctcct cacggtaacg gcgttcgcac tcgctgttcg     71100
     gatgattatc tctggctccc gctcgccgta tgccactacg tggagacaac gggtgacacc     71160
     gcagtattgg agcaaagtat tccttatctg gaaggccgcc tcctccagcc cggtgaagaa     71220
     tctgtctatg attctcccgt catcagcaac atcgaagaga cgttgtggct gcactgcgta     71280
     aaagcgattc aacatgggtt gcggtttgga cagcatgggc tgccacttat gggggcgggt     71340
     gactggaatg atggtatgaa ccaggtcggc attgaaggca gaggcgaaag cgtctggctg     71400
     gggttcttcc tgtacgatat tttacagcga ttcgctacgc tcgcagaaca gcagcaggac     71460
     gccagtgtcg cgttgatgtg tcgttctcag gcgctgcagt tgcaaaaaaa tcttgagacc     71520
     tccgcctggg atggcgaatg gtatcggcgg ggatattttg atgatggcac acctctggga     71580
     tctaaaggct cgcaggactg tcggattgat gccattgcgc aaagctggtc tgtgctgtcc     71640
     ggggccgcca gcccggatca cagcagacgg gccatgcagg ctctggataa gtatctcgtg     71700
     gatagcgatg cggggctcat caaactgctg tcccctccat tcgataacca cgggccaaac     71760
     ccgggttaca ttcagggcta tttaccgggc gtgcgagaaa atggtgggca gtatacgcat     71820
     ggtgccatct gggcagtgat ggcgtttgcc agaatgggca ataaagcgcg agcctggcaa     71880
     ctgtggtcaa tgataaatcc cataaaccac acactgaatg ctggcgaagt ggcaaaatat     71940
     aaagcggagc cgtatgtcat gagcgcggat gtctacagcg tggagccaca taccgggcgt     72000
     gcagggtgga gctggtatac cggttcagca ggttgggcat accgtctgct aaccgaggaa     72060
     cttctgggaa taaaacaata cggtacgtcc tttaccctac acgcccagtt tcccgatgaa     72120
     tggtcatctt tcggcttaac gtatcaacat ggctacagcc agtatcacat caccgtttct     72180
     cgtggcggca cggagtacaa ggtcttaatg gatggcgtca ttttaccgga cgacagaatt     72240
     cctctgcttg atgacggtca aaaccataca gttgatatca ttcagaagtg aaaaagctaa     72300
     aaatgcgcat taacgtcttc cgttaatgcg ctgattatct ctgagaacgt caatagccgt     72360
     ctgcatcgcg attttatcat cccttcgttt ttgcttttct tgcatcacct gaaggtactc     72420
     aagcagcgta cgggtgttaa ttggcctgcc ctgtttagcc acttccagta cggcgttacc     72480
     aaggatgatt ttcacaggag acagctgtgc cggataccag tcaagggtgt cttctgattt     72540
     catcataaaa ttctcactga agggtatttt atcacctgtt cccgctttgc tttccggggt     72600
     tgaatttatc gtgcataaat aaccacatgg aacataagca aagtattact caattaaggc     72660
     gtataatgaa tagtagaaca tttatatctt gcacaaactg actcaggaat ttcgaggtca     72720
     gattcatgca tacgacgtca ctactgcacg agctaaaatt cggtgcatga aggtactcac     72780
     accgaaaaag aaacagagta atgataatgt actgatttct tttatgctat aaaggtaata     72840
     ctgatgaaag ctaataaaat tttttttatt gaaggcaaga tcatagaaaa taggctgtta     72900
     ggagaaccaa acaagatttt ttgtatccac agagttatgt ttaacaatgg gaaatatgca     72960
     atagttcgcg cggcatccgg gatatgtttc gcccccggag agataattca acgaaacgat     73020
     ggtgaatggt tttataagca gagtaagaca cccctgctct cttttgaata tatggaagaa     73080
     aatgaatcat gtaggcagtt aatagaatat tattagtgca attaggattt ttcttatcat     73140
     gttcagtgtg aatatcatca gaaaaaatcc tcacacttag gtgagaaagt ttgagggcca     73200
     ggattgatct ggaaatctgc tttttaagcg gtgcatcctg taaaaaacac agacagaaca     73260
     gtcggcgcat gacatccagg tatgaaaaag caaattgacg cacttgttat gcgcaacggt     73320
     ggtagccgcg atggttttca tcattaagac catacttttt tcaacgtaat accgctccac     73380
     agctgggtat aggcaacgct ctcgaatgag aagagctgca tgctttcttt tcctctactt     73440
     accttcgtcg gcattttgtg agacaagctt agattataat gttctgaata aaaaataacg     73500
     cgattattca agcgaaacga caaaccgcca aaaaataaaa ttcgcgtgat gatttaaatg     73560
     tcttttttaa aaatttaact tcccgacatg atgaaataac ggtttcgctt tcataatccc     73620
     cattcatcat ttagatataa aacatcaata atagttgttt aatcttatta gtgtgctagt     73680
     tttaaaatgt accaagcagg cctcgcagtg tttatttcat tggcaccgtt aggctccgga     73740
     aaaaacattt ggagaacaga caccatgtca aaatttcgtg aaaattcgat ccgactttta     73800
     gaaactcgtg aaaagtcatc cgaagcaggt agaaaagacg ggcaacgcag cggagaaaaa     73860
     gacaaaaatg agcgtgagag cggaacgaaa aatacaggta aaggcagttc caaaaaatag     73920
     aacattcctt accctacccc ttactattct cacctgaatt tttagataaa aaatatttat     73980
     gaccacaaaa ggtttttata atctaaaatt tcatagtgac ggtgcatacc ttaacgcatc     74040
     ttcgttttta tcccttaaca acgttgattt ttaagcgcga aatggattta tttgcatcgt     74100
     tacgcttttc tttctcaaaa taatggcagc aaaaaactgc ctctcaaatt cttatcggag     74160
     cgataatgaa catttcaaca cttgaagatc tcttctctca tgatctgtcc gatgtctata     74220
     gtgcggaaaa gcaaatcctt cgggccttgc ctaaaatgtc acgagcggct tcggacccac     74280
     aattaatttc tgcttttgaa caacaccttg aagaaacgcg tggacaaatt gagcgcctcg     74340
     atcgactggc agaaatgaca gactttgttt ctatcactgg catgacatgc cacgcgcttg     74400
     agggtctggc tgaagaagca caggaaatta tggattctgt tgatgctggg cctgtcaggg     74460
     atgcggggct tatcggtgca gcgcagaaag tggagcacta tgagatagcc gcttatggaa     74520
     cactgcatgc tctcgcctta aagcttggat taaacgaggc cgcagaattg cttgctgaga     74580
     cccttcagga agaaaaagag acggataaaa agctaaccgc gattgcggga ctgcaagcct     74640
     gaattctcct tgagattcac agcgtaatat tatgaatctc tttgaagacc aaacatttta     74700
     gatattgaag acttcttaga aaagttttta cttaatttcg tttgatgtat ttcttgcata     74760
     tcccattaag cccttacgtt gccttgataa agtgaatcat tgcgcagcag gaattatatg     74820
     gcctgtctgc gcgtaattat ctttataaaa caacatatca cttaagccag tttaccgtat     74880
     aacaagcttg agattttgtc tctttacatt atgttgtgat tattgaatcc ataaaaggcc     74940
     gctagcgcga cctgatgatt atgggatgcc tagagaaggt ttattttaat ctgataacct     75000
     tcaagaccgg ccatcgtttc ctttgggata aattcaattg aggaaagttc ttttcctgtc     75060
     ttttttcgta actccactgt ttttttcaca atgagcgctg caatttcctc ttcggctttt     75120
     cttacaagtt catcattatc catcatttta ctcctttaga acatttggct ttcttgcaaa     75180
     gcaaggtgaa tatatagaac aaaaatgata actccctata aattatagac tatcgttttg     75240
     aataccgcct tgtagcgaac cagtggagta gtttgccaac tttgagcaag cttatgattc     75300
     tatctggggc agcctaagaa acggaaaata ccctacgcta agaatgtttt tttaacaaga     75360
     cgaagttaac agagggcttt gagcgaaaag tggacttaat ggcttagagt taagactgtc     75420
     atgtcacaat aaggatatta cgaatttcaa attatcctga gctacagaag acaggtccga     75480
     agtaaaaaaa atcacaataa tatacgacca gcgaagtaag cctttcctgt taccacagca     75540
     gctttcaacg tcgccataaa aatcgggaaa aaaatgagta caggataaat ttctaaacgc     75600
     ccaattatca ttgcagcgca catcagatac tttgcgccat ccttcagggt atcaaaggtg     75660
     gatgccgttt aaccaaaacc cagccccatg ttattgatac atgctaccac cgtagcaaaa     75720
     gctgtcatca gatcatatcc cataatgttt aacacacaga taaaaaagac agtgaaaagc     75780
     atgtaaagga aaaagaaact ctatactgag agtaggacgc actcagtcac aatgcttcct     75840
     cccacctaaa tgctcagcaa cgcgcgcaga tgcgccagct gatgcatttc atgtctgcgt     75900
     accagacctg ccaggcggta attaatacca caatcaatga tatccataat gtcgtggctg     75960
     acctctctga ttcagctgtc acgatatgac aaatatatca atccagtgat ctggtatata     76020
     ctaggtaact cgttcaaatc ttatttttct ttgttaaaaa catcgctcaa gaagaatatg     76080
     tctgtttttc atctgctcac tgtatcgcca cggataatct aaacatttac ctaacattgt     76140
     agacgaacta taatatgcac ttgaccagat cagaaagaaa atgacacaat taattaatat     76200
     ttaaaaaata taagcacact gttctttatg gtaatgctat tttccttagg aaaaaactgg     76260
     ctcaaaaatg aattacctgt gaataatgaa cagtgattta cattttgggc atagcaacgc     76320
     ctgttcctgt cgtacctttg ttgtcggatg tttagagtta tggccgcata tcggacaggt     76380
     cactgtggtt ttggtcgcag cttcaacacg tttaagtgcg taatcaaaga atgacatagt     76440
     cttaaccttt ataagagtaa ggcttatcat atcacagctg attatttttc aatcagaaag     76500
     acggtgagct cagcacttaa tcgctcagtt aaaaaattgc atgggattat tactctcttt     76560
     atggcgcgcg tgaaaaagcg aataaaatgg tttgtcttat ctccttttag ggggggatcc     76620
     ccataaagtg ggagccattt tcagacccat tcgcctatga gctttttctg agctgccatt     76680
     accatttctc caacccgccg aaaattcaga cgattagacc gcatatgata attcatcgcg     76740
     aaagcttcta ttaaaactct caataaatct gttctgtgtc ggcatgccgg gctggataag     76800
     tctcagctcc acgccatgct cagaagtcca ttgatcgagc gcgcatcggc ccctactaag     76860
     ttcttatcgt agccggatag ccgcgaaaaa gcgcaatgct gtccagaata cgcgtgacct     76920
     gcacgtctga cattccttcg tgaagtcatc cacgcaggta aagtacttga acatgcggcc     76980
     ggtggctagt gcgtccatga cgaaatccat taacgaggtc agactgggtg ccgccggacg     77040
     gagcagcggc agacgttctg tttctagcct ttcacgtcgc agtaactacc agatgccacg     77100
     gtagccaaat tctctgcact caagtactcc tgtgccagtt tagtgatgcg atgtgcacaa     77160
     tgtgcataag caactgtatt ctgagtgtca tcgctgcagg tcgacaggga cacctcaagt     77220
     gcctccttat caagaattac ttcgacaagc tgtttcttaa gccaggtgta agacgtggca     77280
     tctgaaatgg agtgcttgcg caatagttca caggtagaac actcggcttc agtccgcgga     77340
     gaatgctcat gatctgttgg tcggaaataa gcctcttcat gggtatgtct tcatgtggct     77400
     tatgaagaca ttactaacat aggggggtgt agtttagtaa ctattagata gttttgaaaa     77460
     acagcggtta acattgagta ttacgataaa tagtgggtca tatcatgttc acttatgcca     77520
     aactgaaagt gagactaacc agtggcacaa tgtatgtaaa atcacgaatg ttcatacccc     77580
     ttataaccaa aaagttatca acatatacat gactagatcc aataagcgat ccttaaacga     77640
     tccttaatgg atccatatag ttccaaacag atccccgatc tctacaagcc acgccaatta     77700
     aggcctacag cgaattctgg tgtgtcacat catgaagaaa gtgtgtcata gcatgttttt     77760
     agtgtgtcac actatgttca aagtgggtga caacatgtaa gaggtgtgtc ataacatgtt     77820
     ttgtggtgtg tcgtagcatg tataattact aactattcac ctcttgtgga taaccctgaa     77880
     tggactcaac ataactggcg taactcaatg actgataaca attttatacc agctcagatt     77940
     actaatgaag gcgaaactca tcaattaacc gtcacaagca attcatctgt ccagccggct     78000
     attttgttgc gtcttggggt ctttgttcct gctagtagag caatacctaa agggctgaag     78060
     tcaggtatag atgtatcatc ctcattctca cagttggagt ttgctcgtaa ggaaggttac     78120
     gacgaagtca ggatctttgg agaaaggcta aacatatcaa cagattttag tgtctggatg     78180
     ggtattatcg gcgcttttag caaatacggt ttgaaatcaa atacgataga actgcctttt     78240
     actgagtttg ctgcgttgtg ccagtacgat tcgcgtcagt ttaacaaacg tttgagagac     78300
     acgatctttg atgcactgac ccgcatcggt actaaaacgg ttcagtttaa tagcaagaaa     78360
     acaggcgaca agttcttcac tcaacttctc aaaagtggca agtacacaaa agatactgac     78420
     accatcacac ttcaagctga tgagcgactg cacgaactct atcaaattga ctataacatc     78480
     ctgttgcgta agcgtcctta tcatatgctg aaaggcaagg aagtcgctca aaccctttat     78540
     acctacattg cgagcctgcc cgataaccct gccccgatca gatttgatcg catcattgaa     78600
     cgacttaact taacttctcc agttaaagaa caaaaccggc tcattaaggc ggctttgaag     78660
     caattgcatg acattggcta tatcgaatat agcattgtga aagatggccg gactttgacc     78720
     gtgttaattc acaaacgcaa taagaaactt aaggaattac aaccttaaaa ggtgggtcgt     78780
     attatgctta cgatccagca atagtgggtc gtagcatgtg gtgaggtgtg ctacaacatg     78840
     atgtcttcac tcagtaactt tctgcacctt aattcttggt tgatttctaa ccatcttaag     78900
     tcatacagca tgttgcgaca cactttttgc atgtctctac acaccttctg cataatgata     78960
     cccacctttt aaatctctgc gaaagaccca tttgtttatc atgatgccac acactttttg     79020
     cattatacca cccacttttg aatcgttggc ttgcagggtt tctaccttca atcgaactgt     79080
     catatcctca catcgtttat aacttgcttc ggtaacagct catataactt ggtttatgta     79140
     gggaatattg ggtttaattt catcattttt gtttggttac tgttcatttt gaatgcattt     79200
     tttgaccaac tttgcagttt ttaacatggt ttgcattttt aatgttgctt tgcttctttt     79260
     atcaagattt aattgattga tgcaaagttc attttaagga acataatatg ggattaatga     79320
     atacccttga tcagtgcatt gctgctggcc atgaaatgac aaaagccatt gctgtagctc     79380
     agtttaatga tgatagccct gaggcgagga aaattacgcg tcgctggcgt gtcggtgagg     79440
     cggctgatct aattggtgtg tcatcacaag caattaggga cgcagaaaaa gcaggccgtc     79500
     tcccccaccc cgacatggaa atgcgtgggc gggttgaaca gagagtgggt tatacaatcg     79560
     agcaaataaa ccatatgcga gatgttttcg gtacacgact tcgcagacca aatgagagtg     79620
     ttcctcctgt catcggtgta gcagcgcata aaggtggagt ttacaaaacc tcagtgtcag     79680
     tacatctggc acaagacctt gctttgaaag ggcttcgtgt ccttcttgtc gaaggcaatg     79740
     acccgcaagg aacggcatct atgtatcatg gatgggttcc agatttgcat attcacgcta     79800
     atgatacatt acttccattc taccttggtg aaagggatga tgcttcctac gcaataaaac     79860
     caacttgctg gccagggttg gatataattc cttcctgtct tgcattacat cgtatcgaaa     79920
     cggaacttat ggggcgctat gacgagggaa aattacctac agaacctcac atgatgcttc     79980
     gcctcgcaat cgagactgtt gcccaggact acgatgttat cgttatagat agtgccccta     80040
     atcttggtat aggaaccatt aacgttgttt gtgcggcaga tgtattaatc atccctaccc     80100
     ctgcagagct gtttgactat acttcggcac ttcaattttt tgacatgctg cgcgaccttt     80160
     tgaagaacgt cgatttacag ggttttgaac cagatgtcag aatactattg acgaaatata     80220
     gtaataacaa tggttctcag tctccatgga tggaagagca aatccgtgat gcatggggga     80280
     gtatggtttt gaaaaatgtt gttcgcgaaa ctgacgaagt cggaaagggt cagattcgaa     80340
     tgcgtaccgt ttttgaacag gcaattgatc agcgctcatc tacaggtgca tggcgaaatg     80400
     cgctcgcgat ttgggagcca gtttgcaacg aaatatttga tcgactgatt aaacctcgtt     80460
     gggagattcg ttaatgaaac gtgcgccaat tattccaaag tcttcccctg caatcactcc     80520
     tgctgctacc actgcagcac ctgctgcgcc aatggttgat tcattgattg ctcgagttgg     80580
     tgccatggca aaaggaaata cgatcaccct tcccatttgc ggtcgtgatg taaaatttgt     80640
     tcttgaaacc atcccgggaa aattggttga aaaggcaacg aaggtttggg ctggaaatga     80700
     gcgtcttcag gatttgttaa acgaggattc tttggatgac ctgatacctt cattcctgtt     80760
     aacgggacaa cagcatcctg catttggtcg taaaattatt gatggtattg aaatagcgga     80820
     tggtagccgt cgacgtatga ccgccatact gacctctagc gaatatcgaa ttcttgtcgg     80880
     tgatcttgat gatgagcaaa tggattcgct atgtaagcta ggtaatgatt atcgacctac     80940
     gagtgcttat gaaagaggaa accgttacac gttccgtctt aagaatgaat ttaacgggaa     81000
     tatttctgct ttagcggatg ctgaaaatat ttctcgtaaa atcatcactc ggtgcatcaa     81060
     tacagctaaa cttccacgtg atttgatagc cctcttctct catcctggtg agttatctgc     81120
     acgaatgggt gataatttga atcgtctttt cagtgatgat gaagccttat taatttccac     81180
     aactgatgag cttttaaaga agcggcaaag tgggattgtg tatgaaacag aagaaattat     81240
     tgaggcatta actcgatccc ttaaagcttc taaaggcagt gcatctgtag cgcctgttaa     81300
     aagagaattt gttccgggcg caatggctca atacaaaggt aataaagtag tatttacgct     81360
     tgatcgcacc aaaatctcta aagattgtat tgagcaaatg gagaatatac ttgagaaatt     81420
     agaaaaactt gggtctcgtt aacttcatat attttctgat gtatccttct cattatcact     81480
     gatccacggt cctaatccta catctgggac cgtggtccca accctgcatc tgggaccgtg     81540
     gtcccaaccc tacatctggg accgtggtcc caaccctaca tctgggaccg tggtcccaac     81600
     cctacatctg ggaccgtggt cccaacccta catctgggac cgtggtccca accctacatc     81660
     tgggaccgtg gtcccaaccc tacatctggg accgtggtcc caaccctaca tctgggaccg     81720
     tggtcccaac cctacatctg ggaccgtggt cccaacccta catctgggac cgtggtccca     81780
     accctacatc tgggaccgtg gtcccaaccc tgcatctggg accgtggtcc caaccctgca     81840
     tctgggaccg tggtcccaac cctgcatctg ggaccgtggt cccaaccctg catctgggac     81900
     cgtggtccca accctgcatc tgggaccgtg gtcccaaccc tgcatctggg accgtggtcc     81960
     caaccctgca tctgggaccg tggtcccaac cctgcatctg ggaccgtggt cccaaccctg     82020
     catctgggac cgtggtccca accctgcatc tgggaccgtg gtcccaaccc tgcatctggg     82080
     accgtggtcc caaccctgca tctgggaccg tggtcccaac cctgcatctg ggaccgtggt     82140
     cccaaccctg catctgggac cgtggtccca accctgcatc tgggaccgtg gtcccaaccc     82200
     tgcatctggg accatggtcc caacactaca tctgtattac ttgtcaaatt tatgatttat     82260
     gcgtacgagc aaaatgttaa atattactct tggcgcttcc tcgcttactc gcgggctttg     82320
     cccggtcgtg cggctgcggc gagcactatc agcttgtgaa aggttcgatc atttgcgagg     82380
     taaataacct gtgctaaggg taaatatttg acaacatcta acgatcaacg gccttcgttt     82440
     ctgagtaaga ttactatcgg ataaaagctt tcaaatacct cattgtttga ggcattgaat     82500
     tacttcagta attgcccctg ttggtatata gaggcgttcc atctaagctc ggtaacactg     82560
     ccatgccgta atcagttttg aactcatatt cctacggctt cgctttagca gtgattttct     82620
     tttgaaataa tttttaccga ttagccacta catgtttgag tctgtaattt tgctatgttc     82680
     tgtatcactg tgcgtaaatg ttaaatggtt tattcttagc tcatatttca cgaagggatg     82740
     tgaactgtta aacaggaaaa gcagaatgaa actcgtctgg aaagagaccc caagaggacg     82800
     cattgagcga tatttaagta ttactgaaaa ggaatcggta ctgcatgtgt tcagtcattc     82860
     cagaaaacct tctcaggcgg acttgcggat cacaaatgtc attcttgaag agatggacag     82920
     aaaggaatta tggatagaat gcgattgtgt cgagcgtgag caggatatga aggggcccta     82980
     caactgtgaa gtaaaaagag catatcttag acacgtcaag acatccatgc gacatgatga     83040
     gacgtgtccg ttgtatcgta tgaaaaaaga aagggatgca gactccaagt caaatgaagg     83100
     gaaaacaagc cctctcaatc caatcggtgg agatgactgg ttacctgacc gaaaagagaa     83160
     agctagagcc aaacagagta aggaactgcc gcacccgcgc aaaaaaagac gaaagacact     83220
     caaaccagtc ccagcattgg gtagaaaatt gctgactctc attcaggctg ctgggttaaa     83280
     ccaaatcgaa ctgggtactc attacaagcc tcctggactg gctactgcag tgcagttcgt     83340
     caaggacgta cttaataccc atactatgag aaatggcact attctcgcgg acctgatctc     83400
     atgctcgcca tgggtggcta tagaaaagat tgaagagatg cttaaaaagc tggaagtcaa     83460
     cggcggtatt aacagccttg ataaggaatt atgtgtatat gttgtcggcc tggcggcaga     83520
     ggtttcaaga gagagcgtga cctttagtgt aagagggaag gcatttacac acagtcccga     83580
     gacacgagta accataaatg gtgaaaacta tcttaacgcc ggaagtaggg ggccatattg     83640
     gactattctc gaataccggc gagatggaaa aggtattgtg tattgccacg acgcatatgc     83700
     acatgccgct tttactctgg acaatccagt ccccgtagat agcaaccttg agaaatccac     83760
     tcttaagaca atcatcaatg cctgcgagtt tgcatcccgc caaacaaatc gccctgaatc     83820
     acttagtctc agcaagccac tatttacgtt gagaacgttt gaggacggag ttgaggaagt     83880
     tattcaccca gattttattt tgaacgttgc accggtaaac cagaaaactg ttacgacgct     83940
     gattattgaa acgatggggt atgacttagc tgattacatt gagagaaaat ctgaaacgca     84000
     taacctgatg cgtcaggaag gtacactcct tactgatcct cctgactggc ccgaaccatc     84060
     aaaaacaacg tttaacagtg ttttgctgaa gcatatcttt agggcggcga aataactgta     84120
     tgcaaaaaga aaacagcaat gttgactaaa atatatgagt tttaccttct tgacgtataa     84180
     agtgaacagg caatgaaagt agtgacattt tgaatggact cggccttatc agaagcccaa     84240
     gtgtaaagaa caactgaatc gccactggtt taatcgacac cttaaggtta cgttaccggc     84300
     aattaacgca taaaaagtaa aatcaaacgc aactggtatt ttcatttgtc agattttgcc     84360
     ctgattgacc cgctctgaca gtgcctggtg actttctttt cgttcgctgt agcgatcggc     84420
     aaggtaacca ttttggccct tgagcagcag tgtcatttta aacagttcct cagcgacatc     84480
     gacgatacga tcataccagg aagggggctt catccgtccg ttctcatcga attcctgcca     84540
     tgctttcgcc actgaggact ggttggggat agtgaacatc cgcatccacc gactcagaat     84600
     acgcatctgg ttcacggcat taaaagactg cgaaccgccg caaacctgca ctgcaagtgt     84660
     cttgccctgc gaaggaagta ccgcgccttc acttaaggct atccagtcga tctgcgcctt     84720
     cataaccgcg ctcatagccc cgtgccgttc cggggaactc cacaccatcc cgtcacacaa     84780
     tctgaccaga ccgcgcagct cgttgacttt agggtgcgta tccggggcat catccggcag     84840
     aggcagtcca gaggggttaa agaatttcac ctccgcgccc atcgccgtca gcaggcgacc     84900
     tgcttcctcc gcgacaaaac ggctgtagga gcgctctctt actgagccat acaggatctg     84960
     gattcgtggc ggctcctgca ggtgcaggcg ttctgcgatg tgttgatcaa aacattcagt     85020
     attcaggaca ggaaattgtt ccatttttct cctccggaga acaggttatt tcaaagtcta     85080
     taaatatgat ttaccatatg tgtattctaa atggaacgga gtgaaaaatg ctacatcctg     85140
     ttcagctttt caaaatcctg tctgatgaaa cacggctcgc catcgtcatg attctgcggg     85200
     agtcaggaga aatgtgcgtg tgcgatatct gtacagccac ctccgaatcg cagcccaaaa     85260
     tctcacgaca tatggctatc cttcgtgaag ctgagctggt tattgaccgt cgggaaggca     85320
     aatggatcca ctaccgtctg tcaccccaca taccggcgtg ggcagctgag ataatcgcaa     85380
     cgtcctggca gtgtctgcga gaggatgtgc gtgaatggct gcaaaaagca gcctgcacct     85440
     cctgctgaga caggtaaaca catttactta atcatatgtg atggagtctg gaatgctttt     85500
     agcagggagt atatttttac tgacgctggt actggtgatc tggcaaccca gaggcctgag     85560
     tattggctgg agcgcgagta tcggggctgt gctggctctg ggaactggtg tcatccatat     85620
     cgctgatatt cccgttgtct ggaatatcgt ctggaacgcg acagcggcat ttattgcggt     85680
     catcatcatc agcctgctgc ttgatgagtc cggcttcttt gaatgggccg cactgcacgt     85740
     ttcccgctgg ggtaacggac gtggccgcct tctgtttacc tggatagtgt tgctcggtgc     85800
     cgctgttgct gcgttgtttg ccaatgacgg cgccgcgctg attctgacac cgattgtgat     85860
     tgcgatgctg ctcgctctgg ggttcagcca gggaacgaca ctggcctttg tcatggcggc     85920
     aggatttatt gcggatacgg ccagcctgcc gctcattgtt tctaacctgg tgaatattgt     85980
     ctcagcagat ttcttcggac tgggctttac gcagtacgcc tccgttatgg tgcccgtgga     86040
     cgtggcagct attgcggcta cgctggccat gctgcatatc ttcttccgca gggatattcc     86100
     ggccacgtat gacgtttcgc tgctgaagac gcctgccagt gcgataaagg atccggcgac     86160
     cttcagggcg ggctggattg tcctgttatt actgcttgtc ggtttctttg ttctggagcc     86220
     cctggggatc ccggtcagcg cgatagcagc agctggcgca gctgtgcttt tcgtggtagc     86280
     gaaaagaggt catgccatca acaccgggaa agtcctgcgc ggtgcgccat ggcagatcgt     86340
     tattttctcg ctgggtatgt acctggtggt ctatggcctg cgcaatgctg gccttacaga     86400
     gtacctgtca ggcgtgctga gcctgctggc agacaaaggg ttatgggcag cgacgttcgg     86460
     taccggcttc ctgacggcat ttctctcatc agtgatgaac aatatgccga ccgtgctgat     86520
     tggtgcgttg tcgattgacg ggagtacggc gactggcgtc gtcaaagagg caatggttta     86580
     tgccaatgtg attggctgcg atttaggccc gaaaatcacc ccgattggca gtctggctac     86640
     cctgctgtgg ctgcatgtgc tttcccagaa aaatatgacg atcacatggg gatattactt     86700
     ccgtaccggc attgttatga ctgtacctgt gctgtttgtc actctggccg cgctggcgtg     86760
     gcggctctct gtcactttgt aatgagatac tgatatgagc aacattacca tctatcacaa     86820
     cccggcctgt ggtacttcac gcaacacact ggagatgatc cgcaacagcg gcaatgaacc     86880
     gacgataatt tattatctcg atacgccccc gacccgtgat gagctgatta aacttatttc     86940
     agatatggga attacggttc gtggattgct gcgtaagaat gttgagcctt atgaacaact     87000
     gggacttgca gaagacaagt ttaccgatgg gcaactgcta gaatttatgc tgcaacatcc     87060
     agtcttgatt aacaggccaa ttgttgtaac gcctgcagga acccgcctgt gtaggccttc     87120
     agaggtggtt ctggaaatta ttccggaacc tcaacagggt gccttcacga aagaagatgg     87180
     cgaaaaggtt attgatgaaa cagggaagcg ggtgaactag taagcaacga aatgaataat     87240
     tcgattgtgg aacacgttat ttagctttaa caggaaacaa ataagagccc atgtatttca     87300
     tggactcttt cttagatgcc tcgctattct gtccaacttt ttggggtcag tacaacacta     87360
     ggccatctgc ttgactagac accatcagaa tagcctctta gccgccgcac ggcaaggaga     87420
     agaaggctat gaaactgcca cgaagttccc ttatctggtg cgtattaata gtgtgtctca     87480
     cactgctgat attcacattc ctgacacgaa aatcgctctg cgaaattcgt tataaggacg     87540
     gagacaggga ggtggcggct ttcatggcct acgaatccgg taagtagcaa cctggaggcg     87600
     ggggaaaccc cgccttttca ggagctgatg atgtctggat ttgcctgaag cgcctttatg     87660
     aaggggctac cggttcgctg gtagcccctt tttccttccc ggcgcgaccg cacgcatgaa     87720
     caacctggaa ggtctgttcc tctccgggaa aagggggagg ggcggcaatg cttatcgtga     87780
     tgctggtatt ttgatgctac agctacagcg tttctcccgt atgctgcttg cgctgcctgc     87840
     cgggcattct tctggcaatg ctcctgaccg ggacaccgat gtgattcgtc gccctgctcg     87900
     gtgtgattgc actggcaggg atgattattc gcaatgccgt catactgata agtgagatag     87960
     acagcatata tctggcgcac cggcacagtt ctctgcatgt tgtcactgat ttgcttaaag     88020
     gggctctcac atttgctgag tctgctgtac aacacactat tactggccac gttaccaatg     88080
     ctggctttcc ccctcgcggc cgcagacagc gtttctggaa tgaagaatat ctgatgatga     88140
     cagagcagac agacgcgttt gcccgcgctt cgctggataa cttctccggg tatgggcaat     88200
     gcaccatgaa aagtaagtct ctggctgact gatacgaccc ctacaccctg agtaggtagt     88260
     cgatcattta gttgtcgtgc cgagatgtga acagcataat gtactgatgt tcatgaagag     88320
     gttgatgtta acgctgttcc ccccataaag ctttgcagaa atgaacaaat agtttgcctc     88380
     tcgttattac cctgcttatg cacgtttgct tcgttttttc tgtccccggt ggcgttttcc     88440
     tgctattccg gcgagccgtc tgaacgttgg acagtccata tgtgataagg cagggcaact     88500
     ggccacgtga agcagcgtgt cacgcagtgc tgtcaggtcg tttatttttt cgttcagctc     88560
     cagggctttc gcactacaga gggcacggga aatttcaggt tttccatctc tgctaaacat     88620
     ccccgcgatt tcatcaagcg aaaaatttgc cgccttaccc ataattatca ggtttagccg     88680
     caggagcacg tcaggggaat attgtcgccg caatccccga cgggcaactg gagaaatcag     88740
     acctgtttcc tcgtaatagc gaagggccga cgggctgact ccgcttacct tcgcaacttc     88800
     accaatatcc agaagtttca tgatgaaccc caacaattcc tacagagaaa agtccctgaa     88860
     tgaggatgaa tatccgtcat cagattactg aaaaactgac gttgacttca agctgacttg     88920
     aagtgctaag gttcacagga attgaccaaa ctccggaaca ataatgatga atattactga     88980
     taaaacagtg agtctacata aaacaggcat cactgttacg ctttctctgg cgatgctact     89040
     ggcttcgctg ggcaccagca ttgcaaatat tgccttaccg acactggtac aagcttttat     89100
     ggcaccgttt gatcaggttc aggcagttgt ggttgtctac cttgtcgcgc tgactctctc     89160
     agccgttatt gcaggcagtc tcggtgacag atttggactg aagcgggtgc tagtaatggg     89220
     gttgatgtta tttgctgtcg cttgtctgct ttgcgcggtc atgccagacc tgcgtctact     89280
     ggttggcgcg cgggcattac agggtgtcgg ggctgcattc ctgatgacac tgtcgatggc     89340
     tcttatgcgt caggtagcgg gcagtgcaga tattggaaga gcgatgggta tcttgggaac     89400
     cgtatcagca ttgggcacgg cgctgggacc gtccctcggc gggttattgc ttccactaac     89460
     aggctggcgc ggtgtctttt ggatccaggt tcctctggct gtgcttacca ttattttggc     89520
     tgtcacagca ttaccggacg aagcgatcaa atgtaagccc gcaggttctg gtttgaagac     89580
     cccgctgagc aggaaaatca taagcagcct gttcgtcaat atgctggttg ctgctgtgat     89640
     gatgaccacg ctggttgtcg gaccattttt cctcagttcg ggcttgggta tgaacagcgt     89700
     acacgtcggt ctcgtcatga ccatcggccc tgttatctcg attttcagtg gtatcccgtc     89760
     aggtcggctc gttgacagac tcggtagccg ccttatcgtg gcggctggaa tatccctcct     89820
     ggctgcaggt acctttctga tggcgggatt gccgcaaata atgggcgtac ccgggtacat     89880
     catttcactg gctgtgctca cgccgggcta tcagcttttc caggctgcca ataacacggc     89940
     agtattgtct gatgttcgtg atgatcggcg cggcacagtt tcaggcatgc tgagcttctc     90000
     acgtaacgta ggtctgattg ctggtgcttc tgcaatggga gctgtgtttg cacaccaggt     90060
     gggaacgcat gacttcactc tcgcttctgc ggaggctatc cgtgacggga tgcgtggtac     90120
     ttttctgctg gcgggcgtac tcatgttggt tgctgttgct gtggttttcc tcagtttatt     90180
     taaccgggat tcgtttgccc gcttaacccc ataatatcct gcgttaacct gtttctaatc     90240
     atttatgaca gtcagcttta agctgtgagt ccaacgggtc aatgcactcc cttgggggac     90300
     tacttgtcat gtgtatcgag caatacaata aatgtaataa catttgtgat ttgcacatgg     90360
     attgaataga ccctagtttc ctagactgtt ccgtgcctca tgaaccaggc actttcataa     90420
     actgcagggg gctgatcctc acatgaccag ctccccttta tttaacaaag gatgatgttg     90480
     gccacgtccg cccttggcac taagcggact gtgatcaacc ttctgacgtc ttgttttctg     90540
     gcttccttcg tgacttgccc taagcatgtt gtagtgcgat acttgtaatg acatttgtat     90600
     ttacaagagg tgtgagacat gggtagcatc aacctgcgta ttgacgatga acttaaagcg     90660
     cgttcttacg ctgcgctcga aaaaatgggt gtaactccct ctgaagcgct tcgcctcatg     90720
     cttgaatata ttgctgacaa tgaacgtttg ccgttcaaac agacactcct gagtgatgag     90780
     gatgctgagc tcgtggagat agtgaaagaa cgtcttcgca atcctaagcc agtacgtgtg     90840
     acgctggatg agctctgatg gcatattttc tggattttga cgagcgtgca ctaaaggaat     90900
     ggcgaaagct gggctcgacg gtacgtgaac agttgaaaaa gaagctggct gaagtgcttg     90960
     agtaaccgag aattgaagcg aacaagcttc ggggtatgca tgactgttac aaaattaagc     91020
     tccggtcttc aggctatcgt cttgtatatc aggtcataga cgagaaggtt gtcgtctttg     91080
     tgatttctgt tgggaaaaga gagcgctcgg aagtttatag cgaggcggtc aaacgcattc     91140
     tctgaaataa agcaggacat ctcagtttcg cagtaaaggt gccacttctg ctttgcgttg     91200
     acaggaagaa ggctatgaaa ctgctatgga tcattcaaga atcgaggctg ggggaaatat     91260
     aatccttgcg tttaacccgg gatattattt gttgcacctt ggtttttggg atacctatcc     91320
     tgatgacgaa tgtgattagc actaattttt acgacacttt tagaatgccg agcaattcag     91380
     gttgaagcga agcacaacgt ttagaacgct ttatcggtcc gccagactac gtattcagcg     91440
     ggcgtttact tgtttatctg aggaatatct tgagtaataa cacccctctt tatccgcaac     91500
     agctaacggt tcatcaggct atggaactgg cgaatgcaca ctggaatgcg ggtcaggcag     91560
     cacaggcaga gcagctttgt ttgcgtgttc ttcaggttgc cccttcgcag cccgatgctc     91620
     ttaatctttt aggcttgatg atgcatgcct acggcaagat ggatctggcc ctcgactaca     91680
     tacgtaaagc tgggcagtcg ccgggtgcac cggcgatagt gttcagcaat ctggccgagc     91740
     tttgccgcca aagggggtta ttacaggaag cagaacaagc cgcccggcga gcagtagaac     91800
     aagagccgca actggctttg gcatggaata accttggcat cattttgcag gaggcaggga     91860
     aatttaaggc cagccttgag tgcctgcaat acgtggcatc gctgcaacca gacaatgctg     91920
     aggtgcacaa caatctggcc aatacctgga agcgcctggg tgacttgcaa cgcgctcagg     91980
     aaagttacca gcgtgcgctg aatttacgac ctgattacgc agaggtctac agtaatctcg     92040
     cctcgctgtt aagtgagttg ggatgtattg atgaggctgc ggcttctgcc agacaggcaa     92100
     tagatatcaa cccgcaactg gctgatgcct acctgaatct ggcggatatt gaattgtcgc     92160
     gtatgcgcta cgcagaagca tcgcattggg ttaaagcact tctggagttt tcgccccgac     92220
     atgcgggggc gcttatcact cttgcccata tcatgatagc taatgagcat tatgaagagg     92280
     cggccttcga agcacgcaag gcgctggcca tcgccccgga cagggctaat gcgcatatga     92340
     tcctgggtaa agcattgcag gcgcttgggc agtatgaaga cgcagacaga gcttatagta     92400
     aggcagcggt attaccaggc acggttgctg aagaggccct gattgcgcgc gcggttttgc     92460
     tgatggaaac cggtgataag caagccgcta cggcggcgtt tgaacaggcc ttgaaacgtt     92520
     ttccagattc agcgcggatt gtcgctgcgc gttgtgacaa taagttctat cgtgccggcg     92580
     accctgacat tgatgtgatg gagagcgcat tggtcagcga gccaacgcct ccacttaatg     92640
     aaaaaatgat gctgcatttt tcgctgggca aagcctggct tgatgttagc gattccgaac     92700
     gcgcattttt tcatctgaat cagggcaacg ccctcaagcg tgcctctttt cattacgatg     92760
     ccgctcaaac ccgtgcgtgg gtgaacaaca ttgcggagat tttcacgcca gccttgatgg     92820
     cgcagttcaa caacgcgggc acggcttctg agcggtcggt ctttgtcgtc gggatgcctc     92880
     gctctggcac cactctggtt gagcagattc tggcctcaca tcccggtgtt tacggtgcag     92940
     gggagttgcg tgcactggat cgggctgtgg cacgcgcagg ccgattcccc gatgatgtac     93000
     cacgctggaa taatgctgac tttgctcgta ttgggacaga ctatctggag caggtgagtc     93060
     acctggcacc ggaggcattg cgcgtgatcg acaagctgcc tgcgaacttc ttttatgccg     93120
     gactgattcc acttcttctg cctggcgcgc gcatcatcca ttgccgccgt aaccctgttg     93180
     atacgtgctt atcctgttac agcaagctgt ttgctggcga acagacattc gcttatcaac     93240
     tggatgagct gggtcagttc taccgtgatt atgaggcgtt gatggcccat tttcgccaga     93300
     tactgccagc tgacagcttc attgaagtcg actatgagac tgtggtcgac gatcttgaag     93360
     ggcaggcgcg gcgcctgatt gattttatcg ctcttccctg ggacgacgcc tgtctgacct     93420
     tccacgaaac tcgccgtatc gtgcgcacgg caagcgttgc ccaggtgcgt cagccgatct     93480
     atacctcctc taaaggacgc tggcaacaac atgctgcaca cctcggtccc ttgttaaaag     93540
     cactggggat ggagcagaaa tgaaccctga accgacagac aaccaaaccc ttttccagca     93600
     ggttgatgaa cttctgaaag ctgaacgctg ggcacaggcc gaagcggtgc tgagtcaagc     93660
     gctgtgctct ggttccgggc caataccttt gtggcgtcag ctctatgtag cgtaccgcca     93720
     gcagggaaat atcgctggag cgacccaggt actagagatg atcgtacagg ccacccctgg     93780
     cgacctgcat tcgcgcttcg acctggccga aatgctgtta ttgcagggag agttcacgcg     93840
     cggctggcgc gaatatcgct tccgttacag gcaggatcac acccgcatgt ttgagcgcca     93900
     tatccggcag ccacgctggg aagggcagtc aattataggg aagacgctgt tcatccacga     93960
     tgagcaaggt tacggtgata cctttcagtt tcttcgactg gtggagcagg cacaaatgcg     94020
     aagcggtgcc catgttgtgc tggaggtgaa cgaggaggct tataacctgg ctcatggcgt     94080
     caggggttat catcagctga tgaagcgagg aacgctgcca ccaccgtttg attttcactg     94140
     tgaactgatg agcctgccag ccgcactcgg cctacaactg tcggacctgc cggggcgagt     94200
     gccttatctc tttgccgatc ccgcgcgagt ggagaaatgg cgcgcccgtc tggctgatct     94260
     tccacgcccg ctagtgggat tggtgtgggc tggccgtccc acccatgcga atgacaagca     94320
     ccgttcgctg gcgctcgccg atctggcacc gctggcgcaa gagggtatga ccttcctcgc     94380
     gttgcagaaa ggaccagcgg cagagcaggc tgttacgccg cttgcgggca tgtcgctgct     94440
     gtcgctcagc gatgaaatcc acgattttga tgatactgcc gccatcctgc gagtgataga     94500
     cacgctggtc tcggtcgact cttctccggt tcatctggcc ggtgcgctcg gatgtccagc     94560
     ctgtgtgctg ctgcctttcc agcatgactg gcgctggtta caacaacgcg aggactctcc     94620
     ctggtatcct gaaatgcggc tgttccgcca gcttgcggca ggagaatgga aaaccccgtt     94680
     gcaaaacgtc gctatcgctt tgaaaaaatt aaaaaataag cctgagtgat acaggggata     94740
     gtaatatctc tgagcattct actgaagata gatattttac tgccgataac taaagattaa     94800
     gactaattac agtacattaa tattattcga tttgaggcag caaaccgcta acaccaacgc     94860
     atgactaatg ctataagtaa attcttatta aattatgtta atgcgggttg ctaaatgtca     94920
     aaaaatatta caaatccaac tgcgatagac agacggaagg tgctgggcct ttcaataggg     94980
     tcagcaattg cgttgctgtc gtccgcagaa gtttattcag catgtatcgc tcttggtaat     95040
     accgctacag tgactggaac cactggctgc gttacctggt ctggaggaaa tcttacactg     95100
     accaatgctg gaacactcat ttcaacaggt gcggcgcccg taacggcgac atctgcagcg     95160
     ggaacattac tcaataacgg attgctaagt ggcacatctg ccgctggcgt cgagaacacg     95220
     gctaatgctc ttattgttca gaataacagt acgatcatca gtaacaccat cgggcttaac     95280
     aataacggaa cgattgtatc gctgaacaac aatgccggag gaacgatttc cggttcagtt     95340
     gcgggtgtta agaataacag tttcatcatg tcgctcagta ataacaatat catctccggt     95400
     ggtctgggca tcaacaatgg tggcactttg ggctctctcg ctaacagtgg aaccctcacc     95460
     ggaacgacga caggagttta taactcgggt ctcatcacaa acttatccaa cagtggctct     95520
     ctctccggca ccagttatgg catccagtct gataatggca gtcagatcct ctctttgcaa     95580
     aataccagca cgggcattat tgaaggtggg acgggcgtgt tggtcggcaa tctaaccccc     95640
     tctggcacga tcaacgtcaa cacgttaacc aatgctggcc agatttcggg aacgactaac     95700
     gtcggggtcg gcaccagcag caacggcact atcgggagct taaataatac gggtaccctc     95760
     gttggtagtc tgggtggtgt gggcaatgcc ggcaccatcg gttctctggt caacagtggt     95820
     accatctcca gcagcggtta tgccgtttat aacgccggat ccggtacctt tggcccgatc     95880
     accaacagcg gcatgattgc tggtaccatt tacaatggtg ccacccgcag catgaccatt     95940
     aacggcagca acgatgcgac cttcggtacc ctgacgggag ccagtggcgg aaccggtagt     96000
     gcggatatcg gaatgctcta cagtaccagc gcagacctgt tttttgcgtc cggtaatctg     96060
     ctgcttaatg acaatattca ggccggcagc aaaacggtga ataacacagg cgcgacctta     96120
     caggtcaata acatcctcag catcaccggc aactacgtgc agagggcatc tgcagccttg     96180
     gtagtcggtg ttggcgatgt cgcagtgagc aacggcgtct cagccgatac cggctatgga     96240
     cgtctgattg tcagtggtgc tgccaccatc gacaatggtt caacggtggc actcaagtca     96300
     ctcaatacct accgctttgc tccgggccag cgttatgtgg ttattaccgc cgcccaaaat     96360
     ggcaccaatt acaatgccaa cagcttaaat tacctgactt ccgcctatga gggtgtgaca     96420
     agcggatctg tggttgacag tggcaacacg agcagtctgg tggtttctct gggtgcaaaa     96480
     gcgacagatt cgggtacagg tacgcctgga gtgccgacaa atccgggtac aggtacgcct     96540
     ggagtgccga caaatccggg tacaggtacg cctggaggag gggagactcc agtcacgccg     96600
     ggctttgcaa ctacgggcaa tgcgatatct tctctgagcg gattgaagca gtacaccggg     96660
     attgctccag gactgcttga tctctataac gcctcactgg ccattgattc tactcgtgac     96720
     gcgaacaaag taggtgaaca gctctctccc gtacagaaca gcagcgccag caatgtagcc     96780
     tcagtggcga catttgacgc cgtcggtgtg gtcggtcagc gagttgattc agtgcgtctg     96840
     gcgcatacac aaggtatgag cggggtggca accggtgatg atcctaccga ctgggctgca     96900
     tgggggcagg tatttggcgg ccatgctaac cagggtatgg tagatagtgt cagtgggtat     96960
     aaagcgaact acagcgggct ggtactgggt gttgaccggg ctatgggaga tgcatggcgg     97020
     gtcggtggtg cactgactta cagttacacc tcggtccatg gcgaagacaa tctttccggt     97080
     aataagacgg gagttgattc ttacggtctg attggctatg ccagttatac cggtgaccca     97140
     tggtacgtga acctgtctgc cagcgtcact cagcaacgct acgacacttc acgtaaagtt     97200
     aatatgacgg gttattccga ttcggcttgg ggcaaattta acggtcagca gtacgtgacc     97260
     aaggcagaat tcggttatcc gctggccgtg gcggatacca ccacgctgac gcctttggct     97320
     aacctgagtt acagttatca gacacttgat agctataaag aaagcagcgg aaatggttct     97380
     gctctttcgg tggaaagtag ccacaataac gcgttccgta gtggattggg cgcgaaactg     97440
     gagaaatcat tccagaccgg tattggcgac attgtaccgt atgttcaggc agtgtggacg     97500
     catcagtatg actccaagca gagcaccacg aatgctagct atgctgctga tactattgga     97560
     gaaacaagct tcacaacctt cggtgcgtcg cccgttgaag acactgctga tctctccttg     97620
     ggtaccaccg ttctaaattc agatacgctc agtgtgaccg cgcgttatac cgcgcagttc     97680
     ggtgaacagt atcaggggca gacagtcagt ctgcaggtac gtaagctgtt ttgatacaac     97740
     caaatataac ccagctcctg aaaggccgca ggagctgggt ataatcgcac taatgataca     97800
     ttctcgaagc aagtggtgaa cctgcgtgac atgggtctat tcaagctcgc tcttgtgctg     97860
     cgctggaaaa tatagggatc acactttttg aagtgctgcg ccttatactt aactatattg     97920
     ccgacaatga acgtcttctt ttcaagaaaa tgctgctcaa cgataaagat gctgaactcg     97980
     gtgagatagt gaaagagcga atacgtaatc ctaagcctgt tcgtgtgatt ctggacgacc     98040
     tctgagggcg tattttctgg atttgtcgag tggacactga agggatgcca taaaccttac     98100
     gtgaccgtaa gagagcaact caaaaagaag ctggcagata tgctcaaatt tacgccagtc     98160
     tgaaagagat gtcctgcgaa tgggatggca tgagcggctg gctcgagacg gaaagcgatc     98220
     gactggctga gagtgttgat gagcatctta aggcgctcga ggagcagatt caggactggg     98280
     cgcagggacc ggacagtctg aacgacgact gaaaaatgat gaggatttat acagctttca     98340
     tacggttatt cctgggcaga tgtggcacgg caggatataa tggcgatggc gcttgaggct     98400
     ttttgcctca tgatgttcgg gtggtttgtt atcgtgttgt gaggcagaaa gaagaaagcc     98460
     ccgtaggaag ttaatttaca ttaaccaacc acacgaggct taatctacat gctagacaca     98520
     tctagattag ccgcttactg cgctttgcgc aaggagaaga aggctatgaa actgccacga     98580
     agttccctta tctggtgcgt attaatagtg tgtctcacac tgctgatatt cacctacctg     98640
     acacgaaaat cgctctgcga aattcgttat aaggacggag acagggaggt ggcggctttc     98700
     atggcctacg aatccggtaa gtagcaacct ggaggcgggg gaaaccccgc cttttcagga     98760
     gctgatgatg tctggatttg cctgaagcgc ctttatgaag gggctaccgg ttcgctggta     98820
     gccccttttt ccttcccggc gcgaccgcac gcatgaacaa cctggaaggg ctgttcccct     98880
     ccggggaacg ggggaaagac ggcagcgcct ccggcgcttc tgtctgtctc cctcctccgt     98940
     attcctcagt gcttcactcc ttcttctggc ggtgacaaaa gctcgatggc cagcagtatt     99000
     cccgtgtgag aaaaatctgt ctgctccatg actttccagt gaagccgttt gagctggtaa     99060
     gttaactgtg cgcggtttgt ttctgaaccg ttgctggcca gcatcaggca gcactgaccg     99120
     atgatccggc aggcttcgtc gtaaatcatg tcatcggtat cgtcttcggt ttcattatct     99180
     gacatgaggc tgaacctcgc tgtgtgtttt ttgcccggat tcagcataca tcaaaacagc     99240
     atcacttccc cggacatggc ccccttcggc tcctgacccg cgaagcggct cagtcgtcga     99300
     gccccactcc gccaggcagc tgctgtgcac ccgccagtct ccgccgaatc ccttcggggt     99360
     tcgggcttcg ctagggtctg atggcggagg tcaacccctg gcttgctgcg accgtgccgg     99420
     tcacgccgcc ccgaccgcga cggagaagcc gtcgctttaa ggccgccacg ccgttccgcc     99480
     gtgtcgggtg tgtgcatcct gttcatgcgg tgaggccatc ccctgtgcgt cctcccgcgc     99540
     aaggcttgtc gtagcaccgt cgggtcgtca tccaaggggt gaaatgcact ccgccaaaac     99600
     tttttgcagg caaaaacttt tgtctgcgcc cctttccttc ctcccttcgc cgttgctcct     99660
     ttgccctttg ccgcgagaga actcaccagg gagatggaca accatcccca caggagaaaa     99720
     ccaggatgca cacacgaaat gtcaacgtca gaaccgccgc tccagaatct tccaggaaga     99780
     taggggagaa gcaaaacgtg tggtcagccg gattaaaggc cagctctctg tggcgacgct     99840
     cgaggcgcaa ctcactgccg caatggctga agaagcgcat acacattatg gcgaggcatt     99900
     cacaacagtt gatctgttca aatccctgat gacgggtttt tttcagggac tcaggaaacc     99960
     catcagtcac gtaatacata aggagacaaa aatgcaggtt ctgaaagccg caacatcacc    100020
     gaaaaaggta ggcgcgagcc gtgacatggt tgcactgctg cgcattcagg ccaccgacac    100080
     gcatgtggtg gaattcgaca acgtagacac acgctttaac gactgcacga actggcaggt    100140
     tatggaaggg gataaacgtg tcctgttcag tacccgaacg cacgaacgct tttctgacat    100200
     taaggcaggg gtgctggcaa cgatcgcggt ctgtgaaaac cgtgccaccg cgtttgattc    100260
     cgcgatgctg gaaagtgccc gcgcgatgat gaaggtcctc gatgcctgtc cttcatttgg    100320
     tgcgctggtc gcgcacccga aacgcatcac cgattaattc tgagtgccgt gaccggatag    100380
     ccctccggtc acggcgaacc atcacttaaa ctgagaggta aaaatcatgg tcaccaccca    100440
     ttctacggca aacaaaaccg caaaagccac ccgcagcaaa aaagctgcgc ctgacgccgc    100500
     acagactgcc agccagacgc tgttacagtt gctgatagcg acccccgttc aactgatgcc    100560
     gtattcacgc ctgtcccgca cggatctgaa cgtgcgccgt attccccaca cggacaagga    100620
     agtggaggaa ctcgctgaca gtattgaggc cgtggggatt ctccagaacc tgattggcgt    100680
     tgaactgcct gacggctcag tcggtgtggt cggcggggaa gggcgtcgca gggcaacggg    100740
     cattctggtc aaaaaaggga ttaccgatgc ggacacgcca tttgttccgg tgaaggtgat    100800
     cccgctggaa ctggcggtgg tggcctccat gaccgaaaac ggtcagcgta aaaatatgca    100860
     ccctgccgag cagattgtcg gtttcagaac gctggagcag gagggcaaaa ccgtctcgca    100920
     gatcagcgcc ctgctggggt atgccccgcg ccacgttcag cgctgcctga agctggcaaa    100980
     ccttgccccc tccctgctgg atacgctggc gcgggatgaa atctccctcg agcagtgcga    101040
     agcgctgacc cttgccgaca cgcatgagcg tcaggagcag gtctggaaag aagccgtgga    101100
     acagtggcgt gaccctgccg tgcagaccct gcgcaaaatg gtcacgaatg acaagatggc    101160
     ggtcagccac ccgatgtttg aatttgtggg cgaggaggcg tatatcgccg ctggcgggac    101220
     gctgaccgcc gatctgttca gcgacaggga cagcaccttt gccgacgcgg cacaggtgaa    101280
     atccctgctg tcaggaaaac tcacggttct tgcggcgcgt attcagcagg agcagggctg    101340
     gggctggtca gagtttcgca tgagcgagct gggcgacaac gtgaccgacc gtgaacagta    101400
     ccgctttgcc atgccagacg ccgtcctgac tgaagaagaa aaacagcgcg tcagcgagct    101460
     ggaagaaaaa atggaagcca ccgacagcca cgatgacgaa tatgctctcc agcaggaaat    101520
     tgacgacatt gtctgtgagg cgacgtaccg cgaagccaca ccggaattcc gcgccgcaca    101580
     cggcgtctgg gtgtcatggg atggcgggaa ctttaaggtt caggcgggta ttcacaaagt    101640
     gacggatgag gagcgtcagg aggaagaaaa agcccttcag gagcgccgcg ataatgtgat    101700
     gacgtacacc acgccggata ttccagccga tgcgtatccc gcgacgctgg tcaaagccat    101760
     gtcagccgag cgcacgctgg ctgttcaggt cgaactggct ggacgccccg atgtatcggt    101820
     cgcactcctg acgtggacgc tgtgtctcgg cctgtttgac cgtcgccacg gtcagcgcag    101880
     tgaacccctg aaagcctctg tatcttcaaa ccagtatcac ctcgcctcgc tggctccgtc    101940
     cggtgaggag ggtaaggcac tgatggcgct gaggacgcag aaagcgacgt ttcaggcgac    102000
     gctgcctgaa cactggcatc tcgggtttac ctggctgctg tcatggtctg cggaggaggt    102060
     taacactctg ctgggattct gcgcggcgca cggtatcgat ggtattcagg agcgtctgta    102120
     taaccgcacg gataaaagcg cactggacgg gctggaagca gcactcgatt ttgacctgcg    102180
     taagtggtgg cagccggatg cagagagcta ctttggcaaa ctcaaaattg cccagattgg    102240
     taaggcatat gaacaggccg gactgaccga caaggcgggg gaggtcgtga aacttaaacg    102300
     tcgggatgcg gcgaaagccg ccgaacagga tctcaatgcc gttggctggc tccctgactg    102360
     gatggtgcgc cctgcgccag ccgctcaggc tgaagagagc actgaaaccg tcgctgacac    102420
     cactgaccac gctgcgtaaa ccggaggccg ccgccttcgg gcggcgggta cagacatgac    102480
     gatgaaatat gacctgaccc gaatcaatac cctgaccgcc tccgatatgg agttcattcg    102540
     ccagcagggc gaggatgcac gtcgcgccct cagcgatgcc gtgaccggcc tgctgacgac    102600
     ccccgagggc tggcgcgtct gcgccgagta ccgcagcgag ttcggtggct ttttccccgt    102660
     acagtgtcgg ttcagcgcgg acggctgtga tgactggcat ctttgcgtgt gcagtcctgg    102720
     cgagctgtcg ccgtactggc ttctggtcct gctctcatcc ggtggcgagg tggtgcgtac    102780
     tctttaccag aatgacacgc tccagcctga acaggtcagc cagttgatcg cgcagatggc    102840
     aggtatgcgc cgctttaact gcaccgcccg taccgtggcg acactgatga gcggggaggt    102900
     gacagcatga tcccgtcctc acacgccctc gtttccctga agcctgcccg tcaggccgcg    102960
     attcaggcta tcagtctggt cgagtcctcc cgcgaacgcg gcgcacgact gcccgccatg    103020
     ccttacgtgc gcaccttttt gcgcgtgctc acgggcagcg gtcgcctcaa tgccacggtg    103080
     gcacgtcaga tccccggcct gaactgggtc ccgaaaaacc ggcattcaaa cctgaagcag    103140
     gtggaggcgg cgctcgatgt catgatcgcg acgggcggtg aagcctgccc gctgccgctc    103200
     acgctggatg ttcaggccga actgttcccc gacgtcatgc acacccgcac gaaccgacgg    103260
     ctgcacaggg cggaaatccg caccacacga cagattcgcc aggagtcccg cgaggttgaa    103320
     cagcgctgga agttgcgcca gaacctgctt gcacaggctg aagttgacct caattttcag    103380
     tctccggaat cggtctgcac ctggtacacc cggtggagcg acgagtttga cgcgggagag    103440
     ctggcgggaa tgttctggcg atggcagacg cggttcgcgt cgctgaacgc gctggaatgg    103500
     ctgcgcctga ggggtgatcc gctgtacgcc gtgatgtatg aaattccgta tatcgtccgg    103560
     gaaacgcccg agcctgttcg ccagactgag cgctggcagg tgccgaacaa gctgactctg    103620
     tggaggacac cggcatgaga aataacccgt acaaaacgga gctgaaggtc gcccgcagcc    103680
     agcgcaaccg gctgaaaacg atatccgcca ggctgaaaga gatgtcctgt gaatgggatg    103740
     gcatgagcgg ctggctcgag acggaaagcg atcgactggc agagagtgtt gatgagcatg    103800
     ttaaggcact ggaggagcag attcaggact gggcgcaggg accggacagt ctgaacgacg    103860
     actgaaaaat gatgaggatt tatacagctt tcagacggtt attcctgggc agatgtggca    103920
     cggcaggata taatggcgat ggcgcttgag gctttttgcc tcatgatgtt cgggtggttt    103980
     gttatcgtgt tgtgaggcaa aaagcagaaa gccccgaagt taattctcat taaccacgag    104040
     gcttgatctg tatgcctaga caacatcaga ttagccgctt acctgccgaa aggcaaggag    104100
     aagaaggcca tgaaactgcc acgaagtacc ctgctctggt gcgtattaat agtgtgtctc    104160
     acactgctga tattcactta cctgacccgc aaatcgctct gcgaaatccg gtacagggac    104220
     acgaacaggg aggtggcggc ttttatggcc tacgaatccg gtaagtaagc tacctggagg    104280
     cgggggaaac cccgcctttt caggagctga ctagtctgtc atgcctgaag cgcctttatg    104340
     aaggggttgc cggttcgctg gtagcccctt tttccttccc ggcgcgaccg cacgcatgaa    104400
     caatctggaa gggctgttcc cctccgggga acgggggaag gacggcagcg cctccggcgc    104460
     ttccgcctgt ctcccccctc cgtattcctc agcgcttcac ttattcatcg ggtggcgaca    104520
     gtagctcgat ggccagcagt attcctgtgt gagaaaaatc ggtctgctcc atgatggtcc    104580
     agtgaagccg ttttagctgg taggtcagtc tggcgcggtg ggtttctgcg cctttgctgg    104640
     ccagcataag gcaacactga ccgatgatcc ggcagacttc atcgtaaata atgtcgtcgg    104700
     tgtcgtcttc gctgtggata tctgacatga ggctgaacct cgctgtgtgt tttttgcccg    104760
     gtttcagcat acatcaaaac agcatcactt caccgagcat ggcccccttc ggctcctgac    104820
     ccgcgaagcg gctcagtcgt cgagccccac tccgccaggc agctgctgtg cacccgccag    104880
     tctccgccga atcccttcgg ggttcgggct tcgctagggt ctgatggctg aggtcaaccc    104940
     ctggcttgct gcgaccgtgc cggtcacgcc gccctgaccg cgacggagaa gccgtcgctt    105000
     taaggccgcc acgccgttcc gccgtgtcgg gtgtgtgcat cctgtccgtc cggtgaggcc    105060
     atcccccgtg cgtcctcacg cggagggctt gtcgtagcac cgtcgggtcg tcatccaagg    105120
     ggtgaaatac acgccgccaa aactttttgc gaaagaccgc aaaaactgtt gtctgcgccc    105180
     ctttccttcc tcccttcgcc gtcgctcctt tgccctttgc cgcgaaagaa ctcaccaggg    105240
     agatggacac ccatcaccac aggagaaaac caggatgcac acacgaaacg tcaacgtcaa    105300
     aaccgccgct cacgaatctt ccaggaagat aggggaaaac ccggtcatgg gtctgacgta    105360
     tgagcaggcc gccgatctgt tttcctgggt ggtgaacgca gcgaaagggg agccacagcc    105420
     cgccattttt aacgtccccg ctgaaagcgt ggagctgagt ttaatgtatg aagacgcccc    105480
     ggattatttt tcggtgtggt ttttaaacgg ttatccggtc gctgccggtg tgccgtcaga    105540
     acattatttc cgtgtcatta ccgcgttaat taacttttct caggagtaaa tattatggtc    105600
     agttttgcaa gccgttatcg tgtcccgacc tctattcgcc agaatcgccc gctgacaaac    105660
     gatgaattac aacgctttgt cccgagcgcg ttttctgaag ataaacacga ttcacgctca    105720
     gagcgttata cctatattcc gaccattgtg ctcctggatc gtttacgcga cgaaggtttc    105780
     cagccctatt atgcaaccca gtcccgtacc cgtgatattg aaaaacgcga ctttacgaaa    105840
     catatgctgc gtttgcgtcg tcacgatcaa cttgacggaa aagaagtgcc ggaaattatt    105900
     ctgctgaaca gtcacgacgg ttcaagcagt tataaaatga tcccgggcat gttccgccag    105960
     atttgtacta atggtctggt cgcctggaaa aatttcggtg aaatcagtgt gcctcacaaa    106020
     ggggatattg tggagcaggt catcgagggc gcttataccg tactgaaaac atttgatgcg    106080
     gtaacggata atatcgacat gatgaaaggg attcagctga gtgagcctga acaacgtctg    106140
     ttgagtacgg ttgccctgga ttttaaatat gacgggaaaa aaccaccagt gacccccgac    106200
     caggtattac agtcccgccg ctgggaagat aaaagcccgg atttatggac cacctttaac    106260
     cgtattcagg agaatgttat caaaggcggg attagcggca gaacggcaaa aggccagcgc    106320
     acccgaacac gcgaagtcac aggaatcgac ggggatatta aattaaacca ggcattgtgg    106380
     aaaatggccg aagaattcgc aaaactgaaa gcctgaaatt aagccgctct gatgagcggc    106440
     tttttattgc acagaattca tcgcggcggt ttttgatgcc ggtccggttc gatcattttc    106500
     tccgttctgg ggggatcgtt gcgcgagaag cgtttttctg gccagcaaca cgcgatatat    106560
     attcttaata tcttccgcat aggccttgcg ccgggtgatg agctttttgc tcggtccggt    106620
     attatatatc cccacgctgt cccagttttt cccgtatgac ctgaagttgt gcgccagcac    106680
     ccatgcgccg gtataaacac aaatacacgg atctttcagc agacgttcgc gcgtaatatt    106740
     aaagttttta agcttgccat aatgcgagct gttcacctgc attccgcaga catcttccgt    106800
     tccgtcgcga ttcgatccat tgatcgccgc tgctttgagt ttgctttcct taattgaaat    106860
     tgacatgagc aggaggggat caatacggta atcgtgcccg gcctggtcaa agcacatctg    106920
     tggagcggct ccggctgaaa atgaaagcac caggagcgca gcagggaata cagttatttt    106980
     cattattctg ccttttaggg agatataagc ctcactgaga gggcgcataa aaaatacccc    107040
     gccagatcat ccaaatcaag ttaattccct acaaacgcgc ggaagcgctt taaatcatgc    107100
     gtttacagtc aggccgaaat aaacaagtca gaccaggcgc aggtatttca gagccgctct    107160
     ttactcacca cttaaaacat cacaccccac gcaagacttc gtcttgcaga ttttgccttt    107220
     taaatcagtg gttaaatgct aaattatttc gggattttga gatatgagct taaaaggtgt    107280
     gttaatcccc acacattgca gtgctggatt aacacacctt gcagtgccgg atgcagcact    107340
     gcaaggtgtg gggattgtgt gtacgtaata attagagtaa cttaaaaaca gacagtgccg    107400
     gatgcacaca cctcatagtg ctgcatcccc acacatcaca gtgccggaat agcacacctg    107460
     acagtgccgg attgacacac ctttttcctg tgctggcccg gcgtggctca gctggaaaat    107520
     ataagattac cgagaaattc atccctgaca gtgctgcatc cggcactgca tgaaaaagac    107580
     aggaaaatat catgccgcgt aagaacatct acttcaaaga taaaattgac agagaaatac    107640
     aggatatact tgaaatagag atacaaaagg gggccaccac atcagatatg aactattcat    107700
     ctattgtgaa tgagctggtt cgactcggac tgatggtcta caaatcaaaa gaagaaggtt    107760
     ccacctttga ccttgacgga ttcagacgtg acctgattaa gaaagtctca ggctctcggg    107820
     aaggaatgat gattttaacc gcgcttgttt ctgaaatata tgtcacgctc aaaggccccg    107880
     aagcaggcgt ggcacttgat gaccttatca ataacaacat cagcgccatt aatgttgctg    107940
     aagataatgc tgaaagacaa cacttcctga tggactgaat acacagattc tggccggagt    108000
     tcaccggcca ctttcgatca ctgcgggctc tccttttccc acggcagcgc ctctttttca    108060
     cactggttta ttttctcttt taagaaaacc tcaaactcca tacacagcaa tttcagcgcc    108120
     tgaccatcct cgttctggtc cagtatccgt tcagtgaaat aacccagcgt attcatcaac    108180
     cttgtcagca tttcgtcatt caggctgcgc ttatgcactc tggccattgt gcgtatctct    108240
     tcagccagat tatccggaat acgcatactg tagccggtcg ttttacccgg aattaataca    108300
     cgctctcctt cccgccacat ccacaactgc tctgcatggt catcattctg aatatcttca    108360
     ccacctgaac gttcacccct gtcaagcagc tgacccagcc atgtctcgaa tttaacggcc    108420
     agtgaaatca gccgttcccc ctccgccgtt ttaatgactg cacgctctgg ctgataatta    108480
     agagataaaa gaagtcgcgc aataatttca tcgttcacac tccttttccc cactctggcg    108540
     catattctca actccataag cagattatcc ggcgcacgaa gacgccactc taccgcctct    108600
     ccgggacgga acttacgcgg ccgcccccga ccttcccaca ttttctcttt tactttcatt    108660
     ggtatagatc ccacaaacaa tagggttact ttctggctga ccaagcctac gcacatttat    108720
     attcagataa ttcctaatca tttataaaag tgtgacatgc gtcacagttt ttttttttta    108780
     gggtcatggg acaatatcgc gtgcgtaaac aaccacttat gcacacacat tttgtttaca    108840
     tccggagaaa caagcatgtc tatcaaagat aatgccctca atgtcgtgaa gggatgggcg    108900
     gtagcgtcct tattccgcac tgctcttgaa aatcgtcaga tgaaaaagtt cctgaaaaat    108960
     ggggggctga ttttaatttc acttatggtc gctcatccgg ttcttgcagc aggaacggat    109020
     ttactcgcac cgcaacaagc aaccgtcaac agtacgttcg gctcgggctc gtctttaatt    109080
     aaatggttct atatcgcgga aattgtgatg ggcctgttta tttatattaa agcgcgctcg    109140
     ccactcgtct ttgtcggtat cgtgggctgt attatcttca cccgcgtcgc tttctctatt    109200
     gcgagctgat gatgagcggg gaagaggata aatactactt cccggaaacg ctcaatcagc    109260
     aggaacgcta tttcggtttg cccttagacg aaatcattat tgttgcgcct ctgattatcc    109320
     tgggcgtgct caataatatg tctaccgaac tttccataat agcgggcctg ctctgggcat    109380
     cagtcaggta tctgaaaaaa ggacaaggct ctttctggtt actgaatttc tgttactggc    109440
     atctgccttc tcttttattc aaggtcacct tccgaaaaat acctgattcc agcttccggc    109500
     actggagggc gtaattccca tggaactcaa aattaaaggc gagcgcgata aacaactcag    109560
     ttatgcgttt attggcctcg tttcattact ggttctgagt ggcacgggaa atgtactgac    109620
     cggctctctg gcgtggtatt tcgcgaccac ccagaaaacc gtcaccacgc ccatgaccta    109680
     taaccagcca ttcacctctg acgctgtcag cgcagatgca tccggcatga ccatgttcgc    109740
     ctcttccttt atttactggc ggctgaatgt gagtccggag aacatcgata acaaccagaa    109800
     aatgctgctc gggtttgtcc cgtcaactga acgggacctg ctccgtaaag cgctggatgt    109860
     tgaagctgaa cgcatcaaga aaggcggcat cactacccgg ttcgacacga aggatatccg    109920
     ggtgatgacc gacggctccg tggagttcag cggtacgctg aaatccgcca ccaccaacgg    109980
     tgccatcacc acccccctga aggaccagga caaaacctac cgcctgaaca tcagctacca    110040
     gaacggactg gtgaatctcc actcctttga agagcttcag ccggtcacca ccaccaactg    110100
     acaggactgc ccatgaaact tcgcatttca ccggcagctg ctgctgtgtt actggcatcg    110160
     ggaatcttta ccagcggcct tcgggccgct accgcacccg ccgccatccc ctttgagaac    110220
     gacgccgcct ttaatgtcac gctcagtaac accaacccga cgaaggttgt tgtggacggg    110280
     gaattaatta ccagcatcag cgggccaacc ggtgcctacg accagagcac taccgacgat    110340
     ggcgcactca ttctgtcgcc gcttgtcggc cagaacttca cgctgtttat ccagactgac    110400
     cacggctcct ctctgagcct gaacgtcaga ccccaggccg gaaacggcaa aaccctgcgc    110460
     tttactccca tgtcaccacc gctgcgcaaa aacgatgacg ctaaggcatg ggaagaaggg    110520
     cagacctatg agaaaaccct ggtcgcactg tcgcgtgccg tggtgaacgg tcaggtgccg    110580
     gacgactatg tggagtatcc cgtcagccgt atgacggcgt acacgccatc cacgcccgtt    110640
     cgtctcacgc cggaacgcca gtttgtcggc aaccacctgc gcatcgtgcg ctttcgcatg    110700
     aacaaccctg gcagcattac ccagagcctg cgcgagcgcg acttctggct gaagggggtt    110760
     cgcgccgtca tgctctccca aaaccagctg tatgccgggg gcgaagggta tgcctgggtc    110820
     gtgttttcgg atgacggagt accgcgctca tgagtctgaa cgaaaatctt aaaacccgcc    110880
     gcacccagtt ggctgttctg gccaccgtga ttgccgtcgg tgccgccacc gccggcggcg    110940
     tgatgtggta cgggaatcat caggaacagc aaaagcaccc tgcgcctgtt gccgcaccca    111000
     atatgaccgg cgtggtcacc gcctccttta atgagcaggt gaacgacgcg gcactggcac    111060
     agcagcaggc caaaacctct gcgcttgagc agcagtacgc cacgcttgct cagctggtcg    111120
     cccagaacaa gctcaccaca gaacagaaac tggccgagaa ggacgctgaa attcagcgcc    111180
     tgaccgacca ggtccagaaa gcccccggca gcaacacgac cacgggccag cagtcaccac    111240
     ctgctggcca gaacggaaca ccactcccgg gtcccgttgc tgccggtcag gcccgaccgc    111300
     cggaatactc cgtcaccccc aacgcaccgg ccgccactgg tgtcaacatg gggcagggcg    111360
     cagggttcta tccgggcggc tcaggccagc gattaaccgg tggactctcc accacgaagt    111420
     tcagttatga cagcctaaaa aagaagccca ctaagctgcc gtggataccg tccggctctt    111480
     tctctgacgc cgtcatgatt gaaggggctg atgccaatgc cagcgtcacc ggtcagcaaa    111540
     acaccagtcc cgtaacgctt cgcctgcagg gcaatattca gatgcccaac aacaaggaat    111600
     acagcgccga cggatgtttc atcgtagggg aaatctgggg tgacatttcc agtgagcgcg    111660
     gcaccgtgcg cacccagtcc atcagctgcg tgctgaagaa cggcaaacac gtcgatatgg    111720
     agtttcaggg gcacgtcagc taccagggca aaaacgggat tcgcggcaag cctgtcatgc    111780
     gtaacggcat gattgtcggc tacgccggcg cggccggtat gctgtctggt tttggtgagg    111840
     gcatcaagtc cgccgccaca ccgtccgtgg gtctcggtgc aacagccgat gttggcgcag    111900
     gtgacgtatt caaacagggc ttcgggggcg gtgccaataa agcggctgac acgctgagcc    111960
     agtactggat caagcgcgcc gagcagtatc acccggtgat tgatatcggg gccggcaacc    112020
     aggtcacggt ggtattccag aagggcttcc gccttgaaac actggaagat gctgaggacg    112080
     cgaaggcgaa agaggagttg cagaaagccg gcaatgccgc gcagaacgct gtctcgccac    112140
     aacctgccag tcagtcgacc acctccggca cggcgtcagt cggcaatatc aatcccgatg    112200
     atgtgcttcg tcaggccagc cagctgcgcc tcggtgacac tatcaactga tgatgaggta    112260
     aatatgaacg cacgaaaaat actgcattgg gcagccactg gctggacccc gatgctgata    112320
     ttcatcgctt caatagttgt tttatacgcc acactgcact cccattttat gtgcgtgcag    112380
     ctgactggat tattgctctg cggcttaagt ggacttctgt tatgtgaatc aatgacgggc    112440
     gggagtctgt ggcggatgtt gaatcagcaa ccttcagata atgaaggaaa gacatcgatt    112500
     acaggtcatg cagataaaga tgatcagggg taatcaacat gttttctgac ttgcgccacc    112560
     tcgctattcc atcgctgatt tttgccattg agcttacggt gtgggccgtt ctgattcgaa    112620
     acggttacgg tgaatatggc tggaaatact ggcgagcagg cctccttgcg agtctggtca    112680
     tcctccttca caccaacatg attttctatg gctcaaaaga gcgaatctgg catgcagcag    112740
     gtgttctcgc accctgggtc atcctggttc cggcattcat cgtgttctgc tttattcaaa    112800
     cgaatcagga cttactgacg ctggactggt ttttcaccgg cgtctttgcc agtggcgtat    112860
     tccagtggct ctttaatgtc ctggtgagaa acttcaggta atcagaacac ggcatcacct    112920
     cttccacgac tatcccttta acaccaaccg gagttatccc atgaaaaaac tactgggcgc    112980
     tgcactgctg tgcagcgcac tgactggctg tgccggtctc aattctgatt tcgactgcaa    113040
     caagaccgcg accgaccagt gcctgaccac aggtgaggcc aacaagctgg ccgcgcaggg    113100
     taaaaatctc gactccctcg ccgccgataa agccgcaaaa aagcctgcgg gtgaaaccct    113160
     gccggcactg cgtaacacag cgccggtcgt gaatcccggt cgtcctgtct ccgtcgcagc    113220
     aaccggaacc gccatcgcga aacccattgc gccacgacca ctggccaccg cgccatctgg    113280
     ttcgaccggc tctctggtga cgccgctgac gaccgccggt catgttaccc cggtgacacc    113340
     agtgaatacg gcgggacggg tgccggttca gcgcattccg gatgcgaccc agcgtctgtg    113400
     gattgccccc tgggtcgaca ccgatgacaa ctttcatcag cccgccgtgg tggagttcgt    113460
     gaagaacaaa tcccactggg atgagagtta tcgtgtgatc ggggagggtg gcgaatgagt    113520
     gttctcgaca acctgatgtc gctggtcaac agccggaagc gtgaggacgg cgctgcaacg    113580
     gcccgcgcca atctggaaca gacctggggc tatccctccc tggtcgcggc cctgccgtat    113640
     cgctattacg acgatgtaaa tgaactgttc atcaatgagg ggagtgccgg ttttattctg    113700
     gaagctgcgc cactgccggg cgcgaacgag caagtgattg ccgcccttga tgacatgctg    113760
     cgcaaaaagc tgccgcgcaa aacgccggtg agcgtccttc tgcttgccag caagtgtgtc    113820
     ggggagcgta ttgcccgcgg tgtcagtagc gatatgtgga aaggcgatat gtccgagtac    113880
     ctgaacaaaa tcaccaaagc cttctggcag cgctcggcgc tgaagggcct ggctaacgaa    113940
     cgggaatacc cgctgtacct gcgtaattac cggattttca ttgtctacgg caaacccgca    114000
     aaacgcttct cccagcaggt gatggacgat ctggtgcagg tccgcaacac cattcgtgtt    114060
     tctctggggg cagcgcgtat tgagacgatc aacacccacg tcaactcatt cctctcggtc    114120
     atgcgcgaga tgatgaacta ccgccaggag caggtgatga cctccagcgg ggactacaac    114180
     gaagatgaaa aactcaaccg tcagattgtt gagccgggga tcgatgtccg cgtgaaaccg    114240
     tcctatatcc gcgtcgaact ccctgacagg attgaggaaa acgggacgcg tctgccggca    114300
     tcagcctgtc gcgtggtgaa catgcagctc gccaaaagcc ccaaacggtt tgcgctgtgg    114360
     cagggtgcgg ataacctgca gaacctgcgc ttcccggacc tcggcatccc gtgcccgttt    114420
     atgctcagct ggaccaccga actggaagag cagaccgcca cgcaaaacga ggcgctgcgt    114480
     aaggacatgg acctgtcgaa aaaagccaac tcggcctatg gccagctctt tccgagcacg    114540
     aaacggcagg ccgaggagtg gcggcgcaac cgtgagcagt tgtccaataa tgagatcgcg    114600
     ttttgccgca cctatctcaa cctgaccctg ttcacaccgg ataacaacac ggatgcgcag    114660
     gcctgcgagc tggctgccgt gaacgtgttc cgtaagaacg atctggagat ggtcaccgtt    114720
     cagtatcagc agatgcgtaa ctggctgggc tgcttcccct tcatgatgca ggaagggatg    114780
     tgggaagatc tgaagatgac cggtgccacg ctgcgctgca aatcctggaa cgcggtgaac    114840
     ctaatgccgg tcgttgccga acgccagctg tcgcatgtgg ggatgccgct gccgacctac    114900
     cgcaaccagg tggccttttt cgacatgttc ggggaagaga acggcagcac caacttcaat    114960
     attgccgtga cgggaacgtc aggcgcaggg aaaacattcc tgatacaggg cattctccgc    115020
     gatgtactta acgccggcgg tttcgcctgg gttattgata tgggggatgg atataagaat    115080
     tactgtcatc aggcaggtgg cgtctacctc gacggtgcga agctgcgctt taacccgttt    115140
     gccaacgtga aagatattaa ccagtccgcc gaagggattg tacgtctgct gaccgtgctg    115200
     gccagtccca cggagcctct cgacggggtc tgtgaggcga tcctgcaaaa agcggtgatg    115260
     acagcctggg agaaaaaaca gcacggtgcg cgcatcgatg atgttcataa ctacctgacc    115320
     gacccggcgg tgaacgaggc ctttgccgac aagccaacca ttatttcccg ccttgcggaa    115380
     ctggccatgc tgctggatac gtactgcaca tgggggccgg acggcgaata cttcaacgcg    115440
     gacagcccga cgctcgacgg cgaaacccgc tttgcggtgc tcgagctgct gagcctcgag    115500
     gataagccga agctgctctc gtccattctg ttttcgctca tcctggcgat tcaggaaaaa    115560
     atgtaccaca gcccgcgcga cctcaagaaa gtctgcatca tcgacgaagc ctggcgactg    115620
     ctgggcggct ccaacccgca tgcggcacgc tttatcgaga cagggtaccg taccgtgcgt    115680
     cgtcaccgtg gggcgtttat taccatcacc cagggcatca aggacttcag cgccagtaag    115740
     gaagccgaag cggcctggaa caacagctcg accaaaatca cgttgctgca ggacacacgg    115800
     gcctttaaac agtacctcgc agataacccg gaccagttct ccgacatgga aaaagaagtc    115860
     atccggggct tccagcccgc gcttctgacc ggctacagct cgctcctggt cagtgccggc    115920
     gaattcagct cgttccaccg cctgtttgtc gatcccatca cgcgcgccat gttcagctcg    115980
     cgcggtgagg actttgcgtt tatgcaggat gcgcagcggg ccggttccac ggctgaagaa    116040
     gcggcttatt tgctggccca gaagaagttt ggtccggaac tccaggaact tgaagaatgg    116100
     ataaaagccg catgagtgag aacaacgaaa agccgtatga cgctgagagc gtccgggacg    116160
     gcgtgacgat cgctaccttc tttgcctccc gctgggtgaa aggcctgcta ctgggcgggg    116220
     cgggtttgct ggcgatgacg ggcgtggcgt atgtgacagc gaaagccgtg acgccggacg    116280
     tggtggtgtt cgacatgaag ggcacggtag acctctttat gcagcagtca gcccagttga    116340
     accttgatga ggggaaagcg aaagtgctga catcccgctt caataccgcg ctgagcgaca    116400
     gtctgaatgc gtggcagacc tcgcataacg ccatcatcct ggtcaaaccg gcggtcatga    116460
     gtcctcagcc ggatatcacg gctgacattc gcagcgatat ctcacggcgt attcaggagg    116520
     gccagtgaaa aaacgactga tgcgctgcgc cctcacgctg ctgatcctct cagccagtgc    116580
     gggggcgaaa gacctcggca cctggggcaa tgtctttgag ccggccgagc aggacatgct    116640
     ggtctttatt caggacaggc tgaaggggat ggagcagtcc ggggagctgg agcggctcaa    116700
     aaacgaagcg actgagcggg tgaaaaagca tgccgtccga ccgaagccgg ttgacggtct    116760
     gacccgcgcc ctgaaatacc gtgccttcac ctttgacccg acctttaccg tgcaggaaac    116820
     catcaccgat atgcagggca atatcattgc ccgcaagggg gatcaggtta atccgctcga    116880
     taaggtcccg ttcagccagg tgctgtattt catcgacggg gacgacaaag agcagattgc    116940
     ctgggcgaaa cagcagattg ccggtcagac gaatatcaag gtcatcctgg tcaacgggaa    117000
     tatcaaggag accagtgacg cgctcgatga gcgcattttc ttcgatcagt ctggtgtcct    117060
     gacccgcaag tttggtttcg agcacatccc ggtgcgtatt tcgcgcgacg gtcgtgcgct    117120
     gaaggtggaa gaaataccgg tcagggaggg gaaaagatga tcttcctgct ggtcttatca    117180
     gtaatcgccg gtatgaccgg gtgtgttatc gcgacagcag ggttacctga aaatctgcgc    117240
     tggcagggca tacagtgtgg ggccataaca gccattgcgc aggccggcat ccttcatgtc    117300
     atacccctgg acagggacgg gagtgggctt ttgatggcgg gcgggatcat gctggcccag    117360
     tgttattccc cccgcctcgc ggaagacaca cggaaactga gagtgcattt tgggatacgt    117420
     tccgcgccgg gttacctgtt gatgtatgcc ctgtgcctag tgctgacagg cgtttgctgg    117480
     ctgccgatct ggatggctat cagatgagcc cccctggttt ggtttgtata tcattcggtc    117540
     agcaccctgt gcgcattact tcattacatc attgtgttcc ggtgaggccg gttctgatga    117600
     tgtacgtcaa aatccattaa aggtactcaa atatgaccac aaccacatta ggtgacctgt    117660
     tccctgagat acgtaatgct gcgtcagtgc gggataaaaa ccctgcttcg cgacgtaaaa    117720
     tttccagcag gacctcccgc agcggcacag cggaaagact caaagcgctg taccccgaaa    117780
     ttgagtcctg gagtccaata ctggcaacac agtcctggcg ggtctggtgc agggaaaacc    117840
     atcaggcatt cactgagccc gaaatccgag acgagcgctt cccggaatac ctggtcgggc    117900
     ttatccgggc aaaaatggcg gagatgaatg aatggcgata atcagctgtt tcagccagcc    117960
     tgaatcgctg cgcggcgtgc tggtctgcct gaatgacacg ggaggaatag cgggactttg    118020
     cgcggtggcg ctggggctgg ggatatggat tgttgcccag gtgcggagcg aagccgccgc    118080
     caaaaaaaga ctggcgaagg tgatgaaata cgggcagcca gccatttcct ctccgccgac    118140
     attcggcggt cagcagcatg cggaggcggt ccatctgttt gccaaccggg actactatca    118200
     gttcctgctt tcggagtttg aaaaagcgct gcttgcacag ggatatgagc tgacagcaga    118260
     ccgtgcgcgg catgttgtcc ctgacagtga cagcacgcgc caggtggcca gagcgattat    118320
     gatcgcgcgt gagcgctata tggcacccct gcagtcagat gcgacgctgg aagataaagc    118380
     ggatgaatgc gccagggcag ggtattcaca tcagtggttt tgtctgctgg ctgccgggag    118440
     tgaacggacg ggctggtaca ttgcccggtc gacgccgaca accggcagtg aataaccgtc    118500
     atattatcgt gccccctctg aattcttctc tgtatctcac tgacttaacc gccacgccat    118560
     tcaggatgtt cggtgctcac tgcgttgcgc tccgcctcaa cctgactgcc gtcacggttt    118620
     cttcttaaca cctgacaagg taacgccatg aaaaaagacc ctgatggtga aaagggccgg    118680
     aatgtcgctg taacggctgt tcgccacgac gaaaaatcag cctcacgtct ggatgatatt    118740
     cttcaggaaa accctctttt ctacccttcg attgtcctgc gggccggcat tctcgccctg    118800
     cacgaaatga cctgtgaaca gcgcatggcc ctggttatcc gggcagcact gcctccagcc    118860
     aaacactgac cttcattttg ccctcccgtc tgtctggcgg ctgcggctcc ccggagatac    118920
     cccatgactc accctgaaca catcagtccg gtgacggtca ctcgtgatcg caacggcttc    118980
     tggactcacc cgcactactt ccagcccgca gacgatgaag ccacgccggc agaatttggc    119040
     gactggctgc accggtacaa cctgacctgc gccacgcggt ggatggagaa tgatgccccg    119100
     ccccacgtca tcagggcctg ggaaaacgga ttcagcagca ttcatgagtg gcagccctcc    119160
     gcgccggcgg gtgacggctg gtttattggc tccatccatg actcggaaga cggaccgctt    119220
     tgcgtctggc tgcgggaggc acaatgacct tcagagcctg tctgaccgcc ctgttactga    119280
     ccgtgtcgtg ctggacggcg tcgttgtctt ccgcctcggc tgcggcgagt aatgccggcg    119340
     aggggcggtg ggtgaacccg atatcggacg tgtgctggaa atgtctgttc ccgatgtcgg    119400
     tcggcaacgt caagctggca tccggcccgc agccggacac cagtaacccg tcaatgccca    119460
     tccagatttg ctcctatggc gtcttttacc gcatggggct ggccatcggc tactgggagc    119520
     cgacggccat gacggacgtg acccgtgaac ccggcgtgat ggtgaacatg gggggcttta    119580
     agattgatct cgggcgaacc ggaaccggaa cggccgggca gagtgaccgg cccgcagccg    119640
     gcgcgttcta ccacgtccac tggtacaaat acccgctgat ttcctggctc agcatcatga    119700
     ccagtaccgg ttgtttccag ggcggggata tggatatcgc ctacatgtct gaagtcgacc    119760
     cgctctggaa tgacagtacg ctgtcgatga tgattaatcc ggaggccgcg ctgttcggca    119820
     atctgattgc ccaggccgcc tgtgcagcgg atgcggtggc cagcaccgcc ggcgtgccgc    119880
     tgtcccccct gttctggtgt gccggcagtc agggcagcat gtacccgttc accggcttta    119940
     ccagcggcga gttttctccc ctggaatcgt cgcttctggt cagcgagcgc atggcgttca    120000
     agctgcaccg cgaaggtctg gtgatgaaca cggtcggggc ggattatgcg gtctgctatc    120060
     agtatccgtc tccgatcgtg ccgaaagaac ggtggcgcta tcagatggtg aacatgttcc    120120
     ccgaaaccaa cagctgccat gccttcgggg ccagtaccca gacgtggggc acgccccaca    120180
     actccccgca gtcgaagaaa aactttggct atctgctctg gcgcaaacgt aactgcgtct    120240
     attcgtgagg tccggtcatg cataacacac tctttcgggc gctgctcctc agcgtccttt    120300
     ttggcggcgc tcagacggta ctggccagcg aacaggccag cgtgtctgcc agtgatatgg    120360
     cctggatgaa acagcaacag cagccacttg acagtcttaa acagcgcctg caggggcaga    120420
     caatgtcgct gccagcagag cagcaggcgc ttatcagtcg tctgcagggt gatctcgcgc    120480
     ggcagcaggc tgagcgcgag agcggtgaaa aacgcacctt tcccgccatg tactttgtca    120540
     gcctgggact gccgcgcgag gggttgcttc cgatgctgaa ggaagcaaac cgatacggtg    120600
     tgccggcgac gctgcgcggg ctggtcaaca acgacctgcg tcagacggca tcagccatgt    120660
     ttgagctggc gaaagaggac aagaatatcg gggtgcaaat cgaccccacg ctgtacaccg    120720
     agtaccacat cacgaccatc ccggccctgg tggtgacctg cccgggtcgc tttgatgtca    120780
     ttcgtggcag cctcccgctg aagcaggcgc tggagaaagt ggccgagagc ggggactgcg    120840
     ccgcaacggc gaaacagata ctggaggacg ggaaatgaaa cgactgattc tggcggcgct    120900
     gctgatgacg ccctgtgttg tgttgtccgc tgacccggct tttgaggcgg gggcaagctt    120960
     cggaaaaggc aatgcctctg caggcacggg cagcctgaaa aatcctgacg cggtgaccgg    121020
     ctctattccc ggctacagcg cgaaaccgcc ggaaagcggc tactacggcg gcgttcaggg    121080
     gggcgacagt gggctttccg ataaaggaca ggccgcgctg gcgggaaatg atgcggcaca    121140
     gtccgtcatc agctcaggca acagcaaccc catcccgacc atcgacccaa acgctccctt    121200
     tattaccatt ggtaaaaatg cggaagccgg atcggaaggg gtgctggacg gaacaaacaa    121260
     acagtgtact gaagtcactg tctccaaatc gactttcgag aatttccagt gcgataagga    121320
     tatcgcgtcg gtcgaggcct gcacccgtac cgccacggcc ggaggacaca cgaccacaac    121380
     cacggtccag aaaacgctga ccctgagtgc cgcggatgcg gtgatttctt atggcggtgg    121440
     ctcatcgttc agcttcgcct ttgtctcccc agaaaccggt ccgattatca gcgcgcattt    121500
     ttactggagg gagggcgata ccaaagccgg caaaatcaac ttctggggca tcagtgaaaa    121560
     gatgattggg aaacagtttg actgggcggt cccggctgcg gcgggttatc agatgtccac    121620
     caatactccg ctgccggcgg caacctatac cagtacgtcc tgtaccagcg gcaataaaaa    121680
     ccgttgcgag gcacacatca gggacattat tgaggggttt aaaaacggtc aggtcagcgc    121740
     gaccatagtg attacgatga atgccgtgac ccagacgttt gtcccggatg tgacctggaa    121800
     aacgtcctgc ggtctggaca tgtcgaaagc gagaaagacc acctccacct gcacgacgcc    121860
     cggcggaaat cacaccgtgg tgaacaatgg ccagagctat caggtctaca gcgactgctg    121920
     gcagtacacc gataactatg tcgtcccttc aaactccacc ggtaactgcg gcacgctgat    121980
     gaccaacccg aaatgcacgg cctcagcgtc taaatgtgtg gaaagcaccg acgggcagtg    122040
     tacgcatatg agctacacat atcagtgcca gaagacctgg cagtcaggcg gtctggtgtg    122100
     tggcggtgac tatatctgta agaccggaga ctgcaatgag gccaacgggg cagggagcag    122160
     cggatttgac gttgccgtcg ccaaactggc tggcctggct tcggcggcgg atgatgttaa    122220
     ggacgatcaa agtcagattg atatcaaagc ctttaccggc aaggcgatga gctgtcgcaa    122280
     ggcgttcgcg gggttctcca actgctgcaa agactcaggc tgggggcagg attccggact    122340
     ggcggcctgt aactccaatg agatggccat cggcaaagcg aaagcgaaaa aagtgacggt    122400
     cattgtcggt gagcgctgcg accgtcaggt actcggagcc tgcatccaga aaagtcaggt    122460
     ctactgtgtc tttgaaggaa aactggcgcg catcattcag gagcaggggc gacgtgacca    122520
     gctgggcgtg aagttcggca gcggggacag cccgaactgt cggggtatca ccattcctga    122580
     actgcagaac atcgattttg acaaaattaa cttctctgat ttttacgagg acctgatgaa    122640
     aaatcagaag atccccgaca cgtcggcgca ggtaaagctc atcaaagaac gtattgcggc    122700
     gcaggtgaat cagcagggag gcaataaatg aaaagactga tgtgcggcct gctgatggtc    122760
     gtgaccagtc tgccagccat tgcggaggag attatcaccc ccgccgaccc gttcaccggc    122820
     tggtcctggt ataacgaacc gaaaacgccc ccggataagt acccgaaacc tcagcaaccc    122880
     gcgccgccga cgaccattcc tgatctcagt aaaatgaccg cgctggagca ggcaaaggtg    122940
     ctgaagggct acacgatgga ggcgctaaac cgcgccatcc tgtaccccac gcgggagaac    123000
     acggcgacgt tcctgcgctg gcagaagttc tggactgacc ggggctccat gttcagccag    123060
     tcattcgcag cggcccagct gagtcatcct gatctggatt acaacctgga gtacccgcac    123120
     tacaacagca tggccccgtt tgtgcagacg cgcgatcagc agacgcagca aaacgcggtc    123180
     gcgcagctgt ctcagcaata tggtctgttc tacttctacc ggggcagtga cccgattgat    123240
     gtgcagatgg ccggggtggt ggctgatttt gcgaaaacga acgggatatc cctcatcccc    123300
     gtgtcggtcg acgggcaggt ggcagcaaca ttaccgcaga gccgtccgga tacgggccag    123360
     tcgcatacga tgaacatctc gcactacccg gccctgttcc tggttgatgc aaaaagcaaa    123420
     aactaccgcg ccctgtctta cggctttatg acgcaggacg acctgtcgaa gcgcttcctg    123480
     aacgtggcca ccggctttaa accccactcc tgagaatttt ctatgacaaa aatacttttc    123540
     acgctcatcc gggatgcagg gcgcttagct ctgtacgctt ttgtgctcgg tccggcactt    123600
     gtgctgtatc tgtttgtgat gttagcggct tcagacggct cactttcccg gcagttcctg    123660
     acgacttttc acgatctgac tgacggcgta cctgccggca aagtgatggg gtgcattaat    123720
     gaaaatgaga tggcaaatcg tttttcaccg ccagaatccg gagataagtt cccgcctgcc    123780
     ccgaaagcac cgcccgaagt gttgtgtcag cgtggtcccg tggacagcca ttcatgggca    123840
     agttcgacag attctatgct gaggaatttc tggattatgg cggtgaggtt cggttgcgga    123900
     ttagggttta tttcccgtcg actgtctctt gccgcccaaa agcgtatttc accagacaca    123960
     cattcggttt tggtattgca gaaaaaggaa aaacacgaat gaaagcatca cttctcgcgg    124020
     gactgatttt ctggggcacg attgcccttg tgctgagcga attaataacg gtatctgtca    124080
     gcggaacaca aacatgcctg gtgtggctga gctatgccct ctggggcatt gcaggtgcga    124140
     tggtcatgcg tgccggtttt gtcgctttgc gggaacgacg caccagacgc agcggggtga    124200
     ccggtcatga aatgtaaaaa cattctgaca gcactcatgt gtcttatccc tgtgctggcc    124260
     agtgccggcg ttcgtgagga gctgatggcg ctggagtccg cgaaagccag cccggtgaca    124320
     accctgaatc ccgctgccag tccggtggtt ttgcctccca gcctgatgca gctgccggac    124380
     ggacgccggg caaacatgaa ggactacgcg gtcgtgctgt ttatgcaggc ccactgccag    124440
     tacagcgcga agttcgatcc gctgctgaag ggctgggccg atgagcacaa tatccgcgtt    124500
     tacccttaca ccctggacgg cggcggcgac gggtcttatc caaatccgct ggttccgcgc    124560
     aagactgacc cggcctcacc gattgctgat gagatagtca ccttctttgg caatggtctg    124620
     ccgattgcca cgccgacggc ctttgtggtg aatgtgaaca ccctcaaggc ctatccgctg    124680
     acgcagggaa tgatggaaat cccgacgctt gaaaatcgct gggccagcct gattcaggcg    124740
     gatatggata acgtcgaccc caacgctttg ccgccattgc ctgccagtgc gcaggtcacg    124800
     cctaagtaat acaaccggaa tacaaaatga ctacaaattc gtatgcgctg tcgcgtaccg    124860
     agcgcgtgtg gctgttattc agcgtcacct tgcttgtgtc cgccgtcttt tatggccttc    124920
     tcgccgccag ggtggtccgg gcgctttccc gtcctgacct gacgatgtac ctgcaggact    124980
     ttccggtact gctgctgatt tcgctgagcg gaggatttat cgtttctgcg gcaggccatt    125040
     acgccatgcg cgtcgcgctg aacaaaccac tgcaggggga ggcccgacat ggttaagtct    125100
     cttattacgg cagcctcaat ctttatgaca ggcatggctg cattgccggc gcaggctgat    125160
     gtgaacggcg atctgaacgg tttctttggc agtcttggtt acagtggcaa tgtttcccag    125220
     gctcaggcgt ggcagggtca ggcggcgggt tattactcag gggggtccgt gtatctgcgt    125280
     aaccctgtca aaaacgtgca gcttatctcg atgcagctcc cgtcactgaa cgccggttgt    125340
     ggcggcattg atgcctatct ggggtcgttc agtatgatca gcggcgagga aatccagcgt    125400
     ttcgtgaagc aaatcatgag taacgcagcg ggttacgcct ttgaccttgc cctgcagaca    125460
     atggtcccgg aactgaagca ggcaaaggac ttcctgcaga aactcgccag cgacgtgaac    125520
     tccatgaaca tgagctcctg tcaggccgcg caggggatta tcggcgggct gtggcccgtc    125580
     acgcaggtct cccagcagaa aatctgtcag gacattgccg gcgaaaccaa catgttctct    125640
     gactgggcct cctcccgtca gggctgcacg gtgggcgggc agagtaataa ggtgaccgat    125700
     aaggccgggg acgatcagaa agaccaggtg ctgaaaaaca agaaccttat ctgggacacg    125760
     ctgagtaaga acgggctgct ggggaatgac cgggcactga aagaactggt catgagtacc    125820
     gtcgggtcga tcatctttaa caacaatggc gacgtcacca ttctgacccc cctggtcgat    125880
     aaccgcgacc tgataaaggt gctcatgcgg ggcgggactg caaaggttta cggctgtgat    125940
     gaggcgacgt tgtgtctggg tcctgtcgtc aaagacctga cgatctcaga gtcgaacgcc    126000
     ctggtgacgc tggttaaaaa cctgatgctc tcgatgcaga acaagctggt tgatgacacc    126060
     gcgctgagca atcaggagaa aggctttgtg aacaccacgt ccgtgccggt gctgaaatac    126120
     ctgaccaacg cccagagcat gggcatgagt gcgacctatc tgctgcaggt ggctgacttt    126180
     atcgctcagg acctgatgat ccagtacctc caggagctgg ttaaacaggc gagcctgtca    126240
     ctggccggca agaacttccc ggaagaggcc gcggcaaaac tgcgcgacaa catcattcac    126300
     gcccagggat tactggctga catgaagctg cagtcggcag cggatcagaa cgcgctcgac    126360
     ggtatcgacc gcaacatgca atacctgcaa cagcaggtat ccaccattgt ttcaggctcc    126420
     tatcagagca actaccactg gggggatcgc tgatgccagg cataaagaaa tacagcttta    126480
     tcgatcccgg tatccggacg ctggttgcga ccctgaatgc atatggatta cgtacatatg    126540
     catcgtgtca ggggcatggt tttccggtag accgtattaa accctacatt gcatttactt    126600
     cgacgccttc agaagccgcg tcatttgccc gcagccttcg ccacgatgct gagtcagtaa    126660
     gaccaacgtt aaactgggga tgggagatta ctgccgggtt tgacagcgat ttcagactct    126720
     gtttccggct gcatcctgca ggcccgcacc gctgtaagtc acgtttctgc cgccgttcat    126780
     tcacagcaga ctttggcagg attcgcctgt taatcaaatc agcgcaagcc agttcagggg    126840
     attaatcagt cccgtatacc aaagcccgcc gactgtcagt gctgtgatcg ttaatatcgt    126900
     catgacaaac caataaattt tattgttcag ccgcgttcct ccaaacgggt cggttgaatt    126960
     gcatccgtta cagacttgag cggtaacact aagaggtttc tcgcaatcaa tacagcgctt    127020
     caggttcgtt gccatcaatg accttcttat ttgaggatat gcaaagtgaa catcaaaata    127080
     cccgtatttt atcgaggcat tattaatcaa tgtctcattc aacttactta caaaacaagg    127140
     tatttcccct cactcctgag caagattctt caacctctgt gtcagttact gtttccgtgt    127200
     aaattcagtg gggtaaacac tgatgcttga gatctacaca atttatggcg ggggaatgtg    127260
     gaaaacggcg ctggacgccg tggtcaccct catcggggcg aataccttca gtacgctgat    127320
     gcgcatggcg gggactttct cggtgctggc ggtgttgctg gcgtttatca aacagcgcaa    127380
     cccgatggtg ttcgtgcagt ggctggccat tttcatgctg atcaccacta ttctggtcgt    127440
     tccaaaacgc tccgtacaaa tcattgatat ttcagacccg gcagcggtct ggaaaacgga    127500
     taacgtgccg gtggggttag cggcgattgc gtcgctgacg accagtgtcg ggtataagat    127560
     ggcctccacg tatgacatgc tgatgtcgcg gccagactcg gtcacctaca gcaaaacggg    127620
     gatgctgttt ggctcgcaaa ttgtggcaga gaccagcgac ttcaccacac agaacccgga    127680
     gctggcgcag atgctgccgg attatgtgga aaactgcgtc attggcgaca ttctgctgaa    127740
     cggcaagtac acggtaaacc agctgctgaa ctctactgac ccgctggcgc ttatcaccag    127800
     taacccgagt ccgctccggg gcattttcaa aatgacctcc agcgcacgcc agttcctgac    127860
     ctgtcagcag gcggccacgg aaatcaggac actggccaat attgacgtga acccagggag    127920
     tgcgaccttt acctggctca cccggaaggt gttcggcaac aaacttaacg gtgccagcct    127980
     cctgtctaat gcgatgggtg agagttatgg ctatttctat gccggcggcc tgaccgccgc    128040
     acaaatcatg aaaaacaaca tcaccaacag cgcggtgcgc caggggataa aagggtttgc    128100
     ggcccgatcg tcagacacgg ccaacctgct gaacctggcc actgagaatg cggccaccaa    128160
     acagcgtctg agctgggcgg cgggtaacga gcttgccacg cgaacactgc cgtttgcgca    128220
     gtcgcttctg atgttaattc tggtgtgtct gttcccgctg atgattgccc tggcggcatc    128280
     aaaccacagt ctgtttgggt tgaatacgct gaagatttat gtgggcggat ttatctattt    128340
     tcagatgtgg ccggtcatgt tcgccattct gaacttcgcc tcaaacttct ggctgcagtc    128400
     gcagacaggc ggtacgcccc tggtgctggc caacaaaaat attattgcgc tgcaacattc    128460
     ggatgtggcg aacctggccg ggtatctggc gctgtcaatt ccggtcctgt cattctttct    128520
     gacgaaaggc gctgccgcta tcggctcgca ggtggccggt accgtgctca gctcagcagc    128580
     cttcacctcg gcaggcgtgg cctccaccac ggcggacgga aactggtcat tcaataatat    128640
     gtcgatggac aacctcagcc agaacaagct ggacaccaat ctggttcagc gtcaggggca    128700
     gcagacctgg caggcggata acggttcgac ccagactcag acggccgggg gccacacggt    128760
     tatcgacggc tcaggtgcca tgtcgaatct gccggtgaac atgaaactga gccagctggc    128820
     cagcagtgga ttccaggagt cggcgcgccg ggcagagcag caggcacaga cgtcgctcga    128880
     tggttacaac cacagcgtca ctagtggctg gtctcagctc tcgcagctgt ctcaccagaa    128940
     cgggtccagc gacagcgtca cgcagggcag cgaaaacagc caggcaacga atgcgacacg    129000
     cggtgtcagc atgatgatgt ctgcagccga aagttatgcg aaggcgaata atatctccac    129060
     gcaggaagcc tataactcgt tgatggatat cagtaaccag gggtcactga gtgctggagt    129120
     taaaaccact gtagggggag gcttaaatgt cggggtggct aaatttggtg ctgaagctaa    129180
     tgccgccaca gatgttcgtc atgccacagg cagctcgcgt gggatacaga attctgactc    129240
     ccatacgcag gatatgcgtc acggtaataa tagtcaggcg gtcaatgatt tccgtcaggg    129300
     gatggatatg gtatccagca gccgcgtaac ggatggttca aaccataccg acaatgccgc    129360
     gaccagtaac gtccagcagt tcgcggcgac gctcaacgat gcgcaaagtc agtatcatca    129420
     gtacaccacc agttcgacca gcagtaatga gttcagccgc atggcgaccc tggcgcaaaa    129480
     tgagagcgca agtcttgata ccaactacac ccaggagttt gtggactggg ctggtaacaa    129540
     atacggtgat aaggcgcagg ccatgctgac cagtgcacca agtgcccgcg aagcggcaat    129600
     ggaattcgtt aacgagcgtc ttaaacctga aattatgggt gactaccagc aggggcgtgc    129660
     tgaccttgtc agcggcaatg cacacgagcc gttcagtggg gcacatattg tgccgacaac    129720
     atcagtcgat tctgaaccag gatatggaag cactcgcacg gctggtgata gcggctacat    129780
     cgttgaaggg aatggggggc gtacattaca cagcaatggg cagtctgcag aaaataaccc    129840
     gagtacagtg acttctggcg gccaacatca cttgcctgaa cgcggaacag aatctgacag    129900
     tagcggccag gtccgttatg aggggccgcg aagttctact tccgggcgca ataacattaa    129960
     tgcagaaaca agggagggtg ctgcatctca ggttactgac agtggctcat ccgggcgtgt    130020
     ccacagcggc ggtgttaacg gggaggatat gcggagtttg tacaatgaga atcaagcgag    130080
     gctaaaagag catgccgggg agtattccgg gccacaaaac gagatacagc aaaaggtagc    130140
     aggacaaaga tctgaaaatg agcagaatat caacaaatct gctggggaaa ttggcaaaaa    130200
     acaatccact gttcaggcat ccagtgatat tctaaaagga gaagatttaa gcgctcaagg    130260
     caaattcttg aaaggtcaca aagaagctga aatagaccaa cagatgccaa ttgttgatag    130320
     cgcaaaacgg agagagctag agcagcaatt agctgaactc aagaacaaaa ctcgttagga    130380
     ggggaagtga aaaaaggtaa ttttcgctta attgcttttg taccgatgtt tgtcatgtac    130440
     ttcgggttcc cgttaattag ggatgtagtt ccgtttcatg acatttacac ataccaagat    130500
     tggtttgctt tattaggtat gtatgtgatt ggaaccctat tggccgcccc gcttatatat    130560
     ttattgatta aagactctgg taagcatctg aagctaggat taactgtacg ttggatttta    130620
     ttcctggtag caacacttca agttgcatgt atgtactatt tgtgggaaca aggcgcgcag    130680
     ctatatctct caatggcaat tactatgggg ataatcagtg ctatttatgc gtatggaacc    130740
     aaaagtacaa gcatcatgcg ggataaagac actgggaatc tctatcgtgt gcatcggggt    130800
     aaagcgcatc tgttatcaga gcatgatgta caaagatata agtcaggcct aagcgacaca    130860
     ggcaattcac cgtatgaatt ttcatcaagt gcaattgctg gtttcgatag tcatgcttca    130920
     gaaaacaatt tgagtttcaa ttcaagtatg tttagcagcg ataacttttc gtctggtatg    130980
     tctataaatc catcatctgg ctcgccaatg gtaggaggga tttcgggtca tgatataagt    131040
     ggcaacagtt ggggaacgaa cttcaacgag ccaacgaata cgtatgatcc caatcgggga    131100
     tactgacgaa aggggctaat cagccccttt tatatatcta aacctcacct accagattta    131160
     atctaaatat ctcaataaat cagccgataa cagtcctgtt agcgctccgc cgctagcagg    131220
     acgttttttt atgcaaagga taaataatga aattaaaaca atatgcagtc gttggcttag    131280
     tggcttcaac tcttgccctc tccggttgtg gcgccatgtc caccgctgtc aaaaagcgta    131340
     atctggacgt caagacgcag atgagccaga ccatctggct ggagccttcg tcagagaaga    131400
     cggtatatct gcaggttcgc aatacgtcag atcaggacat gtccggtctg gaaactcaga    131460
     tttcaaatgc gctgacggca aaaggctacc gcgtcagtca ttctccggat gatgcatatt    131520
     actgggtgca ggcaaatgtc ctgaaggctg aaaagatgga tttgcgtgcc tcacagggtt    131580
     tcctgagcac cggttatgaa ggtgcagccg ctggcgccgc actgggcgcg ggcatcaccg    131640
     cgtataactc cacatctgcg ggcgccacgc tcggtgtcgg tctggcagcc ggcctgattg    131700
     gtatggcggc agattccatg gtcgaggacg tgaactacac gatggtgacc gatctgcaaa    131760
     tttccgagcg cagtaaagca acggtcacca ctgacaacat cgcggccctg aagcagggga    131820
     cgtccggtgt gaaagtacag accagctctg agcagggcaa ccgtgccaaa taccagaccc    131880
     gcgtggtatc gaacgccaac aaggtgaacc tcaagtttga agaggcaaaa cctgtcctgg    131940
     aagctcagct ggcaaaatcc attaccggta ttctgtaaca tcctgcggct gtggcgtccg    132000
     tcacagccct tctccctgtt ttagcctgtt aacgaccacc tgctttaagc cgggtgcgtc    132060
     agtgctttct gttattcctg tgaaatttcg cttcctcgca tgactgcgcc tggcgcagcc    132120
     ctgtctgtgg cgagcgttgc gtccttaatg tgtaaggaat gtacctgaca tgatacctga    132180
     gagaaatgaa cggccgggtt actcagctga gttctggtgg ctcatccatc ttgaaagtga    132240
     actgatgatg acggccgtgt acctgcgggt attcggttca ctgccggagg ggaaggcgac    132300
     gactgatatt gcgtactggg ccggttatga atacaccatc cagcgcctgg aacctcgatc    132360
     ggtgcattca gcccgttatg ctgatgtggc tgcatcagtc cgggcgatgg ctgcgggcat    132420
     tgatgaaaaa gactggctgt ccggttgtca gcaggcggag tttgaactga gcctgactga    132480
     cgatgaagaa accgggcagg aatttaccag acctgactaa atcagcgcaa cacaccactt    132540
     ttaaggccac agccgcagca tcccttttgt gactccccac tttctgataa cccacatcac    132600
     ctgccggtga tgcgataact gccggacatt ttctatgagc tttgcaggaa aaaatcttac    132660
     ccagggcggg cagatgaccg cctaccgctg gcgcatgttc cttcaggtga ataactggat    132720
     tggtttctgg attttcattt tgttcgccgt gctggcgtcc gccattttct tctggcgcat    132780
     tccccaggaa accctcgata acggctccct gtggtggttc gcgtggatga acagcagttt    132840
     tatcgatctg atgccagcca gcgccccgaa actctacgac attcactact ggtacgcgcc    132900
     gacgcagacg ccgatggtgc tgaaaatgac cctcgcgcaa atctttaccg acccctacat    132960
     gacggcaatg ggcgatcagg tgctcagtga gctgcagtgg gctggcctgg caagcggcgt    133020
     gttcagtatg gcggtttttc tggccgtcac ctggtacatc gtggggatag ggcgtcgtga    133080
     gagcgaggat gaatatctct caggtatgac gctgaccgac aaagccgccg acgttaacca    133140
     gctgctgcgc cggaacgggg agttgtctga cctgcgcgtg ggtgacctgc acatggtcag    133200
     aatggcggag gtcatgaact tcctgatgca cgggaccatc ggggtgggta agtcgaccct    133260
     catccgctgg ctgctggatt acatccgtaa acgcggtgac cgggccatta tttacgactc    133320
     cggctgtacc ttcaccgaaa cccactacaa ccccgatacc gacttcattc ttaacgcgca    133380
     cgacgatcgc tgcgcgaact ggcagctgtg gggcgagtgc gtcgatgccg ttgattacga    133440
     caatatggcg tcgagcctga tccccgtgga aggtgaatcg gacccgttct gggtctccag    133500
     ctcgcgcacc atctttgcgg acctggcgat tcggatgtcg gttgacccgg accgcagtat    133560
     tgagaaattc ctcaaaaccc tgctgtcact cagcatgaaa agcctgcgtg agtatctggc    133620
     taacacgccg tcggccaacc tggttgagga gaaaatcgaa aagaccgcca tctccatccg    133680
     ttctgtcgtc accaactatg cgaagtcgct gcgctacctg caggggctgg atgatggcgt    133740
     caaaccaccg ttcaccatcc gcgaatggat gacaaaagag gagcatgaca gcagctggct    133800
     gtttatctcc actcaggccc ggcaccgtaa aagcgtgcga ccgctcattt ccctgtgggt    133860
     gtcactggcc accatgatgc tgcagagcat gggggagaac agcgatcgtc gcgtctggtt    133920
     catctacgat gaaatcccga gcctgcagcg tattcctgag ctggcagaaa ctctcgcgga    133980
     agcccgtaag tttggcgggt gctttgtact gggcatgcag aacatggcgc agctggtcca    134040
     cgtctacggc cgggaactgg ccaaaagtat tttcgacctg atgaacaccc gtatgtacgg    134100
     tcgctccccg agcgccgaga tggccaaagt ggtggaggag gagctgggta accagcgtaa    134160
     acgcaaaatc cgggagcaga acagctacgg tctggaccag gtgcgtgacg gtgtgtcgct    134220
     cggcaaggat gaggtcaata acccgatagt ggattacgag caggtgatgc gcctgcccaa    134280
     cctgaatttt tacgtgcgcc tgccgggtga gtatccggta gtgcgcctga agctgaaata    134340
     ccgtgagcag aagaagcacc accctggcct gatagagcgc aatatccacg acgccctgag    134400
     tccggagctg gaaaaggtga ttcaggccaa tgaacgggcg gcctccgtcg cgggccttgc    134460
     cttcccgacc ggtgatgagg tgctggagaa aggcagtaac agtgaaaccg ccaccacgat    134520
     aaacacgccg gcaacggtcc ggcaaacgcc tgtggtggca aaacccgtga ctgcctcggc    134580
     gatatcgcag aaacctgcgc cggccgtgac cgccgtgaat aagcccgatg agccggtttt    134640
     accggttaaa cacagtccgg tgacaccccc tgccactgaa cctgaaaaaa acaacctggt    134700
     atcgcttcac agtatccgtc agaccgcgcc ttccccggac agtggtcttc ctgtcgcaga    134760
     aacaccttct gagcacgctg tgtcttctgc accctctgaa gcggcagcct cagttgtccc    134820
     ttcggttgca ttacctgcag ccctgcaaag tctgcgtaac cgccccgttt cgcctgagcc    134880
     agcgccgacg tccgcccttg gcatgctgca aaaagcccgt cagcgcccgg tcaacacgga    134940
     aagcgatcag cagggtgagg ataatgccgg cggggaatcc atgaatctcg agatgcatgt    135000
     ctctgaacgg gcagacggtg gcctgagcat cacgacggca ggtcaccctc ccgagcctga    135060
     acacgcggct gaaacccatc gtgtcagccg gcaactggcc caggaagaag agaacatttt    135120
     acgtcaccgt gagccggacg atccgggtta cagcgattac gaccaacact acgatgacag    135180
     agagccagac ctatgatgtc agtcgccccc gtagcctcag ccggcggagc cgccggctac    135240
     tacagcaatg ccgataacta ctatttcctc gggaatctcc agagcctgtg gctgggagaa    135300
     ggggcgaaag ccctgggtct tgagggcagc gtccgggggg atgacctcac ggccgtcctt    135360
     gagggtcgtc tccctgatgg ctcgcgcctg gggaaagaga ttaacggcaa ccacgttcac    135420
     cgtcccggtc atgatctgac gttctctgcc cctaaaagtg tctccattct ggggctgatt    135480
     ggcggggata aagcgatggt ggaagcccat aaccatgccg tccgggtagc ggccggttat    135540
     gtggagaagc ttatctccgc gcgcgacacg aaagacgggg tcacttccat tgttcacacc    135600
     gacaaaatgg tggccgccgc gtttacccac gacacctcgc gtaatctcga tccgcagctg    135660
     cacacccatt tactcatcgc caacatgact gagcaggacg ggaaatggaa agcgctggcc    135720
     accgactata tccataacgc cggctttatc gagacggtga tgaagatgca ggtcacgctc    135780
     gggaaaatct accgcagcgc cttgcgccag cacgtggagg ccctcggcca tgaggtggag    135840
     gaagtcggga aacatggcat gtgggaaatt aaaggcgtcc cggaggacgt tcgtgacgaa    135900
     ttttcctccc ggggccgcga aattcagggg gctatcggtg cggaggccac actgcgcagc    135960
     cgggatgtgg cggcgaaaga tacccgccag gcaaaggtcg atccgtcccg cctgcgtctg    136020
     atggatcgct ggctcaatca gatgaaagac aagggctatg atctcaaagc ctatcaggag    136080
     agcgtggtgc cgcgtgatgc gggtccacgc gaagcggcga tgccgcctga acgcgttcct    136140
     cctgctgcca cggttcgtac cgtgcctgaa tcgctcaccc cggagaagac ccccctgacg    136200
     gtaaaagccc ctgagccaca ggacgtgtca cccgaacggg aaaccgcgaa caaccagaca    136260
     gaagcacaat cgactgacac tctgagtcag ccggttcatg ccggacccgg aaaaatgccg    136320
     tcaactggca cctctcttcg ggaaccgcag ttgcataccg acgcccccct gccggagctg    136380
     gctgaagctg tgcgtctggc catctcgcag ttaagtgaca gtaaaacccg ctttaccttt    136440
     ggtgaactga tgctgaccgc cgccgaactg agcgacaccc tgcccgatat gaaccaggtc    136500
     cgtcaggcga tcgacgtctc gcttaaggag ggcatgatag ttccgctgga cagtgagaaa    136560
     ggcgtgttta cctcccgtat tcatctgctg gacgaactct ccattcaggc cctgagtcag    136620
     gaacacctga aatccaccgc cgtggtcagc ttcacccgcc cggaacagta cgcgccgccg    136680
     gccctgtctg tcgtggaaaa ggatgccctg gtgctgatga atgccccttc cggtgtggcc    136740
     ggcatccgtg acctgaccgc tcagctgacc ggtatttcac tggcgcaggg ccgcgacgtg    136800
     caggtgcttg cgagctcggc cgagcgtgcc ctttcgcttg aaaaatccga cgcgctccgt    136860
     gaccggctgg tcagtcgcca gcatgtcctc agcggggact ttcatcttaa accccagagc    136920
     acgctgatta tcgaaggggc ggaacgtctg gggctgaagg agactctggt cctgctgggt    136980
     gaggcgaggg cgcaggatgc gcagctggtt tttctcgaca gcgcaggtcg acaggccaat    137040
     ggcaatgcca tgtcggtgct ggagtctgcc ggcattgccc ggtcacgccg gaccgaacct    137100
     gcaccggggc tggaggctga ggtggtcagc attacgaaca aacgtgaccg ttacgaagcg    137160
     ctggctatcc ggtatgccga tttgagcggt ggggctgaga atgttaccgc tgtggtggtc    137220
     gggaagcgcg agcaaacgca cctgaccggg cttatccggg atgcccttca gaatgccggg    137280
     cagctggcac gcgaaggtgt ggagatagag gcacgccagc cggtctggct tgataccaaa    137340
     acccgccgca tgtccggctc ttaccggcct ggcatggtgc ttgaggaccg cagcgataaa    137400
     aaagagcgtc atagctacgt tatcgatcgc gtccatgagg acacccgtat gctgtccctg    137460
     attgacggcg acggggtact gacccgcatg aaaatcagtg aggtcaccgc cgactggcgt    137520
     ctgtataacc gtgaaaccct cagcgtggcc acgggcgaac gtctgatgtc ggtggccggt    137580
     gaccgcgagc acaacctgaa agccaaagac cggctggaag tgacgcagat cagcgagaaa    137640
     ggcattgagg tgaaaagggg ggatgacatc ctgatgctgc cgaaagacca gccgctttac    137700
     gtaacgcacg catacgtcag cgccccgggt gggcgcgata acgacgcggg cgtggtgctg    137760
     gctgccctca acagtcggga tatttccacg caaaccatga actcactggc acagagcggc    137820
     catcgcgccg aagtgtttac tgccgaagac caggacagag ctgaagcccg cctgcaacgg    137880
     atgaaaacaa atgcctcccc cgtgcagctg gtccgcagcc tcagcgggaa ggaggatgtg    137940
     agcgaggcag tgggccgtct ccatgacagc gtgagaacag aggccgggct tgccgtatgg    138000
     cgtgccatca atgaccagcg acatgtcacg ttcagtgaac tgacgctcgc gagtgcggcg    138060
     gaaaaatatc accccgattt tgaccagatt ggcgatgaaa tctcgtcgat ggtgaaacgc    138120
     ggcgacctgc tgaaggtatc ggccgggggc gaacccctgc tggttgcccg ctcgacctgg    138180
     gagatggaga aagccatttt gcgggtcgtg gatgagggga aaaacacgca gcagccgtta    138240
     ctcgaccagg tgccttcggc agtgcttaac gggctgacgg ggggacaaaa acaggcgacg    138300
     tcgctggttc tcggcagtac tgaccagttt accggtattc aggggtatgc cggcgtgggg    138360
     aaaaccacgc agatgaaagc agtggtggcc gccctggaga cgctgccggc cgatgcgcgg    138420
     cctgcgctga cgggactggc cccgacgcat caggccgtga aagagatgag cgacgtgggt    138480
     gtgcgtgccc agaccattaa atcctttatt gttgagcatg accaggccac ggcggccggt    138540
     gagaaacctg actacaagag tcaggtcttc ctgattgatg aatcctcaat ggccggaaac    138600
     caggacacgg cggcgctttt ccaggccatt gccgccggtg gtggtcgtgc cgtctcgatg    138660
     ggcgacattg accagtttga agccgtcgac tccggtgcgc cctttaagct gatgcaggag    138720
     cgcagcccga tggatgtcgc gattatgaaa gagattgtgc gtcagaaaga tgtgcagctg    138780
     cgcggggcgg ttcacgacat catcgacaac cgtatcgatg ctgccctgaa acgcattgag    138840
     gcgcagccgg ttgaccgcgt ggcccgcgaa gcggatgcga ccccgcccga cagtgcattc    138900
     cacgaaacgg agaccccggt ggacgatatt gtgcgtgact ggacggggcg ctcccccgag    138960
     gcgcgtgccc ggacgctcat catcacgcag ctcaacgctg accgccagtc ggtgaacgcc    139020
     ggtatccaca ggcagctgcg tgagcgcggt gagctgggga acatcgccat caccgttccg    139080
     gtactcgata aaatcaccca cacgcgtcac gagtttaata aaacgcaggc ctggacggca    139140
     ggcatggtgg tgaaacgggg cgaccgctac caggacgttc tggccgtgga ccgcaacggc    139200
     aacacggtca ccgtgcgcaa tgaggagggg aaaatcggac tgtactcgcc gagggagctg    139260
     attaccgggg acgtgcagct gtttaagcgc aaccagatag aagtgcggca gggcgacctg    139320
     ctgcgcttca cggccaccga ccgcgagcag gggcagacgg cgaaccagcg ctttaccgtc    139380
     gagtccgtca gcgagaaagg ggacattcgc ctgcgcgggg aaaaagggat ggtcaccatc    139440
     aatccggaca gcgtccgggc gcagcagcat ctggactacg gctgggccgt gacgggctac    139500
     ggtgcgcagg ggacgagcac ggattacgtt atctccctgg agggaacaga ggaagggcgc    139560
     aaggcgctgg ccacgcggcg ggcgttttat atttcggctt cgcgtgccaa agagcatgtt    139620
     cagatctaca ccgacggcaa agcagactgg acgaaagcgg tgacccggcc tgagcgcgac    139680
     atcaagaccg cgcatgatgc ccttcaccct gaaacccagc gccagcaggc gagggccatc    139740
     tgggcaatgg ggcagcctgt gagtaaaacg gcgattggcc gggcctgggt ccgtcatcag    139800
     ggcatgcagg acacctccct gacggcgaag attattcccg caacacgccg ttttccagag    139860
     ccggcgctgg cgctcccggt ttatgacaat aacgggaaaa gtgcgggtct ggccctggtc    139920
     tctctggtct ccagcccgga ggggcgactg acgcagggtg acacccggat ggtcatgacc    139980
     gaaagagcac gcggggcggt gcttcagcgc agtcagtccg gtcataccca tgtcgtcagt    140040
     gacctcggtg ccgcgctcga ggcggtaaaa gcgaatccga aagacggcgt ggtgtggcag    140100
     acgggcgaag aatcaccctc atcacatctc ataaaagtga ccggcggtga acgacaggat    140160
     gcggaagaga gagcggccat caacgtcagc cggcgcgaaa cggacattgt gctgccggaa    140220
     actgaaaaac agaagccgga acaggccatg tcagcagaca ccgaaaaagc ccgtgaacag    140280
     gaggcattgc gcaggattgc tgaagaaact ctgcaaatta aacctgagtt cacaggcact    140340
     gaagcaagtc aagaaagcaa cgaacctgac cgatctacac tcaaaaacat tgccagctct    140400
     gaagacattg cggccagtga tgccgcgcga agacattctg aaaaggctga gattgtgcag    140460
     gacagaacgc ctgaagagcg tgccggcgca tcgagagttg tcagcgaact ggcgaacagc    140520
     gagcgggata ttgttcgcca gccagagcct gcagagcgcg gccgtatgcc ggagcgtgat    140580
     gaacagaccc tgacccatac catccagaaa gaacgctaaa ccttcctata ctgacctgag    140640
     aatttcctat gaaaccgaca gcattaagct ctttattagt tacaacatac atattttttg    140700
     tttcgactgc acacgcctcg acccctgcgg tcgtattcag tcccgagcag gaggcgcgta    140760
     ttggcgaaat cgctgcagag tacctgactg cgcatccgga catcctggtc acggtgagta    140820
     tgaaattgca ggaacaaaaa cgggaacggg agcagctgaa gttcgccgtc cgcgtgatgg    140880
     ataaccaggc ggccctgctg aacgatccgg atacgccatc ttctggcccg gctaacgcgg    140940
     gcgtggcggt gattgaattc tttgattatc agtgtgtgtt ctgcagcaaa atggccccgg    141000
     aaatggaggc cgtcatgaaa tcccgcccgg acgtgcgcta cttcttcaaa gaatggccta    141060
     tttttgggga gcgctgggaa aattcaacta aagccgcagg gtatggcctg tctgtctgga    141120
     aacaaaaggg ggctgaggct tatgtgacat accacaatgc cgtctatgcc accggacacg    141180
     atgaagggaa actgaccgga caggatattg tgcaggccgc gggtctggcc ggctttacgg    141240
     ggccggtgag ggatgatttt tcaccgcttc ttgcccgtaa tgatgcgctg gccagagcgc    141300
     tcggtctgac cggaaccccc ggcatcattg tcatgcccgt gaaaggcgcg acgcccaaaa    141360
     atatcaccgt attccctgaa tatgttccgg cagcgtcact ggaagccgct atccagaaag    141420
     cttctaccgc gcactgactg acaccccggt gagcgggttc ccgccagaat ccgctcagaa    141480
     ctggcttcag tgcgttcctg cctgacttac cctctgcact tttacgcttc ctcaaacagc    141540
     cggacggtct gttttgcggc gagcgttgcg aaatagccca tttccagact tattctttcg    141600
     tggctgatgt ctttctgcac gcgatatacg cgatcctgat ccgtttagca cgctattcgg    141660
     gatcattacg tatggaaaag tcatgtgtga aaaggtaaac ttcaggggtt tacgggagcc    141720
     ttgtggtggg gctgaccgtt gatttagttt tgtgacctga ctcaaattta tatttgactg    141780
     ctttgtggtg aggcagagag gtggcagaac aattttcggg agaaatgcgg acttccgaaa    141840
     acaggaacac ggatggggcg tgtccataac gacgctcagg agcaggtgac agccttttgc    141900
     tgaaccctga atgcacaaac cccctgatat ctttctcaac ttggcggaag ggtagatatc    141960
     agggggtcca aaagcaggcg cgatgcctgt gaaggattat aacgcatgca ccatagaaaa    142020
     caatacccgg ccgccctaag aacaggtcgc cgtgaatgag aatctaacct cagtccactg    142080
     gtcaaacctg cctgcagatg agcaagtcca gttctggcaa gatatcgatg ccggaaaaca    142140
     ggatggcttt cttgtcgcgt ccgttaaaac gctgacccgt cgtcagcgcg gcgaccattc    142200
     aacgaaaccc aagtgtgaaa atccagcctg gtatcgccct gagcattata aaaagctgtc    142260
     aggggaactc gatcatgcct ataaccgact ggtacagaaa gataaagaaa ccggtcaggt    142320
     cagcctgcgc atgcacgtct cgcggcatcc tttgtatgtt gccggccgcc gtaaagccgg    142380
     tcgcaagtac ggctttcgtc cggagcgtca gcgtctcctg gatgcgctct ggcctgtgct    142440
     tatcagcttc tgcgatgccg ggaaacacac cgtcggtatg tgtatttcgc gtctggctaa    142500
     agaactgagc gcaaaggaca gcaagggcaa tgttattcct gaaacagagg tgacggtgtc    142560
     acgcctttca cggcttattg aggaacaggt tcgctttggt gtactgggtc tggctgaaga    142620
     acgcacatgg gatcgtgagt ctcgctcctg gctgccgacg tatgtttata tcacgcttgt    142680
     cggttttcag atgctgggtg tgaatgtcag taaactgacc cgggaacagg acaaaaaact    142740
     caagacaagc gctgagcgcg accagctgat acgtgaaggt gtcatgaatg aatacgatga    142800
     gatatcgcct cataccgccc gtaaacgctg gtacagccag aagcagcggg aggcacttca    142860
     ctaccggcgt aagaaagggg ctgaacgtaa gcgtgccaat cgtcttatca agctgcccgt    142920
     ggatgcgcgt atccatgcta tgtcagcgtg gatctacaaa acaatgccgc ccgacgaggc    142980
     gtactggtgc acatccgaac gtctgagggt gctggccatc cagcatctct atcagctgga    143040
     tcttgcctta tcacctgctg agcagacctg ataccgtaac acattcattt tttctgaatg    143100
     cccctgaccg gggcttttgg cgttggtttt ttatcacaaa attgcctttt tattgtgcag    143160
     ctcggcgcca tatcttcttt ttttgcccaa tcccatccga tctggcacgt cccgacgacg    143220
     tcatttcatt tttttccaca gaaacccgca aacgaataaa tcaggtaagc cgcatacaga    143280
     taacaccaaa cccgcaaaat aatcttaccc cactttttta tgtccctttt catttcatga    143340
     caggataaat ttttgtcttc cgcaactctg tggataaatc ataatgcctt cgcatgcaat    143400
     ggcctcacgg ccatgcgctc agagaaaaga taagggttcc tcccgtcgca agcgccgggc    143460
     cccggtctgg ccagaatcca gcattaagcc ccccctgacc cctgctaaac cgacgccgcc    143520
     ccggcccgaa gggccggaac accctcgctt taagagggat gttgtaacta gtatccagcc    143580
     gctgccacag accttcatgt cctcgtgccc gccacctacc ggcaaagctg tatcaaagtc    143640
     atgtgccagt gaaaaaccgt ctggcaggaa ggggggtgat cacgtttccg gaacctcttc    143700
     atcggggagc ggcatcttta ctgctgaacg tccggattcc aacgtcaaaa catgtatcgt    143760
     tcgcgaagct cactcccata ctcaccaccg tctgaagtca ctggggtcag tccgggaaac    143820
     ggaacatttt gtacggtaag cggggtttga agcccaatgg aacggaaacg tactttcttt    143880
     actcggccaa tcagctcaaa aaatgcactt agcgtacgat atcgtacggt tgggcttcaa    143940
     acccctgaaa cgggggcgca gcacgccggg gaagggctga caccccgtaa accggggctc    144000
     tctcaccaga gctgcatcag gatgagcagt accagcaggt ggccggtata agcaatgtag    144060
     aaaaaatgtc ggggcataaa gcgctgatcg cctgcaggac accactggat gctcagggat    144120
     acggccatca gggggaacac cagtgtcgga agggtggcga ataacagcgt gtctgccggc    144180
     agactcagca gatgcgatac cccgttcagg ctgcacagcg acagcacggt cacgataatt    144240
     cccgcacgct gcacgccggg cgtttttccg cctgtcgctg tcaccatgcc ggtggccagg    144300
     gcaatacccg ccagaccgta actggccgga ctcagcggcc agacaaggat gcccagcacc    144360
     agagcgccgg ccatcagtcc tttcttcccg taccggtact gcagggcaag cagctgcgtg    144420
     acgcctgcga acacgaacag gatattcagt gcccaccagg gctgatgccc ggcaaaggcc    144480
     agactgaaca ccggctgggt gatgacggcc catatccact gacggttcgc cctcacctgg    144540
     agccgttctg gtctgcgctg cacgttcatc gcccagataa gcgtgaacag ggggaaggcc    144600
     atccggccag ccgcatacgc cagcggttcg gggggcgtca ggaacagcgt gttgatgtgg    144660
     tcgcccagca tggcgagcag cgccagtacc ttgaccatat ccagggcggc aggactgacc    144720
     ctgccgggag tctgaagact gtgaagaagg ccaggaactg aatgattcac gcggtatatt    144780
     ctcctgacgg cacgcgctca gcaaccagtt ctggacatga tgccagaatg ccctgcccgt    144840
     ctgtgacgtc acgcggacct ttaatttttc cagaattttg cgtgccgcaa actccgattt    144900
     atcccgcagc acacgcatgg cgcccgccac atcttgattc tgaacacaaa gacttaaaat    144960
     atggaaatcg ttcatcaccc ttcctttctg cccctttaat tatcggcaca gaaagggaaa    145020
     tatttatact tattttatta tattcaatga gttataggaa aataaaaaga ctttttcagt    145080
     ataaaagctt gccagtcctc aaaaatgatc tttatgtgaa tcacagtgta tgattcatga    145140
     caaagagaac aaatatgagt accagaaata atttatggac aatttttccg atagtgccaa    145200
     aacgtccagg actgatagca ttttttgtat gtcgtcggga tgtattcgtc gaaaacggag    145260
     cattacatga caagggctgg acagaattac cttaatgtct aaccgcgcgg gattaatccg    145320
     agtgggaatg cagaaccgac cgggctacgc tccggccgga acagcagttc tagatcttgc    145380
     tcttacagta agcgataagt gccgagacgg ataagggtac tgttccgtct tccattggcc    145440
     ttgaaggaat gaattttgtt tttcgagcag cattcgcttt agctacattt cgttgcttac    145500
     tgatcgggtt agtagttttt tggttggcta attttttgaa tctatcaagc caatttgcat    145560
     actcattacc tacagctcga atcagttttt tgagatcggg gtctgttgct ctattataaa    145620
     aatcttccat tttattcata tgctgacgag ttgttttctc ttcattcagc gcatcaagta    145680
     cttcctgata catatcaatc tccgccaatt taaaaatgtg attagagcat ggtttcaatt    145740
     cctgggcaaa atgactgttg tgtccaggtg agcagagaaa gccgcagctc ggcttattca    145800
     tctagaatca ggctggtctc gaacagattt cctgttttat caaaactaaa ccaatatgcg    145860
     ttatagtctt tatcttcgca gtttacataa agtttccctg tgaagtttaa atctgtgtag    145920
     gttccatcct gattatcttt gagtaaccgt ccttcttcgg aaacaacata gaatggacag    145980
     aaaaactcta aatcttttgt gcaaaaattt tcagaagtgg cggcttcggg tagtggtctt    146040
     ttcttgtacg tgatgttatt tacaaaaccc atgattgtta ccttatgttt atggatttaa    146100
     ttacctgagt gtccattttg aacctgcagg aatccatttt gaatcaagtg tgattgggga    146160
     atgtaattga gcaaacatat ttactgtagt tccaaaatta gcgcatattc tttgagtaat    146220
     aactatcact ttttgttcat cgctaatagt atgggtttta ccgtagtagt cacaagtgat    146280
     ttcaatgttt ctaaatttaa tgctttgtgc tccgtcctta tcaatggcat taatgttaac    146340
     aacagagatt tctgcaatta caggaaatga gaaaaaatat aaataaagtt aggagctttt    146400
     tcattatgcg cttactagtt agtgattata tgttccatcc tactaggtca gatcactgtt    146460
     ttccagtaga acacgacaaa atagcaggat ctggacggta ttacctgaac gaccaagtgg    146520
     tagaaaatga tggacagaaa atgctgtatg tctaactgcc tgggaaatta acccttatta    146580
     tctcattcgt tcgcttgcca gattataaac atcacttctt tcgcgtttac ctacggctac    146640
     aacagcgata atcaattgat cgtcaatcac ctgatagacc aggcgaaaac cagacgcacg    146700
     taattttatt ttgtagcagt cctttatccc acgcagcttt gcagagggaa tatgaggatt    146760
     ttcactgcag ttcttcagct ttttagcaaa ttgctgctga atggacttat ccagcttcat    146820
     ccactctttc agcgcatcat ccctgaattt gactgtgtaa gtcataagta gctatccaga    146880
     tccacgtcgt gcagttgctg gttgctgcgc tcggcgacca gcttaaccag ttcctgatca    146940
     tccagggcat cgagcatctt ttcgtacagc tctgcgggta cacaataaaa ggctggctgg    147000
     ttacggttca gaatagcaac cgggtagcca tcaccggcgc tgactgtagc catcggattt    147060
     ttcttaagct cgcttacact ggcgcttgtg tcggtaagaa tgatattagg cataaaacca    147120
     cctttaagac tgtttaacca gtcttaaagg tactctttac atgacctgtt aacaagtctt    147180
     ttgtgttttt ttcgtatgga cagaatcacc tgaacgtcca atgtgactga aaggcagacg    147240
     taatatgata aaatttcctg cacttacagc taatgcaatc agacaagaca acccggacgg    147300
     cactatgacg cagaaaacac tggcagaacg ctttgatgaa ctggaactgg aatatcagga    147360
     agtcatatcg acaacatata cagcattcag cgagttttcg ggaaaaaaca aagaatatgt    147420
     ggattcacct aaatataaaa cctggatagc cagagctaaa aaactaatta ctgatagtta    147480
     tggaaaggat tctgattttt atacggggtt tgttgaagca gagagcgggt tttatgcatc    147540
     aaatcatgaa attctgacca aacagttaaa acctgcattt gatgcagcga aagcagattt    147600
     agtttattcc attccggcaa tatcaaatgc tttggcaaat ataaatgatg ggttagaact    147660
     cataataaat attctcaata aatttcctgc tttttgccgt caattaaaga aaaggcacga    147720
     tggaaggcca acgattgaaa ttagcgatga atatgatgta caggatctgg ttcattcact    147780
     tctggtgctg cattttgatg acgtcagggc agaggaggct tcaccgagtt atgctggctc    147840
     gtcatccaga caggactttc tgctaaagaa ggaaaagata gtcattgagg tgaagaaaac    147900
     ccgtaagacc ctcagcgctg gcaaaattgg agaagaactg atcattgata tggcccgtta    147960
     ctgcgcacac ccggactgcg acacgttggt atgttttgtt tacgaccctg atggctgggt    148020
     gaataatccg aaaggagtga taagcgatct tgagagagga gatacagaag gtaagaccag    148080
     ggtggtgatt gcccagttct gatattgact gttgccatct ggattgaatt acctgaatgt    148140
     ccaggcaggc gcggagataa cgtaacaggt gggatttgcc agcagattct gagctggccg    148200
     cgcagccggt ggtggtgaaa tgctggcgct ggacagaaca acggttatgt ccaggtggcg    148260
     tggggattaa tgggaggtgg ccgcagcggt attccggcgc actgtcacgc cctggccgga    148320
     gttaccaagg gtcagtttgg aaatgcacta agcgtacaat aatttccgat atccaaacgg    148380
     accccaagtt gcactcccgg catttcgtac taaagctatt tcgctggtac tggccggggg    148440
     cgtcgtagca gccctgttag gcccgtttct ggccagtctc ggcagtgtat tgttcagtgt    148500
     gccgtatgta ggctcattcc tctttatggg cataatggcc tcgctgggcc tgttgttatt    148560
     ggcacgtttg cagataccgg cccagcccgg tgaaccttcc gggcaagtgc cggcaaggcc    148620
     gtgtaaaaag tggtttctca gcctgcgtat cttgtcgccc ttttttccgg ctcatccgga    148680
     tttggaataa tggttctggg cctgacggca acgcccatcg caatgaagca ttacggtttt    148740
     gacttgtcac aaatcgccgt cctgatccaa ctccacatac tgggccgttt cgtacccgtg    148800
     gttttttaca gcattggacc tcaaacacct tatataagtc attagcatac tatctaattc    148860
     atcaatcaac atcatgtgat gtttcgaatg aaacattatt tcaataatgc ctaaaaactc    148920
     acattcgacc ttttagctaa agatgtttaa tgtgatctac gtcaagattc tgatcatcat    148980
     cttccgggat agttcacgcc ataaattaag ttttgtcgct aataaagaaa caatactgtc    149040
     tacgaataat cgaacgaatc tagataagtt gacattcaac ttctttaata ttaatgagat    149100
     tctttaatga aatcaattaa atacgctgta gctatagctg tgtgtggtgt tatcttctct    149160
     tcttctgttt acgcagggca gtttatgact gtggaagcaa aagctgaagc tattcagcaa    149220
     attcgtaacg aagcgaatgc tgcaaaatca atcattgata tttatcaagc acatcctgat    149280
     aattcaatgt ataaccaatt gcaacttgct cgcgatactt tcgatggtgc tgctttacgt    149340
     attgctgata ttcaggctac acctgctgct ccagtagcta caccatctaa actgatgaat    149400
     gttccgcatc aaattccagt attagctcct cagcctaacc ttattacccc agttactcca    149460
     cagcctatag cgcttcctgt taagcctatg gctactcctg ctgctactcc agttaaattg    149520
     cagcaagtac ctcaaccaat ggcaacacct acacctgcta ctgttaatgt tcctaatcct    149580
     attgctgtat cacctaagcc catggccatt cctttagcta caccagcggc gatccctcag    149640
     aaattgcaac aaactcctgt agcaatgaat gttcctcagc ctcagacggc agcaacgcct    149700
     attcctgtac ctcagcctat ggtttctctt ataccaattg ttaagggtac tagtactcct    149760
     atcgccactg gcgttagcgg ccctcacaca atcgtgccta tactttcttc tacagctgtg    149820
     aaaacagtag acgctaaacc gagtacttta actacaggta taatcaatac tcagaccact    149880
     gcatcaacca cattcggcgc tgttgatggt aaagatggtg aaaaaggcga taaaggcagc    149940
     gacggtaaaa acggcgtaac aaccaccatc acgaagatgg aagttgatac agctatgcaa    150000
     gcaaaagtag tagcaaacac cgcagctatc gcttctacag ctacccaaac cgctaccgta    150060
     gctaaagatt tgcaggatgc aaaacaggtc cttgctcagc aacaagctaa cagcaatgca    150120
     caattcaaaa gcttgaaaaa tgaaattgac ggcaacaaaa aagaagcacg tagcggagtg    150180
     gctagcgcta ttgcgattgc atcaatgcca caggttgaag caggtcaatc agtgatgttt    150240
     tctgctggtg taggttcatt caaagatgaa caagctctaa gcgtcggcgc ttccttccat    150300
     gctggggagc atgcagtgat caaagctggt atcagcgatt caactaataa tgatctgtct    150360
     atgggcgcag gtgtcggaat cggcttttga tttatctata acgtccctat aatggggtgt    150420
     atagaaaaga agtctgttta gcatcctagg gtatgggttt gtttgttaca tagcgttaga    150480
     tagacttctt ttttacactt tccagatgat atatttatga tcaaacttat tattctaact    150540
     actatccttt cacttgcatt agttcttact ggtttctttt ttggctacat atactttgtc    150600
     ttatatgttt attaagctca gtctattcat tatgaaagga ctataatggt ttggttataa    150660
     ttttcggtat ctattttgtg gctattatgc tgcgaaataa atttgatgaa atgacatata    150720
     gcggtgatta aatgaaaaaa ttaatgatgg tagttgttag catctcaatt cttgcaggat    150780
     gttctacaga agctgatcgt atggctaaat gtgaagcaca agggatagat aaacccactt    150840
     gctatcttgc tgaacaaaac cgcactacag ctattaatgc tgctgctgag aaacaggcac    150900
     tcgaaaacgc ggctaatgct gtacaacacg cacaagcagc acatgtaatc gatcctatgc    150960
     gggaagctac gctaacgggt ccaggtgtga aagctaccgt tagtaacggt tttttcaagg    151020
     ccactatcaa taacaaaaag gctaaggtta agcgcctcaa cgcgaattac tatgaaatta    151080
     gcggggctgg ctacatcgtt tctatctcgt tggataaaga aggtatacaa agcgcctctt    151140
     atacaaaaca atattctaaa acgaatggga ttatgcaggt acagcaataa taaaagaagc    151200
     cccttattat tgtggagcca ggtgagcatt tcctccgcaa gcaaaaaacc tttatctgtc    151260
     cgcatggcgt gggggtaaag gtggagaatg cagatttttt gcagcgcccg gttgaagggg    151320
     gacaattcca gggatacggc aggttccagt gacctgatct tcggtctttt ctggttgctg    151380
     ggctatcagt tctctcctcg tctggctgat gccggagctg taagcacacc cgttttagtt    151440
     ccacgcactt tttgagattt ccgtgttttc ggccatcaat ctgtattctt ccggcgtcag    151500
     gttattcagg gattcatgag gtcgctcact gttatattca gccagccagc gctctgtaat    151560
     ttcccgtgct tcattcaggg ttctgaacag gtaaaaatcc agtatttctg tccggtacgt    151620
     ccggttaaac cgttcgataa aggcattctg ggtcggctta cccggtttga taaagtccag    151680
     catcaccccg tgttcttccg cccactgcgc cagtgccagt gagaccagtt ctggcccgtt    151740
     atccatccgc atcttcagag gatatccgcg gtttgctact atcctgtcca gtacccggac    151800
     gacacgctga gctggaatat tcaggtcgat ttctatcgcc agcacctcac ggttaaaatc    151860
     atccaccacg ttgaaggttc gaaagcgtct gccgcagacg agtgcatcgt gcataaaatc    151920
     aatcgaccag ctctggttta acgcttgcgg tgttgccagc ggggtcgggt tgcgcaccgg    151980
     cagacgttgt ttacccttac gacgaaaatt cagtttcagc aggcagtaaa tccggtgaac    152040
     gcgtttatgg ttccaggcat taccgtgcct gcgaagcacc tgaaaaagct tcttaaaacc    152100
     gtagcgcgga tagcgttctg ccagttcagt cagcgcctgg atcaccggtt catcacgccg    152160
     ggtatcaggc tgataaaaat ataccgtcct gctcagcgat aacgtcctgc aggcctggcg    152220
     taaactcatg gcaaaatgcg ccgtcagata gcggacgagt tcacgcttta tcgctggttt    152280
     taaagctttt tttcgataac atctttcaac gcccggcatt ccagactgag atcggcaaac    152340
     atctgtttga gccgccggtt ctcgtcttcc agatctttga tctttttaat atcggccgct    152400
     tccatcccgc catacttggc cttccagttg taatagctgg cttcagatat cgcggcctca    152460
     cggcagacat ctttgacggt tcgtccggct tcgacggact tcagaacggc gataatctgg    152520
     tgttcagtga atcggatctt acgcatagct atctccacag gtgacataat cagtatgtcg    152580
     gaagatctct aaaagtgaat gggccgtttt gccgggatac ttacagtttt accttcagaa    152640
     ggagtattgt ctgcgtctct ctccttcttc aacctataca aaggacattg ttcatcatgt    152700
     ggtcttgttg attgaacgtg tcttagtttg gctccattaa cctcacagct aaagggagct    152760
     tcagctttcg ggtctgggcc aacgcaatcg cacttgagcc acaattcttt cttgtccatt    152820
     tcttcaagaa ttctattagc aatacgcaaa tcagcctgtg ccggtttgcg accattactg    152880
     aagacatgaa gcagcgcttc cttctctacc agtaacagtt tacgctcaaa atagcctcta    152940
     ggatttttct tccatacaag ttccatttat agaactgctt cgagttagtt acctgattaa    153000
     aaataataac atgttaagat aacatctaat taagatgtga taaattacaa tatgacactg    153060
     ttttaaatac acaaattaac ttattaagat gttaacttat caagataaca tcttattgtt    153120
     atattatctt tgatgtcgta ttatcttact aacttaacaa tatgagcggt ggaatgatga    153180
     tcatagttct tggcagtcaa aagggtggtg ttggtaaaag tacgctcgct gtttcgctcg    153240
     ctgcgtacct cattacactg ggaaaacgcg tactaattgt tgatgctgat gaccaaaaat    153300
     cagttttaac ctggtataac aacaggccag aaaacttacc ccatatgccg gtcactggtg    153360
     ctactggcaa cattaaagca atgcttaaag aacatgaaaa atcgtatgac ttcgttattg    153420
     ctgattgcgc agggcgcgac agcgcagaaa tgcgaagtgg attgatggcc gcagatgtat    153480
     tcatttctcc tttacgcccc tcgcagatgg atctagacgt tgtccctcat acatgttctg    153540
     ttttcacagc tgctaaagac ttcaatgaag ctgttagagg ctacttagtt ctgaacatga    153600
     caccaacaaa catgtttgtt aatgaagcaa atcaggccgc agaagttctt aaagatttcc    153660
     ctgaaatgaa gcttgctgaa gctcgtgttt gtgatcgcaa agcccatagg gatgcatggg    153720
     ctgaatcaat gacaatattt gagacacaga acgttaaagc tcaagaagaa attgaggcac    153780
     tggtgaagga gattattctg tgaggaatag agcgaataca caatccagag acgaggcttc    153840
     ctttataaat ggcggtactg caggactgaa caacaaagat ttggaaacgt cgtccaaaaa    153900
     ggtagctaca agcaaagcta agccagtaag catttctttg gcagaagaga atttatgggc    153960
     cattgataac attatacgtg aagagatgtt atccgggcgt agtagggtta acagatctga    154020
     tgtggtcagg gcagcagtga tggccttaga aaagctacct cagaatgaaa tatctcaact    154080
     aattgaaaaa tctaaactta agtaaagcct ctgataacaa gatattatta tcatatcttg    154140
     ttatcttgtt atcttgttat cttgttatct tgttatcttc agattaaatt cacttccttt    154200
     ttaatatcgc aatagcctca gtttctgaca tatggaactg gacgcgatga cgcgccgcca    154260
     catcgagcgc aaacaccttc gtatacacct cagtcgagct gatgctcttg tgccccatta    154320
     aactctgcag caccttcagt ggtataccgg catacagcat gtgcatggcg taagaatgac    154380
     ggaacgtgtg cggcgtcacc ggcacggaga acgtcacgcc gtcggccgct gcagcttcaa    154440
     ccgattcgct gagccaggtg cggaccgtcc gatcggtgat ctcccagatg cgagccttct    154500
     ccattctgcc ggtgcgtttg ttgcgtcgct cgagcggaat tttcagtgtg gccaccatca    154560
     tctccagctg gctgacgtac tggtgatcgg aaagcggtac cagccggtga gcctggctgc    154620
     cggcaggcgc acgacctgcc gttctggcgg ctttctcggt ccgttgtttg agggtggcca    154680
     gctgcacaaa cgggtagggc ggcgccaggg aaaaatcccc acgcgtaagc gccagcgcct    154740
     cgttgatgcg agcccctgta ttccagagag ttgcaagcag catcttgcgg tgcagatccg    154800
     ggacgtagtg aagcagggcg cttacttccg gcgccagcag atatttcggc aggtcatcct    154860
     gcaccagaga catctggcga agcgccagag cggccggata atcgatggct actggcaact    154920
     gagcttgcgt atcttgggca ttgtacgtaa taagtccagg catcattgtt gcccttcatc    154980
     ttcttgttga tagctacgta actgtattga ttcaaatgcc tcattttcaa atcttctcag    155040
     tctcgcctct gtggaccagc tgcgttggcg cgcttcacgc aaccctcgca atacccctga    155100
     tttatctctc aaatgagcag aatccggtag cccgacttcc ctgcgcaatc ttgctgacag    155160
     aataaaagct ctgactgcag tttgaaaaca atcaaaatta agaatcagtt cgaagcggtc    155220
     gtcattagaa tccgtgagct tactaatccg tgagaccagc gcaacatagt cagcttccag    155280
     cgaacgaatc ttgaatagct ggcgcggcgg gagaacacgc cagtcaccgc tggctgctga    155340
     aaggtccagc acaggaattc tattgtcctg actaagcttt tcaagatggg tccaacgaag    155400
     atatgtccat cctgaggcgt agcgttccag caggaaagcc agctcagtgg caaggtacag    155460
     tcgttcagcg gcagccttat cagcagccgc gcgttcttcc cgtctgcgag taaaatgatg    155520
     agtcaggcac acaccaccaa gtgctgcacc tgcagatgaa accgccgtaa tgatctgcgg    155580
     ccacaggctg gcgctgtcct tcaccacctt cacgccctcg gtcgcaataa accagtcagc    155640
     catgtttgtt cctttattga gaaatcccgc ctcgatcctt aaagacgcgt aaatgcaccg    155700
     aacggtctgt ccagcatatc cagctggaaa cagtctcgtt cttcatcacc ctcaaactca    155760
     tattcaatca ggtattcttc gggttgaggt gtccatcgtt ccggtgaact ttccctccat    155820
     tcccagcgcc ctgttgagtc aatccggcgt gcaagttccc gcccctcctc atccagaaca    155880
     tgcaccagtg gatagccaaa atgcattgtt tgatgtaacc ggagctttgg atagtcgctc    155940
     agctgatccc ataagccgga aagaccatga ttggtttcat tctcatttga gttatctggc    156000
     atcttaattc cttagttaat agtcactaat gacaattatc ccgctcagca caatcgactg    156060
     cgcgcctgca tctgtcactt agatgatttt ctcctaccgt tatcattttc aggatgataa    156120
     taagcagcca tatagccact ccgttaaatt accggatgac cgtttccggc agatccgatt    156180
     ttctggagta taacaacttt ccggaagtgt accacgcaca cggaataacc acaccggcct    156240
     tttatggtgg tgagcgggtg atcgcggggc agggtcaaag cactacatat agatgaaaat    156300
     gcagctgaaa gcgtggcaca tgttgtgttt ctgcgccgct gcgcgccggg gcgggtgaag    156360
     aagatccgga actgggagtt ttcggatctc cggagaggaa gagaaagaat gttctttaaa    156420
     aagtaataat gggtgttgat tgttgttaaa taatgattaa tgcataaaag ggagttaagc    156480
     gaactcttct ttactctatg cgcaaatcca tctgaatgac agatgtaatc ctgaagtggc    156540
     actcatctcc ggcagcataa tcgcgtgctt tgacatcgtg gccagtctta aaagtcgaca    156600
     ttgtgccagg agcagacgtt gcagacattc ccatcagaag caaattgctg tcttcttaat    156660
     ccagtcatac ttgctgtaag aaaaccgtta tcaacaagat gagagatcag tacgatcgcc    156720
     ccgcgttgtc ggatgagaga tgacaataaa ttcgacgggt aattggctgt cgttcctagc    156780
     ttgatgtttt gcccccggtg ggatttcaat tccctgtcgg gccttgattt catgtttatt    156840
     accttccagt tcaatcgtca ggttcccctc aagaacataa aaaaactgcc tagaaacaga    156900
     atgaaagtgc cgtttttctt gagtacctgg aggcattttt tcatgaataa ttagcatgtc    156960
     cgggcggttt agcagatacc agccatcaca attatgcccc cagatataat gctcggcatt    157020
     gtcttttgaa atcatcgatt ttctcctatg taaaagtttt ttctttgtac aggcagacta    157080
     acgcgataaa ggtagggggc actaccacca aatttagggt gaccgctttg gttgagatac    157140
     tccgtcagga gaggaatggg caaacagaag tagaaaaaat tacttaaagc tcgaacaaca    157200
     ataacttacg ctcctcgctc tcagcggacc gtctgccagc tccagaaatt atccctttct    157260
     tacagaaatt cttaccagct acttccttcc tcatctctcc aaaccgttta ccgtcatcga    157320
     tccgacttta ctgctttttg gaactcgttc cagctatctt cctgatgtgt agggtttacc    157380
     ctgtcgtcac gtaggcttac ccagtggtaa acgattcggc tatgcatctg cagccccagc    157440
     cccgcccgac gctgattagg taagcctcca gcaatagcgg acgatgcagt tctgtcaagc    157500
     caagactggc actgtttaaa gtagaggaga atcatgtatc aattaatggg gagcaggtca    157560
     gccatgactt tgagtccgta aaattatgag ttagagctcg ctgtctttat tagtattttc    157620
     actagaatcc tggttgagcg accagatagt ccgatgccat ttactaaact tggttcctct    157680
     ttatgattta gcctcgatct ttaggatatg ccattcaact taaatttaga taatcatagt    157740
     taaaaatcc                                                            157749
//

If you have problems or comments...

PBIL Back to PBIL home page