(data stored in ACNUC7421 zone)

EMBL: CP000655

ID   CP000655; SV 1; circular; genomic DNA; STD; PRO; 2159490 BP.
XX
AC   CP000655; AAUC01000000-AAUC01000015;
XX
PR   Project:PRJNA16679;
XX
DT   20-APR-2007 (Rel. 91, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 9)
XX
DE   Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1, complete
DE   genome.
XX
KW   .
XX
OS   Polynucleobacter asymbioticus QLW-P1DMWA-1
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Polynucleobacter.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-2159490
RX   PUBMED; 22448227.
RA   Hahn M.W., Scheuerl T., Jezberova J., Koll U., Jezbera J., Simek K.,
RA   Vannini C., Petroni G., Wu Q.L.;
RT   "The passive yet successful way of planktonic life: genomic and
RT   experimental analysis of the ecology of a free-living polynucleobacter
RT   population";
RL   PLoS One 7(3):E32772-E32772(2012).
XX
RN   [2]
RP   1-2159490
RX   PUBMED; 22675600.
RA   Meincke L., Copeland A., Lapidus A., Lucas S., Berry K.W., Del Rio T.G.,
RA   Hammon N., Dalin E., Tice H., Pitluck S., Richardson P., Bruce D.,
RA   Goodwin L., Han C., Tapia R., Detter J.C., Schmutz J., Brettin T.,
RA   Larimer F., Land M., Hauser L., Kyrpides N.C., Ivanova N., Goker M.,
RA   Woyke T., Wu Q.L., Pockl M., Hahn M.W., Klenk H.P.;
RT   "Complete genome sequence of Polynucleobacter necessarius subsp.
RT   asymbioticus type strain (QLW-P1DMWA-1(T))";
RL   Stand Genomic Sci 6(1):74-83(2012).
XX
RN   [3]
RP   1-2159490
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Meincke L., Brettin T., Bruce D., Detter J.C., Han C.,
RA   Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N.,
RA   Poeckl M., Wu Q.L., Hahn M., Richardson P.;
RT   "Complete sequence of Polynucleobacter sp. QLW-P1DMWA-1";
RL   Unpublished.
XX
RN   [4]
RP   1-2159490
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Meincke L., Brettin T., Bruce D., Detter J.C., Han C.,
RA   Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N.,
RA   Poeckl M., Wu Q.L., Hahn M., Richardson P.;
RT   ;
RL   Submitted (09-APR-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 08eb9dfa93291934e61103d71d185158.
DR   BioSample; SAMN02598371.
DR   EnsemblGenomes-Gn; EBG00001006709.
DR   EnsemblGenomes-Gn; EBG00001006713.
DR   EnsemblGenomes-Gn; EBG00001006716.
DR   EnsemblGenomes-Gn; EBG00001006719.
DR   EnsemblGenomes-Gn; EBG00001006721.
DR   EnsemblGenomes-Gn; EBG00001006725.
DR   EnsemblGenomes-Gn; EBG00001006727.
DR   EnsemblGenomes-Gn; EBG00001006729.
DR   EnsemblGenomes-Gn; EBG00001006733.
DR   EnsemblGenomes-Gn; EBG00001006736.
DR   EnsemblGenomes-Gn; EBG00001006741.
DR   EnsemblGenomes-Gn; EBG00001006745.
DR   EnsemblGenomes-Gn; EBG00001006747.
DR   EnsemblGenomes-Gn; EBG00001006748.
DR   EnsemblGenomes-Gn; EBG00001006749.
DR   EnsemblGenomes-Gn; EBG00001006752.
DR   EnsemblGenomes-Gn; EBG00001006755.
DR   EnsemblGenomes-Gn; EBG00001006756.
DR   EnsemblGenomes-Gn; EBG00001006758.
DR   EnsemblGenomes-Gn; EBG00001006763.
DR   EnsemblGenomes-Gn; EBG00001006767.
DR   EnsemblGenomes-Gn; EBG00001006770.
DR   EnsemblGenomes-Gn; EBG00001006771.
DR   EnsemblGenomes-Gn; EBG00001006773.
DR   EnsemblGenomes-Gn; EBG00001006778.
DR   EnsemblGenomes-Gn; EBG00001006782.
DR   EnsemblGenomes-Gn; EBG00001006786.
DR   EnsemblGenomes-Gn; EBG00001006790.
DR   EnsemblGenomes-Gn; EBG00001006793.
DR   EnsemblGenomes-Gn; EBG00001006797.
DR   EnsemblGenomes-Gn; EBG00001006801.
DR   EnsemblGenomes-Gn; EBG00001006805.
DR   EnsemblGenomes-Gn; EBG00001006809.
DR   EnsemblGenomes-Gn; EBG00001006813.
DR   EnsemblGenomes-Gn; EBG00001006817.
DR   EnsemblGenomes-Gn; EBG00001006820.
DR   EnsemblGenomes-Gn; EBG00001006821.
DR   EnsemblGenomes-Gn; EBG00001006825.
DR   EnsemblGenomes-Gn; EBG00001006829.
DR   EnsemblGenomes-Gn; EBG00001006832.
DR   EnsemblGenomes-Gn; EBG00001006836.
DR   EnsemblGenomes-Gn; EBG00001006839.
DR   EnsemblGenomes-Gn; EBG00001006841.
DR   EnsemblGenomes-Gn; EBG00001006844.
DR   EnsemblGenomes-Gn; EBG00001006848.
DR   EnsemblGenomes-Gn; EBG00001006851.
DR   EnsemblGenomes-Gn; EBG00001006852.
DR   EnsemblGenomes-Gn; EBG00001006853.
DR   EnsemblGenomes-Gn; EBG00001006855.
DR   EnsemblGenomes-Gn; EBG00001006859.
DR   EnsemblGenomes-Gn; Pnuc_R0001.
DR   EnsemblGenomes-Gn; Pnuc_R0002.
DR   EnsemblGenomes-Gn; Pnuc_R0003.
DR   EnsemblGenomes-Gn; Pnuc_R0004.
DR   EnsemblGenomes-Gn; Pnuc_R0005.
DR   EnsemblGenomes-Gn; Pnuc_R0006.
DR   EnsemblGenomes-Gn; Pnuc_R0007.
DR   EnsemblGenomes-Gn; Pnuc_R0008.
DR   EnsemblGenomes-Gn; Pnuc_R0009.
DR   EnsemblGenomes-Gn; Pnuc_R0010.
DR   EnsemblGenomes-Gn; Pnuc_R0011.
DR   EnsemblGenomes-Gn; Pnuc_R0012.
DR   EnsemblGenomes-Gn; Pnuc_R0013.
DR   EnsemblGenomes-Gn; Pnuc_R0014.
DR   EnsemblGenomes-Gn; Pnuc_R0015.
DR   EnsemblGenomes-Gn; Pnuc_R0016.
DR   EnsemblGenomes-Gn; Pnuc_R0017.
DR   EnsemblGenomes-Gn; Pnuc_R0018.
DR   EnsemblGenomes-Gn; Pnuc_R0020.
DR   EnsemblGenomes-Gn; Pnuc_R0021.
DR   EnsemblGenomes-Gn; Pnuc_R0022.
DR   EnsemblGenomes-Gn; Pnuc_R0023.
DR   EnsemblGenomes-Gn; Pnuc_R0024.
DR   EnsemblGenomes-Gn; Pnuc_R0025.
DR   EnsemblGenomes-Gn; Pnuc_R0026.
DR   EnsemblGenomes-Gn; Pnuc_R0027.
DR   EnsemblGenomes-Gn; Pnuc_R0028.
DR   EnsemblGenomes-Gn; Pnuc_R0029.
DR   EnsemblGenomes-Gn; Pnuc_R0030.
DR   EnsemblGenomes-Gn; Pnuc_R0031.
DR   EnsemblGenomes-Gn; Pnuc_R0032.
DR   EnsemblGenomes-Gn; Pnuc_R0033.
DR   EnsemblGenomes-Gn; Pnuc_R0034.
DR   EnsemblGenomes-Gn; Pnuc_R0035.
DR   EnsemblGenomes-Gn; Pnuc_R0036.
DR   EnsemblGenomes-Gn; Pnuc_R0037.
DR   EnsemblGenomes-Gn; Pnuc_R0038.
DR   EnsemblGenomes-Gn; Pnuc_R0039.
DR   EnsemblGenomes-Gn; Pnuc_R0040.
DR   EnsemblGenomes-Gn; Pnuc_R0041.
DR   EnsemblGenomes-Gn; Pnuc_R0043.
DR   EnsemblGenomes-Gn; Pnuc_R0044.
DR   EnsemblGenomes-Tr; EBT00001532309.
DR   EnsemblGenomes-Tr; EBT00001532310.
DR   EnsemblGenomes-Tr; EBT00001532311.
DR   EnsemblGenomes-Tr; EBT00001532312.
DR   EnsemblGenomes-Tr; EBT00001532313.
DR   EnsemblGenomes-Tr; EBT00001532314.
DR   EnsemblGenomes-Tr; EBT00001532315.
DR   EnsemblGenomes-Tr; EBT00001532316.
DR   EnsemblGenomes-Tr; EBT00001532317.
DR   EnsemblGenomes-Tr; EBT00001532318.
DR   EnsemblGenomes-Tr; EBT00001532319.
DR   EnsemblGenomes-Tr; EBT00001532320.
DR   EnsemblGenomes-Tr; EBT00001532321.
DR   EnsemblGenomes-Tr; EBT00001532322.
DR   EnsemblGenomes-Tr; EBT00001532323.
DR   EnsemblGenomes-Tr; EBT00001532324.
DR   EnsemblGenomes-Tr; EBT00001532325.
DR   EnsemblGenomes-Tr; EBT00001532326.
DR   EnsemblGenomes-Tr; EBT00001532327.
DR   EnsemblGenomes-Tr; EBT00001532328.
DR   EnsemblGenomes-Tr; EBT00001532329.
DR   EnsemblGenomes-Tr; EBT00001532330.
DR   EnsemblGenomes-Tr; EBT00001532331.
DR   EnsemblGenomes-Tr; EBT00001532332.
DR   EnsemblGenomes-Tr; EBT00001532333.
DR   EnsemblGenomes-Tr; EBT00001532334.
DR   EnsemblGenomes-Tr; EBT00001532335.
DR   EnsemblGenomes-Tr; EBT00001532336.
DR   EnsemblGenomes-Tr; EBT00001532337.
DR   EnsemblGenomes-Tr; EBT00001532338.
DR   EnsemblGenomes-Tr; EBT00001532339.
DR   EnsemblGenomes-Tr; EBT00001532340.
DR   EnsemblGenomes-Tr; EBT00001532341.
DR   EnsemblGenomes-Tr; EBT00001532342.
DR   EnsemblGenomes-Tr; EBT00001532343.
DR   EnsemblGenomes-Tr; EBT00001532344.
DR   EnsemblGenomes-Tr; EBT00001532345.
DR   EnsemblGenomes-Tr; EBT00001532346.
DR   EnsemblGenomes-Tr; EBT00001532347.
DR   EnsemblGenomes-Tr; EBT00001532348.
DR   EnsemblGenomes-Tr; EBT00001532349.
DR   EnsemblGenomes-Tr; EBT00001532350.
DR   EnsemblGenomes-Tr; EBT00001532351.
DR   EnsemblGenomes-Tr; EBT00001532352.
DR   EnsemblGenomes-Tr; EBT00001532353.
DR   EnsemblGenomes-Tr; EBT00001532354.
DR   EnsemblGenomes-Tr; EBT00001532355.
DR   EnsemblGenomes-Tr; EBT00001532356.
DR   EnsemblGenomes-Tr; EBT00001532357.
DR   EnsemblGenomes-Tr; EBT00001532358.
DR   EnsemblGenomes-Tr; Pnuc_R0001-1.
DR   EnsemblGenomes-Tr; Pnuc_R0002-1.
DR   EnsemblGenomes-Tr; Pnuc_R0003-1.
DR   EnsemblGenomes-Tr; Pnuc_R0004-1.
DR   EnsemblGenomes-Tr; Pnuc_R0005-1.
DR   EnsemblGenomes-Tr; Pnuc_R0006-1.
DR   EnsemblGenomes-Tr; Pnuc_R0007-1.
DR   EnsemblGenomes-Tr; Pnuc_R0008-1.
DR   EnsemblGenomes-Tr; Pnuc_R0009-1.
DR   EnsemblGenomes-Tr; Pnuc_R0010-1.
DR   EnsemblGenomes-Tr; Pnuc_R0011-1.
DR   EnsemblGenomes-Tr; Pnuc_R0012-1.
DR   EnsemblGenomes-Tr; Pnuc_R0013-1.
DR   EnsemblGenomes-Tr; Pnuc_R0014-1.
DR   EnsemblGenomes-Tr; Pnuc_R0015-1.
DR   EnsemblGenomes-Tr; Pnuc_R0016-1.
DR   EnsemblGenomes-Tr; Pnuc_R0017-1.
DR   EnsemblGenomes-Tr; Pnuc_R0018-1.
DR   EnsemblGenomes-Tr; Pnuc_R0020-1.
DR   EnsemblGenomes-Tr; Pnuc_R0021-1.
DR   EnsemblGenomes-Tr; Pnuc_R0022-1.
DR   EnsemblGenomes-Tr; Pnuc_R0023-1.
DR   EnsemblGenomes-Tr; Pnuc_R0024-1.
DR   EnsemblGenomes-Tr; Pnuc_R0025-1.
DR   EnsemblGenomes-Tr; Pnuc_R0026-1.
DR   EnsemblGenomes-Tr; Pnuc_R0027-1.
DR   EnsemblGenomes-Tr; Pnuc_R0028-1.
DR   EnsemblGenomes-Tr; Pnuc_R0029-1.
DR   EnsemblGenomes-Tr; Pnuc_R0030-1.
DR   EnsemblGenomes-Tr; Pnuc_R0031-1.
DR   EnsemblGenomes-Tr; Pnuc_R0032-1.
DR   EnsemblGenomes-Tr; Pnuc_R0033-1.
DR   EnsemblGenomes-Tr; Pnuc_R0034-1.
DR   EnsemblGenomes-Tr; Pnuc_R0035-1.
DR   EnsemblGenomes-Tr; Pnuc_R0036-1.
DR   EnsemblGenomes-Tr; Pnuc_R0037-1.
DR   EnsemblGenomes-Tr; Pnuc_R0038-1.
DR   EnsemblGenomes-Tr; Pnuc_R0039-1.
DR   EnsemblGenomes-Tr; Pnuc_R0040-1.
DR   EnsemblGenomes-Tr; Pnuc_R0041-1.
DR   EnsemblGenomes-Tr; Pnuc_R0043-1.
DR   EnsemblGenomes-Tr; Pnuc_R0044-1.
DR   EuropePMC; PMC2408644; 18474084.
DR   EuropePMC; PMC3308952; 22448227.
DR   EuropePMC; PMC3368402; 22675600.
DR   EuropePMC; PMC5018217; 27064460.
DR   EuropePMC; PMC5244307; 27836842.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01070; sucA.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01718; Polynucleobacter-1.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000655.
DR   SILVA-SSU; CP000655.
DR   StrainInfo; 844713; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4001734
CC   Source DNA and bacteria available from Martin Hahn
CC   (martin.hahn@oeaw.ac.at)
CC   Contacts: Martin Hahn (martin.hahn@oeaw.ac.at)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2159490
FT                   /organism="Polynucleobacter asymbioticus QLW-P1DMWA-1"
FT                   /sub_species="asymbioticus QLW-P1DMWA-1"
FT                   /strain="QLW-P1DMWA-1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:312153"
FT   gene            33..1460
FT                   /locus_tag="Pnuc_0001"
FT   CDS_pept        33..1460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: bpm:BURPS1710b_0301 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator, DnaA C-terminal domain; Chromosomal replication
FT                   initiator, DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33223"
FT                   /db_xref="GOA:A4SUQ9"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUQ9"
FT                   /protein_id="ABP33223.1"
FT                   /translation="MSNLQNPPALNSISPLGFWDGAISALSRELSPQQFKTWIQPLTLV
FT                   SFDESDCSLTVGAPNRFKLDWIKKTFADRFQELASEYFSGPININFVLAVEGSAPTPSN
FT                   VPAPEIDMSEPQSQDESSPIISVEEQSFEIEDHSKLNPNLTFETFVTGKANQLARAASI
FT                   QVAHNPGTSYNPMFLYGGVGLGKTHLIHAIGNHLLKEKPNARIRYIHAEQYVSDVVRAY
FT                   QQKAFDRFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALLSNKSQVIITSDTYPK
FT                   EMAGIDDRLISRFDSGLTVAIEPPELEMRVAILMKKAASEGIPMTEDVAFFVAKHLRSN
FT                   VRELEGALRKILAFVRFHGREVTIDVARIALKDLLSIQNRQISVENIQKAVADFYSIKV
FT                   ADMYSKKRPANIARPRQIAMFMAKELTQKSLPEIGELFGGRDHTTVLHAVRKIGEERSH
FT                   DSQLNHEIHVIEQTLKA"
FT   gene            1724..2839
FT                   /locus_tag="Pnuc_0002"
FT   CDS_pept        1724..2839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: reu:Reut_A0002 DNA polymerase III, beta chain;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33224"
FT                   /db_xref="GOA:A4SUR0"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUR0"
FT                   /protein_id="ABP33224.1"
FT                   /translation="MQLVNTSRDSLLKPLQVVSGIVERRHTLPILANLLFKKNGEKVSF
FT                   ISTDIEIQITTNANFGVGSEDVTTTVAARKLLDILRALPEGEVSLNLKDNRMVVQSGKS
FT                   RFSLQTLSATEFPVMQSVGEVTAAWSMTQKSFRQLISQVHFSMAQQDIRYYLNGMLLVV
FT                   EGKEVVAVATDGHRLAFSRVELTEAPSGSGQRQEIIIPRKTILECQHLLEDSDESLEIS
FT                   LTANQVKFSFGDIELISKLVEGKFPDFQRVIPKGHKNTLVVGRDALQAALQRAAILTTD
FT                   KFKGVRFSLSPNRITIQSTNAEQEEAQEEIETEYSGDAVEIGFNVSYLLDVLSNLKNEK
FT                   IQISLGDANSSAVVTLPGSENFKYVVMPMRI"
FT   gene            2851..5349
FT                   /locus_tag="Pnuc_0003"
FT   CDS_pept        2851..5349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0003"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: reu:Reut_A0003 DNA gyrase, B subunit; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA gyrase, subunit B domain
FT                   protein; ATP-binding region, ATPase domain protein domain
FT                   protein; TOPRIM domain protein; DNA topoisomerase, type
FT                   IIA, subunit B, region 2 domain protein; SMART: DNA
FT                   topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33225"
FT                   /db_xref="GOA:A4SUR1"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUR1"
FT                   /protein_id="ABP33225.1"
FT                   /translation="MTEEKKVVEQYGAASIQILEGLEAVRKRPGMYIGDTSDGTGLHHL
FT                   VFEVLDNSIDEALAGYCSEITVVIQTDNSISIVDNGRGVPTGIKYDDKHEPKRSAAEIV
FT                   MTELHAGGKFDQNSYKVSGGLHGVGVSCVNALSKWLKLTIRRDGKAHYMEFARGVIQNR
FT                   NVVDEDGVMVSPITVTGDTELSGTEVHFLADETIFGNVEFHYEILVKRIRELSFLNNGV
FT                   HIKLIDQRTGQEEDFAFSGGVKGFVEYINQTKNVLHPNIFYAEGVRPSDLGGQITAEVS
FT                   MQWNDSFSEQVLCFTNNIPQRDGGTHLTGLRAAMTRVINKYIDENEVAKKAKVEISGDD
FT                   MREGLACVLSVKVPEPKFSSQTKDKLVSSEVRGPVEEIVAEALSAYLQERPADAKILCG
FT                   KIVDAARAREAARKARDMTRRKGVLDGLGLPGKLADCQEKDPTKSELFIVEGDSAGGSA
FT                   KQGRDRRFQAILPLKGKILNVEKARFDKMLASQEVVTLITVLGTGIGIEEYKADKLRYH
FT                   RIIIMTDADVDGSHIRTLLLTFFYRQMPELIERGHIYIAQPPLYKVKFGKNEQYIKDDN
FT                   ELNQLLLKIALETASLQTPTGEVIEGESLNELAKHYQVIQSIVDRLSRTIDEDALRAIA
FT                   SGTQLNLDTEKSANESADRLRQALADSLNPLALPPEIIVQKEDRTERFRLLLSRRIHGN
FT                   LKLSTINSDFVHGDDYQSLANAAAVLSGKVLPGTKVRRGDPDKNQKEQTINDFRAAFSW
FT                   LLSEAERVLSRQRYKGLGEMNPSQLWETTMDASSRTLLQVKIEDAIAADQVFTTLMGDE
FT                   VEPRRAFIEKNALIARNLDV"
FT   gene            5352..5846
FT                   /locus_tag="Pnuc_0004"
FT   CDS_pept        5352..5846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0004"
FT                   /product="nuclear protein SET"
FT                   /note="PFAM: nuclear protein SET; KEGG: rme:Rmet_3537
FT                   nuclear protein SET"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33226"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR003616"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUR2"
FT                   /protein_id="ABP33226.1"
FT                   /translation="MASKKLKPPKVDRSSIVVKSSPIHGKGVFVAKPIKKGQAIIEYKG
FT                   ERISWKLAEKRHPHDPKDPNHTFYFSLEDGRVIDAKYGGNAARWINHSCKPSCETREDS
FT                   FEGKPRVFIYAKRSLKVGEELFYDYSLDVEGRISKQMKKDYECRCGAKKCRGTMLALKD
FT                   K"
FT   gene            5855..6079
FT                   /locus_tag="Pnuc_0005"
FT   CDS_pept        5855..6079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0005"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc3357 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33227"
FT                   /db_xref="InterPro:IPR022191"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUR3"
FT                   /protein_id="ABP33227.1"
FT                   /translation="MLYVTIQELEAAINYWRSQSPAEGEELRLCPEAAALAKPYALMIV
FT                   QGSQRVPLDVLDELTRSAIHGFLKTNQTP"
FT   gene            6181..6942
FT                   /locus_tag="Pnuc_0006"
FT   CDS_pept        6181..6942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0006"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: reh:H16_B0501 ABC-type transporter, ATPase component:
FT                   HAAT family; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33228"
FT                   /db_xref="GOA:A4SUR4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUR4"
FT                   /protein_id="ABP33228.1"
FT                   /translation="MQEIILETIGLGKSFKGFSAVTDVNLKVTRGTIHALIGPNGAGKT
FT                   TCFNLLTKFLEPTSGQILFNGFDITKEAPAEIARRGIIRSFQISAVFPHLTVLENVRVA
FT                   LQRGLGTEFFFWKSGSSLNVLNDRALELLHEVGLEEFAHKETLNLAYGRKRALEIATTL
FT                   AMEPELMLLDEPTQGMGHEDVDHVTRLIDRVAKGRTILMVEHNMKVIASIANKITVLQR
FT                   GSVLAEGSYQEVSSNPLVVEAYMGSHGGDAL"
FT   gene            6939..7643
FT                   /locus_tag="Pnuc_0007"
FT   CDS_pept        6939..7643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0007"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: eba:ebA3429 ABC transporter subunit; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33229"
FT                   /db_xref="GOA:A4SUR5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUR5"
FT                   /protein_id="ABP33229.1"
FT                   /translation="MSNVALEVKNLESWYGESHILHGVNFSVRDGEVVTLLGRNGAGRS
FT                   TILKTILGLTSKRKGSIEVFGKETIALPTYQIARLGIGYCPEERGIFASLDTEENLLLP
FT                   PKVSSGGMDVEEIYEMFPNLYERRNSPGTRLSGGEQQMLAMARILRTGAKLLLLDEITE
FT                   GLAPVIVQKLGEVVTKLRNKGFTIVLVEQNFRFAAGLADRHYVVEGGQIVEVVQHSELE
FT                   AKAELLNGYLGV"
FT   gene            7672..8874
FT                   /locus_tag="Pnuc_0008"
FT   CDS_pept        7672..8874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0008"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="KEGG: reu:Reut_A3369 extracellular ligand-binding
FT                   receptor; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33230"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUR6"
FT                   /protein_id="ABP33230.1"
FT                   /translation="MKQTLISIAAAALVAVAGNAGAADQPPLKIGFITDMSGLYSDIDG
FT                   QGGLEAMKMAVADFGGTVNGRKIEIISADHQNKADVAASKTREWIDQNGVSVVFGGTNS
FT                   GTALATAKVAAEKKRIYINNGAGTSALTNEQCSPYTIHYTYDTIALANGSAKGLVDKGY
FT                   KNWYFLTADYAFGYALEKDASNVVLANGGKVLGDSKHPLNASDFSSYLLQAQNSKAQVL
FT                   GLANAGGDTINSVKAANEFGITKTMKLAGLLVFITDVHAIGIKNAQGLLATTAWYWDQN
FT                   DQTRKFAGRFMEKMKRMPSMVQAGDYSSTMTYLNAVKAAGTDDSDKVMAQLRKTKINDM
FT                   FTKNGYIRKDGTMVHDMYLYEVKTPAEVKSPWDYYKLVSTLSGEKAFTIPPDSKCALLN
FT                   K"
FT   sig_peptide     7672..7740
FT                   /locus_tag="Pnuc_0008"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 23"
FT   gene            8878..9762
FT                   /locus_tag="Pnuc_0009"
FT   CDS_pept        8878..9762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0009"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   reh:H16_A3659 ABC-type transporter, permease component; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33231"
FT                   /db_xref="GOA:A4SUR7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUR7"
FT                   /protein_id="ABP33231.1"
FT                   /translation="MEIFGLSSSALLSQLLLGLVNGSFYAILSLGLAVIFGLLNVINFS
FT                   HGAMFMLGAIVTWMAGQYFGINYWVMLLLSPLIVGLVGIVIERLLLRHLYQLDHLYGLL
FT                   LTFGLTLFIEGVLRSIYGASGLAYNTPEALGGATDLGFMVLPNYRAWVVFASLTVCFAT
FT                   WYIIEKTSIGAYLRAGTENPKLVQAFGVNFPLMTTLTYGFGVALAAFSGVLAAPIIQIS
FT                   PLMGSNLIIIVFAVVVIGGMGSIMGSILTGLGLGLIEGLTKVFYPQASSTVVFAIMVIV
FT                   LLFRPAGLFGREK"
FT   gene            9759..10715
FT                   /locus_tag="Pnuc_0010"
FT   CDS_pept        9759..10715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0010"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   reh:H16_A3658 ABC-type transporter, permease component; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33232"
FT                   /db_xref="GOA:A4SUR8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUR8"
FT                   /protein_id="ABP33232.1"
FT                   /translation="MKLPKLLILLVLLGFAIAAPFFAYPIFLMKILSFALFAAAFNLLL
FT                   GYTGLLSFGHAAFFGGAGYCAGYLMRDMGVGPAAGIAIGVLFAAALGALIGGLAIRRQG
FT                   IYFSMITLALAQMFYFICLQAPASGGEDGFQGIPRGDLFGLIDLQNDLNLYYFVLAITV
FT                   AGFVFIQRIITSPFGQVLKAIKENEPRAISLGYKVNRFKFLVFVLSAALAGLAGSTQAL
FT                   VLGFETLTDVHWTMSGLVILMTLVGGVGTMAGPFVGALVIVLLEHRVGEIGNFLAEITS
FT                   IAWFNSLGESVTIVTGLIFIFCVMAFRRGLVGIFTKK"
FT   sig_peptide     9759..9875
FT                   /locus_tag="Pnuc_0010"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.494 at
FT                   residue 39"
FT   gene            complement(10721..11734)
FT                   /locus_tag="Pnuc_0011"
FT   CDS_pept        complement(10721..11734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0011"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   ajs:Ajs_0232 aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33233"
FT                   /db_xref="GOA:A4SUR9"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR041726"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUR9"
FT                   /protein_id="ABP33233.1"
FT                   /translation="MSSETVVFQEQLSNYLKDIGLTDGPIGLSQLTGGQSNPTYKISSG
FT                   SKHYVLRKKPGGVLLPSAHAVDREYRVMKALANTNVPVPQMLAYCEDESIIGTAFFVME
FT                   YLDGRVFIDQSLTQLQATERHTLYEEMNRTIAAIHKLDYVALGLESFGKPGNYFSRQIA
FT                   RWSRQVRDANIPIPDSLNKLMDWLPENIPNEDETSLIHGDFRMDNLIFHKTELRVIGVL
FT                   DWELSTLGNPLADFAYQCMAWRIAPTLWRGIQGLDLKSLGIPSEAEYIAMYEKRIGRPI
FT                   AEHWPFLMAYNLFRISAILHGITKRAMDGNANASDAIENGKKAGALADLGWACAQQ"
FT   gene            complement(11742..12512)
FT                   /locus_tag="Pnuc_0012"
FT   CDS_pept        complement(11742..12512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0012"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: ajs:Ajs_0231 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33234"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUS0"
FT                   /protein_id="ABP33234.1"
FT                   /translation="MDINQLFRLDNKTAFITGASSGIGKHCAILLAQAGAKVALASRRV
FT                   DQLQSVVDEITGLGGQAKAFELDVTNNKSVVRCFDELTHWDMPTIIINNAGMSVNRKLL
FT                   DQTEEDWDRVIDTNLKGSWLVATEAARRLAATNTPGNIVNVASILGERIIGGVAPYVIS
FT                   KAGVIQSTKVMALELARQEIRVNALLPGYVITDLNRDFLLSEAGQKILTRIPTRRFNNL
FT                   EDLNGPLLLLASDASKAMTGTTLVVDSGHLISGL"
FT   gene            complement(12512..13759)
FT                   /locus_tag="Pnuc_0013"
FT   CDS_pept        complement(12512..13759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0013"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   ajs:Ajs_0230 acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33235"
FT                   /db_xref="GOA:A4SUS1"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUS1"
FT                   /protein_id="ABP33235.1"
FT                   /translation="MPYSKIILAKGIYKCHFTFSYYYNQIMDFSLTPKLEALRDRTRAF
FT                   ILEQVIPLEKDPRQNEHGPSEELRKDLIELARKEGLLTPHASIEMGGLGLSHVEKAVIF
FT                   EEAGYSCLGPIAMNIHAPDEGNIHLMEEVATPEQKERWLKPLAQGKIRSCFAMTEPAPG
FT                   AGSDPSMLATTAIKDGDDYLINGRKWFITGAEGADFVIIMALGEDGTATMFLSDMNVPG
FT                   IELVRNMDAMDSCFTGGHGVLQFTNLRVPAKNILGEFGKGFKYAQVRLAPARLTHCMRW
FT                   LGQARRAQDIAIAYAQQREAFGKILGAHEGVGFMLADNDMDLQTSRLHILQTAWLLDQG
FT                   QRCNYESSRAKVVCSEAEWRVVDRCVQILGGQGVTGETALMKIFKDMRGFRIYDGPSEV
FT                   HRWSMARKLIGNKESK"
FT   gene            13784..14575
FT                   /locus_tag="Pnuc_0014"
FT   CDS_pept        13784..14575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0014"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   reu:Reut_A3365 protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33236"
FT                   /db_xref="GOA:A4SUS2"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUS2"
FT                   /protein_id="ABP33236.1"
FT                   /translation="MIGPPIEFSIYIWPLLFCAAFFAGLVDAVAGGGGLIQVPALFAAY
FT                   PDVPPATLLSTNKLASVGGTLNAARKFLRHVSLPWAVVGPAIVAAFVGSLMGANAVSHF
FT                   PAEPLRKALPFVLVFLLIYTWFQPSLGEAHAPKEVSHYQKFKALLLGLTIGFYDGFFGP
FT                   GTGSFLLFGFVRFFGFDFLHASAATKLVNVSTNLAAILMLASLGQINWPLGFVMMIANI
FT                   AGSQFGSRLAIKHGSGFVRKVFLVIVSALILKSAWNAYFLN"
FT   gene            14682..16601
FT                   /locus_tag="Pnuc_0015"
FT   CDS_pept        14682..16601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0015"
FT                   /product="glucose inhibited division protein A"
FT                   /note="TIGRFAM: glucose inhibited division protein A; PFAM:
FT                   glucose-inhibited division protein A; KEGG: bxe:Bxe_A0028
FT                   glucose-inhibited division protein A subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33237"
FT                   /db_xref="GOA:A4SUS3"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUS3"
FT                   /protein_id="ABP33237.1"
FT                   /translation="MRYSKNFDVIVVGGGHAGTEAALASARMGCDTLLITHSIENLGAM
FT                   SCNPSIGGIGKGHLVKEIDAMGGAMAAATDEAGIQFRILNSSKGPAVRATRAQGDRVLY
FT                   KAAIRRRLENQPNLSLFQAAVDDLLVKGDEVQGVVTQMGLEFMAKKVVLTAGTFLDGKI
FT                   HVGLNNYAGGRAGDPAAVSLSARLKELKLPQGRLKTGTPPRIDGRTIDFSVMLEQPGDL
FT                   DPVPVFSYLGRPEQHPKQVPCWISHTNEQTHDIIRGGLDRSPMYTGVIEGVGPRYCPSI
FT                   EDKIHRFASRNSHQIFLEPEGLTTNEFYPNGISTSLPFDVQWELVRSIRGLESAVIVRP
FT                   GYAIEYDFFDPRHLRHSLETKAIGGLYFAGQINGTTGYEEAAAQGMLAGINAGLAAQGK
FT                   EAWLPKRSESYIGVLVDDLITRGVQEPYRMFTSRAEYRLSLREDNADMRLTAIGRDLGL
FT                   VDDYRWEVFCRKQEAVSRETSRLKDIWVGPKHEIAPLVTQLLGQELSHECNLTELLRRP
FT                   GITYEAITALGNRIWAPESLDDDLGLAAQISDQVEISVKYQGYIERQAVEIARQEHNET
FT                   FPLPEGLDYSQVLGLSKEVQQKLNLHKPETLGQAGRISGVTPAALSLLLVHLKKGLGRT
FT                   QETI"
FT   gene            16598..17266
FT                   /locus_tag="Pnuc_0016"
FT   CDS_pept        16598..17266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0016"
FT                   /product="16S rRNA m(7)G-527 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: methyltransferase GidB; PFAM: glucose
FT                   inhibited division protein; KEGG: azo:azo0142 probable
FT                   methyltransferase GidB"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33238"
FT                   /db_xref="GOA:A4SUS4"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUS4"
FT                   /protein_id="ABP33238.1"
FT                   /translation="MTEGLLALGIEQLGLDLSPQNVADLELFLQEMTRWNQVHNLTAID
FT                   NEEGSIRLHLIDSIAVLPVMRRFLPQQNPKIADLGSGGGLPAIPIAIVEPNWRLTLIEA
FT                   IRKKTAFLQHVRGKLKLKNIEVISDRVENVALQQSGQFDAVISRAFTNLARFLDLSLPL
FT                   LKPDGLVFAMKAKRADEEMQNVSMQDWHLLADEPLHIPNLAVERRLLVLTPVRKLPLPI
FT                   "
FT   gene            17284..18054
FT                   /locus_tag="Pnuc_0017"
FT   CDS_pept        17284..18054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0017"
FT                   /product="chromosome segregation ATPase"
FT                   /note="PFAM: Cobyrinic acid a,c-diamide synthase; KEGG:
FT                   rso:RSc3326 putative chromosome partitioning protein ParA"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33239"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUS5"
FT                   /protein_id="ABP33239.1"
FT                   /translation="MAKIFCIANQKGGVGKTTTAVNLAAGLAGLQQRVLLVDLDPQGNA
FT                   TMGSGIEKADLTTSVYQVLIGLASVKECSKQCESSGYDVLPANRDLAGAEIELVDLDTR
FT                   EARLKDALSQVIDDYDFILIDCPPALSLLTLNGLCAANGVIVPMQCEYFALEGLSDLVN
FT                   TIKQVHANLNPDLVIIGLLRVMFDARMTLQQQVSDQLLEHFGDKVFKTIIPRNVRLAEA
FT                   PSYGLPGVAFDKSSRGAKAYLEFGAEMVERIKQM"
FT   gene            18075..18965
FT                   /locus_tag="Pnuc_0018"
FT   CDS_pept        18075..18965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0018"
FT                   /product="chromosome segregation DNA-binding protein"
FT                   /note="TIGRFAM: parB-like partition protein; PFAM: ParB
FT                   domain protein nuclease; KEGG: rso:RSc3325 putative
FT                   chromosome partitioning protein ParB"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33240"
FT                   /db_xref="GOA:A4SUS6"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUS6"
FT                   /protein_id="ABP33240.1"
FT                   /translation="MVAIKKKGLGRGLEALLGEKTSAVSPSTDINRLPLTALQAGKYQP
FT                   RQKMEAGALQELAESIREQGIMQPLLVRLVGPGKYEIIAGERRFRAATIAGLKEVPVLV
FT                   SGADDEAAAAMALVENMQREDLNPLEESQGLARLIEEFGFTHEQAAKAVGKSRSAITNL
FT                   LRLIQLAKPVQSMLLAGDIDMGHARALLPLPGASQVALAQRIAAQGLSVREAERMTAAL
FT                   VIAGGQIGDKKTNGKGGSASSSKDPDMRRLTQEIADLIGLNTEFKLKGKGGELRIHFSQ
FT                   FDELDSLLKKLGVQS"
FT   gene            19034..19528
FT                   /locus_tag="Pnuc_0019"
FT   CDS_pept        19034..19528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0019"
FT                   /product="putative ATP synthase protein I AtpI"
FT                   /note="KEGG: bps:BPSL3403 putative ATP synthase protein I
FT                   AtpI"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33241"
FT                   /db_xref="GOA:A4SUS7"
FT                   /db_xref="InterPro:IPR005598"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUS7"
FT                   /protein_id="ABP33241.1"
FT                   /translation="MIPQKNRFSDVDDWDEPEEEVYRVYSKEEIAALQKSDASKYRALS
FT                   PWKIVLAQIVITALSMVFWSIFGAPVGVSLYTQSAFLGGLISVLPTALFLTRLELAKKS
FT                   QRLNPGRFLAALVSGEFIKIAVTLMMFIGIAFLVPGVLWVPLLVTYLLALKCVWLAWFW
FT                   R"
FT   gene            19568..20443
FT                   /locus_tag="Pnuc_0020"
FT   CDS_pept        19568..20443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0020"
FT                   /product="ATP synthase F0, A subunit"
FT                   /note="TIGRFAM: ATP synthase F0, A subunit; PFAM:
FT                   H+-transporting two-sector ATPase, A subunit; KEGG:
FT                   rso:RSc3323 probable ATP synthase A chain transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33242"
FT                   /db_xref="GOA:A4SUS8"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUS8"
FT                   /protein_id="ABP33242.1"
FT                   /translation="MSSEVNQAHEAAEQMTPTAYISEHLQNLTSTGEHQSSIVDFSVIN
FT                   LDTIFWASLMGLIAVFILLIAARRATPGVPGRFQSLIEMIVEMVDTQAKSIVHGDRTFI
FT                   APLALFVFFWIILLNTLDLIPVDWVLGVNHFIGNFGGHVPHNRMVPTTDLNATMGMSLS
FT                   VLILVFFYSFKVKGFGGFLHELISAPFGAKWYLAPFNLALNIIEYLAKGVSLGMRLFGN
FT                   MYAGELVFLLIALLGSVWTFNLDLTLFGLVGHVIAGSAWAIFHILVILLQAFIFMMLTL
FT                   VYIGQAHSHH"
FT   gene            20489..20755
FT                   /locus_tag="Pnuc_0021"
FT   CDS_pept        20489..20755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0021"
FT                   /product="ATP synthase F0, C subunit"
FT                   /note="TIGRFAM: ATP synthase F0, C subunit; PFAM:
FT                   H+-transporting two-sector ATPase, C subunit; KEGG:
FT                   rso:RSc3322 probable ATP synthase C chain (lipid-binding)
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33243"
FT                   /db_xref="GOA:A4SUS9"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUS9"
FT                   /protein_id="ABP33243.1"
FT                   /translation="MQAFLATIQGSTAICIGIIIGLGAIGACLGIALMGGKYIEACARQ
FT                   PELMEPLQTKMFLLAGLIDAAFLIGVGVAMLFAFANPLLAVIK"
FT   gene            20819..21289
FT                   /locus_tag="Pnuc_0022"
FT   CDS_pept        20819..21289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0022"
FT                   /product="ATP synthase F0 subcomplex B subunit"
FT                   /note="TIGRFAM: ATP synthase F0, B subunit; PFAM:
FT                   H+-transporting two-sector ATPase, B/B' subunit; KEGG:
FT                   rme:Rmet_3498 ATP synthase F0, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33244"
FT                   /db_xref="GOA:A4SUT0"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUT0"
FT                   /protein_id="ABP33244.1"
FT                   /translation="MNLNATLFAQMIVFFVLWWVVARFVWPPLVKALDERSSKIADGLA
FT                   AAERGKEALALASNEAEQELTKARQEGVQRVAEAEKRAQMSADEIRANAQAEAARIITQ
FT                   AKQDADQQVTSAREVLRAEVAVLAVKGAEQILRREVDAKAHGQLLDQLKAEL"
FT   gene            21291..21827
FT                   /locus_tag="Pnuc_0023"
FT   CDS_pept        21291..21827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0023"
FT                   /product="ATP synthase F1 subcomplex delta subunit"
FT                   /note="TIGRFAM: ATP synthase F1, delta subunit; PFAM:
FT                   H+-transporting two-sector ATPase, delta (OSCP) subunit;
FT                   KEGG: rso:RSc3320 probable ATP synthase delta chain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33245"
FT                   /db_xref="GOA:A4SUT1"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUT1"
FT                   /protein_id="ABP33245.1"
FT                   /translation="MAELATIARPYAEALFQSAKPAELAGCLEQLNELAQLAALPEVAA
FT                   LSNNPKVSADDLSKLLSGMVKTKLDGKVASFLNLINQNHRLAAVPEIAHQFEAMKNKSE
FT                   GAAEVSITSAFPLEGSALNDLLSSLKKRFGGKELRPTIQVDPTLIGGVRIQVGDEVMDS
FT                   SVKAQLAQMQASLGA"
FT   gene            21873..23414
FT                   /locus_tag="Pnuc_0024"
FT   CDS_pept        21873..23414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0024"
FT                   /product="ATP synthase F1 subcomplex alpha subunit"
FT                   /EC_number="3.6.3.15"
FT                   /note="KEGG: reh:H16_A3639 membrane-bound ATP synthase, F1
FT                   sector,alpha-subunit; TIGRFAM: ATP synthase F1, alpha
FT                   subunit; PFAM: H+-transporting two-sector ATPase,
FT                   alpha/beta subunit, central region; H+-transporting
FT                   two-sector ATPase, alpha/beta subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33246"
FT                   /db_xref="GOA:A4SUT2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUT2"
FT                   /protein_id="ABP33246.1"
FT                   /translation="MQLNPSEISELIKSRISEMGVDSQVRNEGTVISVTDGICRVHGLS
FT                   GVMQGEMLEFPNNTIGLALNLERDSVGAVVLGEYTHIKEGDPVKCTGRILEVPVGPELL
FT                   GRVVNALGQPIDGKGPINTKLTDFIEKVAPGVIARQSVSQPVQTGLKAIDAMVPIGRGQ
FT                   RELIIGDRQTGKTAVAVDAIINQKGKGVYCVYVAIGQKASTIANVVRKLTELGAMEYTV
FT                   VVAASASESAAMQYLSAYAGCTMGEYFRDRGEDALIVYDDLTKQAVAYRQISLLLRRPP
FT                   GREAYPGDVFYLHSRLLERAARVNAEYVEKFTNGAVKGKTGSLTALPIIETQAGDVSAF
FT                   VPTNVISITDGQIFLETDLFNAGVRPAINAGISVSRVGGAAQTKVIKKLSGGIRTDLAQ
FT                   YRELAAFAQFASDLDEATRKQLERGRRVTELCKQAQYKPLQVWEMAASLYAVNNGYFDD
FT                   LEVKNVLAFEKGLQDHLKSKYADLVARIEETKDLSKDDEAALRAAIEDYKRSASF"
FT   gene            23432..24301
FT                   /locus_tag="Pnuc_0025"
FT   CDS_pept        23432..24301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0025"
FT                   /product="ATP synthase F1 subcomplex gamma subunit"
FT                   /EC_number="3.6.3.15"
FT                   /note="KEGG: reu:Reut_A3347 H+-transporting two-sector
FT                   ATPase, gamma subunit; TIGRFAM: ATP synthase F1, gamma
FT                   subunit; PFAM: H+-transporting two-sector ATPase, gamma
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33247"
FT                   /db_xref="GOA:A4SUT3"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUT3"
FT                   /protein_id="ABP33247.1"
FT                   /translation="MASTKEIRSKIKSVQNTRKITKAMEMVAASKMRRAQERMRNARPY
FT                   AEKIREIVANLSKANPEFRPAYMEAREVKKVGTILVTTDKGLCGGLNTNVLRFITNQVR
FT                   DLQEKNIEIVYTAIGSKGLQFLNRSKAKLISQTIQIGDTPHMDVLIGAIIAQLEAFERG
FT                   EIDAVYLAYNRFVNAMKQEPVLEKLLPLEPAALVPEDKAGNSWDYIYEPDAESILNGLL
FT                   KRYVEAMIYQAVTENMASEQSARMVSMKAASDNAKNVIGELQLEYNKTRQAAITKELSE
FT                   IVGGAAAV"
FT   gene            24357..25757
FT                   /locus_tag="Pnuc_0026"
FT   CDS_pept        24357..25757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0026"
FT                   /product="ATP synthase F1 subcomplex beta subunit"
FT                   /EC_number="3.6.3.15"
FT                   /note="KEGG: reh:H16_A3637 membrane-bound ATP synthase, F1
FT                   sector,beta-subunit; TIGRFAM: ATP synthase F1, beta
FT                   subunit; PFAM: H+-transporting two-sector ATPase,
FT                   alpha/beta subunit, central region; H+-transporting
FT                   two-sector ATPase, alpha/beta subunit domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33248"
FT                   /db_xref="GOA:A4SUT4"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUT4"
FT                   /protein_id="ABP33248.1"
FT                   /translation="MSNGNIVQCIGPVVDIQFPRDKMPNIYDALTLVESGEKSFAEKGL
FT                   TFEVQQQIGDGVVRAIAMGASDGLRRGMEVKSTGKPISVPVGPATLGRIMDVLGRPIDD
FT                   AGPIATEERRAIHQPAPKFDELSPSVDLLETGIKVIDLVCPFAKGGKVGLFGGAGVGKT
FT                   VNMMELINNIAKQHSGLSVFAGVGERTREGNDFYHEMKESNVIDKVAMVFGQMNEPPGN
FT                   RLRVALTGLTMAEAFRDEGRDILFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEE
FT                   MGKLQERITSTKTGSVTSIQAVYVPADDLTDPSPATTFLHLDSTVVLSRDIAALGIYPA
FT                   VDPLDSTSRQLDPQVVGQEHYEVARDVQMTLQRYKELRDIIAILGMDELSPEDKLAVSR
FT                   ARKIQRFLSQPFHVAEVFTGSPGKYVPLKETIRGFKMICSGELDHLPEQAFYMVGSIDE
FT                   AIEKAKKL"
FT   gene            25779..26195
FT                   /locus_tag="Pnuc_0027"
FT   CDS_pept        25779..26195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0027"
FT                   /product="ATP synthase F1 subcomplex epsilon subunit"
FT                   /note="TIGRFAM: ATP synthase F1, epsilon subunit; PFAM:
FT                   H+-transporting two-sector ATPase, delta/epsilon subunit;
FT                   KEGG: reh:H16_A3636 membrane-bound ATP synthase, F1
FT                   sector,epsilon-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33249"
FT                   /db_xref="GOA:A4SUT5"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUT5"
FT                   /protein_id="ABP33249.1"
FT                   /translation="MSTIRVDVVSAEQSIFSGEAKFVALPGESGELGILRGHTPLITRI
FT                   RPGSVRIEKADGDEEFVFVAGGYLEVQPDRVTVLADTAIRGHDLDEAKAIEAKKRAEEA
FT                   MQNRGTDFDMALAQSEFAMAAAQLAAIARFRRKK"
FT   gene            26211..27320
FT                   /locus_tag="Pnuc_0028"
FT   CDS_pept        26211..27320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0028"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="KEGG: rme:Rmet_3491 uroporphyrinogen decarboxylase;
FT                   TIGRFAM: uroporphyrinogen decarboxylase; PFAM:
FT                   Uroporphyrinogen decarboxylase (URO-D)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33250"
FT                   /db_xref="GOA:A4SUT6"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUT6"
FT                   /protein_id="ABP33250.1"
FT                   /translation="MLLNDRFLKACLGEAVDQTPLWLMRQAGRYLPEYNATRARAGSFL
FT                   GLAKNPAYATEVTLQPLDRYPLDAAILFSDILTIPDAMGLGLKFTAGEGPSFEHPLRTE
FT                   DDVKKLRVADMDQLKYVFEAVSEIRKALIQYGKQRVPLIGFSGSPWTLACYMIDGSSAD
FT                   DFRHAKTMMFSRPDLMQQILDINIQSVANYLIEQVKAGAQALMIFDTWGGMLPDGWYQR
FT                   VSLAAMQKVIALLPREYEGQKIPVIMFTKGGAIWLNDMAQIGADVIAMDWTMSLSRARK
FT                   QLLALNKPLALQGNLDPLILFSEPEQIARQASLLLDDLASAPPLKAGLHSLDGHIFNLG
FT                   HGISQFTPPESVTALSQAVIKHSRSLRSK"
FT   gene            27590..29719
FT                   /locus_tag="Pnuc_0029"
FT   CDS_pept        27590..29719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0029"
FT                   /product="replication restart DNA helicase PriA"
FT                   /note="KEGG: bpa:BPP4131 putative primosomal protein;
FT                   TIGRFAM: primosomal protein N'; PFAM: helicase domain
FT                   protein; type III restriction enzyme, res subunit;
FT                   DEAD/DEAH box helicase domain protein; SMART: DEAD-like
FT                   helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33251"
FT                   /db_xref="GOA:A4SUT7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUT7"
FT                   /protein_id="ABP33251.1"
FT                   /translation="MPSPIVVQVVVDKPLAQGFDYLWDSNQLGNDPEVGQLVEVPFGRA
FT                   SLVGIVIKVSDHSDYELDKLKSITRVAPLPPFDAASLRLVNFASQYYIHALGETIIPTI
FT                   PQMWKKPDNWEKALEKISAAEEKKRKKIQQEPSEGLIDEAHLNQGQALALEKLRQCSVE
FT                   KEFKTILLQGQTGSGKTAVFLNWLKGILEDSSSQVLLLVPEINLTPQLERRVRAYFPDK
FT                   KMVVLHSGVSEKNRGIAWYEAMTGKAQIILGTRLAALTPLPNLRAIVVDEEHDPSYKQQ
FT                   DGIRYSARDLAIWRAHDLKIPVLLASATPSLESWIAAKAGRYEYIRLDQRAQGAALPQV
FT                   RLINTRDPQSQFSPGDIGRPISASLITKTLANAISKNLENKKQSLILINRRGYAPILSC
FT                   NACTWLSKCQQCSSYMVMHKAGALGRRPVLSCHHCGLVKPIPEHCPDCGNADLKTLGKG
FT                   TQKIEDAIEEMWPSARVLRVDTDASRKSKGAEELFQEIHAGNVDIVVGTQMIAKGHDYQ
FT                   NIGLVAVLDADSRLFSPDFRAAERLFAQLVQVAGRAGRSSKDDQGAGEIYIETQYPEAA
FT                   VFQYLLRHDVDGFLGYLAHERDEAKLPPFSYQGLVHAEAKSLDKAIQFLAALKGRLKSR
FT                   GLMTPGLKVYDPVPRAVMRVAGTERAQLVLEADDRRQLQDVLEAVDQDLRNGSQGRISK
FT                   GDRIRWLIERDPTSI"
FT   gene            complement(29729..30142)
FT                   /locus_tag="Pnuc_0030"
FT   CDS_pept        complement(29729..30142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0030"
FT                   /product="glycine cleavage system H protein"
FT                   /note="TIGRFAM: glycine cleavage system H protein; PFAM:
FT                   glycine cleavage H-protein; KEGG: rme:Rmet_3481 glycine
FT                   cleavage system H protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33252"
FT                   /db_xref="GOA:A4SUT8"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUT8"
FT                   /protein_id="ABP33252.1"
FT                   /translation="MFAKDKIMNSQDTFKFAETHEWADLENDGLVWVGISNHAQEALGD
FT                   VMFFQAPKIGQQVKQGEAIAVIESVKAASDIHTPITGEIVELNEEVDATPELVNQNPYG
FT                   VWLFKIKPSSEDALNSELGTLLSLEQYTSSSGA"
FT   gene            30204..30848
FT                   /locus_tag="Pnuc_0031"
FT   CDS_pept        30204..30848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0031"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   reu:Reut_A3268 beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33253"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUT9"
FT                   /protein_id="ABP33253.1"
FT                   /translation="MPIKLGIVPVTPYEQNCSILVCQETGDAAVIDPGGDIEKILDGVK
FT                   QMGGQVKKILLTHGHLDHCAAAKDLADQLAVPIEGPQEEERFWIDQLPEQTVRFGFGHA
FT                   KVFEPNRWLNDGDHVKVGNVDLEVFHCPGHTPGHIVFFDRADRLAIVGDVLFAGSIGRT
FT                   DFPRGNHADLIHAIRTKLWPLGDDVQFVPGHGPMSNFGQERKTNPYVGDGA"
FT   gene            complement(31085..32125)
FT                   /locus_tag="Pnuc_0032"
FT   CDS_pept        complement(31085..32125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0032"
FT                   /product="fatty acid desaturase"
FT                   /note="PFAM: fatty acid desaturase; KEGG: bps:BPSL2382
FT                   putative fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33254"
FT                   /db_xref="GOA:A4SUU0"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUU0"
FT                   /protein_id="ABP33254.1"
FT                   /translation="MPMAQGETGRAIMLLVIDSLLWLGCIAGTVFVESVLLKIVFGVIA
FT                   GFVTGRIFILGHDACHQSFTPNRELNKVLGRIAFLPSLTPYSLWDVGHNVVHHGQTNLK
FT                   GFDFVWAPLSKSEYDALPSWRKALERLYRSGWGPVFYYLIEIWWRREYFPNAKNKPGDR
FT                   PIFLKDNLLVTAFAIIWIGCLIAGAIATGQSIWLGLITGFAVPFLFWNGMIGFVVYVHH
FT                   THPKVSWYDKKSEWLRAQPFVSTTVHLTFNWIWGKLMHHIMEHTAHHVDMSVPLYRLPE
FT                   AQQTLETILPDRIFVQKFSWDWYFDTARKCKLYDFQNKAWLDFDGNKTADSVRVVLSPV
FT                   PAGQNG"
FT   gene            complement(32310..32385)
FT                   /locus_tag="Pnuc_R0001"
FT                   /note="tRNA-Arg4"
FT   tRNA            complement(32310..32385)
FT                   /locus_tag="Pnuc_R0001"
FT                   /product="tRNA-Arg"
FT   gene            32491..32994
FT                   /locus_tag="Pnuc_0033"
FT   CDS_pept        32491..32994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0033"
FT                   /product="cytochrome c, class I"
FT                   /note="PFAM: cytochrome c, class I; KEGG: reu:Reut_A3322
FT                   cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33255"
FT                   /db_xref="GOA:A4SUU1"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUU1"
FT                   /protein_id="ABP33255.1"
FT                   /translation="MSNEHGNLIKSPKQLIIMVFASFFVPLIIILLLMVFVNNGKRGDS
FT                   TAATDQLIKPVAQLNFQGASAGPHEPQTGEQVYKAVCAACHATGAAGAPKFGDAAAWAP
FT                   RIAKGYDSLLTSVLKGKNAMPARGGSNPADISDYELGRAVVYMANASGGKLPEPKAPDA
FT                   AAAK"
FT   gene            complement(33037..33933)
FT                   /locus_tag="Pnuc_0034"
FT   CDS_pept        complement(33037..33933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0034"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: rso:RSc3266
FT                   hypothetical transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33256"
FT                   /db_xref="GOA:A4SUU2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUU2"
FT                   /protein_id="ABP33256.1"
FT                   /translation="MELGSLDFLKQQDLPTGALYMVATPIGNLGDITLRALHVLNSMDG
FT                   IACEDTRHSVALLQQFGIHKKCLALHTHNEMGGAQTVIQHLANNERWAYISDAGTPGVS
FT                   DPGARLVDEVHKAGFRVIPIPGASAVSCAISGSGAVMLDSEGQFQFLGFWPHKTKERDA
FT                   LLFDICNSKRTSAFFESPHHIKETLALLSNALEPERQMLIGRELTKKFEQLVSLQAKEV
FT                   AHWLENAESLKGEFIVLVAGREGSADEPPEHASLLMWAKALSPYLGSKEIATVLSQTLG
FT                   LPKKDAYQIALDAKLEK"
FT   gene            34010..34642
FT                   /locus_tag="Pnuc_0035"
FT   CDS_pept        34010..34642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0035"
FT                   /product="phosphoheptose isomerase"
FT                   /EC_number="5.3.1.-"
FT                   /note="TIGRFAM: phosphoheptose isomerase; KEGG: ngo:NGO1986
FT                   phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33257"
FT                   /db_xref="GOA:A4SUU3"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUU3"
FT                   /protein_id="ABP33257.1"
FT                   /translation="MKPPLAHNIAMNKDTIERLRKRASQHFLDSIAVKQEAEKVLPESV
FT                   AHGVLAMVDCLRSGGKIMACGNGGSAADAQHFAAELIGRFERERQELAAIALTTDTSIL
FT                   TAVGNDYSYDEIFSKQVRGLGKKGDILLGISTSGNSKNVVKAIEAAKTMGIKIIALTGN
FT                   GGGKIATLLDQDDINLCAPSTRTARIQETHLVLLHGLCDGVDHILLD"
FT   gene            34672..35322
FT                   /locus_tag="Pnuc_0036"
FT   CDS_pept        34672..35322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0036"
FT                   /product="transport-associated protein"
FT                   /note="PFAM: transport-associated; KEGG: rso:RSc3264
FT                   hypothetical signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33258"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUU4"
FT                   /protein_id="ABP33258.1"
FT                   /translation="MRIQFISKLFIAALLVSQLSACAVVAIGGVTASAAILADRRSPAV
FT                   QAIDKGIELQAENALAKRFGDSAHINVTSFNQKVLLTGEVKDADIKGEAGAYVKAMKNA
FT                   RSVFNELVIGPNSTFSSRANDSYLESSIKTQMIFTDKLPSNSMAIVAEGGSVYLMGILT
FT                   QNEADLAKKVASNTSGVKDVYAYFDIISEQEKARLEKQGKADESQPNSPPKYQ"
FT   sig_peptide     34672..34776
FT                   /locus_tag="Pnuc_0036"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.706 at
FT                   residue 35"
FT   gene            35340..35693
FT                   /locus_tag="Pnuc_0037"
FT   CDS_pept        35340..35693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0037"
FT                   /product="cytochrome c, class I"
FT                   /note="PFAM: cytochrome c, class I; KEGG: rso:RSc3260
FT                   probable cytochrome c transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33259"
FT                   /db_xref="GOA:A4SUU5"
FT                   /db_xref="InterPro:IPR002324"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUU5"
FT                   /protein_id="ABP33259.1"
FT                   /translation="MIASRAGTKVFYLLGLLFFYTQCAQANPEDQKAFAIAKQNACLGC
FT                   HAVNKKIVGPSFQSVAQKYKNDPNAQVFLKNKIAKGGAGSWGVVPMPANAKLTDTELSL
FT                   LAAWVLRGAPSEN"
FT   sig_peptide     35340..35420
FT                   /locus_tag="Pnuc_0037"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.968) with cleavage site probability 0.966 at
FT                   residue 27"
FT   gene            complement(35690..36346)
FT                   /locus_tag="Pnuc_0038"
FT   CDS_pept        complement(35690..36346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0038"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bps:BPSL3237 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33260"
FT                   /db_xref="GOA:A4SUU6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUU6"
FT                   /protein_id="ABP33260.1"
FT                   /translation="MHNNLASNYLPIQPYKTRLTVPVRELHAGHRAEILEHLLKLGDED
FT                   RRLRFGTQTPNEIIEHYVSGLNFNEDAVFGVFDADLQLVGMAHLAYLPAVKGQPRAAEF
FT                   GVSVLPEGRAQGLGTALLERSAVHSRNSNIQTLYVHCLANNKAMMHLAQKAGMKVEYAY
FT                   GDADAYLKLPPANPGTIVQEAANEQWADFDYALKENLKLANQAWWWFLGRPGHAR"
FT   gene            36834..38359
FT                   /locus_tag="Pnuc_R0002"
FT   rRNA            36834..38359
FT                   /locus_tag="Pnuc_R0002"
FT                   /product="16S ribosomal RNA"
FT   gene            38418..38494
FT                   /locus_tag="Pnuc_R0003"
FT                   /note="tRNA-Ile1"
FT   tRNA            38418..38494
FT                   /locus_tag="Pnuc_R0003"
FT                   /product="tRNA-Ile"
FT   gene            38525..38600
FT                   /locus_tag="Pnuc_R0004"
FT                   /note="tRNA-Ala1"
FT   tRNA            38525..38600
FT                   /locus_tag="Pnuc_R0004"
FT                   /product="tRNA-Ala"
FT   gene            38869..41681
FT                   /locus_tag="Pnuc_R0005"
FT   rRNA            38869..41681
FT                   /locus_tag="Pnuc_R0005"
FT                   /product="23S ribosomal RNA"
FT   gene            41850..41962
FT                   /locus_tag="Pnuc_R0006"
FT   rRNA            41850..41962
FT                   /locus_tag="Pnuc_R0006"
FT                   /product="5S ribosomal RNA"
FT   gene            42067..42151
FT                   /locus_tag="Pnuc_R0007"
FT                   /note="tRNA-Tyr1"
FT   tRNA            42067..42151
FT                   /locus_tag="Pnuc_R0007"
FT                   /product="tRNA-Tyr"
FT   gene            42157..42230
FT                   /locus_tag="Pnuc_R0008"
FT                   /note="tRNA-Gly1"
FT   tRNA            42157..42230
FT                   /locus_tag="Pnuc_R0008"
FT                   /product="tRNA-Gly"
FT   gene            42251..42325
FT                   /locus_tag="Pnuc_R0009"
FT                   /note="tRNA-Thr1"
FT   tRNA            42251..42325
FT                   /locus_tag="Pnuc_R0009"
FT                   /product="tRNA-Thr"
FT   gene            42390..43580
FT                   /locus_tag="Pnuc_0039"
FT   CDS_pept        42390..43580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0039"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor,
FT                   GTP-binding; elongation factor Tu domain protein domain
FT                   protein; elongation factor Tu, domain 2 protein; KEGG:
FT                   bam:Bamb_0265 translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33261"
FT                   /db_xref="GOA:A4SUU7"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUU7"
FT                   /protein_id="ABP33261.1"
FT                   /translation="MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSKAFGGEAK
FT                   AYDQIDAAPEEKARGITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCSAADGPMPQTREHILLARQVGVPYIVVFLNKCDMVDDAELLELVEMEVRELLSKYDF
FT                   PGDDTPIIQGSAKLALEGDEGPMGKEAIMKLAEALDTYIPTPERAIDGAFLMPVEDVFS
FT                   ISGRGTVVTGRIERGIVKVGEEIEIIGIKPTLKTTCTGVEMFRKLLDQGQAGDNVGILL
FT                   RGTKREEVERGQVLAKPGSITPHTHFTAEVYILGKDEGGRHTPFFNNYRPQFYFRTTDV
FT                   TGSIELPKDKEMVMPGDNVTITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKILA"
FT   gene            43590..43665
FT                   /locus_tag="Pnuc_R0010"
FT                   /note="tRNA-Trp1"
FT   tRNA            43590..43665
FT                   /locus_tag="Pnuc_R0010"
FT                   /product="tRNA-Trp"
FT   gene            43686..44063
FT                   /locus_tag="Pnuc_0040"
FT   CDS_pept        43686..44063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0040"
FT                   /product="protein translocase subunit secE/sec61 gamma"
FT                   /note="TIGRFAM: preprotein translocase, SecE subunit; PFAM:
FT                   protein secE/sec61-gamma protein; KEGG: bps:BPSL3227
FT                   preprotein translocase SecE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33262"
FT                   /db_xref="GOA:A4SUU8"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUU8"
FT                   /protein_id="ABP33262.1"
FT                   /translation="MSHQTASHSEEKSGWVSGLAALIVVAALVLYYTLVDQSLLVRLAV
FT                   LFGGIAAAVMIVAISPDGRRFIAYAKDSWYEVKKVVWPTRKETTQMTLVVFGFVLIMSL
FT                   FLWIADKLIEWLVFSVLLGWK"
FT   gene            44073..44645
FT                   /locus_tag="Pnuc_0041"
FT   CDS_pept        44073..44645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0041"
FT                   /product="transcription antitermination protein nusG"
FT                   /note="KEGG: reh:H16_A3502 transcription antitermination
FT                   protein; TIGRFAM: transcription termination/antitermination
FT                   factor NusG; PFAM: transcription antitermination protein
FT                   NusG; KOW domain protein; SMART: NGN domain protein; KOW
FT                   (Kyrpides, Ouzounis, Woese) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33263"
FT                   /db_xref="GOA:A4SUU9"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUU9"
FT                   /protein_id="ABP33263.1"
FT                   /translation="MIDAEAAVNPQATGNMRWYVIHAYSGMEKSVKKGLEERIARSGMP
FT                   EKFGRILVPSEEVVEIKSGAKSVTERRFFPGYVLIEMEMTDESWHLVKNTPKVTGFVGG
FT                   VRNRPSPISTAEVAKIMDQMQAGVDKPKPKTLFEVGEIVRVKEGPFVDFNGNIEEVNYE
FT                   KSRLRVSVTIFGRGTPVELEFGQVEKM"
FT   gene            44813..45244
FT                   /locus_tag="Pnuc_0042"
FT   CDS_pept        44813..45244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0042"
FT                   /product="LSU ribosomal protein L11P"
FT                   /note="PFAM: ribosomal protein L11; KEGG: mfa:Mfla_0268
FT                   ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33264"
FT                   /db_xref="GOA:A4SUV0"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUV0"
FT                   /protein_id="ABP33264.1"
FT                   /translation="MAKKIIGFIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAQ
FT                   TQSMEPGLPIPVVITAFADKSFTFIMKTPPATIMIKKAAKIEKGSPRPHTDKVGKITRA
FT                   QAEEIAKAKMPDLTAADMDAAVRTIAGSARSMGITVEGL"
FT   gene            45247..45948
FT                   /locus_tag="Pnuc_0043"
FT   CDS_pept        45247..45948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0043"
FT                   /product="LSU ribosomal protein L1P"
FT                   /note="PFAM: ribosomal protein L1; KEGG: rso:RSc3037 50S
FT                   ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33265"
FT                   /db_xref="GOA:A4SUV1"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUV1"
FT                   /protein_id="ABP33265.1"
FT                   /translation="MTKLSKRVKAIQSKVDRNKFYPLEDALNLVKECATAKFDESIDVA
FT                   VQLGIDAKKSDQVVRGAVVLPAGTGKHVRVAVFAQGEKAEQAKAAGAEIVGMEELAEQI
FT                   KGGKIDFDILIASPDTMKIVGTLGQVLGPRGLMPNPKVGTVTPDVATAVKNAKAGQVQF
FT                   RVDKAGIVHASIGRRSFEPAALKSNLLALLEALNKAKPPASKGIYLKKVAVSSTMGAGV
FT                   RVDQASLQAAA"
FT   gene            46186..46833
FT                   /locus_tag="Pnuc_0044"
FT   CDS_pept        46186..46833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0044"
FT                   /product="LSU ribosomal protein L10P"
FT                   /note="PFAM: ribosomal protein L10; KEGG: reu:Reut_A3191
FT                   ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33266"
FT                   /db_xref="GOA:A4SUV2"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUV2"
FT                   /protein_id="ABP33266.1"
FT                   /translation="MPLNVQDKKAIVADVGAQLAGAQTVVLAEYRGIPVEQLTKLRASA
FT                   RDQGVYLRVLKNTLARRAAQGTQFEPLADSMVGPLIYGISADPIASAKVLQNFAKTQDK
FT                   LVITAGLYNGKLLDVAGVKSLASIPSRDELLSQLLGVMLAPVSAMARVLGAVAAQKAAG
FT                   APAPVAEVAAPAAEAAAPAEVVAEAAAPEVAAEPAAAAPEAGTEAKETPAAE"
FT   gene            46870..47244
FT                   /locus_tag="Pnuc_0045"
FT   CDS_pept        46870..47244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0045"
FT                   /product="LSU ribosomal protein L12P"
FT                   /note="TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal
FT                   protein L7/L12-like; KEGG: bxe:Bxe_A0305 ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33267"
FT                   /db_xref="GOA:A4SUV3"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUV3"
FT                   /protein_id="ABP33267.1"
FT                   /translation="MAITKEEIIDAVGSMSVMDLNDLVKAFEEKFGVSAAAMAVAGPAG
FT                   AAGGAAAEEQTEFTVNLLEAGANKVSVIKAVREITGLGLKEAKDLVDGAPKPIKEAVDK
FT                   KTAEEAKKKLEEAGAKAELK"
FT   gene            47471..51571
FT                   /locus_tag="Pnuc_0046"
FT   CDS_pept        47471..51571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0046"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: rso:RSc3034 probable DNA-directed RNA
FT                   polymerase (beta chain) protein; TIGRFAM: DNA-directed RNA
FT                   polymerase, beta subunit; PFAM: RNA polymerase Rpb2, domain
FT                   6; RNA polymerase Rpb2, domain 7; RNA polymerase Rpb2,
FT                   domain 2; RNA polymerase beta subunit; RNA polymerase Rpb2,
FT                   domain 3"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33268"
FT                   /db_xref="GOA:A4SUV4"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUV4"
FT                   /protein_id="ABP33268.1"
FT                   /translation="MNYSFTERKRVRKSFAKRVNNHQVPYLIATQLESYAKFLQADKPA
FT                   MSRLTEGLQAAFTSAFPIVSNNGYARMEYVSYQLSQPPFDVKECQQRGYTYHSALRAKV
FT                   RLIIYDREAPTKVKEVKESEVYMGEIPLMTENGSFVINGTERVIVSQLHRSPGVFFEHD
FT                   KGKTHSSGKLLFSARIIPYRGSWLDFEFDPKDILYFRVDRRRKMPVTILLKAIGLNNEQ
FT                   ILANFFNFDHFSLTANGGSMEFVPERLRGQLANFDVLDKNGVVVIQKDKRINAKHIREL
FT                   EAAKTKTIAVPDDYLVGRVVARNIVDPDSGEILAYANDEITEELLATLRDAGIKQLETI
FT                   YTNDLDSGAYISQTLRTDETADQMAARIAIYRMMRPGEPPTEDAVEALFQRLFYNEDTY
FT                   DLSRVGRMKVNSRLNRPEMEGPMVLSNEDILDTIKSLVDLRNGKGEVDDIDHLGNRRVR
FT                   CVGELAENQFRAGLSRVERAVKERLGQAETENLMPHDLINSKPISSAIREFFGSSQLSQ
FT                   FMDQTNPLSEITHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLI
FT                   NSLALFARLNEHGFLETPYRKVSNSKVSDEVVYLSAIEEAKYVIAQANATIDKSGKLAD
FT                   ELVSARQAGETIMVSPERIDFIDVAPSQIVSAAASLVPFLEHDDANRALMGANMSRQAV
FT                   PCLRPDKPLVGTGLERIVAVDSGTVILATRGGIVDYVDANRIVIRVNDDETAAGEVGVD
FT                   IYNLIKYTRSNQNTNINQRPIVQAGDRVVRGDVVADGASTDLGELALGQNMTVAFMPWN
FT                   GYNFEDSILISEKVVAEDRYTSIHIEELSVVARDTKLGSEEITRDISNLAESQLSRLDE
FT                   SGIVYIGAEVEAGDVLVGKVTPKGETTLTPEEKLLRAIFGEKASDVKDTSLRVPSGMIG
FT                   TVIDVQVFTREGIERDARAQAIIQEELQRYRLDLNDQLRIVEGDAFMRLEKLLIGKVAN
FT                   GGPQKLAKGTKIDKEYLASLDKYHWFDVRPADEEVATQVEAIKSSIEAKRKQFDEAFEE
FT                   KRTKLTQGDDLQAGVTKMVKVYLAVKRRLQPGDKMAGRHGNKGVVSKIAPAEDMPFMAD
FT                   GRPVDIVLNPLGVPSRMNVGQILETHLGWAAQGIGKRIDEMVRQQVKQAELRKFLKQLY
FT                   NETGRIEDIDNFTDEQITVLAENLRQGLPFATPVFDGATEAEIGRMLELAYPEEVATSL
FT                   KMTPSRQQMILCDGRTGDQFERPVTVGVMHVLKLHHLVDDKMHARSTGPYSLVTQQPLG
FT                   GKAQFGGQRFGEMEVWALEAYGASYVLQEMLTVKSDDVAGRTKVYENIVKGEHTIDAGM
FT                   PESFNVLVKEIRSLGIDIDMERN"
FT   gene            51573..55835
FT                   /locus_tag="Pnuc_0047"
FT   CDS_pept        51573..55835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0047"
FT                   /product="DNA-directed RNA polymerase subunit beta'"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: reu:Reut_A3188 RNA polymerase Rpb1, domain 4;
FT                   TIGRFAM: DNA-directed RNA polymerase, beta' subunit; PFAM:
FT                   RNA polymerase, alpha subunit; RNA polymerase Rpb1, domain
FT                   3; RNA polymerase Rpb1, domain 1; RNA polymerase Rpb1,
FT                   domain 5; RNA polymerase Rpb1, domain 4; SMART: RNA
FT                   polymerase I subunit A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33269"
FT                   /db_xref="GOA:A4SUV5"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUV5"
FT                   /protein_id="ABP33269.1"
FT                   /translation="MKALLDLFKQTQGDEQFDVIKIGLASPEKIRSWSFGEVRKPETIN
FT                   YRTFKPERDGLFCAKIFGPTKDYECLCGKYKRLKFRGVICEKCGVEVTLAKVRRERMGH
FT                   IELAAPVAHIWFLKSLPSRLGMVLDMTLRDIERVLYFEAYVVVDPGMTPEGAMKRGQIM
FT                   SEDEYIAKTEEYGDGAFTAIMGAEGIRDLLRGIDIDREVETIRADLKATGSDAKIKKYA
FT                   KRLKVLEAFQTSGIKPDWMIMEVLPVLPPELRPLVPLDGGRFATSDLNDLYRRVINRNN
FT                   RLKRLLELRAPEIIVRNEKRMLQEAVDSLLDNGRRGKAMTGANKRPLKSLAEMIKGKSG
FT                   RFRQNLLGKRVDYSGRSVIVVGPTLKLHQCGLPKLMALELFKPFIFNKLETLGIATTIK
FT                   AAKKEVESQTPIVWDILEEVIREHPIMLNRAPTLHRLGIQAFEPMLIEGKAIQLHPLVC
FT                   AAFNADFDGDQMAVHVPLSLEAQMEARTLMLASNNVLFPANGEPSIVPSQDVVLGLYYA
FT                   TRDKINGKGEGMVFANIAEVIRAHEAGQVELASRVAVRITEFEIVDKKAEGDARFAEKT
FT                   KIYQTSVGRAILSEILPKGMTFEEINKPLKKKEISRLINTSFRKCGLRETVIFADRLLQ
FT                   SGFRLATNAGISVAIDDMLIPTSKERIITEATNKVKEYDKQFMSGLVTNQERYNNVVDI
FT                   WGAAGDQVGKAMMDELSHVDVLDRNSKTVRQESFNSIYMMADSGARGSAAQIRQLAGMR
FT                   GLMAKPDGSIIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLCDV
FT                   TQDLVVIEDDCGATSGVTMKALVEGGEIIEALRDRILGRVCIGDIVHPDTQEVIVANDT
FT                   LLDEDHVDQIVALGIDEVKVRTVLSCLTRFGLCAKCYGRDLGRGGLVNVGEAVGVIAAQ
FT                   SIGEPGTQLTMRTFHIGGAASRALVASNIEAKSNGALKFSGTMRIVKNAKGEQIVISRS
FT                   GEALIIDDNGRERERHKVPYGATLLFKEDAAVKAGASLATWDPLTRPIISEYAGIARFD
FT                   NVEEGVTVAKQVDEVTGLSTLVVIDGKRRSAASKGVRPMINLVDDKGGEVMIAGTDHPV
FT                   NIGLQVGALITVKDGQKVEVGEVLARIPIESQKTRDITGGLPRVAELFEARSPKDAAVL
FT                   AKVTGTVSFGKETKGKQRLVITDMDGEANEFLIPKEKQVLVHDGQVVNKGEMIVEGPAD
FT                   PHDILTLRGIEELAIYIVDEVQDVYRLQGVKINDKHIEVIVRQMLRRVQITDGGDTAYI
FT                   TGEQVERSKLYDANDLVIAAGKRPAQFENVLLGITKASLSTDSFISAASFQETTRVLTE
FT                   AAIMGKTDTLRGLKENVIIGRLIPAGTGLSYRRARKVREQFERDRAQMIAAEEEAIANT
FT                   PVEIEAEVIAPAGEADPS"
FT   gene            56013..56393
FT                   /locus_tag="Pnuc_0048"
FT   CDS_pept        56013..56393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0048"
FT                   /product="SSU ribosomal protein S12P"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23; KEGG: reh:H16_A3494 SSU ribosomal protein
FT                   S12"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33270"
FT                   /db_xref="GOA:A4SUV6"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUV6"
FT                   /protein_id="ABP33270.1"
FT                   /translation="MPTINQLIRKPRSRLIVKSKSPALENSPQRRGVCTRVYTTTPKKP
FT                   NSALRKVAKVRLTNGFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGSLDL
FT                   QGVKDRKQSRSKYGAKRAKKAA"
FT   gene            56543..57013
FT                   /locus_tag="Pnuc_0049"
FT   CDS_pept        56543..57013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0049"
FT                   /product="SSU ribosomal protein S7P"
FT                   /note="PFAM: ribosomal protein S7; KEGG: rso:RSc3023
FT                   probable 30S ribosomal subunit protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33271"
FT                   /db_xref="GOA:A4SUV7"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUV7"
FT                   /protein_id="ABP33271.1"
FT                   /translation="MPRRREVPKREILPDPKFGNVEVAKFMNVLMLDGKKSVAERIVYG
FT                   AFDHIEKKANKEPLEIFSTAMGNVKPMVEVKSRRVGGANYQVPVEVRPSRRSALAMRWV
FT                   REAAKKRGEKSMAQRLANELLEAAEGRGGAMKKREEVHRMAEANKAFSHFRF"
FT   gene            57041..59143
FT                   /locus_tag="Pnuc_0050"
FT   CDS_pept        57041..59143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0050"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor, GTP-binding; elongation
FT                   factor Tu, domain 2 protein; elongation factor G, domain
FT                   IV; KEGG: rso:RSc3022 probable elongation factor G (ef-g
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33272"
FT                   /db_xref="GOA:A4SUV8"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUV8"
FT                   /protein_id="ABP33272.1"
FT                   /translation="MARKTPIDKYRNIGISAHIDAGKTTTTERVLFYTGVNHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTTFWKGMAGNFPEHRINIIDTPGHVDFTIEVERSMR
FT                   VLDGACMVYCAVGGVQPQSETVWRQANKYQVPRLAFVNKMDRTGANFFKVYDQMKLRLK
FT                   ANPILIQIPIGAEENFKGVVDLVKMKAIYWDEASQGTKFSYEEIPAELKASAEEWREKM
FT                   VEAAAESSEELMEKYLGGEELTEEEIKAALRQRTIANEIIPMMCGTAFKNKGVQAMLDA
FT                   VVELLPSPLDVPPVPCELEDGTPTTRKADDAEKFSALAFKIMTDPFVGQLIFFRVYSGV
FT                   MKSGDTIYNPIKGKKERVGRLLQMHANQREEIKEVYAGDIAAAVGLKDATTGETLCDPD
FT                   SIVILERMVFPEPVISQAVEPKTKPDQEKMGLALNRLAQEDPSFRVKTDEESGQTIISG
FT                   MGELHLEILVDRMRREFGVEATVGKPQVAYRETIRKVCEEIEGKFVKQSGGRGQYGHVV
FT                   LKLEPQEPGKGFEFIDAIKGGVVPREYIPAVEKGIRETLNSGILAGYPVVDIKATLFFG
FT                   SYHDVDSNENAFKMAGSMAFKDGMRKASPVLLEPMMAVEVETPEDFMGNVMGDLSSRRG
FT                   ILQGMDDIPGGGKIVRAEVPLAEMFGYSTGLRSLTQGRATYTMEFKHYSEAPKNVAEAV
FT                   MAAKAK"
FT   gene            59194..60384
FT                   /locus_tag="Pnuc_0051"
FT   CDS_pept        59194..60384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0051"
FT                   /product="translation elongation factor 1A (EF-1A/EF-Tu)"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor,
FT                   GTP-binding; elongation factor Tu domain protein domain
FT                   protein; elongation factor Tu, domain 2 protein; KEGG:
FT                   bam:Bamb_0265 translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33273"
FT                   /db_xref="GOA:A4SUU7"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUU7"
FT                   /protein_id="ABP33273.1"
FT                   /translation="MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSKAFGGEAK
FT                   AYDQIDAAPEEKARGITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCSAADGPMPQTREHILLARQVGVPYIVVFLNKCDMVDDAELLELVEMEVRELLSKYDF
FT                   PGDDTPIIQGSAKLALEGDEGPMGKEAIMKLAEALDTYIPTPERAIDGAFLMPVEDVFS
FT                   ISGRGTVVTGRIERGIVKVGEEIEIIGIKPTLKTTCTGVEMFRKLLDQGQAGDNVGILL
FT                   RGTKREEVERGQVLAKPGSITPHTHFTAEVYILGKDEGGRHTPFFNNYRPQFYFRTTDV
FT                   TGSIELPKDKEMVMPGDNVTITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKILA"
FT   gene            60518..60829
FT                   /locus_tag="Pnuc_0052"
FT   CDS_pept        60518..60829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0052"
FT                   /product="SSU ribosomal protein S10P"
FT                   /note="PFAM: ribosomal protein S10; KEGG: bxe:Bxe_A0313
FT                   ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33274"
FT                   /db_xref="GOA:A4SUW0"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUW0"
FT                   /protein_id="ABP33274.1"
FT                   /translation="MQNQKIRIRLKAFDYRLIDQSAAEIVDTAKRTGAVVKGPVPLPTR
FT                   IERFDILRSPHVNKTSRDQLEIRTHLRLMDIVDPTEKTVDALMKLDLPAGVDVEIKLQ"
FT   gene            61026..61682
FT                   /locus_tag="Pnuc_0053"
FT   CDS_pept        61026..61682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0053"
FT                   /product="LSU ribosomal protein L3P"
FT                   /note="PFAM: ribosomal protein L3; KEGG: bam:Bamb_0267
FT                   ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33275"
FT                   /db_xref="GOA:A4SUW1"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUW1"
FT                   /protein_id="ABP33275.1"
FT                   /translation="MSLGLIGRKVGMTRLFTDEGDSIPVTVIDVSDNRIAQIKTQATDG
FT                   YDAIQLAHGTRRATRVTKAMAGHFAKAGVMAGNGLNEFQLDAAKIAEMTPGQVIPADTA
FT                   FTAGQKVDVQGVSIGKGYAGTIKRYHFASGRASHGNSRSHNVPGSIGMAQDPGRVFPGK
FT                   RMTGHLGDVTRTVQNLVIARIDAERNLIMVKGAIPGAPGGKVIVTPAVKTPLKKK"
FT   gene            61694..62314
FT                   /locus_tag="Pnuc_0054"
FT   CDS_pept        61694..62314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0054"
FT                   /product="LSU ribosomal protein L4P"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: rme:Rmet_3316
FT                   ribosomal protein L4/L1e"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33276"
FT                   /db_xref="GOA:A4SUW2"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUW2"
FT                   /protein_id="ABP33276.1"
FT                   /translation="MELKLLQDNGTLGAGVQASPEVFEREYNEALVHQVVVAYQANARS
FT                   GNRAQKDREQVKHTTKKPWRQKGTGRARAGMSSSPLWRGGGRIFPNSPEENFSQKVNKK
FT                   MYRAGMRSILSQLAREGRLNVVDQFSLDAPKTKVLADKVKAMGLDSVLIIVDQVSENLY
FT                   LASRNLHKVAVCEPQHADPLALVQYKKVLVSKAAIAKIEELLK"
FT   gene            62311..62625
FT                   /locus_tag="Pnuc_0055"
FT   CDS_pept        62311..62625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0055"
FT                   /product="LSU ribosomal protein L23P"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: rso:RSc3017
FT                   probable 50S ribosomal subunit protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33277"
FT                   /db_xref="GOA:A4SUW3"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUW3"
FT                   /protein_id="ABP33277.1"
FT                   /translation="MSQVRKNDHSLMKVLLGPVISEKATMVAEKNEQVVFQVARDANKS
FT                   DVKQAVELLFKVQVDSVQIVNQKGKPKRYGRFEGRRDHTKKAYVNLKPGQEINFEAEAN
FT                   "
FT   gene            62628..63458
FT                   /locus_tag="Pnuc_0056"
FT   CDS_pept        62628..63458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0056"
FT                   /product="LSU ribosomal protein L2P"
FT                   /note="PFAM: ribosomal protein L2; KEGG: rso:RSc3016
FT                   probable 50S ribosomal subunit protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33278"
FT                   /db_xref="GOA:A4SUW4"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUW4"
FT                   /protein_id="ABP33278.1"
FT                   /translation="MPLMKTKPTSPGRRSMVKVVNPDLHKGKPFAPLLEPQFQKAGRNN
FT                   NGHITTRHKGGGHKHHYRVVDFKRNDKDGIPAKVERLEYDPNRSANIALIVFADGERRY
FT                   IPAAKGMTVGQSLMSGSEAPIKSGNNLPIRNIPVGSTIHCVEIMPGKGAQVARSAGGSA
FT                   VLLAREGVYAQVRLRSGEVRRVLIECRATIGEVGNEEHSLRVIGKAGANRWRGIRPTVR
FT                   GVAMNPVDHPHGGGEGKTGEGRVPVSPWGTPTKGYRTRRNKRTTSMIVQRRQKR"
FT   gene            63478..63756
FT                   /locus_tag="Pnuc_0057"
FT   CDS_pept        63478..63756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0057"
FT                   /product="SSU ribosomal protein S19P"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15; KEGG: reh:H16_A3480 SSU ribosomal protein
FT                   S19"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33279"
FT                   /db_xref="GOA:A4SUW5"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUW5"
FT                   /protein_id="ABP33279.1"
FT                   /translation="MTRSAKKGPFCDASLVKKVEVAQANKDKKPIKTWSRRSTILPDFI
FT                   GLTIAVHNGRQHVPVYVSENMVGHKLGEFALTRTFKGHAADKKVTKK"
FT   gene            63767..64096
FT                   /locus_tag="Pnuc_0058"
FT   CDS_pept        63767..64096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0058"
FT                   /product="LSU ribosomal protein L22P"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17; KEGG: reh:H16_A3479 LSU ribosomal protein
FT                   L22"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33280"
FT                   /db_xref="GOA:A4SUW6"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUW6"
FT                   /protein_id="ABP33280.1"
FT                   /translation="MEVKAIHKSARISAQKTRLVADQIRGLPIARALNILNFSPKKAAF
FT                   IVKKVVESAMANAEHNKGADIDELKVSTIIVDKGTSLKRFTARAKGRGNQIEKQTCHIT
FT                   VTLSN"
FT   gene            64105..64932
FT                   /locus_tag="Pnuc_0059"
FT   CDS_pept        64105..64932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0059"
FT                   /product="SSU ribosomal protein S3P"
FT                   /note="KEGG: rfr:Rfer_3789 ribosomal protein S3; TIGRFAM:
FT                   ribosomal protein S3; PFAM: ribosomal protein S3-C-terminal
FT                   domain protein; KH, type 2 domain protein; Ribosomal
FT                   protein S3, N-terminal domain; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33281"
FT                   /db_xref="GOA:A4SUW7"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUW7"
FT                   /protein_id="ABP33281.1"
FT                   /translation="MGQKINPTGFRLAVTKNWTSRWYANNTDFAKMLKEDVDVRIYLKK
FT                   KLKNASVSKVVIERPAKNARITIYSSRPGVVIGKKGEDIEVLRRELQKRMGVPVHVNIE
FT                   EIRKPEVDAQLIADSITQQLEKRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGAEIA
FT                   RREWYREGRVPLHTLKADIDYATSEAETTYGIIGVKVWVYKGDTLGRGAEAQAAATSAE
FT                   PAAEEKKTRRAPSKTAARKPAAGTDKPLVAAKPAVKRVRKVETPAADTQKSGE"
FT   gene            64935..65348
FT                   /locus_tag="Pnuc_0060"
FT   CDS_pept        64935..65348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0060"
FT                   /product="LSU ribosomal protein L16P"
FT                   /note="PFAM: ribosomal protein L16; KEGG: bte:BTH_I3061
FT                   ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33282"
FT                   /db_xref="GOA:A4SUW8"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUW8"
FT                   /protein_id="ABP33282.1"
FT                   /translation="MLQPKRRKYRKEQKGRNTGVATRGSSVAFGDFGLKAVGRGRLTAR
FT                   QIESARRAMTRHIKRGGRIWIRIFPDKPISQKPAEVRMGNGKGNPEYYVAEIQPGKVLY
FT                   EMDGVDEQLAREAFKLAAAKLPLQTTFVIRHLG"
FT   gene            65345..65557
FT                   /locus_tag="Pnuc_0061"
FT   CDS_pept        65345..65557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0061"
FT                   /product="LSU ribosomal protein L29P"
FT                   /note="PFAM: ribosomal protein L29; KEGG: bte:BTH_I3060
FT                   ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33283"
FT                   /db_xref="GOA:A4SUW9"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUW9"
FT                   /protein_id="ABP33283.1"
FT                   /translation="MIGIEIMKNTELASKDLTALNAELTELLKTSFKLRMQKGTQQLTN
FT                   TSQLGKNKRDIARVKTFIAQKTAQK"
FT   gene            65570..65839
FT                   /locus_tag="Pnuc_0062"
FT   CDS_pept        65570..65839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0062"
FT                   /product="SSU ribosomal protein S17P"
FT                   /note="PFAM: ribosomal protein S17; KEGG: rso:RSc3010
FT                   probable 30S ribosomal subunit protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33284"
FT                   /db_xref="GOA:A4SUX0"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUX0"
FT                   /protein_id="ABP33284.1"
FT                   /translation="MTELSKPLRRTLVGRVVSDKMQKTVTVLVERQVKHPVIGKYVGQS
FT                   KKYHAHDEAGTYKMGDTVEIAESKPISRTKSWVVTRLVEASKGI"
FT   gene            66023..66391
FT                   /locus_tag="Pnuc_0063"
FT   CDS_pept        66023..66391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0063"
FT                   /product="LSU ribosomal protein L14P"
FT                   /note="TIGRFAM: ribosomal protein L14; PFAM: ribosomal
FT                   protein L14b/L23e; KEGG: rso:RSc3009 probable 50S ribosomal
FT                   subunit protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33285"
FT                   /db_xref="GOA:A4SUX1"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUX1"
FT                   /protein_id="ABP33285.1"
FT                   /translation="MIQTESRLQVADNTGASEVLCIKVLGGSKRRYASIGDVIKVSVKS
FT                   AAPRGRVKKGDIYNAVVVRTAKGVRRPDGSLIKFDANAAVLLNAKLEPIGTRIFGPVTR
FT                   ELRTEKFMKIVSLAPEVI"
FT   gene            66401..66709
FT                   /locus_tag="Pnuc_0064"
FT   CDS_pept        66401..66709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0064"
FT                   /product="LSU ribosomal protein L24P"
FT                   /note="KEGG: rme:Rmet_3306 ribosomal protein L24; TIGRFAM:
FT                   ribosomal protein L24; PFAM: KOW domain protein; SMART: KOW
FT                   (Kyrpides, Ouzounis, Woese) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33286"
FT                   /db_xref="GOA:A4SUX2"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUX2"
FT                   /protein_id="ABP33286.1"
FT                   /translation="MKKIRKGDSVVLLTGRDKGKQGTVTAVLENKLVIEGVNIYKKSVK
FT                   PNPAAGVTGGMIDKTMPVHISNVAVVDGNGKPSRVGIKLVDGKKQRFLKTTGATLSA"
FT   gene            66726..67268
FT                   /locus_tag="Pnuc_0065"
FT   CDS_pept        66726..67268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0065"
FT                   /product="LSU ribosomal protein L5P"
FT                   /note="PFAM: ribosomal protein L5; KEGG: reu:Reut_A3167
FT                   ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33287"
FT                   /db_xref="GOA:A4SUX3"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUX3"
FT                   /protein_id="ABP33287.1"
FT                   /translation="MSTRFQEHYQEKVVADLITKFGYKSVMEVPRITKVTLNMGLGDAV
FT                   NDKKIIENAVGDLTKVAGQKPVVTKAKKAIAGFKIRQGYPIGAMVTLRGQRMYEFLDRF
FT                   VTVALPRVRDFRGISGKAFDGRGNYNIGVKEQIIFPEIEYDKIDALRGLNISITTTAKT
FT                   DEEAKALLAAFKFPFRN"
FT   gene            67278..67583
FT                   /locus_tag="Pnuc_0066"
FT   CDS_pept        67278..67583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0066"
FT                   /product="SSU ribosomal protein S14P"
FT                   /note="PFAM: ribosomal protein S14; KEGG: rso:RSc3006 30S
FT                   ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33288"
FT                   /db_xref="GOA:A4SUX4"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUX4"
FT                   /protein_id="ABP33288.1"
FT                   /translation="MAKLSLIERENKRAKTVEKYAVKRAELKAIIADQSRSDEERYEAR
FT                   LKLQALPRNASPIRQRNRCSLTGRPRGTFRKFGLARSKIREIAFRGEIPGLTKASW"
FT   gene            67608..68003
FT                   /locus_tag="Pnuc_0067"
FT   CDS_pept        67608..68003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0067"
FT                   /product="SSU ribosomal protein S8P"
FT                   /note="PFAM: ribosomal protein S8; KEGG: mpt:Mpe_A3429 30S
FT                   ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33289"
FT                   /db_xref="GOA:A4SUX5"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUX5"
FT                   /protein_id="ABP33289.1"
FT                   /translation="MSISDPIADMLTRIRNAQAVQKPVVLMPSSKVKVAIAKVLQDEGY
FT                   IESFEIKGEAAKPVLHIDLKYYAGRPVIERIDRVSTPSLRIYKGRHDIPEVMNGLGIAI
FT                   ISTPQGVMTDRKARATGVGGEVICYVA"
FT   gene            68014..68547
FT                   /locus_tag="Pnuc_0068"
FT   CDS_pept        68014..68547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0068"
FT                   /product="LSU ribosomal protein L6P"
FT                   /note="PFAM: ribosomal protein L6; KEGG: rso:RSc3004
FT                   probable 50S ribosomal subunit protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33290"
FT                   /db_xref="GOA:A4SUX6"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUX6"
FT                   /protein_id="ABP33290.1"
FT                   /translation="MSRVGKSPITVPKGAEISINGANVTVKGPLGTLTHNLHPSVGLKQ
FT                   EDGVLTVVLNNDSPEAGAQSGTARALVNNMVVGVTTGFERKLSLVGVGYRAAAQGETLK
FT                   LQLGFSHDIIYNLPKGVKAETPTQTEIIIKGSNKQQVGQVAAEVRAYRSPEPYKGKGVR
FT                   YVDEVVHLKETKKK"
FT   gene            68561..68914
FT                   /locus_tag="Pnuc_0069"
FT   CDS_pept        68561..68914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0069"
FT                   /product="LSU ribosomal protein L18P"
FT                   /note="TIGRFAM: ribosomal protein L18; PFAM: ribosomal
FT                   protein L18P/L5E; KEGG: bte:BTH_I3052 ribosomal protein
FT                   L18"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33291"
FT                   /db_xref="GOA:A4SUX7"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUX7"
FT                   /protein_id="ABP33291.1"
FT                   /translation="MNKDESRQRRARQTRIRIAEAQANRLTVIRSNTHISAQVYSPCGT
FT                   KVVAAASTMEKDLRQAIKNGGNAQAAAQIGKLVAERAVKAGVVDVAFDRSGHRYHGRIK
FT                   ALAEAAREAGLKF"
FT   gene            68933..69451
FT                   /locus_tag="Pnuc_0070"
FT   CDS_pept        68933..69451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0070"
FT                   /product="SSU ribosomal protein S5P"
FT                   /note="TIGRFAM: ribosomal protein S5; PFAM: ribosomal
FT                   protein S5 domain protein; Ribosomal protein S5-like; KEGG:
FT                   rme:Rmet_3300 ribosomal protein S5-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33292"
FT                   /db_xref="GOA:A4SUX8"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUX8"
FT                   /protein_id="ABP33292.1"
FT                   /translation="MAKMQTKMQNEERDDGLREKMIAVNRVTKVVKGGRILGFAALTVV
FT                   GDGDGRIGMGKGKSKEVPVAVQKAMDEARRKMIKVTLRKGTLQHTVTGQHGASRVLISP
FT                   AKDGTGIIAGGPMRAIFDVMGVTNVVAKSLGSTNPYNLVRATIDGLSKMSTPAEIAAKR
FT                   GKSVEEILG"
FT   gene            69476..69664
FT                   /locus_tag="Pnuc_0071"
FT   CDS_pept        69476..69664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0071"
FT                   /product="LSU ribosomal protein L30P"
FT                   /note="PFAM: ribosomal protein L30; KEGG: bte:BTH_I3050
FT                   ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33293"
FT                   /db_xref="GOA:A4SUX9"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUX9"
FT                   /protein_id="ABP33293.1"
FT                   /translation="MTTSNTKVKLQLVRSLIGTRESHRATVRGLGLGRINSVSELEDTP
FT                   AVRGMINKVSYLVKVIG"
FT   gene            69692..70132
FT                   /locus_tag="Pnuc_0072"
FT   CDS_pept        69692..70132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0072"
FT                   /product="LSU ribosomal protein L15P"
FT                   /note="PFAM: ribosomal protein L15; KEGG: rme:Rmet_3298
FT                   ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33294"
FT                   /db_xref="GOA:A4SUY0"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUY0"
FT                   /protein_id="ABP33294.1"
FT                   /translation="MQLNTLKPAEGSKKNRRRVGRGIGSGLGKTAGRGHKGQKSRSGGF
FT                   HKVGFEGGQMPMYRRLPKRGFVSMTRRHVGQITLNDLAKINLPEVDLLVLKAHGFAGEQ
FT                   INAVKVIKTGELKIAVTLKGLTATAGAKAAIEAAGGKLVELA"
FT   gene            70151..71488
FT                   /locus_tag="Pnuc_0073"
FT   CDS_pept        70151..71488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0073"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /note="TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein; KEGG: rso:RSc2999 probable preprotein
FT                   translocase secy (membrane subunit) transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33295"
FT                   /db_xref="GOA:A4SUY1"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUY1"
FT                   /protein_id="ABP33295.1"
FT                   /translation="MALAPTNSASTSTAGGKFGELRHRLIFLVLALLVFRLGAHIPVPG
FT                   IDPDQLAQLFAGQKDGILGMFNLFSGGALSRFTVFALGIMPYISASIIMQLMTIVVPSL
FT                   ESLKKEGQAGQRKITQYTRYGTVFLATFQALGISVALQAQPGLVINPGLTFEVNTVVTL
FT                   VTGTMFLMWLGEQITERGLGNGISIIIFGGIVSGLPNALASLLELVRTGSMNIISALLI
FT                   VVIVAAVTYFVVFVERGQRRILVNYAKRQVGNKVYGGQSSYFPLKLNMAGVIPPIFASS
FT                   IILFPATIAGWFTSGEPTNLFSRAIKDLAATLAPGQPVYTILYAAAIIFFCFFYTALVF
FT                   NSRETAENLKKSGAFVPGIRPGDQTARYIDKILVRLTLAGAIYMVLVCLLPEFLVLKYN
FT                   VPFYFGGTSLLIIVVVAMDFMAQVQSFVMQQQYGSLMKKANFKMGA"
FT   gene            71493..71711
FT                   /locus_tag="Pnuc_0074"
FT   CDS_pept        71493..71711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0074"
FT                   /product="bacterial translation initiation factor 1
FT                   (bIF-1)"
FT                   /note="TIGRFAM: translation initiation factor IF-1; PFAM:
FT                   RNA binding S1 domain protein; S1, IF1 family protein;
FT                   KEGG: pol:Bpro_0496 translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33296"
FT                   /db_xref="GOA:A4SUY2"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUY2"
FT                   /protein_id="ABP33296.1"
FT                   /translation="MSKDDVIQMAGEVVENLPNAMFRVKLENGHVFLGHISGKMRMHYI
FT                   RILPGDKVTVEMTPYDLTRARIIFRAK"
FT   gene            71888..72253
FT                   /locus_tag="Pnuc_0075"
FT   CDS_pept        71888..72253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0075"
FT                   /product="SSU ribosomal protein S13P"
FT                   /note="PFAM: ribosomal protein S13; KEGG: rme:Rmet_3294
FT                   ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33297"
FT                   /db_xref="GOA:A4SUY3"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUY3"
FT                   /protein_id="ABP33297.1"
FT                   /translation="MARIAGVNIPNHQHTVIGLTAIFGIGTTRANKICQTTGVAIDKKV
FT                   KDLTDADLEKLRDEVGKFITEGDLRREVTMSIKRLMDLGCYRGVRHRKGLPVRGQRTKT
FT                   NARTRKGPRKSGVQLKK"
FT   gene            72272..72679
FT                   /locus_tag="Pnuc_0076"
FT   CDS_pept        72272..72679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0076"
FT                   /product="SSU ribosomal protein S11P"
FT                   /note="PFAM: ribosomal protein S11; KEGG: mfa:Mfla_0303
FT                   ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33298"
FT                   /db_xref="GOA:A4SUY4"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUY4"
FT                   /protein_id="ABP33298.1"
FT                   /translation="MAKQQSASAASQRARKKVKKNVADGIAHVHASFNNTIITITDRQG
FT                   NALSWATSGGQGFKGSRKSTPFAAQVAAEVAGKAAVECGIKNLEVQIKGPGPGRESAVR
FT                   ALNSLGIKITEIQDVTPVPHNGCRPPKRRRI"
FT   gene            72798..73421
FT                   /locus_tag="Pnuc_0077"
FT   CDS_pept        72798..73421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0077"
FT                   /product="SSU ribosomal protein S4P"
FT                   /note="PFAM: ribosomal protein S4; RNA-binding S4 domain
FT                   protein; KEGG: reu:Reut_A3155 ribosomal protein S4,
FT                   bacterial and organelle form"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33299"
FT                   /db_xref="GOA:A4SUY5"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUY5"
FT                   /protein_id="ABP33299.1"
FT                   /translation="MARYLGPKAKLARREGTDLFLKSARRALSDKCKLDTKPGQHGRTS
FT                   GSRTSDYGNQLREKQKVKRIYGVLERQFRRYFAEAERRKGNTGETLLQLLESRLDNVVY
FT                   RMGFGSTRAEARQLVSHCAILLNGSPVNIPSIQVKPGDVVAIREKAKKQARITESLNLV
FT                   GQMAAVTWVSVDAAKLEGTFKQVPDREDISGEINESLIVELYSR"
FT   gene            73445..74425
FT                   /locus_tag="Pnuc_0078"
FT   CDS_pept        73445..74425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0078"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: rme:Rmet_3291 DNA-directed RNA polymerase,
FT                   alpha subunit; TIGRFAM: DNA-directed RNA polymerase, alpha
FT                   subunit; PFAM: RNA polymerase, alpha subunit domain
FT                   protein; RNA polymerase, dimerisation; RNA polymerase,
FT                   insert; SMART: RNA polymerase, RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33300"
FT                   /db_xref="GOA:A4SUY6"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUY6"
FT                   /protein_id="ABP33300.1"
FT                   /translation="MQTNLLKPKIISVEALTANQAKVVMEPFERGYGHTLGNALRRVLL
FT                   SSMVGYAPTEVAIAGVVHEYSTLDGVQEDVVNLLLNLKGIVFKLQSRDEVTINLRKEGP
FT                   GVVTAKDIDLPHDVEIMNPDHVIAHLSAGGKLDMQIKVEKGRGYVPGNVRQYNDETTKI
FT                   IGRIVLDASFSPVSRVSYAVESARVEQRTDLDRLVMTIETNGVLSPEEAIRQAASILVD
FT                   QLVVFAALESSEVSGDLAPSRSSMVDPMLMRPVDDLELTVRSANCLKAENIYYIGDLIQ
FT                   RTENELLKTPNLGRKSLNEIKDVLAARGLSLGMKLESWPPANLEK"
FT   gene            74442..74831
FT                   /locus_tag="Pnuc_0079"
FT   CDS_pept        74442..74831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0079"
FT                   /product="LSU ribosomal protein L17P"
FT                   /note="PFAM: ribosomal protein L17; KEGG: bxe:Bxe_A0341
FT                   ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33301"
FT                   /db_xref="GOA:A4SUY7"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUY7"
FT                   /protein_id="ABP33301.1"
FT                   /translation="MRHGNGLRKLNRTSSHRLAMLRNMSNSLLEHEVIKTTLPKAKELR
FT                   MVVEPLITLGKKDNLANRRLAFNRTRDRDIVTKLFTELGPRYATRPGGYLRILKFGFRH
FT                   GDNAPMALVELVDRPEVEETAVVAE"
FT   gene            74907..75257
FT                   /locus_tag="Pnuc_0080"
FT   CDS_pept        74907..75257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0080"
FT                   /product="CutA1 divalent ion tolerance protein"
FT                   /note="PFAM: CutA1 divalent ion tolerance protein; KEGG:
FT                   mca:MCA1040 periplasmic divalent cation tolerance protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33302"
FT                   /db_xref="GOA:A4SUY8"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUY8"
FT                   /protein_id="ABP33302.1"
FT                   /translation="MPQTPQDNLDAMLLVITSLPSVDTAKALAKDLIESRLAACVQLQE
FT                   GIQSLYRWEGKICEAQEVLLSAKTMATKWAEISAFIQDKHPYELPEILAFSPEQYEYQY
FT                   GKWAKSEVNSKS"
FT   gene            75254..76930
FT                   /locus_tag="Pnuc_0081"
FT   CDS_pept        75254..76930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0081"
FT                   /product="Protein-disulfide reductase"
FT                   /EC_number="1.8.1.8"
FT                   /note="PFAM: cytochrome c biogenesis protein, transmembrane
FT                   region; Thioredoxin domain; KEGG: rme:Rmet_3288 cytochrome
FT                   c biogenesis protein, transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33303"
FT                   /db_xref="GOA:A4SUY9"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036929"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUY9"
FT                   /protein_id="ABP33303.1"
FT                   /translation="MRMQSFLKTAIALLLLFAAQVFAATDFLPPEKAFKAEATWLENSN
FT                   QIEIEFLPSKGYYIYQESLKFQAGTDVGKLSSVKPSLPAGIEKFDETFQKKLQIYKQPF
FT                   LVSLEIKPIAGKPVLVEVTLQGCAEAGICYPPMTLKFLLAGPGVKAAPIPDALDGTQGV
FT                   VSQDQEEFSLSNLWRERDNVNAIGRFLENTSTTYLFLAFFVLGLALAFTPCVLPMLPIL
FT                   SSVIFGVQDGKAVSRARASLLALSYVLGMALVYALAGVLMAALGGSVQRALQSPLALGA
FT                   FALLLLALSGSLFGLYDLRLPQSWHHHVDRLAGRHQGGSVFGAFALGGISTLVASPCIT
FT                   APLAGVLAFIAQTGSMSLGAGLLFVMALGMGLPLLFIAIEARILIPSTGIWMVWLQRTL
FT                   GVLLVATAAWIASPLMQKNTGIDAVSVVNGQKERHVGELSFAVIYSPAELDVQLNKAKQ
FT                   ENKLVLLDFYADWCISCKEMEVNTFTNAEVSKELKQFVLLQADVTANSPENQALLKRYG
FT                   LYGPPGILIFTQNSEELKALRIIGYMPPQRFLEQLQKIVRN"
FT   sig_peptide     75254..75325
FT                   /locus_tag="Pnuc_0081"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            76935..77429
FT                   /locus_tag="Pnuc_0082"
FT   CDS_pept        76935..77429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0082"
FT                   /product="MOSC domain containing protein"
FT                   /note="PFAM: MOSC domain containing protein; KEGG:
FT                   fal:FRAAL1642 hypothetical protein; putative MOSC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33304"
FT                   /db_xref="GOA:A4SUZ0"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUZ0"
FT                   /protein_id="ABP33304.1"
FT                   /translation="MVRISAIFIATNAGEPMIQKSSARIFPKLGLDGDRYALGLGAYSK
FT                   AVPTKTRDVSLIAREGIDAANRKLKLLGLEEFLDNETRRNIVIEGLSSQELNKLVNQEF
FT                   YLGGLRFKATELCIPCERPSKLAKKNDFLKAFEGRGGIRAQILEAGEIKLGDRLSKTLA
FT                   I"
FT   gene            complement(77418..78443)
FT                   /locus_tag="Pnuc_0083"
FT   CDS_pept        complement(77418..78443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0083"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="PFAM: delta-aminolevulinic acid dehydratase; KEGG:
FT                   pol:Bpro_0245 porphobilinogen synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33305"
FT                   /db_xref="GOA:A4SUZ1"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUZ1"
FT                   /protein_id="ABP33305.1"
FT                   /translation="MKTKSPANSLLNFPAHRPRRMRRDDWSRRLMQENSVSASDLIYPV
FT                   FLLEGSGQSQAVASMPGVNRVSLDLLIPVAQECVDLGIPVLALFPVIDAALKTADGKEA
FT                   FNANGLIPTAVRELKKRFPNLGIMTDVALDPYTSHGQDGVLDDQGRILNDETTAILVQQ
FT                   AIAQAQAGVDIVAPSDMMDGRIGKIREALEQKNLIHTRIMAYSAKYASAFYGPFRDAVG
FT                   SSKNLGKADKKTYQMDCANGDEALREVALDISEGADMVMVKPGMPYLDIVRRVREEFDY
FT                   PTYAYQVSGEYAMLKAAAQNGWLDHDAVMMESLIAFKRAGADGVLTYFALDAARLIRSN
FT                   S"
FT   gene            complement(78421..79086)
FT                   /locus_tag="Pnuc_0084"
FT   CDS_pept        complement(78421..79086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0084"
FT                   /product="cell division checkpoint GTPase YihA"
FT                   /note="PFAM: GTP-binding protein, HSR1-related; KEGG:
FT                   reu:Reut_A3148 GTP-binding protein, HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33306"
FT                   /db_xref="GOA:A4SUZ2"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SUZ2"
FT                   /protein_id="ABP33306.1"
FT                   /translation="MSKLFQARFATTVNDTHCLPATPLREVAFAGRSNAGKSSALNVLC
FT                   NQKRLAFASKTPGRTQHINYFGIFAKDDLLAYLVDLPGYGYAAVNHETKYHWNALLSDY
FT                   LQEREQLVGMVLIVDARRGITELDEQMIQWFVPTGKPIHILLSKCDKLNKSECKHALED
FT                   VRKQLQQYDPALPDGTGESQQLTAQLFSSTKRIGLEEADNLIIKWLFEAETHEDEITS"
FT   gene            79202..79942
FT                   /locus_tag="Pnuc_0085"
FT   CDS_pept        79202..79942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0085"
FT                   /product="Cytochrome c553-like protein"
FT                   /note="KEGG: reh:H16_A3451 cytochrome c553"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33307"
FT                   /db_xref="GOA:A4SUZ3"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUZ3"
FT                   /protein_id="ABP33307.1"
FT                   /translation="MRQTSQISKFTSLRAGFAAISIFALTSISGLAIANDAPAAAPAAE
FT                   APAAEAKPVVPGKPKADPAAGEALYSAGDATRGVTACITCHGPKGQSAVGTWPKLSAQH
FT                   AAYITKQLKNFKEGTRANAVMMGMAATLTEQDMINISSFLVKQPASQGVAQNKDTIELG
FT                   QSIYRGGIASKAVPACAACHSPNGAGLPSQYPRLGGQWADYTYAQLVAFSNGTRKNGPM
FT                   MTTIAGKMSDAEMKAVSDYIAGLH"
FT   sig_peptide     79202..79306
FT                   /locus_tag="Pnuc_0085"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 35"
FT   gene            complement(80034..81332)
FT                   /locus_tag="Pnuc_0086"
FT   CDS_pept        complement(80034..81332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0086"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /note="TIGRFAM: diaminopimelate decarboxylase; PFAM:
FT                   Orn/DAP/Arg decarboxylase 2; KEGG: reh:H16_A3443
FT                   diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33308"
FT                   /db_xref="GOA:A4SUZ4"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUZ4"
FT                   /protein_id="ABP33308.1"
FT                   /translation="MISKAIPLPSLTGFSERNGNWYAEDIALADLAREFGTPLYVYSKS
FT                   ALSKAYQAYDKACVDKQGKRRARIHYAMKANSNLAVINCFKELGAGFDLVSGGELARAL
FT                   AIGADPKSLVFAGVGKSAKEIAEALKAGVKCINVESIAELHKINRVATELGLRAPISLR
FT                   VNPDVDAQTHPYISTGLKGNKFGIAYHEVLKTYREASQLAQIDVVGIDCHIGSQITTTA
FT                   PYLDALDKVLDLVAQLKKEGIVIHHLDLGGGLGISYSDETPPDITDFTDTLLNRVAERG
FT                   FGHLDVVLEPGRSLVGNAGVLLTTVEYLKPGAEKNFCIVDAAMTELMRPALYEAHHGIV
FT                   PVQAKQAKALTYDVVGPVCESGDWLGRDRHLAVEEGDLLAILSAGAYGFVMASNYNTRP
FT                   KPAEIIVDGKNAYVIRARENTSDLFASEAVLPK"
FT   gene            81571..81951
FT                   /locus_tag="Pnuc_0087"
FT   CDS_pept        81571..81951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0087"
FT                   /product="Frataxin family protein"
FT                   /note="PFAM: Frataxin family protein; KEGG: bxe:Bxe_A0353
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33309"
FT                   /db_xref="GOA:A4SUZ5"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUZ5"
FT                   /protein_id="ABP33309.1"
FT                   /translation="MNPNNSAVETIDDKQFYQLGSNLLHSIEVALESADDELDLDLDVE
FT                   RQGGNVINIRFRDKSVIVVNTQPPLHEIWVAAKSGGYHYRWAGTLAQPLWLDTKTGKEL
FT                   LSDLSEFASTQAGQPIKIELMK"
FT   gene            complement(81968..83053)
FT                   /locus_tag="Pnuc_0088"
FT   CDS_pept        complement(81968..83053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0088"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /note="PFAM: 3-dehydroquinate synthase; KEGG: reh:H16_A3434
FT                   3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33310"
FT                   /db_xref="GOA:A4SUZ6"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUZ6"
FT                   /protein_id="ABP33310.1"
FT                   /translation="MMKTLEVDLGNRSYPIYIGTDLIDQPELFNACEKATSIYIVTNTT
FT                   VAPLYSERLTKTLEKFGKPVRIIALPDGESYKDWKNLQLIFDDLLKFGADRQTMLVALG
FT                   GGVIGDMTGFAAASFMRGIRFIQVPTTLLAQVDSSVGGKTGINHPLGKNMIGAFHQPVA
FT                   VIADLNTLKTLPPRELSAGLAEVVKHGAIADAQFLDWIEANAKALLACDTDAMGHAVLR
FT                   SCEIKSAVVSADEREGGIRATLNFGHTFGHAIEAGMGYGEWLHGEAVGCGMVLGADLSC
FT                   RLKRISKADVERLTKIIHSMNLPIVPPKFGVKRYMELMQVDKKTEGGQIRYVILEKIGK
FT                   AQIESAPDALVKETLSATGAA"
FT   gene            complement(83059..83544)
FT                   /locus_tag="Pnuc_0089"
FT   CDS_pept        complement(83059..83544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0089"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="PFAM: shikimate kinase; KEGG: bur:Bcep18194_A3489
FT                   shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33311"
FT                   /db_xref="GOA:A4SUZ7"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUZ7"
FT                   /protein_id="ABP33311.1"
FT                   /translation="MGAGKSTVGKVLAKKLGRRFLDADHIIEERCGVKIPVIFEMEGEE
FT                   GFRKREAQAIREATNEKNIILATGGGAVLLPENRQALSEGGTVIYLHANPLELWHRTKG
FT                   GEGRPLLRNGDAKKILENLYAIRDPLYREIADHVIETGKPSVNQLVNTLIMQLELSN"
FT   gene            complement(83596..84657)
FT                   /locus_tag="Pnuc_0090"
FT   CDS_pept        complement(83596..84657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0090"
FT                   /product="type II and III secretion system protein"
FT                   /note="PFAM: type II and III secretion system protein;
FT                   Secretin/TonB, short N-terminal domain; KEGG: net:Neut_1803
FT                   type IV pilus secretin PilQ"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33312"
FT                   /db_xref="GOA:A4SUZ8"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUZ8"
FT                   /protein_id="ABP33312.1"
FT                   /translation="MLGISITTLANDSTPKQDHFDTIISLQFVDIEVAELLQVLAKLGH
FT                   TNFLLSESIKGKISVDLNNTPWQTALHSILASRGLRLVRNGDIYWIGPHAEIAAFQKYR
FT                   REDSALPFGGDHINSPSQILIEARIVEADERFARELGVKIGQQANLAGSRTDKKISANL
FT                   DLGGAGLNGFNPATVAATLLSKDASRLLQMELSALESEGQGKILSNPRIMTGDQVKATI
FT                   EQGTELPYQTTSQNGSKLQFRKANLRLEVLPKIHPDGKISMLVGINKDTIGMKTEQGYA
FT                   IDTKSLSSEVTVENGGTAIIGGIYQTTEREDEVKIPLLGDIPLFGHLFRHKSKLKDKTE
FT                   LLVFLTPTVLDKH"
FT   gene            complement(84714..85406)
FT                   /locus_tag="Pnuc_0091"
FT   CDS_pept        complement(84714..85406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33313"
FT                   /db_xref="GOA:A4SUZ9"
FT                   /db_xref="UniProtKB/TrEMBL:A4SUZ9"
FT                   /protein_id="ABP33313.1"
FT                   /translation="MPSRHISPQSFDSILSELGDDPAIPDPHGIRKRSAPNPPPLNQPS
FT                   PSKAAANFEGFADKNPVARLKKIGPLLGFGGAYIALGVAFLMAYNSVQSSNDSTQIDSQ
FT                   RQISEIKKELAALQNELIEIEESIYSSMDLLEVSIHSLKQIKTNPKTISKPKVIPHEAE
FT                   LRNWRYLGFSQTRGSHQAFFHNGKASVMVEKGALVLGDWVLNHFSKESVTLTHPQGKSL
FT                   ILKPSKSE"
FT   gene            85548..87884
FT                   /locus_tag="Pnuc_0092"
FT   CDS_pept        85548..87884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0092"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: rme:Rmet_3274 penicillin-binding protein 1A;
FT                   TIGRFAM: penicillin-binding protein, 1A family; PFAM:
FT                   glycosyl transferase, family 51; penicillin-binding
FT                   protein, transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33314"
FT                   /db_xref="GOA:A4SV00"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV00"
FT                   /protein_id="ABP33314.1"
FT                   /translation="MALPPKDKPTFNQRPIRQPDRRPRHSRVEPDSPQKTSGSPLIKAL
FT                   LIIGLAAAIVMTLLLGYAFLVAKPNLPKISALTDYNPKTPLRIYTADKVLIGEFGEERR
FT                   KVIPLSEIPLSMRNAVLAIEDDRFYSHGGVDYVGILRATVTNLRGHLSQGASTITMQVA
FT                   RNFFLSNEKTFSRKIYEVLLAWEIESQLTKDKILEIYMNQIFLGQRAFGFSSAAQIYFG
FT                   KELKDITIAESAMLAGLPKAPSAYNPVTNFRRAKVRQEYILQRMRDLGYINAEEYQKAL
FT                   VEELHIRGLGNEFAVRADFPAEMVRQLLFAQYGEAIYSQGIDVYTTILKADQDAAYKAV
FT                   RRGIFEYDLRHAYRGPEGFIDLPDDPVKRQRAIDEALLAYPQLDDLQSGVVLDVKPKEM
FT                   QVMIATGDTITLKGEGMKLAAASLTDSTQPKKRLRPGAVVRLLSDGGVWKLAQLPQVEA
FT                   AFVSMNAESGAILSLVGGFDFRRNQFNHVTQALRQPGSSFKPFIYAAAIEKGFSPSTMV
FT                   NDAPLSIGGMETGSQAWEPKNYDGKYDGMMRLRNALAKSKNLVSVRIIRAIGPSYTQEF
FT                   IQRFGFEPEKHPPYLTMALGAGSVTPLQMASAYSVFANGGYRVDPFLIDKMVDSKGTVL
FT                   FEAKPASVGNGAPRVLDARTAFVMDSMLQEVTKTGTAASARGKLGRTDIAGKTGTTNES
FT                   HDAWFAGYNPKVVAIAWIGFDKPASLGDKETGGGLALPMWISYMGIALKDVPQISREVP
FT                   SGVTQVDGDWFIPEFAPNGGVRELQ"
FT   gene            87897..88601
FT                   /locus_tag="Pnuc_0093"
FT   CDS_pept        87897..88601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0093"
FT                   /product="protein of unknown function DUF1568"
FT                   /note="PFAM: protein of unknown function DUF1568; KEGG:
FT                   aav:Aave_1007 protein of unknown function DUF1568"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33315"
FT                   /db_xref="GOA:A4SV01"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV01"
FT                   /protein_id="ABP33315.1"
FT                   /translation="MARQARTVIPGQAMHVMVRGNNRETLFFGDEDRGIYLEWLREAAR
FT                   LFGCAVHAFALMPNHVHLLMTPQNEDSLAKTMQSLGRRYAQYFNQQHQRSGTIWEGRYR
FT                   SSLIDPDYFLRCQRYIELNPVRAGYESSPQDSGWTSFTTHIGGNAEPWLVDHQQFWKLG
FT                   NTPFERQMNWAAFVKEGAPHWEDRQITESLIRSKPWVSDIYAKKLFKDTPGLTQIRHRG
FT                   RPRKISALNSVT"
FT   gene            88797..93542
FT                   /locus_tag="Pnuc_0094"
FT   CDS_pept        88797..93542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0094"
FT                   /product="glutamate synthase (NADH) large subunit"
FT                   /EC_number="1.4.1.14"
FT                   /note="PFAM: glutamine amidotransferase, class-II;
FT                   glutamate synthase, alpha subunit domain protein;
FT                   ferredoxin-dependent glutamate synthase; glutamate
FT                   synthase; KEGG: reh:H16_A3431 glutamate synthase [NADPH],
FT                   glutamate synthase amidotransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33316"
FT                   /db_xref="GOA:A4SV02"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV02"
FT                   /protein_id="ABP33316.1"
FT                   /translation="MTTQIHSDLRPIAQGLYDPQNEHDACGVGFVAHIKGKKSHEIVSQ
FT                   GLKILENLDHRGAVGADPLMGDGAGILIQIPDILYREEMAKQGVHLPPLGEYGVGMIFL
FT                   PKEHASRLACEQELERTVRLEGQVVLGWRDVPVDVKLPMSPTVQMTEPFIRQIFIGRGR
FT                   DIMTTDALERKLYVIRKTASHAIQDLHLKHGKEYFVASMSARTIVYKGLLLANQVGAYY
FT                   QDLQDPRTVSALALVHQRFSTNTFPAWELAHPYRMIAHNGEINTVKGNVNWVNAREGAI
FT                   SSPVLGDDLQKLWPLIYPGQSDTACFDNCLELLVMSGYPLAQAMMMMIPEAWEQHALMD
FT                   DNRRAFYEYHAAMMEPWDGPAAMAFTDGRQIGATLDRNGLRPARYYVTDDDLVIMGSEA
FT                   GVLPIPESKIIQKWRLQPGKMFMIDMEQGRIVDDVELKNAVSKAKPYKSWIDAVRVKLD
FT                   EVDASKADLIDEKITIRPAAKLLDRQQAFGYTQEDIKYLMAPMAMNGEEAIGSMGNDSP
FT                   LAVLSNKNKPLYNYFKQLFAQVTNPPIDSIRENMVMSLVSFIGPKPNLLDTNNINPPMR
FT                   LEVSQPILDFDDMTKIRHIDHYTNGKFRSYELDICYPASWGKAGIEARLASLCAEAADA
FT                   VRSGYNILIVSDRQVDEQHVAIPALLATSAIHQHLVQKGLRTSVGLVVETGSARETHHF
FT                   ALLAGYGAEAVHPYLAMETLSEMAKGLSGDLSGERAVKNFVKAVGKGLQKVMSKMGIST
FT                   YMSYTGSQIFEAIGLNHDIIDQYFKGTPSNVGGIGVFEVAEEALRMHSSAFGNDPVLTN
FT                   MLDAGGEYAFRIRGENHMWTPDTIAKLQHSTRIGAEKGYQTYKEYANIINDQTKRQMTL
FT                   RGLFEFKVDPAKAIPLDEVESAKEIVKRFATGAMSLGSISTEAHATLAVAMNRIGGKSN
FT                   TGEGGEDPNRYVNELKGIPIKRGETLASILGSDVVEANIPLLDGDSLRSKIKQVASGRF
FT                   GVTTEYLRSADQIQIKMAQGAKPGEGGQLPGGKVSDYIGKLRFSVPGVGLISPPPHHDI
FT                   YSIEDIAQLIHDLKNVNPKADVSVKLVSEVGVGTIAAGVAKAKADHVVIAGHDGGTGAS
FT                   PLSSIKHAGSPWELGLAETQQTLVLNGLRSRIRVQADGQMKTGRDVVIGALLGADEFGF
FT                   ATAPLVVEGCIMMRKCHLNTCPVGVATQDPELRKKFSGKPEHVVNFFFFIAEEAREIMA
FT                   QLGIRKFDDLIGRVDLLDTRKGIENWKVHGLDFSKIFAAPQVAADVPRYQILTQDHGLA
FT                   SALDNILIEKSEPALERGEKVSFIVPVKNVNRTVGAMLSGEVAQRYGHAGLPDDTIHIQ
FT                   LNGTAGQSFAAFLARGITLDLVGDGNDYVGKGLSGGRVIVRAPHEFRGDTAKNIIVGNT
FT                   VLYGAIAGEAFFNGVAGERFAVRNSGSTTVVEGTGDHGCEYMTGGTVVVLGTTGRNFAA
FT                   GMSGGIAYVYDEDGLFDKRCNTSMASLEKVLPSAEQIAKMPQSEWHAPIDVKDGGERLT
FT                   DEQILKSLIERHFRYTGSERAKALLADWENARGRFVKVLPTEYKRALGELWEKAQKKTI
FT                   AA"
FT   gene            93581..95044
FT                   /locus_tag="Pnuc_0095"
FT   CDS_pept        93581..95044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0095"
FT                   /product="glutamate synthase (NADH) small subunit"
FT                   /EC_number="1.4.1.14"
FT                   /note="TIGRFAM: glutamate synthase, NADH/NADPH, small
FT                   subunit; PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: bte:BTH_I3013 glutamate synthase,
FT                   small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33317"
FT                   /db_xref="GOA:A4SV03"
FT                   /db_xref="InterPro:IPR006005"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV03"
FT                   /protein_id="ABP33317.1"
FT                   /translation="MGKVTGFMEFERVDETYEAPVKRLHHYKEFVAALTDEEAKVQGAR
FT                   CMDCGIPFCNNGCPVNNIIPDFNDLVFHNDWKNALDVLQSTNNFPEFTGRICPAPCEAA
FT                   CTLGINRAPVGIKSIEHAIIDKGWESGWVKPQPSKSKTGKKVAVVGGGPAGMAAAQQLA
FT                   RVGHDVTVYEKNDRIGGLLRYGIPDFKMEKWLIDRRVEQMQAEGVKFETGIFVGKEVLG
FT                   VEVKNYSKKTVSPEQLMKDFDAVVITGGAEQPRDLPVPGRELSGVHYALEFLIPQNKEN
FT                   AGDFKNEIRATDKHVVVIGGGDTGSDCVGTSNRHGATKITQFELLPQPPEEENKPLVWP
FT                   YWPTKLRTSSSHEEGCDRDWSVGTKRFEGKNGKVEKLIGVRLEWKDGKMAEVPNSEFEI
FT                   KADLVLLAMGFVSPVQQVLNAFGVEKDARGNAKATVDGQNAYQTNVSKVFAAGDMRRGQ
FT                   SLVVWAIREGRQCARAVDEYLMGSSVLPR"
FT   gene            95055..95903
FT                   /locus_tag="Pnuc_0096"
FT   CDS_pept        95055..95903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0096"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rso:RSc2962 probable ATP-binding ABC transporter
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33318"
FT                   /db_xref="GOA:A4SV04"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030296"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV04"
FT                   /protein_id="ABP33318.1"
FT                   /translation="MNSPRPDSLDVKKPLGEVVVSINDVNFSYAPGERQILSGLNMEFR
FT                   RGQVVAVMGGSGCGKTTILRLIGGQFTAQSGEVLFEGQDIGKMSGNELMAARRRMGMLF
FT                   QFGALFTDLSVFENVAFPLREHTNLSEELLRSLVLMKLNAVGLRGARDLMPSQISGGMA
FT                   RRVALARAIALDPPLIMYDEPFAGLDPISLGITARLIRDLNNALGATSLLVTHDVEETF
FT                   EIADYVYFIANGRIGAQGTPDELSQSTDPFVRQFLDAAPDGPVPFHYPGQTLEEDFGVR
FT                   V"
FT   gene            95903..96700
FT                   /locus_tag="Pnuc_0097"
FT   CDS_pept        95903..96700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0097"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   reh:H16_A3426 ABC-type transporter, permease component
FT                   involved in toluene tolerance"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33319"
FT                   /db_xref="GOA:A4SV05"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV05"
FT                   /protein_id="ABP33319.1"
FT                   /translation="MNAVGKILDLFGDLGFFIRRNLTSLGLAARMFTAVIWRSGFLLKR
FT                   PRLVIDQILFVGNHSFVIIAVSGLFVGFVLGLQGYYTLNRYGSEQALGLLVALSLTREL
FT                   GPVITALLFAGRAGTSLTAEIGLMKAGEQLSAMEMMAVDPLGRVIAPRLWAGIISMPIL
FT                   ATIFTAVGVLGGYLVGVPLIGVDSGAFWSQMQGGVDLFSDIGNGLIKSLVFGVAVTFIA
FT                   LYQGYEAKPTPEGVSQATTRTVVISSLSVLALDFLLTAMMFSN"
FT   gene            96722..97204
FT                   /locus_tag="Pnuc_0098"
FT   CDS_pept        96722..97204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0098"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: reu:Reut_A3120 mammalian cell entry related"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33320"
FT                   /db_xref="GOA:A4SV06"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR030970"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV06"
FT                   /protein_id="ABP33320.1"
FT                   /translation="MRKSAIDIWVGIFVAIGLLAALFLALKVGNMNAVSFAPTYKITAR
FT                   FDNIGGLKPRAPVKSAGVVVGRIANISFDDKTYQATVVMTIEDAYRFPKDSSAKILTSG
FT                   LLGEQYIGLEAGGSDDMLAEGGKITQTQSAIVLESLISQFLYNKAADSGQEKGAAK"
FT   gene            97204..97962
FT                   /locus_tag="Pnuc_0099"
FT   CDS_pept        97204..97962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0099"
FT                   /product="VacJ family lipoprotein"
FT                   /note="PFAM: VacJ family lipoprotein; KEGG: pna:Pnap_0688
FT                   VacJ family lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33321"
FT                   /db_xref="GOA:A4SV07"
FT                   /db_xref="InterPro:IPR007428"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV07"
FT                   /protein_id="ABP33321.1"
FT                   /translation="MLHLGRLRRTGVRFLLVGFTALIVGCASIPAGVEPSPNDPWEPFN
FT                   RSVFEFNEGLDAYLLKPVVAGYRFVLPEFIREGIYNFFSNYNDIYTALYNLLQGKPGYA
FT                   FNDLMRVAVNTTMGLGGLLDLATPGGLEKHKEDWGQTLGVWGVPAGPYVVLPFFGPSNV
FT                   RDTFGTAADLESDYLFRLLPNVALRNSLTGLRVVNTRNTYYEAGDLLDGAAIDKYSFMR
FT                   DAYIQRRQYQINEGRDDEEPPMPPYENGYE"
FT   sig_peptide     97204..97305
FT                   /locus_tag="Pnuc_0099"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.916) with cleavage site probability 0.770 at
FT                   residue 34"
FT   gene            98024..98656
FT                   /locus_tag="Pnuc_0100"
FT   CDS_pept        98024..98656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0100"
FT                   /product="toluene tolerance family protein"
FT                   /note="PFAM: toluene tolerance family protein; KEGG:
FT                   reu:Reut_A3118 toluene tolerance"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33322"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV08"
FT                   /protein_id="ABP33322.1"
FT                   /translation="MKSYKKISKWLAMSLFVASSALFAQTPDQSTPPDALIKMVVTDVM
FT                   TSVKSDPEIQKGNIPRIVDLVEKKIVPYTDMRRTTEMAMGPNWKKATPEQQAQLTSEFK
FT                   NLLIRTYSGALSQLRDQTVQFKALRSTPDEQEVVVKTVVLGRGDPVPLDYRLEKTDKGW
FT                   KVYDMNIMGVWLVEAYRNQFANQISQNGTEGLVKFLQDRNKQLASTK"
FT   sig_peptide     98024..98098
FT                   /locus_tag="Pnuc_0100"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            98670..98927
FT                   /locus_tag="Pnuc_0101"
FT   CDS_pept        98670..98927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0101"
FT                   /product="sulfate transporter/antisigma-factor antagonist
FT                   STAS"
FT                   /note="KEGG: rme:Rmet_3254 sulfate
FT                   transporter/antisigma-factor antagonist STAS"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33323"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV09"
FT                   /protein_id="ABP33323.1"
FT                   /translation="MSFLLPKTVTQETALQLQKEGLLNAPQLRVVNCALLEDFDSTVLT
FT                   VLLAWQKKAQADGHSLSVEQAPEKLKVLANVYGVSALLGL"
FT   gene            98932..99684
FT                   /locus_tag="Pnuc_0102"
FT   CDS_pept        98932..99684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0102"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: dar:Daro_3396 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33324"
FT                   /db_xref="GOA:A4SV10"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV10"
FT                   /protein_id="ABP33324.1"
FT                   /translation="MHSAISLKNISKHYGALQALDDVSLAIEPGEFFGLLGPNGAGKTT
FT                   LISILAGLVRADKGHAAILGADVQKSFREARRMLGVVPQELVFDPFFTVRETLRFQSGY
FT                   FGIRNNDAWIDEILANLDLAGKADSNMRTLSGGMKRRVLVAQALVHRPPVIILDEPTAG
FT                   VDVELRQSLWQFISRLNQDGHTIVLTTHYLEEAEALCQRIAMLKQGKIVALDTTANLLT
FT                   RYGSVKKDGEGKTDLEEVFVNIMSGGAI"
FT   gene            99681..100469
FT                   /locus_tag="Pnuc_0103"
FT   CDS_pept        99681..100469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0103"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: reh:H16_A3420
FT                   ABC-2-type transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33325"
FT                   /db_xref="GOA:A4SV11"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV11"
FT                   /protein_id="ABP33325.1"
FT                   /translation="MKNALNKPTLEYGSGFPTLLYKEVKRFYKVAFQTVAAPVLTAILY
FT                   LMIFGHVLEGKEVYGRLSYTAFLIPGLVMMSVLQNAFANTSSSLIQSKITGNLVFVLLA
FT                   PLSHFEFYAAYILAAVFRGVVVGLGVFLITAWYGLPAIENPIWILTFAFLGAAILGSLG
FT                   LIAGIWADKYDQLAAFQNFIIMPATMLSGVFYSIHSLPPAWQVVSHFNPFFYMIDGFRF
FT                   GFFGVSDISPWNSLAIVLCFFAVVSVIALRLLQKGYKLRH"
FT   gene            100490..100738
FT                   /locus_tag="Pnuc_0104"
FT   CDS_pept        100490..100738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0104"
FT                   /product="transcriptional regulator, BolA protein family"
FT                   /note="PFAM: BolA family protein; KEGG: reh:H16_A3419
FT                   predicted transcriptional regulator, BolA superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33326"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV12"
FT                   /protein_id="ABP33326.1"
FT                   /translation="MLPTPEQIKGYIKQGIECTHIQVEGDGQHFFATIVSPEFEGKRLI
FT                   QRHQLVYAAMGDRMKAEVHALSIKAFTPEEFTQNMAK"
FT   gene            100781..102055
FT                   /locus_tag="Pnuc_0105"
FT   CDS_pept        100781..102055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0105"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase); KEGG:
FT                   bxe:Bxe_A0396
FT                   UDP-N-acetylglucosamine1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33327"
FT                   /db_xref="GOA:A4SV13"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SV13"
FT                   /protein_id="ABP33327.1"
FT                   /translation="MDKLRMTGGTPLNGEVTIAGAKNAALPILCACLLTDQPVVLRNLP
FT                   DLQDVRTMLKLLQEIGVVVSFPDANNPNHVILNAAVIKSSEATYEMVKTMRASILVLGP
FT                   LLARMHSAKVSLPGGCAIGARPVDQHIKGLKAMGASIKIKSGYIQAETKPTTERLKGAS
FT                   ILTDMITVTGTENLLMAATLASGTTILENAAREPEVGDLAELLVKMGAKITGIGSDRLV
FT                   IEGVEKLHGAEHSVIPDRIEAGTFLCAVAAAGGEVLVKHCRPDTLDAVIVKLKEAGLKM
FT                   EIGPDWIKASMQGRPKAVSFRTSEYPAFPTDMQAQLMAVNAVANGNSTITETIFENRFM
FT                   HVQELNRLGADIAIEGNTAIAQGVERLSGAIVMATDLRASASLVIAGLAAQGETQVDRI
FT                   YHLDRGYDRMEQKLTRLGANIERIK"
FT   gene            102076..102702
FT                   /locus_tag="Pnuc_0106"
FT   CDS_pept        102076..102702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0106"
FT                   /product="ATP phosphoribosyltransferase (homohexameric)"
FT                   /EC_number="2.4.2.17"
FT                   /note="KEGG: mpt:Mpe_A0830 ATP phosphoribosyltransferase;
FT                   TIGRFAM: ATP phosphoribosyltransferase; PFAM: ATP
FT                   phosphoribosyltransferase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33328"
FT                   /db_xref="GOA:A4SV14"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV14"
FT                   /protein_id="ABP33328.1"
FT                   /translation="MKLTLALSKGRIFEETAEILSKVGIMPLEDPEKSRKLIIETSNPD
FT                   VRLIIVRASDVPTYVQFGGADFGVAGLDVLMEKGTDGLYVPFDLDIAKCRMSVAVREGF
FT                   DYAAAVKQGSRLKVATKYVNCAREHFANKGVHIDTIKLYGSMELAPLVGLADAIVDLVS
FT                   TGNTLKANGLVEVEPIADISARLVVNQASYKRKRQQLQPIFELLK"
FT   gene            102737..104059
FT                   /locus_tag="Pnuc_0107"
FT   CDS_pept        102737..104059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0107"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="PFAM: histidinol dehydrogenase; KEGG: reu:Reut_A3111
FT                   histidinol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33329"
FT                   /db_xref="GOA:A4SV15"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV15"
FT                   /protein_id="ABP33329.1"
FT                   /translation="MPKPVQVKRLNSQDIGFIETLLSSLSLPMADDEAIDAAVVKILTA
FT                   VKAKGDAAVLEFTKQFDRLNVAKVSELEITRPELERAYNELSAVQKNALDVAAQRVRAY
FT                   HEKQKIEAGCHSWEYEEADGTRLGQKVTPLDRVGIYVPGGKAAYPSSVLMNAIPAKVAG
FT                   VAEVIMVVPTPDGSRNPLVLAAAYLAGVDRVFTIGGAQAVAALAYGTETIPSVDKIVGP
FT                   GNAYVAAAKRRVFGTVGIDMIAGPSEILVLCDGSSNPDWVAMDLFSQAEHDEQAQSILL
FT                   CPDAKFIEQVQDSINRLLPEMPRAKVIEASLTNRALFIQVQDMKQACEIANAIAAEHLE
FT                   ICTVDPRQWADQIRHAGAIFMGNYTSESLGDYCAGPNHVLPTARTARFSSPLGVYDFIK
FT                   RSSMIEVSEAGAQTLGAIASTLAHGEGLQAHARAAEMRLKK"
FT   gene            complement(104079..105146)
FT                   /locus_tag="Pnuc_0108"
FT   CDS_pept        complement(104079..105146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0108"
FT                   /product="histidinol phosphate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.9"
FT                   /note="TIGRFAM: histidinol-phosphate aminotransferase;
FT                   PFAM: aminotransferase, class I and II; KEGG: pfl:PFL_0930
FT                   histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33330"
FT                   /db_xref="GOA:A4SV16"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV16"
FT                   /protein_id="ABP33330.1"
FT                   /translation="MSRFWSPVVQTLTPYVPGEQPQMQRLVKLNTNESPYGPSAKALAA
FT                   IQSQTNDDLRLYPDPEGLALKKAIAQLHGLDPKQVFLGNGSDEVLAHIFAGLLKQNKPV
FT                   HFPDITYSFYPVYCKLFGIDYKTIPLGEQFEINARDYVLPNGGIIFPNPNAPTGRAIAR
FT                   SEIETLLSKNLDSVVVIDEAYVDYGTESCIPLLRGASCPENLVVVHTLSKSRALAGLRV
FT                   GFAVGHPTLIEGLERVKNSFNSYPLGRLAQAGAIAAIEDQTHLLETSAKVIQTRDRLVS
FT                   QLDALGFDTLPSTANFIFTRHPKHAGESLYQALRDRGIIVRHFKSPRIDAFLRITIGTD
FT                   EQSNELVAALQEILS"
FT   gene            105260..105847
FT                   /locus_tag="Pnuc_0109"
FT   CDS_pept        105260..105847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0109"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /note="PFAM: imidazoleglycerol-phosphate dehydratase; KEGG:
FT                   reu:Reut_A3109 imidazoleglycerol-phosphate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33331"
FT                   /db_xref="GOA:A4SV17"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SV17"
FT                   /protein_id="ABP33331.1"
FT                   /translation="MRQADVTRNTSETKIQISINLDGTGKAELASGVPFLDHMLDQIAR
FT                   HGMIDLKVVAQGDTHIDDHHTVEDVGITLGQAFAKAVGDKAGITRYGHSYVPLDETLSR
FT                   VVVDFSGRPGLEFNVPFTRARVGDFDVDLSIEFFRGFVNHAGVTLHIDNLRGINAHHQI
FT                   ETVFKAFGRALRMALTVDPRAAGVVPSTKGSL"
FT   gene            105895..106557
FT                   /locus_tag="Pnuc_0110"
FT   CDS_pept        105895..106557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0110"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   hisH"
FT                   /EC_number="2.4.2.-"
FT                   /note="TIGRFAM: imidazole glycerol phosphate synthase,
FT                   glutamine amidotransferase subunit; PFAM: glutamine
FT                   amidotransferase class-I; CobB/CobQ domain protein
FT                   glutamine amidotransferase; KEGG: rme:Rmet_3244 imidazole
FT                   glycerol phosphate synthase, glutamine amidotransferase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33332"
FT                   /db_xref="GOA:A4SV18"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV18"
FT                   /protein_id="ABP33332.1"
FT                   /translation="MAQTIAIVDYGMGNLRSVYQAFHHVAPDDNVLIAHKPEEILSADR
FT                   VVLPGQGAMPDCMKHLEESGLLEALLEASKNKPLLGVCVGEQMLFDQSAEVRVSENGKW
FT                   TPCLGLIPGEVRRFELAGKKQADGSAYKVPHMGWNQVRQDRSHPIWDGIPDLTSFYFVH
FT                   SYYVVPQRKEDIAGSTEYGDWFASAVARDNIFATQFHPEKSAEYGLKLYKNFVSWQP"
FT   gene            106577..107338
FT                   /locus_tag="Pnuc_0111"
FT   CDS_pept        106577..107338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0111"
FT                   /product="1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]
FT                   imidazole-4-carboxamide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /note="TIGRFAM: phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase; PFAM: histidine
FT                   biosynthesis; KEGG: pol:Bpro_0808
FT                   phosphoribosylformimino-5-aminoimidazole carboxamide
FT                   ribotide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33333"
FT                   /db_xref="GOA:A4SV19"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SV19"
FT                   /protein_id="ABP33333.1"
FT                   /translation="MLLIPAIDLKDGHCVRLEQGDMDKATVFSEDPGAMAAHWISKGAR
FT                   RLHLVDLNGAFAGKLKNESAIKSILKAVGNEIPVQLGGGIRDLETIERLLDDGISTVII
FT                   GTAAVKNPGFVQDACTAFPGHVMVGLDARDGKVATDGWSKITGHEVIDLAKKFEDWGVE
FT                   AIIYTDIGRDGMLKGVNIEATMKLAQAIRIPVIASGGLSNNQDIEALCKAEEEGVMGVI
FT                   AGRSIYAADLDLAAAQKYADELTLKYAKKII"
FT   gene            107338..108096
FT                   /locus_tag="Pnuc_0112"
FT   CDS_pept        107338..108096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0112"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   hisF"
FT                   /EC_number="4.1.3.-"
FT                   /note="TIGRFAM: imidazoleglycerol phosphate synthase,
FT                   cyclase subunit; PFAM: histidine biosynthesis; KEGG:
FT                   reh:H16_A3410 cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33334"
FT                   /db_xref="GOA:A4SV20"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SV20"
FT                   /protein_id="ABP33334.1"
FT                   /translation="MLTKRIIPCLDVTAGRVVKGVNFVGLRDAGDPVEIARRYDSQGAD
FT                   ELTFLDITATSDGRDLILHIIENVASQVFIPLTVGGGVRAVADVRRLLNAGADKVSMNS
FT                   SAVANPDLVSDAAAYYGSQCIVVAIDAKQTEAGNWEVFTHGGRTATGMDVVEWAKEVAK
FT                   RGAGEILLTSMNRDGSKDGFDLALTAAVSDAVSVPVIASGGVGNLQHLVDGITKGHADA
FT                   VLAASIFHYGEYTVQEAKEYMAAQGVPVRI"
FT   gene            108139..108552
FT                   /locus_tag="Pnuc_0113"
FT   CDS_pept        108139..108552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0113"
FT                   /product="phosphoribosyl-AMP cyclohydrolase"
FT                   /EC_number="3.5.4.19"
FT                   /note="PFAM: phosphoribosyl-AMP cyclohydrolase; KEGG:
FT                   eba:ebB39 phosphoribosyl-AMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33335"
FT                   /db_xref="GOA:A4SV21"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV21"
FT                   /protein_id="ABP33335.1"
FT                   /translation="MSKPLSTFTPIEAIQAGPWLDAVTWNEQGLVPVIAQELGSNDILM
FT                   MAWMNRDALLETLRLGEAVYWTRSRQKLWHKGEESGHTQKVKEIRLDCDGDTILLLVEQ
FT                   KDGIACHTGEHSCFFQQWDSAQAKWVDESKSKK"
FT   gene            108585..108986
FT                   /locus_tag="Pnuc_0114"
FT   CDS_pept        108585..108986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0114"
FT                   /product="phosphoribosyl-ATP pyrophosphohydrolase"
FT                   /note="PFAM: phosphoribosyl-ATP pyrophosphohydrolase; KEGG:
FT                   bxe:Bxe_A0406 putative phosphoribosyl-ATP
FT                   pyrophosphohydrolase HisE"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33336"
FT                   /db_xref="GOA:A4SV22"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV22"
FT                   /protein_id="ABP33336.1"
FT                   /translation="MSSPTNKSINVDTGLAHLADVVDQRRDAFKAGSADPKTSYTALLF
FT                   SKGDDGILKKIGEEATEAVMAAKDARNSNLAAEQQKLLIGEMADLWFHCLIALSQFNLR
FT                   PEDVIAELDRRLGTSGIEEKAARKAANPE"
FT   gene            109013..109369
FT                   /locus_tag="Pnuc_0115"
FT   CDS_pept        109013..109369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0115"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="PFAM: histidine triad (HIT) protein; KEGG:
FT                   vei:Veis_0702 histidine triad (HIT) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33337"
FT                   /db_xref="GOA:A4SV23"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV23"
FT                   /protein_id="ABP33337.1"
FT                   /translation="MSHDPNCLFCKISQGLIPSQKVYEDEEIYAFKDINPAAPVHFLMI
FT                   PKKHIPMLELAESVDTPLLGKMMELAPRLAKEQGCRPGKDGGFRLMVNNGVDGGQEVYH
FT                   LHLHVMGGPRPWKK"
FT   gene            109386..109607
FT                   /locus_tag="Pnuc_0116"
FT   CDS_pept        109386..109607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0116"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatA/E
FT                   family subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: rme:Rmet_3237 twin-arginine
FT                   translocation protein, TatA/E family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33338"
FT                   /db_xref="GOA:A4SV24"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SV24"
FT                   /protein_id="ABP33338.1"
FT                   /translation="MGSFSIWHWLIVLVIVMLVFGTKKLRNIGQDLGGAVKGFKDGMKS
FT                   AEDPNEQIPQSTTTAEKTVDVQAKDINK"
FT   gene            109645..110121
FT                   /locus_tag="Pnuc_0117"
FT   CDS_pept        109645..110121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0117"
FT                   /product="twin-arginine translocation protein, TatB
FT                   subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatB
FT                   subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: reu:Reut_A3099 twin-arginine
FT                   translocation protein TatB"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33339"
FT                   /db_xref="GOA:A4SV25"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV25"
FT                   /protein_id="ABP33339.1"
FT                   /translation="MIDLGVSKLALIAVVALVVVGPERLPKVARMAGNLFGRAQRYMAD
FT                   VKSEVNRQMEIEEFKKFREETTSALKEVENSIGSVAKEASGNLTDQADIFETSFEKPPL
FT                   DEKEVMRKTKRQGRNSWGVRRAARPLWFKRSSGMRTRIQSGAARMKRFHHAAGK"
FT   gene            110140..110916
FT                   /locus_tag="Pnuc_0118"
FT   CDS_pept        110140..110916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0118"
FT                   /product="Sec-independent protein translocase TatC"
FT                   /note="TIGRFAM: Sec-independent protein translocase, TatC
FT                   subunit; PFAM: Sec-independent periplasmic protein
FT                   translocase; KEGG: bxe:Bxe_A0411 twin-arginine
FT                   translocation protein, TatC"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33340"
FT                   /db_xref="GOA:A4SV26"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV26"
FT                   /protein_id="ABP33340.1"
FT                   /translation="MTENNATEDSGLQESFLSHLFELRDRVIKAGLAIIVVFACLVYWA
FT                   PDIFHLFAQPLLSALPAGGKMIVTDVTGSFFVPMKVTMVVAFIIALPVVMYQLWAFIAP
FT                   GLYLHERKLILPLVVSSYTLFIIGMAFAYFLVFPTVFKFMASYNAPLGAEMSTDIDNYL
FT                   SFAMTTFLAFGITFEVPVVVVVLVRMGIVPLSKLREIRPYVIVGAFVISAVVTPPDVLS
FT                   QLLLAVPMTLLYELGLLVARMYVPKPSEDEVVRPTD"
FT   gene            complement(110979..112361)
FT                   /pseudo
FT                   /locus_tag="Pnuc_0119"
FT   gene            112570..113844
FT                   /locus_tag="Pnuc_0120"
FT   CDS_pept        112570..113844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0120"
FT                   /product="porin, Gram-negative type"
FT                   /note="PFAM: porin, Gram-negative type; KEGG: pna:Pnap_0650
FT                   porin, gram-negative type"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33341"
FT                   /db_xref="GOA:A4SV27"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV27"
FT                   /protein_id="ABP33341.1"
FT                   /translation="MKKSLFAVAALSAIAGSAQAQSSVTVYGLLDLGYVGYNTRAATGS
FT                   TQNPQAVNKTTGNAFSSSAESTSRLGFKGTEDLGGGTSAFFTVELGLTPNNNQAVNTGG
FT                   TQNRQTFVGLKKNGIGQFALGTQYTVVHNAVAATDPGQANNISGNLIYPATTEGAGSAE
FT                   NSTGAAYTVRTNNQLSLNSDTFAGFKANAMLVANNKNSNETITVTGTPAAGTYAAAGGL
FT                   NNQNGWGLGLDYTFKNFYATANYQAMTSKQSAQTYTYTSPYVTGITAGAPAQGYAGGSS
FT                   ANGTNVQDNQWYVAATYDFGILKAYAQYITRKVSAQQDNSYYYKRSAEQIGVRSFITPT
FT                   IEAWVSGGLGRYNGYGANTANLTAWQIGSNYWLSKRTNLYAIYGQVGTSNASYPTSVAG
FT                   GAQNTNLNPASANISNYAVGVRHTF"
FT   sig_peptide     112570..112632
FT                   /locus_tag="Pnuc_0120"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.982 at
FT                   residue 21"
FT   gene            113982..116180
FT                   /locus_tag="Pnuc_0121"
FT   CDS_pept        113982..116180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0121"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_4; Tetratricopeptide TPR_2 repeat
FT                   protein; SMART: Tetratricopeptide domain protein; KEGG:
FT                   cph:Cpha266_1840 TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33342"
FT                   /db_xref="GOA:A4SV28"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029489"
FT                   /db_xref="InterPro:IPR037919"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV28"
FT                   /protein_id="ABP33342.1"
FT                   /translation="MSSPQTIQLLQKAVQEIQANELESAKLHLKAVLSKERSQPDALRF
FT                   LGIIAGLQKDWTQALELIDQAIAVSPENGLAYSNRGNVLSELKRHEEALTCYEKAISLQ
FT                   PDYAEAYSNQGNALQALGRFEEALICYEKAISLQPDYAEAYSNQGNAFLALSRYQAALA
FT                   CYEKTVLLDANNAKAFYGAAIIFDLQKKYDYSLGCCNQALKIQPHYLEALALRGTIYFR
FT                   AKDYEQALTNFDEILLIHPQSIQAWLSKGDIYAETKQFEKADEAFKKALVIDPTKDFLF
FT                   GLSIQNQIQMCQWTDLTNQVKDLVHRVRDGEKVAIPYNLISLVDDKSLIRCSIEIYAQA
FT                   MRGNIERVKQEKISPKKKIRLGYFSADFHNHPTAYLVAELFECHDKEKFELFGFVFGRN
FT                   APDEMRNRLEKSFDQFLDVEDRSDEEIAQLAREMHIDIAIDLKGFTKEARPKIFMYGAA
FT                   PIQISYLAFPGTMGLPCFDYVIADPILIPEKHQDGMVEKIIYMPDSYQVNDRSRKISPL
FT                   IKSRKELGLPESGFVFCCFNNNYKITPAVLDGWVKILLAVEGSVLWLYEDNPIAVANLK
FT                   QEALTRGLDAGRFIFAGRMDSADHLARYKNANLFLDTTPCNAHTTASDALWAGLPVLTL
FT                   AGESFGARVAASLNNAVGLSGLTVETQEEYEALAIQLATSPSRLKELKDRLERNLLTAP
FT                   LFDTPLFTKNLEAGYIEAYERHQQNMPLDHIYIDAPKG"
FT   gene            complement(116170..118152)
FT                   /locus_tag="Pnuc_0122"
FT   CDS_pept        complement(116170..118152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0122"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: cph:Cpha266_1841
FT                   TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33343"
FT                   /db_xref="GOA:A4SV29"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029489"
FT                   /db_xref="InterPro:IPR037919"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV29"
FT                   /protein_id="ABP33343.1"
FT                   /translation="MKEAVATQTLFANALTFAQSEQYQAAIDVLAKLLKAEPNHEGAQQ
FT                   LIGAISNALPNKNQSITLLKEFIEISSSSPVLLYALGSLHLELGNYPEAILHLNHALDL
FT                   DPNSFESLHDIGAAYALSGNKVAALESLLKAAKINSQSADLFYNLGRLYDDQFEYGAAI
FT                   TAYRKSVEINSSFTEAWINLGIDLGVYKKYSESLRCLDIAYAQNPNVDFLYGDCLYLHM
FT                   RMCLWEKLNLAKDNIEKGVMKGTRIIPPFPLSALIDSPTLNLEAAKIYTQARYPKNSSL
FT                   GPISNSSNKKIKVGYFSPDFHEHPVSYLMAEVFELHDRSQFEIYGFSFGKPNNDAMRQR
FT                   VESSFDHFLDVAQNTPQEIASMSREMGIDIAIDLCGFTENARTEIFAMRAAPIQASYIG
FT                   FLGSMGAEYIDYLIADEVIVPPQLRQFYSEKIIYLPSYQANDSKRAPSEKYFAKSDFGI
FT                   QEDQFVFCNLNNAFKITQAIFDSWLRILKMTPNSVMLLYAENAEATKNLLEYASKNGVA
FT                   PQRFVFAERLTRADYLARYKITDLFLDTTPYNAGTTASDALWMDIPVITLQGESFPSRV
FT                   ASSLLTHLDLPELIHQSMAGYETQAVELATYPEKYIDLKNKLIANKNSTRLFNSNLFMH
FT                   SYESALKEANTLFCANLPLKDIISL"
FT   gene            complement(118149..119321)
FT                   /locus_tag="Pnuc_0123"
FT   CDS_pept        complement(118149..119321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0123"
FT                   /product="peptidase S1 and S6, chymotrypsin/Hap"
FT                   /note="PFAM: peptidase S1 and S6, chymotrypsin/Hap;
FT                   PDZ/DHR/GLGF domain protein; KEGG: rme:Rmet_3233 peptidase
FT                   S1 and S6, chymotrypsin/Hap"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33344"
FT                   /db_xref="GOA:A4SV30"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV30"
FT                   /protein_id="ABP33344.1"
FT                   /translation="MFNRLWLLFAQSVTILLAAWFIVATLKPQWVSSPNQNLLERVTLK
FT                   EGLYDGSSLSPGSYHEAVKKSMPAVVNIFTNKNSSKPKTKKRNHSSDPLFKFFFGDEPP
FT                   GEEPKSSLGSGVLVSPEGVILTNHHVISDADEVEVSLADGRKFSAKLIGSDPETDIAVL
FT                   KINAPSLPTPITFGEIESVYVGDIVLAIGNPFGVGQTVTSGIVSALGRDHVGINTFENF
FT                   IQTDASINPGNSGGALVDTRGNLIGINTAIYSNNGGSMGIGFAIPVNLAKQVMESILIT
FT                   GGVTRGWIGVEPQNLSKELSESLGLPANTEGVLLSGILEGGPAARGGAQPGDVLISVND
FT                   KPIMDVRQLLNQIAQIGPGNTADLKVLRKNKTLDLKVQTGKRPKPTAVNQ"
FT   sig_peptide     complement(119265..119321)
FT                   /locus_tag="Pnuc_0123"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.709) with cleavage site probability 0.363 at
FT                   residue 19"
FT   gene            complement(119344..119766)
FT                   /locus_tag="Pnuc_0124"
FT   CDS_pept        complement(119344..119766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0124"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /note="TIGRFAM: large conductance mechanosensitive channel
FT                   protein; PFAM: large-conductance mechanosensitive channel;
FT                   KEGG: ajs:Ajs_0788 large conductance mechanosensitive
FT                   channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33345"
FT                   /db_xref="GOA:A4SV31"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV31"
FT                   /protein_id="ABP33345.1"
FT                   /translation="MGVLKEFRDFAVKGNVIDLAVGVIIGGAFGKIVDSLVNDIVMPLI
FT                   STLFGGHIDFSNLFIVLGQVPEGVPRTFDALKKAGVPLFAYGNFITISINFILLAFVIF
FT                   QMVKVVNKVRVMDAPPPPPTPEDIVLLREIRDSLKK"
FT   gene            119904..120506
FT                   /locus_tag="Pnuc_0125"
FT   CDS_pept        119904..120506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0125"
FT                   /product="ubiquinol-cytochrome c reductase, iron-sulfur
FT                   subunit"
FT                   /EC_number="1.10.2.2"
FT                   /note="KEGG: ajs:Ajs_0789 ubiquinol-cytochrome c reductase,
FT                   iron-sulfur subunit; TIGRFAM: ubiquinol-cytochrome c
FT                   reductase, iron-sulfur subunit; PFAM: Rieske [2Fe-2S]
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33346"
FT                   /db_xref="GOA:A4SV32"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019470"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV32"
FT                   /protein_id="ABP33346.1"
FT                   /translation="MSDKPCMDKDRRNWLIATSAVGGVGAAAALYPFVDSFEPSERAKA
FT                   AGAAVEIDIAGMQPDEMRTVEWRGKPVWVVRRTPEQVAELSKIDNELADPNSLRDPAQF
FT                   TPPYAQNQWRSIKPEYLVVVGICTHLGCSPSAKFEAGAQPSLPSSWPGGFLCPCHGSTF
FT                   DMAGRVFKNKPAPDNLEVPPHMYLSDTKILIGDDKKA"
FT   gene            120517..121917
FT                   /locus_tag="Pnuc_0126"
FT   CDS_pept        120517..121917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0126"
FT                   /product="Cytochrome b/b6, N-terminal domain protein"
FT                   /note="PFAM: Cytochrome b/b6, N-terminal domain; KEGG:
FT                   rso:RSc2928 putative cytochrome B subunit transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33347"
FT                   /db_xref="GOA:A4SV33"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR030689"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV33"
FT                   /protein_id="ABP33347.1"
FT                   /translation="MAFHEKEVPADASAAQKLMAWVDSRLPVTDAFKRHMSEYYAPKNL
FT                   NFFYIFGALAIVVLALQIITGIFLVMNYKPDAAKAFDSVEYIMREVPWGWLIRYMHSTG
FT                   ASMFFVVVYMHMFRGLIYGSYRKPRELIWIFGCAIFLCLMGEAFFGYLLPWGQMSYWGA
FT                   QVIVNLFSAIPLIGPDLSLWLRGDYVVGDATLNRFFAFHVIAIPLVLIGLVAAHILALH
FT                   EVGSNNPDGVEIKDNLDAQGHPVDGIPFHPYYSVHDVMYLGGFLMVFACIVFFAPEMGG
FT                   YFLEANNFIPANPLQTPLHIAPVWYFTPFYSMLRATTTNFLLPLWIFLAVILGMFALKT
FT                   KDMKVKGACAAIALILAVGFYLFDAKFWGVVIMGGSVVIMFFLPWLDHSPVKSIRYRPQ
FT                   FHKYIYGIFVVCFVILGYLGIQPPSPVFEKISQICTIYYLGFFLGMPFWSTLGTFKPVP
FT                   TRVTFKSH"
FT   gene            121951..122724
FT                   /locus_tag="Pnuc_0127"
FT   CDS_pept        121951..122724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0127"
FT                   /product="cytochrome c1"
FT                   /note="PFAM: cytochrome c1; KEGG: reh:H16_A3396
FT                   ubiquinol-cytochrome c reductase, cytochrome c1"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33348"
FT                   /db_xref="GOA:A4SV34"
FT                   /db_xref="InterPro:IPR002326"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV34"
FT                   /protein_id="ABP33348.1"
FT                   /translation="MKRILQTLMGVCQATLLVAALGLGANANANEGGFPLDAAPNRVSN
FT                   NASLQNGAKLFVNYCLNCHAATSMRYNRLRDIGLTDQQIKDNLILNDAKVGDLMTISMT
FT                   PKEGKAFFGKNPPDLSVEARARGTDWLYTYLRTFYKDDTTQTGWNNLVYPKVGMPHVLW
FT                   QLQGERAAKFEEHKDPHDESRTEEVFVGFEQLTPGTMKPQEYDDNIADLVAFMSWMAEP
FT                   VQLERKRLGVVVLLFLAIFTLLAWRLNKAYWKDIH"
FT   sig_peptide     121951..122040
FT                   /locus_tag="Pnuc_0127"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.855 at
FT                   residue 30"
FT   gene            122834..123445
FT                   /locus_tag="Pnuc_0128"
FT   CDS_pept        122834..123445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0128"
FT                   /product="Glutathione S-transferase, N-terminal domain
FT                   protein"
FT                   /note="PFAM: Glutathione S-transferase, N-terminal domain;
FT                   KEGG: bam:Bamb_0362 glutathione S-transferase, N-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33349"
FT                   /db_xref="GOA:A4SV35"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034341"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV35"
FT                   /protein_id="ABP33349.1"
FT                   /translation="MMVLYSGTNCPFSQRCRLVLFEKGMDFEIRDVDLFNKPEDISVMN
FT                   PYGQVPILVERDLILYESNIINEYIDERFPHPQLMPPDPVARARARLFLFNFEKELFVH
FT                   VAALENEKGKAADKVHEKARLAIRDRLTQLAPIFVKNKYMLGDEFSMLDVAIAPLLWRL
FT                   EHYGIDLSRNAAALLKYAERIFSRPAYIEALTPSEKVMRR"
FT   gene            123474..123881
FT                   /locus_tag="Pnuc_0129"
FT   CDS_pept        123474..123881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0129"
FT                   /product="Stringent starvation protein B"
FT                   /note="PFAM: Stringent starvation protein B; KEGG:
FT                   rso:RSc2925 putative stringent starvation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33350"
FT                   /db_xref="InterPro:IPR007481"
FT                   /db_xref="InterPro:IPR036760"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV36"
FT                   /protein_id="ABP33350.1"
FT                   /translation="MSDVPSNKPYLIRALHQWCTDFGFTPFIAVFVDARVEVPMEFVKN
FT                   DEIVLNLSLDACHQLQMENDWISFQARFGGIPRKIMVPVSHVLAIYARENGQGMSFPFD
FT                   PSQMKDLHIADSSDAAVEKPKTNKPGLRIVK"
FT   gene            123899..123974
FT                   /locus_tag="Pnuc_R0011"
FT                   /note="tRNA-Thr2"
FT   tRNA            123899..123974
FT                   /locus_tag="Pnuc_R0011"
FT                   /product="tRNA-Thr"
FT   gene            124186..124761
FT                   /locus_tag="Pnuc_0130"
FT   CDS_pept        124186..124761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0130"
FT                   /product="TPR domain protein"
FT                   /note="KEGG: cph:Cpha266_1837 TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33351"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV37"
FT                   /protein_id="ABP33351.1"
FT                   /translation="MQLFPENKRGLSSVYNQAIDQLSNEPCLFVFAHDDLFILDFYWAS
FT                   AIANGLEHFGIVGCAGNKRRQALQPSWAFQNDQFEWDSPENLSGIVGHGTTFPAIGLSI
FT                   FGPPFQEVKLLDGLLLAAYSETLIKNNIRFDEQFDFHFYDMDFCRQAEINDVKMGTIPL
FT                   SLVHESGGNFGTDAWKHGYQKYLQKWKE"
FT   gene            complement(124781..126121)
FT                   /locus_tag="Pnuc_0131"
FT   CDS_pept        complement(124781..126121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0131"
FT                   /product="General substrate transporter"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: azo:azo2850 putative
FT                   sugar transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33352"
FT                   /db_xref="GOA:A4SV38"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV38"
FT                   /protein_id="ABP33352.1"
FT                   /translation="MNNINHLEKSENAHSYRKVALAACFGTFLEWYDFLTFATLAVVFS
FT                   PLFFPSSDPSTGLLASLATFGVGMVVRPIGAAFFGSLGDRIGRKPVFMVTITIMGLATV
FT                   CVGFLPTYAQIGIWAPILLVVLRLLQGLSAGGEIGGSAVYLTEHAGTKNRGFKTSFLQL
FT                   MGPLGILFSTLQIALLRNYLTPEEFESWGWRVPFWISIILLAIAFKVRMSLEETPIYLE
FT                   LMNKNQRSESPLLENFKDPKTRKHMFLLFFCISAGGAILFFCVQVYTAIYLKTSTNIPA
FT                   EVVDKLSIYGTISLLFFTVFAGWLSDKIGRKPVVVSGLVLGAVLILPAFELLNALGNNT
FT                   SNQNNSNYLLALILIGISGILGLVVGPQTALLAELFPAKSRNSAATLPHNLAAGWIGGL
FT                   LPLIVTWINREYGNATAGLWYPTAFLICAAITALIYLPETVATNLRE"
FT   gene            126296..126880
FT                   /locus_tag="Pnuc_0132"
FT   CDS_pept        126296..126880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0132"
FT                   /product="phasin family protein"
FT                   /note="KEGG: pna:Pnap_3102 phasin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33353"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV39"
FT                   /protein_id="ABP33353.1"
FT                   /translation="MNQDQITAKLSQINSKGLEATFSLSEAALENAQKLAELNYAASKD
FT                   ILVNAQDGIQQVLTVKDPKQVAEILNTETMQAAGNQAAAYQKKVSKVLRDGNKEFANVV
FT                   DATIDQLQDGFQDWINTVATNAPAGSDVFLSSFKTAYGSALQGFEQFRAASKEAFATAE
FT                   KNADQAIEAVQGQIAQVKKAATPASRGRKSA"
FT   gene            complement(126974..128248)
FT                   /locus_tag="Pnuc_0133"
FT   CDS_pept        complement(126974..128248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0133"
FT                   /product="protein of unknown function DUF195"
FT                   /note="PFAM: protein of unknown function DUF195; KEGG:
FT                   mpt:Mpe_B0614 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33354"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV40"
FT                   /protein_id="ABP33354.1"
FT                   /translation="MTFDLSSLLLFGLPFGLCAGLLVYALSLRSSLTRAELSAQTEAAL
FT                   ALSLRTERDQALQNAIRLEAELDSERKQGLGRIESLNEAKEALTSQFKNLANEILEDKS
FT                   KRFTEQNAASLDALLKPLQTKLTEFKEQVSTSYGNEARERFALKSEIERLANLNLRMSD
FT                   ETRSLTQALKGDSKVQGNWGELVLESILESSGLRKGEEYVVQDSHTQTDGSRLQPDVVI
FT                   KLPEGRSLVVDSKVSITAYARHAETTDPELAEKELAAHIQSLRQHIQGLSGKNYSSLYG
FT                   VGSVDFVLMFVPIEPAFLLALKTAPNLYQEALAKNIVLVCPSTLMATLRTVAHLWRQDH
FT                   QNRNALEIAKQCGNLYDKFVGFVDDLEKLGQRLDQAQTSYHDAFNKLKTGKGNLIRSAE
FT                   KVRELGVKPSKNLSTPLIESSAEND"
FT   sig_peptide     complement(128171..128248)
FT                   /locus_tag="Pnuc_0133"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.965) with cleavage site probability 0.550 at
FT                   residue 26"
FT   gene            complement(128262..128570)
FT                   /locus_tag="Pnuc_0134"
FT   CDS_pept        complement(128262..128570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0134"
FT                   /product="glutaredoxin-like protein"
FT                   /note="TIGRFAM: glutaredoxin-like protein; PFAM:
FT                   glutaredoxin; KEGG: reh:H16_A3343 glutaredoxin-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33355"
FT                   /db_xref="GOA:A4SV41"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV41"
FT                   /protein_id="ABP33355.1"
FT                   /translation="MDTQAQIKEIVTSHPVVLFMKGNAQFPQCGFSGNAINILKASGVE
FT                   KLHTVNVLEDEGIRQGIKQYANWPTIPQLYINGEFIGGSDIMTEMFQSGELQKLVKG"
FT   gene            complement(128668..129519)
FT                   /locus_tag="Pnuc_0135"
FT   CDS_pept        complement(128668..129519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0135"
FT                   /product="[protein release factor]-glutamine
FT                   N5-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: modification methylase, HemK family; PFAM:
FT                   putative RNA methylase; methyltransferase small; KEGG:
FT                   hch:HCH_01734 methylase of polypeptide chain release
FT                   factors"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33356"
FT                   /db_xref="GOA:A4SV42"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV42"
FT                   /protein_id="ABP33356.1"
FT                   /translation="MSSDLTLRSLLGNSQLPPNEARILMAHILEKHYALPRSALLSRDD
FT                   MALEVQALAHWKELESKRLDGEPIAYLIGKRGFHNIELQVAPGVLIPRAETELLVDIGL
FT                   KEIARLTDNQKMVKVLDLGTGSGAIALALTHEASNISVTATDQSLDALAIARSNAHYLE
FT                   LENRVCFAQGNWYEAISKNDVFDIILSNPPYIANHDPHLTQGDLRFEPLSALTDHSTGL
FT                   TCLETIIFGAKAHLNTEGLLAVEHGFDQSEAVVELMRTAQLKDIQIHLDLAGHNRVVSG
FT                   RK"
FT   gene            complement(129527..130606)
FT                   /locus_tag="Pnuc_0136"
FT   CDS_pept        complement(129527..130606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0136"
FT                   /product="bacterial peptide chain release factor 1 (bRF-1)"
FT                   /note="TIGRFAM: peptide chain release factor 1; PFAM: Class
FT                   I peptide chain release factor; PCRF domain protein; KEGG:
FT                   bur:Bcep18194_A3597 peptide chain release factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33357"
FT                   /db_xref="GOA:A4SV43"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SV43"
FT                   /protein_id="ABP33357.1"
FT                   /translation="MKPSMRAKLDHLDTRLAELNSLLTSEEATKDMDAYRKLTREHSDI
FT                   ATVVEQFGLYKKAEADAQAAEEMRKDPEMKDFADEEQKQAQATMEELEGALQKLLLPKD
FT                   VNDERNVFLEIRAGTGGDESALFAGDLLRMYTRFAERQGWKVEVVNAAESDLGGYKEVV
FT                   LRLVGQSVYSRLKFESGGHRVQRVPQTETQGRIHTSACTVAVMPEADELEAVKINPAEL
FT                   RIDTFRASGAGGQHINKTDSAVRITHIPTGTVVECQDDRSQHRNREQAMKVLVSRIMDA
FT                   REREKHQLEAQTRKSLIGSGDRSDRIRTYNFPQGRITDHRINLTLYKIDAMMDGDIDDL
FT                   CNALASEHQAELLAALGDS"
FT   gene            complement(130607..131923)
FT                   /locus_tag="Pnuc_0137"
FT   CDS_pept        complement(130607..131923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0137"
FT                   /product="glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.70"
FT                   /note="PFAM: glutamyl-tRNA reductase; Shikimate/quinate
FT                   5-dehydrogenase; KEGG: rso:RSc2900 probable glutamyl-tRNA
FT                   reductase oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33358"
FT                   /db_xref="GOA:A4SV44"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SV44"
FT                   /protein_id="ABP33358.1"
FT                   /translation="MKLLTLGINHHTAPVAIREKVAFDPEFLQEALHDLRQHLLGANQS
FT                   GLPEATILSTCNRTEVYCAANDANAANILHEATFDWLAKTQQLAPSSLQPHIYSLPQSD
FT                   AVRHAFRVACGLDSMVIGETQILGQMKDAVRTANDAGVLGTYLNQLFQKTFAVAKEVRG
FT                   STEIGTHSISMAAASVRLSERIFEKISEQKILFIGAGDMITLCATHFVARKPKNVAIAN
FT                   RTIERGQELADSISAQDVQAESLKLSELPGRLHEFDIIVSSTASSLPIIGLGMVESALK
FT                   QRRHKPMVMIDLAVPRDFEPEIARLDDVYLYTVDDLGVMIQTGTNLRQAAVSQAEAIIE
FT                   DRVGNFMHWMQGRNAVPVIQDIQQQGERLRQLELERAMKRLMRGDDPQEVLNAMAQGLT
FT                   NKFLHGSLHALQHSNGAERDALIKLLPKLFASHSKPEDH"
FT   gene            complement(132189..132983)
FT                   /locus_tag="Pnuc_0138"
FT   CDS_pept        complement(132189..132983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0138"
FT                   /product="Uracil-DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="PFAM: Uracil-DNA glycosylase superfamily; KEGG:
FT                   reu:Reut_A3028 uracil-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33359"
FT                   /db_xref="GOA:A4SV45"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV45"
FT                   /protein_id="ABP33359.1"
FT                   /translation="MPSFSKSDIPEDWRALLGDYFDSPAWKQLELNLQSILDSAPASIY
FT                   PQPEHFFKALKLTPVDSVKVVILGQDPYHSPGLAQGLAFSIPADIPLNSRAFPSSLRNI
FT                   SKALALEGFGGLPNGDLHSWAQQGVLLLNTALSVKPGEAGSHANLGWKSLIDCLITQLA
FT                   LQKPSLVWMLWGGHAQSKLPLIESGIDQLILQSSHPSGLGVYKTDKPFLEPGAHASCKH
FT                   FTKANEWLTGHHQAPIQWISLNSAVNGIQVDLFSQSGKNTAH"
FT   gene            complement(132983..134767)
FT                   /locus_tag="Pnuc_0139"
FT   CDS_pept        complement(132983..134767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0139"
FT                   /product="peptidase M61 domain protein"
FT                   /note="PFAM: PDZ/DHR/GLGF domain protein; peptidase M61
FT                   domain protein; KEGG: azo:azo2068 conserved hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33360"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR007963"
FT                   /db_xref="InterPro:IPR024191"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR040756"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV46"
FT                   /protein_id="ABP33360.1"
FT                   /translation="MADLPAIQYTVWPADPHGHRFQVKLHIANPNPDGQVIKMPAWIPG
FT                   SYLIRDFSKQIEAIDAYIAGSTKQKIALERIDNDRWRLPRNAGAVDILTTVYAFDSSVR
FT                   AAYLDTERAFFNATSLCLAVEGQEDLPCSLAITPAEGAFADHWTVQTSLRAAKTDKNGF
FT                   GFYLAKNFDDLIDHPVAIGEFQTVQWMSGSVPHSIAIQGCIHPIDSARLAQDLQAICNS
FT                   TINLFEPKSKQPPFTHYLFLVNTVLNGYGGLEHRNSTALLCRRDQIPQANVPLEEDAYR
FT                   EFLGLCSHEYFHAWLVKRIKPQAFQPYHLSQRNHTRLLWFFEGFTSYYDDLQLFRSKRI
FT                   DLVTYLKLVTNNWNGVLRGPGRHKQSLADSSFDAWTKYYQADENTPNAVVSYYGKGALV
FT                   ALGLDLQIRAFSSNKKSLDDLMRLIWQRHGITLAGIGEDGLDQLILQLLGNGFTKTWNE
FT                   IKARYIFGVEDIPLQKWIASTLVRVKPKHQSSLEKLKLQLGIRHTDVNGWIKITHILDG
FT                   GAAQAAGLAPGDLLASMNGQRITPTRWDSVLNSLAKEQSFAILFYRDDLEHERIVMLES
FT                   SQLPLQYELSPSSDSKSN"
FT   gene            complement(134779..135492)
FT                   /locus_tag="Pnuc_0140"
FT   CDS_pept        complement(134779..135492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0140"
FT                   /product="putative thiol:disulfide interchange protein"
FT                   /note="KEGG: reu:Reut_A3035 probable thiol:disulfide
FT                   interchange protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33361"
FT                   /db_xref="GOA:A4SV47"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR018950"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV47"
FT                   /protein_id="ABP33361.1"
FT                   /translation="MIKFLSAVLICVGLICSTSVQAQAEQQIKVDIQKKLGTTVKVKSV
FT                   HPAPISGLYEVLVGNDIFYTDASGKYLFQGEIIELATGKNITEQRQNDLNRIKWSDLNQ
FT                   SNAFKTVRGNGSRQLAIFSDPNCGYCKRLEKSLQQLDNITIYTYLIPILSPDSAQKAKQ
FT                   IWCSADPSKTYIDWMVNGVTPNGKSDCTTPLDKNLAFAKTYGITGTPTLFFIDGSRFPG
FT                   AVQITDIEKKFGSLK"
FT   sig_peptide     complement(135424..135492)
FT                   /locus_tag="Pnuc_0140"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.615 at
FT                   residue 23"
FT   gene            complement(135485..136759)
FT                   /locus_tag="Pnuc_0141"
FT   CDS_pept        complement(135485..136759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0141"
FT                   /product="Ubiquinone biosynthesis hydroxylase,
FT                   UbiH/UbiF/VisC/COQ6 family"
FT                   /note="TIGRFAM: Ubiquinone biosynthesis hydroxylase,
FT                   UbiH/UbiF/VisC/COQ6 family; PFAM: monooxygenase,
FT                   FAD-binding; KEGG: reu:Reut_A3036 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33362"
FT                   /db_xref="GOA:A4SV48"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV48"
FT                   /protein_id="ABP33362.1"
FT                   /translation="MSDANQKHSSKTPANSPQIRTADVVVVGGGIAGKACALGLAQLGL
FT                   QTVEIAPDLHQAVPTPQSSQWGQRIYAFSPSTQKLLAHLQIWDALDHSRLQAVRDMRIY
FT                   GDRGEKSDHLHLSAFEAGTPQLAWIGESNLIEHTLDQAARFQSKLERMNDAVEKIEVDT
FT                   DGATLHLKSGGTIRTQLVIAADGASSPIRNHLGINTTEESYLQSAVVANWFCTYPHLET
FT                   AFQWFLPGGDIVAMLPLPNKQVSMVWSTSPENAAELLKLDASGWQSRFESIANGAILKQ
FT                   LGELTLNSSPAAFPLRKIRAARFIGPDSSPKVALIGDAAHVMHPLAGQGLNLGLRDVAV
FT                   LLNILGKRESFRAVNDLTLLRRYERQRQGDTSALLWVTDKLKKLFSGSSSTEKRLRNWG
FT                   LGLVNKSHFIKQRLIERALGDIHFD"
FT   gene            136800..137894
FT                   /locus_tag="Pnuc_0142"
FT   CDS_pept        136800..137894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0142"
FT                   /product="GTP-binding protein YchF"
FT                   /note="TIGRFAM: GTP-binding protein YchF; PFAM: GTP-binding
FT                   protein, HSR1-related; Protein of unknown function DUF933;
FT                   KEGG: bpm:BURPS1710b_3587 GTP-binding protein YchF"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33363"
FT                   /db_xref="GOA:A4SV49"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV49"
FT                   /protein_id="ABP33363.1"
FT                   /translation="MSLKCGIVGLPNVGKSTLFNALTKAGIAAENYPFCTIEPNVGVVE
FT                   VPDPRLAALAEIVKPERVLPAAVEFVDIAGLVAGASKGEGLGNQFLANIRETDAITHVV
FT                   RCFEDPNVIHVAGKIDPIADIGVIDTELALSDLATVEKTLNRSSKAAKSGNDKEAAALV
FT                   AVLTKVQAHLDSALPVRSMNLTDDEKLLIKPLCLITAKPAMYVANVKEDGFENNPHLEA
FT                   VKQHAAKENAPVVAVCAAIEAEIADLDDVDKTEFLADLGMAEPGLDRVIRAGYALLGLH
FT                   TYFTAGVKEVRAWTIHQGDTAPQAAGVIHTDFERGFIRAQTIAYDDFIQFKGESGAKEA
FT                   GKMRAEGKEYVVKDGDVLNFLFNV"
FT   gene            complement(137967..138317)
FT                   /locus_tag="Pnuc_0143"
FT   CDS_pept        complement(137967..138317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_5343 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33364"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV50"
FT                   /protein_id="ABP33364.1"
FT                   /translation="MQTLKPSAYLRFLNLIDALDRINPGKKLDSIEESLLDKVVSAAQA
FT                   KQSILVGDLISLSELGSQATLHGRLKNLSAMGYIKMAGNSDGRKKEILPTKQALKRYEE
FT                   ISRCLEKAVNRT"
FT   gene            138429..138998
FT                   /locus_tag="Pnuc_0144"
FT   CDS_pept        138429..138998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0144"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_5344 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33365"
FT                   /db_xref="GOA:A4SV51"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV51"
FT                   /protein_id="ABP33365.1"
FT                   /translation="MPKISFLPSEWFVGIVVSALSYATLFYINSWLTGSLIYSLGVNWI
FT                   YLPAGLRLFITLIFGLPGAIGIALATFTISYFGALPQDLTLCIGTGLISGFAPYLARVL
FT                   ILSNTQLAPDLSNLNLPKLVICILLYALLSAGLHQFWYATMALDGAGTPNHFLVMFIGD
FT                   VFGSLLLISVIKYGLDLLRHFKQRAR"
FT   gene            complement(138979..139782)
FT                   /locus_tag="Pnuc_0145"
FT   CDS_pept        complement(138979..139782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0145"
FT                   /product="indole-3-glycerol phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /note="PFAM: Indole-3-glycerol phosphate synthase; KEGG:
FT                   mfa:Mfla_2465 indole-3-glycerol-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33366"
FT                   /db_xref="GOA:A4SV52"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SV52"
FT                   /protein_id="ABP33366.1"
FT                   /translation="MSDILDKIVATKKIEVAHNSSKISLGNHREQAEANNQSNLLKPRG
FT                   FIQAIERKISAGKAGVITEVKKASPSKGILRENFISAEIAQSYEKHGAACLSVLTDSDY
FT                   FQGCNAYLQEARAACQIPVLRKDFTIDPYQIYEARAIGADAILLIVACLELNQMMELEA
FT                   CAHELGLDVLVEVHNAPELEQALELKTPLLGINNRNLKTFEVSLQTTLSLLSSVPKNKT
FT                   LVTESGILSRADVELMRKNQINAFLVGEAFMRAPDPGTALSELFA"
FT   gene            complement(139792..140817)
FT                   /locus_tag="Pnuc_0146"
FT   CDS_pept        complement(139792..140817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0146"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.18"
FT                   /note="TIGRFAM: anthranilate phosphoribosyltransferase;
FT                   PFAM: glycosyl transferase, family 3; KEGG: rme:Rmet_3180
FT                   anthranilate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33367"
FT                   /db_xref="GOA:A4SV53"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SV53"
FT                   /protein_id="ABP33367.1"
FT                   /translation="MSITPQEALQRCIEHRELFHDEMTDMMRLIMSGEMAPELVAGLLV
FT                   ALRTKKETVGEIAAAAQVMREFATSVHIDDRSHLVDVVGTGGDGAHTFNISTAAMFVAA
FT                   AAGAKIAKHGNRSVSSKSGSADVLEALGANLALSAEQVAKCISTVGAGFMFAPNHHPAM
FT                   KNVVPIRKQLGVRTIFNILGPLTNPADAKRILMGVFHADLVGIQARVLQALGMEHALVV
FT                   YGRDGLDEISLEGPTLVGELKDGVVREYEIHPKDFGLHTAPTNSFKVANAEESKRIVLD
FT                   VIDNKPSAASDIVCLNAGATLYVAGIAPDIASGIAKAKAAIASGAARQKLDAFVAASQS
FT                   N"
FT   gene            complement(140826..141392)
FT                   /locus_tag="Pnuc_0147"
FT   CDS_pept        complement(140826..141392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0147"
FT                   /product="anthranilate synthase, component II"
FT                   /EC_number="4.1.3.27"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   rso:RSc2882 probable panthranilate synthase component II
FT                   (glutamine amido-transferase) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33368"
FT                   /db_xref="GOA:A4SV54"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV54"
FT                   /protein_id="ABP33368.1"
FT                   /translation="MLLMIDNYDSFTYNLVQYFAELGEEVKVFRNDEIAVEDIAKLNPA
FT                   RICISPGPCSPAEAGISVETIKRYAGQIPILGVCLGHQAIGEAFGGKVIRAQKVMHGKT
FT                   DSIHHTGVGVFKNLPDPFKVTRYHSLAIEKSSLPAMLEVTATSSDGEIMGVRHRELAVE
FT                   GVQFHPESILSEHGHALLKNFLQNK"
FT   gene            complement(141376..142881)
FT                   /locus_tag="Pnuc_0148"
FT   CDS_pept        complement(141376..142881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0148"
FT                   /product="anthranilate synthase, component I"
FT                   /EC_number="4.1.3.27"
FT                   /note="KEGG: rso:RSc2881 probable anthranilate synthase
FT                   component I protein; TIGRFAM: anthranilate synthase
FT                   component I; PFAM: Anthranilate synthase component I and
FT                   chorismate binding protein; Anthranilate synthase component
FT                   I domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33369"
FT                   /db_xref="GOA:A4SV55"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV55"
FT                   /protein_id="ABP33369.1"
FT                   /translation="MHREEFNALAKQGFNRIPLVKEVLADLETPLSLYVKLSQAFGKKN
FT                   TYLLESVLGGERFGRFSFIGLPAKTIIRTVGTPSAPANEVFTDGKVVETNTDNPLDFVD
FT                   AFFKRFKVAVQPGLPRFCGGLAGYFGYDTVRYIEGRLATHQLPDELGVPDIQLMLTEEL
FT                   AVIDNVAGRIYLIVYADPSIADSFENAQARLKELLACLSKPVGMPASLPSAKTELIRKF
FT                   KAADFESAVLKTKEYILAGDCMQVVIGQRISKPFTDSPLALYRALRSLNPSPYMYFYDF
FT                   GDMQIVGSSPEILVRQEKRAAEKIVTIRPLAGTRPRGTNPEEDERLAKELLADPKEIAE
FT                   HVMLIDLARNDVGRIAKTGSVKVTDSMSIEKYSHVQHIVSSVEGELLDNMSNMDVLRAT
FT                   FPAGTLSGAPKIRAMEIIDEMEIVKRGVYGGAVGYLSFSGDMDVAIAIRTGVIRDGMLH
FT                   SQAGAGVVADSDPTSEWKETEAKARAVLTAAELVQGGLDAPHD"
FT   gene            complement(142881..143606)
FT                   /locus_tag="Pnuc_0149"
FT   CDS_pept        complement(142881..143606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0149"
FT                   /product="ribulose-5-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="PFAM: ribulose-phosphate 3-epimerase; KEGG:
FT                   bpm:BURPS1710b_3573 ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33370"
FT                   /db_xref="GOA:A4SV56"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV56"
FT                   /protein_id="ABP33370.1"
FT                   /translation="MESQKIPSNRQFLIAPSILSADFACLGKEVQDVLAAGADWIHFDV
FT                   MDNHYVPNLTIGPLVCEAIRPYAMKNGGAAVIDVHLMVEPVDRIVPDFAKAGANLISFH
FT                   PEASPHVNRTLNLIRDQGCQAGLVLNPATPLDHLDHTLELLDLVLLMSVNPGFGGQSFI
FT                   PSTLHKIAQVRARLDRHEAETGRQIRLEVDGGIKVDNIAQVAQAGADTFVAGSAIFGKE
FT                   NYAQVIDAMRAELGKLGRA"
FT   gene            143656..144030
FT                   /locus_tag="Pnuc_0150"
FT   CDS_pept        143656..144030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0150"
FT                   /product="ApaG domain protein"
FT                   /note="PFAM: ApaG domain protein; KEGG: bxe:Bxe_A0464
FT                   protein ApaG, Mg2 efflux/Co2 resistance-related protein,
FT                   CorD-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33371"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV57"
FT                   /protein_id="ABP33371.1"
FT                   /translation="MNPHEISITVKAQYLPDQSDPDNRQFAFAYTITICNTGAASIQLI
FT                   ARHWFITDGDNDVQEVRGLGVVGQQPLLRSGEHFEYTSWATLPTPAGTMRGEYFCVTEE
FT                   AQFFQAPIPEFALVMPRTLH"
FT   gene            144169..145296
FT                   /locus_tag="Pnuc_0151"
FT   CDS_pept        144169..145296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0151"
FT                   /product="MltA domain protein"
FT                   /note="PFAM: MltA domain protein; 3D domain protein; KEGG:
FT                   rme:Rmet_3173 MltA"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33372"
FT                   /db_xref="GOA:A4SV58"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV58"
FT                   /protein_id="ABP33372.1"
FT                   /translation="MISKVKLIQTSVFAILIAGLLAACSTPPTRGPGYRSGAGGSPSSY
FT                   SSSIASFSAVSWQALPGWQEDDLTQAWPAWLKSCQALQKRTTQINWRSVCSQTAGISSQ
FT                   NNQAIRRYFESNFQAYEIRNSAGSDTGMITGYYEPVMNGSLTRTSIYNIPLYSYPKAWR
FT                   QSKPNPAPTRAELISSGVLQGSEIAWVQDPVAAAFMQIQGSGKIRLDDGRILRLGFAGT
FT                   NDQPFKSFAQWLLDRKEITRGEASMQGISQWAKRNPNQVNEMLNANPRFVFFKELPGNV
FT                   DASLGPDGALGVPLTSERSIAIDLQAMPLGAPVFLSTTKAASNQPLQKLVMAQDTGKAI
FT                   VGGVRADYYWGSGEAAGEMAGRMKQNGNMWLLLPR"
FT   sig_peptide     144169..144240
FT                   /locus_tag="Pnuc_0151"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.527 at
FT                   residue 24"
FT   gene            complement(145299..146489)
FT                   /locus_tag="Pnuc_0152"
FT   CDS_pept        complement(145299..146489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0152"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.32"
FT                   /note="KEGG: rso:RSc2871 putative hippurate hydrolase
FT                   protein; TIGRFAM: amidohydrolase; PFAM: peptidase M20;
FT                   peptidase dimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33373"
FT                   /db_xref="GOA:A4SV59"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV59"
FT                   /protein_id="ABP33373.1"
FT                   /translation="MHLIPEITESAKEIQDIRRNIHAHPELRFEENRTADLVAQALSSW
FT                   GISVYRGMGKTGVVGRLDGDLGPGKMIGLRADMDALPLQEHNNFEHTSRNPGKMHACGH
FT                   DGHTAMLLGAAQYLSNHREFKGTVVFIFQPAEEGGAGAKEMINDGLFEQFPCDAVFGLH
FT                   NWPGLAEGHFGVTPGPMMASSNTFEIIIKGRGGHAALPHNSADPVFAGAQVVLALQSII
FT                   TRNKRPIDAAVLSVTQFHAGETSNVIPDSAFIGGTVRTFTLEVLDLIEQRLRELAHNIA
FT                   SAFDCQTEITFSRNYPPLINHANEVAFASEVMSEIAGKSNVSTSIDPTMGAEDFAFMLL
FT                   EKPGCYVFLGNGDGDHRSVGHGMGPCHLHNPSYDFNDALIPVGVSYWVKLAQRYLA"
FT   gene            complement(146548..147264)
FT                   /locus_tag="Pnuc_0153"
FT   CDS_pept        complement(146548..147264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0153"
FT                   /product="dethiobiotin synthase"
FT                   /EC_number="6.3.3.3"
FT                   /note="TIGRFAM: dethiobiotin synthase; KEGG: eba:ebA6011
FT                   cobyrinic acid a,c-diamide synthase:dethiobiotin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33374"
FT                   /db_xref="GOA:A4SV60"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV60"
FT                   /protein_id="ABP33374.1"
FT                   /translation="MNTSSSFFVTGTDTEIGKTLVSGALILKLREQNKHVVGFKPVVAG
FT                   TYLEANGKLLNEDLETLRIASHLSPEELNLCPYVLDTPAAPHIAAAQLGLQLNLATIIK
FT                   AYELIRAQAESVVVEGAGGFLIPLNTTEDLSDFAAQINLPVILVVGMRLGCINHALLTV
FT                   EAIESRKLKIAGWIANSLSSKMDLLEDNIQALQTRIHAPFLGLIPTLPSEIEKPNNAPY
FT                   TLAALQFAAEHIQLPS"
FT   gene            complement(147261..148496)
FT                   /locus_tag="Pnuc_0154"
FT   CDS_pept        complement(147261..148496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0154"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /EC_number="2.3.1.47"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   reh:H16_A0181 8-amino-7-oxononanoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33375"
FT                   /db_xref="GOA:A4SV61"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV61"
FT                   /protein_id="ABP33375.1"
FT                   /translation="MTGSFNALKLVEDQITDLELQLLKRQLRVTESACDTTALVGNRLL
FT                   NTFCSNDYLGLANHPKIIDGLMEGAKKYGVGSGASHLISGHNVAHDHLEKKLASFQASH
FT                   IPKARALFFSTGYLANLAAITGLVRLAPSGGASIYSAKLNHASLIDGVRLASVQNNAAV
FT                   TLFDHTQPASLLSSIKNDVRPLKLIVVDGVFSMDGDLAPVKELLRIAEQSDALLLIDDA
FT                   HGFGVLGKNGHGILEQENISSDRIIYIGTLGKAAGVSGAFVCAKDQFIEWLIQKGRPYI
FT                   YSTATPPAIAHALLKSLEIIEGDEGKERRAQLYRLIQIWQDEMSFTQWTKVSSCTPIQP
FT                   VVLGSNANALMAAKLLDEASYWIPAIRPPTVPPGSARLRVTFSASHREEDLYQLIKTLK
FT                   TIEQQVMDKASS"
FT   gene            complement(148493..149908)
FT                   /locus_tag="Pnuc_0155"
FT   CDS_pept        complement(148493..149908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0155"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="TIGRFAM: adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase; PFAM: aminotransferase class-III; KEGG:
FT                   eba:ebA6019 adenosylmethionine-8-amino-7-oxononanoate
FT                   transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33376"
FT                   /db_xref="GOA:A4SV62"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV62"
FT                   /protein_id="ABP33376.1"
FT                   /translation="MNSRHKHNRYSPKLGKTSGQISNMKVISDLDQATLVKRSLSAVWH
FT                   PCTQMKHHESLPLIAITKGKGAWLYDEQENALLDCISSWWTNLFGHSNQRINQAITNQL
FT                   EKIEHVMLAGFTHQPVVELSEKLSALTQKYLGHVFYASDGASAVEIALKMSHHYWQLQG
FT                   KPQKKKFVCLENGYHGETLGALAVTDVAIFREAYGSLLQEVYTASSPDARKAMTGESAK
FT                   DVAIKAAHELEKLFQKEHEHIAAIIVEPLVQCAGQMAMYSPEYLRLVKTLCECYDIHLI
FT                   ADEIAVGCGRTGKFFACEHAGIWPDFLTLSKGISGGYLPLSLCMTTEKIYRAFYSDQTQ
FT                   QGFLHSHSYTGNPLACAAALACLEIFESEKVLEKNVERSIDLADAFAWAKVDPRIEHWR
FT                   QQGMILAFDIKSEVLKNQKAFPREMFSSCLNAGVLIRPIANTVYVMPPYILSTEEAMAM
FT                   GSAVQRALNQALA"
FT   gene            149930..150967
FT                   /locus_tag="Pnuc_0156"
FT   CDS_pept        149930..150967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0156"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="KEGG: rfr:Rfer_2292 biotin synthase; TIGRFAM: biotin
FT                   synthase; PFAM: Radical SAM domain protein; biotin and
FT                   thiamin synthesis associated; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33377"
FT                   /db_xref="GOA:A4SV63"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SV63"
FT                   /protein_id="ABP33377.1"
FT                   /translation="MLDAQTVEKPLTHIKSKADLRKEVDASGEWTVSQIEALFALPFNE
FT                   LMFKAQQAHEANFPEGDVELATLLSIKTGGCPEDCSYCPQAARYDTDVKAEKLMGLEEV
FT                   LEAAKAAKAAGSNRFCMGAAWREPKDRDIEKVTAMIKGVKALGLETCATLGMLEANQAK
FT                   ALQEAGLDFYNHNLDTSEDFYRSVISTRGYQDRLDTISNVRAAGMSVCCGGIVGMGESR
FT                   EQRAAFLARLANLSPYPESVPINHLVPVAGTPLAEQKPLDPLEFVRTIAVARITMPKAR
FT                   VRLSAGRQELGRAIQAMCFMAGANSIFYGEQLLTTGNPEAEQDLALLAELGLKTKQSCK
FT                   AEVLV"
FT   gene            150979..151608
FT                   /locus_tag="Pnuc_0157"
FT   CDS_pept        150979..151608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0157"
FT                   /product="putative ubiquinone biosynthesis protein"
FT                   /note="KEGG: rso:RSc2854 putative ubiquinone biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33378"
FT                   /db_xref="GOA:A4SV64"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011566"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SV64"
FT                   /protein_id="ABP33378.1"
FT                   /translation="MSLIDRFIAEFDTALRSVVGGAHSRRPTPGSGEISHANLDVAQRK
FT                   HAAGLMRVNHVGEVCAQALYQSQKMLARNPQIQVMLEHSGQEEMDHLAWCETRLQELGS
FT                   HPSYLNPFWYAGSFAIGMLAGLAGDRWSLGFVAETEKQVENHLESHLETLPQEDLRSRA
FT                   IVDQMRIDEIEHGQAALHAGGVVLPDPVQKVMQAMSKVMTTAAYRI"
FT   gene            151901..152332
FT                   /locus_tag="Pnuc_0158"
FT   CDS_pept        151901..152332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0158"
FT                   /product="MraZ protein"
FT                   /note="TIGRFAM: MraZ protein; PFAM: protein of unknown
FT                   function UPF0040; KEGG: rme:Rmet_3137 protein of unknown
FT                   function UPF0040"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33379"
FT                   /db_xref="GOA:A4SV65"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV65"
FT                   /protein_id="ABP33379.1"
FT                   /translation="MVFQGASALNLDAKGRMSIPAKHRDALLVQGEGRITLTKHPDGCL
FT                   LLFPRPEWETFRSRVAQLPMDAHWWRRIFLGNAAEVDLDGAGRVLVSPELRAAAGIEKE
FT                   VMLLGMGSHLELWDAATYAAKEQAAIAQGMPEALKQFNF"
FT   gene            152345..153295
FT                   /locus_tag="Pnuc_0159"
FT   CDS_pept        152345..153295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0159"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /note="TIGRFAM: S-adenosyl-methyltransferase MraW; PFAM:
FT                   methyltransferase; KEGG: rme:Rmet_3136 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33380"
FT                   /db_xref="GOA:A4SV66"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SV66"
FT                   /protein_id="ABP33380.1"
FT                   /translation="MNITHRPVLLAEAVTALISGPLIQEKNAAKKIVVIDGTFGRGGHT
FT                   QALLKSLEMSARVISFDKDLDAISVAQQIQDPRFTIVHDSFAHMDQYAQAESVDGILLD
FT                   LGISSPQVDEAHRGFSFRREGPLDMRMNTDQGLTAAEWLEQAPQEEITRVIKTYGEERF
FT                   AFQIAKAIVAKREEGLSPKTTTELASLVASVVRTREAGQDPATRTFQALRIFINRELED
FT                   LELGLKAALKLLKPGARLAVISFHSLEDRIVKQFFQAHAKVEIPRGLPVREKDLPQSAL
FT                   EIIGRVKPSDLEISENPRARSAIMRVAEKRMGAPV"
FT   gene            153292..153558
FT                   /locus_tag="Pnuc_0160"
FT   CDS_pept        153292..153558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0160"
FT                   /product="cell division protein FtsL"
FT                   /note="PFAM: cell division protein FtsL; KEGG:
FT                   reh:H16_A3280 cell division protein FtsL"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33381"
FT                   /db_xref="GOA:A4SV67"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV67"
FT                   /protein_id="ABP33381.1"
FT                   /translation="MNRATLTLLALLLVCALSLVAAQQRARKLFIAQERAQIEERKLNQ
FT                   EWLRLEYEQRNLSKSARIRDVARNQLHMFPISPERTLYLKEAK"
FT   sig_peptide     153292..153357
FT                   /locus_tag="Pnuc_0160"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.868 at
FT                   residue 22"
FT   gene            153555..155327
FT                   /locus_tag="Pnuc_0161"
FT   CDS_pept        153555..155327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0161"
FT                   /product="peptidoglycan synthetase FtsI"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein, transpeptidase;
FT                   Penicillin-binding protein, dimerisation domain; KEGG:
FT                   reu:Reut_A2985 peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33382"
FT                   /db_xref="GOA:A4SV68"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV68"
FT                   /protein_id="ABP33382.1"
FT                   /translation="MRPVGFSTTPNLVLRLPMWRSRLMLFLLFFVFMLLLIRAFWIQGP
FT                   GNAFYEAKGVRGTQRELELPASRGKILDRNGQVIATSLEAKSVIAYNDTVPDDLAADKV
FT                   QKLASLLQISEAELRKKLKEERKQVFLKRQVDPDVAQQIKQLEIPGIGLNNEYRRFYPE
FT                   GEAMAHVVGFTNVNDKGQEGMELSREQDLAAHPGQRRVVVDRLGRVVEDVAIEQLPQNG
FT                   KDLQLSIDSKIQFLAYNAVKNAVEEHHAKAGGAVVLDTQTGEILALANYPSYNPNDRRF
FT                   LSGEQLRNRVMTDTFEPGSTIKPLTISIALEKGAVTPNTNMVIGAKYLVGPKPITDTHP
FT                   YGNLTVAQIIQKSSNIGTAKIAMNNLSPEEMWNLYTAVGLGQAPKIGFPGAVAGTVHPF
FT                   KKWMPTDQARIAFGYGISASLFQVARAYTVFARDGELVPLTIERSPEFKPGTRVLSAKT
FT                   AIEMREMMEAVTEPGGTAVKAQAEGYRVGGKTGTAHKLVGKGYGNSYRAYFAGLAPISS
FT                   PRIVVAVMIDEPTGGSHYGGDVAAPVFSTIVGETLRTLNVLPDSKVKQMVLDDKPAESA
FT                   HTANVQAQHVVLKR"
FT   gene            155324..156874
FT                   /locus_tag="Pnuc_0162"
FT   CDS_pept        155324..156874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0162"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /EC_number="6.3.2.13"
FT                   /note="TIGRFAM: UDP-N-acetylmuramyl-tripeptide synthetase;
FT                   PFAM: cytoplasmic peptidoglycan synthetase domain protein;
FT                   cytoplasmic peptidoglycan synthetases domain protein; Mur
FT                   ligase, middle domain protein; KEGG: reu:Reut_A2984
FT                   UDP-N-acetylmuramyl-tripeptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33383"
FT                   /db_xref="GOA:A4SV69"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV69"
FT                   /protein_id="ABP33383.1"
FT                   /translation="MRVALNIEPNDLIDHLHTLANSSAKVGADSRQIQSGDIFFAYPVG
FT                   HGAALRDGRQFIEAALANGAAAVVFDPAGIDPQFQDHPQCFAVESLAEKVGEFCAQWYD
FT                   YPSKQLKVIGVTGTNGKTSITQWLAQALDEPNHRTAVLGTLGTGFPTALVMTGYTTPDA
FT                   PKLQTQLRELLDGGAQQVAMEVSSHALHQERIAGTWFNCAVFTNLTQDHLDYHGSMGDY
FT                   AEAKAKLFQQAGLEHAVINLDDPFGRELAINLLAKDSIQVWAYGLAPTAFKGFEKFASR
FT                   LQRIYTQDTVLSGATYQTTFVYGDKGTYPLHIPLLGEFNLSNALAVWTVLLTQGLSPEE
FT                   ATKRVSHLSPVSGRMELIPLGKNQKSEGLLAVVDYAHTPDALQKTLQALRPLAEQRGGK
FT                   LWCVFGCGGDRDITKRPQMGLVAEKFADHIIITSDNSRSEDPQAIIQMIADGLNPSTTN
FT                   VQMIADRAAAIMAAVRHADARDIVLVAGKGHETSQEINGKTFDFSDQEHIRLAAGGLV"
FT   gene            156874..158319
FT                   /locus_tag="Pnuc_0163"
FT   CDS_pept        156874..158319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0163"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl-D-alanyl ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl-D-alanyl ligase; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein;
FT                   cytoplasmic peptidoglycan synthetases domain protein; Mur
FT                   ligase, middle domain protein; KEGG: bps:BPSL3029
FT                   UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diamino
FT                   pimelate--D-alanyl-D-alanyl ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33384"
FT                   /db_xref="GOA:A4SV70"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV70"
FT                   /protein_id="ABP33384.1"
FT                   /translation="MSAMTTLAQVHAMLPGSILVNISLEAAQALSITRVGTDSRQIDAG
FT                   ELFVALAGERFDAHDFLSDVASSGAGAALISNKDKCPKNLPAVCIEDTRAALGQLAKAW
FT                   RVTRHIPLALVTGSNGKTTVKEMIASIFKAAVGESHTLVTKGNLNNDIGLPLTLLKLRP
FT                   TDQLAVVELGMNHPGETALLADIAQANIALINNAQREHQEFMATVAAVAQEHADVIRAL
FT                   PQDGIAVFPGDSEFTDLWRKAAADRKVLDFVLSSTQTNASSAVGGKLLNDGRIEVNTEN
FT                   GSIQIQLNTLGNHNVRNALAASAVAIAAGISLKKIQEGLESFQPVNGRMQAKTIDANHT
FT                   LIDDSYNANPDSVRAAIDALKQSGNNAWIVLGDMGEVGDQGPEFHQEVGAYAAEQGISK
FT                   LFALGEQCQFAIQGFESAKGKSALSSATHFSNMDSLIAQLRDALHAQALGTNQHLNILV
FT                   KGSRFMRMERVVQALLEEAKACS"
FT   gene            158310..159479
FT                   /locus_tag="Pnuc_0164"
FT   CDS_pept        158310..159479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0164"
FT                   /product="Phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="KEGG: rso:RSc2847 probable
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase
FT                   transmembrane protein; TIGRFAM:
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase; PFAM:
FT                   glycosyl transferase, family 4"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33385"
FT                   /db_xref="GOA:A4SV71"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SV71"
FT                   /protein_id="ABP33385.1"
FT                   /translation="MLLILAQWLQDDFGFFRVFNYITFRAVMATVTALLIGLAAGPWVI
FT                   RKLSELKMGQAVRTDGPLTHLVKSGTPTMGGVLILIGIFVSCMLWADLSNRFIWIVMIV
FT                   TFGFGAVGWVDDYRKVVRKDPKGMASREKFFWQTLIGLFAAIYLAFSVSEINNLKVLEL
FT                   FFEWVKSGFALDLPAKTNLLLPFMKEVSYPLGMMGFIILSYLVIVGSSNAVNLTDGLDG
FT                   LVIMPVILVGAALGAFAYVMGNAIYAKYLLFPYIPGAGELMIFCGAMGGAGLAFLWYNT
FT                   HPAQVFMGDVGALALGGALGTIAVIVRQEIVLFVMGGIFVAETVSVMMQVVWFKITKKH
FT                   FGEGRRIFRMAPLHHHFELGGWKETQVVVRFWIITILLVLIGLSSLKLR"
FT   gene            159494..161116
FT                   /locus_tag="Pnuc_0165"
FT   CDS_pept        159494..161116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0165"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanine--D-glutamate
FT                   ligase; PFAM: cytoplasmic peptidoglycan synthetases domain
FT                   protein; Mur ligase, middle domain protein; KEGG:
FT                   reu:Reut_A2981 UDP-N-acetylmuramoylalanine-D-glutamate
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33386"
FT                   /db_xref="GOA:A4SV72"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV72"
FT                   /protein_id="ABP33386.1"
FT                   /translation="MLNLENTFANPLAIANADYQAPNRFLIMGLGESGIAMARWCLRNG
FT                   AAVRLVDTRDRSSLSERQLALLAELEFAGLKDIHFGPLGDDLLVDIDVIGISPGLSPLQ
FT                   EPTQSFLVNARKSRIDIWSEIEFFARAIAALSRMAQTNESSYAAKVLAVTGTNGKTTTT
FT                   ALTGQLCERAGKRVAVAGNISPAALDKLMSCLEAADQLEDMPDVWVLELSSFQLVYTSS
FT                   LNPTAAAVLNITQDHLDWHGEMSAYVEAKSKIFGSDTICVLNRDDSLVMGLFSEEQKAE
FT                   KFTVTFGSNRPDEQGAFGIEHDLRAGGIDWLVWAEVDEDLEPKPKRRRKSAVIEEDEPL
FT                   RLKRLIPADALRIRGRHNALNALAALALARAANLPMNVLLHGLRDYHGEPHRVQSIAIV
FT                   NDVEYVDDSKGTNVGATVAAINGLGSNESGKRIWLIAGGEGKGQDFSPLREPALRFVKG
FT                   VFVIGKDGDKIVEAMGSDIPCTNSKTLQMAVQAAAAQAVSGDLVLLSPACASLDQFRDY
FT                   VERAQVFISEVEELGMRFEGVQA"
FT   gene            161113..162384
FT                   /locus_tag="Pnuc_0166"
FT   CDS_pept        161113..162384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0166"
FT                   /product="cell division-specific peptidoglycan biosynthesis
FT                   regulator FtsW"
FT                   /note="TIGRFAM: cell division protein FtsW; PFAM: cell
FT                   cycle protein; KEGG: reu:Reut_A2980 cell cycle protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33387"
FT                   /db_xref="GOA:A4SV73"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV73"
FT                   /protein_id="ABP33387.1"
FT                   /translation="MSLKEKLFPENRLGLGRFWNFSRGGIDNFRTGLRDAVSGVEQTRS
FT                   RMMEYDQLLVWAVLSLMLIGLVMVYSASITLADGPKYANYSSNFFLIRHIISLVIAIAV
FT                   GIWAFKIPTKVWDRYSPVVFGFTVLLLIAVLIPGVGKGVNGAKRWIPLGVMNFQPSELM
FT                   KFAAVIFAASYTVQRQEYLHSFSKGMLPMGIAVALVGGLLMKEPDMGAFVVVALIAFGI
FT                   LFLGGINAKLFGGLIVVGLLSGAAMIALSPFRRGRMLAFMDPWQVDNAANKGYQLTHSL
FT                   MAFGRGEWFGTGLGGSVEKLHYLPEAHTDFIMAVIGEELGFIGVVVMIFLFYWIVRRAF
FT                   MIGRTALQLDRSFAGLAAKGVAIWIGWQAFINMGVNLGLLPTKGLTLPLVSYGGSGILM
FT                   NAVAIAMLLRIDYENRILMRGGKL"
FT   gene            162381..163454
FT                   /locus_tag="Pnuc_0167"
FT   CDS_pept        162381..163454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0167"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="KEGG: rme:Rmet_3128
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase; TIGRFAM:
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase; PFAM: glycosyl transferase, family 28;
FT                   Glycosyltransferase 28, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33388"
FT                   /db_xref="GOA:A4SV74"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SV74"
FT                   /protein_id="ABP33388.1"
FT                   /translation="MTKPSILVMAGGTGGHIFPGLAVAEYLRICGWNVSWLGNQSGMEY
FT                   RLVKSCNFPFEAVEFGGLRGKGIKAKLMLPINLARACHQSWKIMRRLKPNVVLGMGGYI
FT                   TFPGGLISKLLKRPLVLHEANSVAGSANRALAKIAMRTLTGFPNTMENAEWVGNPIRQE
FT                   FDDIAAPAERYEQRQGPLSLLVVGGSLGAAALNENIPAALALIPLEQRPTVIHQAGDKH
FT                   LLDLQKRYADLGVLADIRPFIEDMPTAYAQADLVICRSGAMTVSELAACGVASCLIPFP
FT                   HAIDDHQTANAQFLSDADAAVFLPQKNLNPQDLALMIQNLTRTDLKEMAVRAHALSKPH
FT                   ATQRVAEVCADCAGVGI"
FT   sig_peptide     162381..162455
FT                   /locus_tag="Pnuc_0167"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.942) with cleavage site probability 0.686 at
FT                   residue 25"
FT   gene            163451..164887
FT                   /locus_tag="Pnuc_0168"
FT   CDS_pept        163451..164887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0168"
FT                   /product="UDP-N-acetylmuramate--L-alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="TIGRFAM: UDP-N-acetylmuramate--alanine ligase; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein;
FT                   cytoplasmic peptidoglycan synthetases domain protein; Mur
FT                   ligase, middle domain protein; KEGG: reh:H16_A3272
FT                   UDP-N-acetylmuramate-L-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33389"
FT                   /db_xref="GOA:A4SV75"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SV75"
FT                   /protein_id="ABP33389.1"
FT                   /translation="MKHIVQQIHFIGIGGTGMSGIAEVLLNLGYQVSGSDLVEGAATKR
FT                   LKELGAVIHIGHDPKNVGTAEAVVISTAVAGNNPEVLAARAAKIPVIQRAVMLGELMRL
FT                   KQGIAIAGTHGKTTTTSLVASVLAEGDLDPTFVIGGKLNSAGANARLGRGDFIVVEADE
FT                   SDASFLQLFPAMEVVTNIDADHMDTYQHDMARLKQAFVQFIQRMPFYGVAVLCIDDANV
FT                   RDIIPFVSQPILRYGLSEDADIRASNVRADGTRMHFTVERRTVRRHGNKPGPLNVTLNL
FT                   PGLHNVRNALAAIGIATELGVGDQAIIKALSEFSGVGRRFQRYGDIPLASGGKFTLIDD
FT                   YGHHPVEMAATLAAARGAYPDRRLVLAFQPHRFTRTRDCFGEFVQVLKNFDALVLTEVY
FT                   PAGEAKIPGADGKSLMKAALVDDKTSKALLNSAAVAFASSVAEMPEKLGQVLKDGDVLI
FT                   TMGAGSISALPHTLSEAKHV"
FT   gene            164880..165893
FT                   /locus_tag="Pnuc_0169"
FT   CDS_pept        164880..165893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0169"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="KEGG: reh:H16_A3271 D-alanine-D-alanine ligase;
FT                   TIGRFAM: D-alanine--D-alanine ligase; PFAM:
FT                   D-alanine--D-alanine ligase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33390"
FT                   /db_xref="GOA:A4SV76"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SV76"
FT                   /protein_id="ABP33390.1"
FT                   /translation="MSKQEELLIQWGDRVKACLANLDIKSLGRVGVLLGGRSGEREISL
FT                   MSGNGVLQALLSKGVDAHGFDPGLRNPTELATEKFDRIFISLHGRFGEDGTIQGLLELL
FT                   ELPYTGSGVLASALAIDKIATKQIWISNGLSTPEYEELTAKSDWNAVVKHLGLPLIVKP
FT                   AHEGSSLGLTKVKSVEELPAAYQLAAGLDKKVIAETCIVGDELTCPLVGQGNSAEALPV
FT                   IKIIPPQANYDFHNKYFSDETQYLCPTGLTAEINAAVQDLALAAYQTLGCRTWGRADVM
FT                   LDKKTGKPYLLEMNTSPGMTSHSLVPMAAKAAGVEYADLVLWLLSQTLLQKEGART"
FT   gene            165890..166747
FT                   /locus_tag="Pnuc_0170"
FT   CDS_pept        165890..166747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0170"
FT                   /product="Polypeptide-transport-associated domain protein,
FT                   FtsQ-type"
FT                   /note="PFAM: cell division protein FtsQ;
FT                   Polypeptide-transport-associated domain protein, FtsQ-type;
FT                   KEGG: rso:RSc2841 putative cell division transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33391"
FT                   /db_xref="GOA:A4SV77"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV77"
FT                   /protein_id="ABP33391.1"
FT                   /translation="MSNFMDRFGEIFAMLMSPLWNHPDRMQKLSRFLMRCFAVMLTIGI
FT                   LVWLSQRPVFALKQIQIEPVAGQTLKHINKSMVKQQVLETVQGNFFSVRLEDVKRGFES
FT                   MPWVRHANVRRVWPNGLIVSIEEQKPFGTWGGADSHVLINNHGEIFAGRVSEINDDVIL
FT                   VDFRGPEDSGPEVMSLYEKANNWFKPWGAEVVSLALTERYAWHIKLSNGMKVEFGRDEE
FT                   SSDKTLTEERVARLFKYWPQVQEKWANRVDAVDLRYANGFAVHLASASMKKNDVDGKKS
FT                   ELKQ"
FT   gene            166757..167986
FT                   /locus_tag="Pnuc_0171"
FT   CDS_pept        166757..167986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0171"
FT                   /product="cell division protein FtsA"
FT                   /note="PFAM: cell division protein FtsA; KEGG: rso:RSc2840
FT                   probable cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33392"
FT                   /db_xref="GOA:A4SV78"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV78"
FT                   /protein_id="ABP33392.1"
FT                   /translation="MSKDNRDLLVGLDIGTSKVVALVAELAPDGQFNVVGVGQTASKGL
FT                   KKGVVVNIEATVQSIQKALEEAEIMADRQIMQVFTGIAGNHIVSFNSSGMVAIRDKEVS
FT                   AGDVERVLETAKAINIPTDQQILHILVQEFIIDGQEDVREPIGMSGLRLEVKVHIVTGA
FT                   VSAAQNIVKCVRRCGLEVNDLILQPLASSLAVLTDDEKELGVVLVDIGGGTTDIAIYCQ
FT                   GSIRHTAVIPIAGDQVTNDIAMALRTPTIDAEDLKIAHGIARQEMADPTTMIDVPGVGD
FT                   REPRPMSKQALAAVIEPRVEELFTLVRGVVRDSGYEDMVSSGIVLTGGTSLMPGMVELA
FT                   EQVFLRPARIGVPEYRGHLHEVLRSPRFATSIGLLMEGQAQLLRGRRVSQSGALQGVIS
FT                   RMKEWFAGNF"
FT   gene            168035..169375
FT                   /locus_tag="Pnuc_0172"
FT   CDS_pept        168035..169375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0172"
FT                   /product="cell division protein FtsZ"
FT                   /note="TIGRFAM: cell division protein FtsZ; PFAM:
FT                   Tubulin/FtsZ, GTPase; Tubulin/FtsZ domain protein; KEGG:
FT                   reh:H16_A3268 cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33393"
FT                   /db_xref="GOA:A4SV79"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV79"
FT                   /protein_id="ABP33393.1"
FT                   /translation="MEFEMLDQETAGKTIIKVVGVGGAGGNAVQHMIRRGVNGVEFICM
FT                   NTDAGALQRSEASVNLQLGSSGLGAGAKPEIGAASAEEARARIADSLQGAHMVFITAGM
FT                   GGGTGTGAAPVVAQVAKEMGILTVGVISKPFDFEGVKRLKVAENGAAELESYVDSLIVV
FT                   LNEKLFEVMGEDAEFDKAFACADDVLHNAVSGIAEIINVQGLINVDFEDVKTVMGEQGK
FT                   AMMGTATVSGMDRARLAAEAAVASPLLEGVDLSGARGVLVNITASRSLKLSETREVMAA
FT                   IRGYAADDATVIFGTVYDDSLGDALRVTVVATGLNNPQARQSHQPEVVWRQATGTHDAM
FT                   PTMADLNSFAPASASAAMSKVNLDSALGTSAGMALTGSGATPAMAAQPAASGVDYSQYD
FT                   LPRVFRSSREATPAPTLGADSSPQAKTLLDKGADYYEIPAFLRKQAD"
FT   gene            169488..169988
FT                   /locus_tag="Pnuc_0173"
FT   CDS_pept        169488..169988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0173"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   bxe:Bxe_A0492 putative type 2 peroxiredoxin, AhpC/TSA
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33394"
FT                   /db_xref="GOA:A4SV80"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV80"
FT                   /protein_id="ABP33394.1"
FT                   /translation="MISVGQKLPSATLYEFLNEETEGCALGPNAFEVEKLAAGKKIVIF
FT                   ALPGAFTPTCSAKHVPGYVEHYDEIKAKGVDEIWCISVNDPFVMGAWGRDQKVGKKIRM
FT                   LGDGSCEFTKKMGLELDLVARGLGVRSDRYAMIVEDGVIKTLDREAPGKFEVSDAASIL
FT                   KKL"
FT   gene            170020..170934
FT                   /locus_tag="Pnuc_0174"
FT   CDS_pept        170020..170934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0174"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase"
FT                   /EC_number="3.5.1.-"
FT                   /note="PFAM: UDP-3-0-acyl N-acetylglucosamine deacetylase;
FT                   KEGG: reu:Reut_A2972 UDP-3-0-acyl N-acetylglucosamine
FT                   deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33395"
FT                   /db_xref="GOA:A4SV81"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SV81"
FT                   /protein_id="ABP33395.1"
FT                   /translation="MMKQRTIAAPVKTVGIGLHSGRKVTIVIKPAPINSGVQFVRIDTP
FT                   EQSVVPATALAVCDTRLASVIQKDGVRVSTVEHLLSACAGLGLDNLLIELDGEEVPIMD
FT                   GSAASFLFLIESAGIAEQEAPRQFVVIKKAVEVREGDKLARLEPFFGFKLDFTIDFKHP
FT                   AVDKTGQRFIVDFAEHAYRSEIGRARTFGFAHEVEALREMGLARGGSLDNAIVLDEHRI
FT                   LNNEELRYEDEFVRHKILDAIGDLYLIGHPIVGAYIAEKSGHALNNALLRKLLDDPSTY
FT                   EISSFAENKAPAAYSQENQPLFF"
FT   gene            complement(170956..171453)
FT                   /locus_tag="Pnuc_0175"
FT   CDS_pept        complement(170956..171453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33396"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV82"
FT                   /protein_id="ABP33396.1"
FT                   /translation="MNFAAKPSRKQTAHEWVDYLRESDGLGGILAKTEDLARLRSILGL
FT                   ALAKTGLDHLLPKIEAGWRSGGQNELFLLVGSASIASRLQQTLPSIIKELDGLGLQCSA
FT                   IKVRVKPAPPSWEVKSRAQDQKNQKPQGFNEVAKKSWKDLLDKLSPDSELYKTVQKLLQ
FT                   SK"
FT   gene            171507..174272
FT                   /locus_tag="Pnuc_0176"
FT   CDS_pept        171507..174272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0176"
FT                   /product="protein translocase subunit secA"
FT                   /note="TIGRFAM: preprotein translocase, SecA subunit; PFAM:
FT                   SEC-C motif domain protein; SecA DEAD domain protein; SecA
FT                   Wing and Scaffold; SecA preprotein cross-linking region;
FT                   KEGG: rme:Rmet_3118 preprotein translocase, SecA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33397"
FT                   /db_xref="GOA:A4SV83"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SV83"
FT                   /protein_id="ABP33397.1"
FT                   /translation="MVIGLLKTLVGSRNDRLLKQYRKVVAKVGTFEANLQTLDDAALAA
FT                   KTDEFKSRLASGESLDSIAPEAFAVVREASVRVMKMRHFDAQLMGGLALHQGKIAEMGT
FT                   GEGKTLTATLPVYLNALTGKGVHVVTVNDYLAQRDAEWMSTLYNFLGMKVGVNLSQMDH
FT                   TTKKEAYAADITYGTNNEFGFDYLRDNMVQDLEQRVQRGLAYAIVDEVDSILIDEARTP
FT                   LIISGQADDHTDLYIKINALPSHLELQIGEEKSDGTGVEKPGDYWVDEKSQQVYLTERG
FT                   HDKAEEVLVQLGALDDGASLYAPQNITLMHHVYAALRAHTLYHRDQQYVVQNGEVIIVD
FT                   EFTGRLMQGRRWSDGLHQAVEAKEGVAIQNENQTLATITFQNYFRMYGKLAGMTGTADT
FT                   EAYEFKEIYNLETVVIPPNRISQRKDKQDQIYKSSRERYDAVIKDIEDCYQRGQPVLVG
FT                   TTSIENSELIAGLLDKRKLPHQVLNAKQHAREAEIIAQAGRPKMITIATNMAGRGTDIV
FT                   LGGNVGKQSSLIQVDEALSDLEKAAKIKSLQDEWQSIHDQVLTAGGLHIIGTERHESRR
FT                   IDNQLRGRSGRQGDPGSSRFYLSLDDPLLRIFAGDRLRAVMERLKMPDGEPIEAGMVTR
FT                   SIESAQRKVEGRNFDIRKQLLEYDDVANDQRKETYRLRNEVLESADIGELIANLREDVL
FT                   RTICSIYVPLESMEEQWDLAGLEHALASEWGLKVDLQKWVEGSDSVDDVEIVDRVLEAA
FT                   KESYDAKVDLSGRQSFAGFERSVLLYSVDTHWREHLAALDHLRQGIHLRGYAQKDPKQE
FT                   YRREAFELYGELLNVIKNDVVKNIMTVEIRSASELDQAAESMNEDLAKLSDVQYQHADP
FT                   DMEVAGSTGDRGAALDIQPAPVRSGPKIGRNDPCSCGSGKKYKNCCGALS"
FT   gene            174442..174900
FT                   /locus_tag="Pnuc_0177"
FT   CDS_pept        174442..174900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0177"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: gfo:orf438 molybdenum-dependent oxidoreductase
FT                   iron-sulfur binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33398"
FT                   /db_xref="GOA:A4SV84"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV84"
FT                   /protein_id="ABP33398.1"
FT                   /translation="MAISFTLNGKAVNFEGDPETPILWVLRDHLDVTSPKYGCGAGLCG
FT                   ACTVHLEGAAIRSCSIPISAAAGKAVTSLEGLAEKMGKAIQDAWIEFDVPQCGYCQTGQ
FT                   MMSAADLLAKKKQPSSDEIKNAMSGNICRCGTYSRIEKAVKRAADKLA"
FT   gene            174912..177035
FT                   /locus_tag="Pnuc_0178"
FT   CDS_pept        174912..177035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0178"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase,
FT                   molybdopterin binding protein"
FT                   /note="KEGG: sfu:Sfum_1730 aldehyde oxidase and xanthine
FT                   dehydrogenase, molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33399"
FT                   /db_xref="GOA:A4SV85"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012368"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV85"
FT                   /protein_id="ABP33399.1"
FT                   /translation="MKNHSLKNQSRRQFIQQTATAAGAFVVGMYLPLSSEAATSAGQQP
FT                   ALANAWIRITPSNQITLICARSEMGQDVYTSMPALLAEELNLPLSMIQVEIAGVAPVYI
FT                   NALLGGQITGGSTSVREAFDKLRTAGAATRSVLVEAAAQRWNVAASDCKAMNGKVTHSS
FT                   GKSATYGELAADAAKLPLPEKPALKSPANFMVIGKESMRRLDTPIKVAGKAVYGIDVKI
FT                   PGMAIASLAQCPVIGGTPTSYDASAALKVSGVIKVVQISDGVAVLAKDFYTARKGRDAL
FT                   QITWNEGANATLSNAVVRKSLEEGLSKKGAVIKTVGDINATVANGKTVSAQYFLPYLAH
FT                   STMEPVNCSADVSNGKCRIIGPIQFQQGGEAVAAAAAGVKPEDVTIETTFLGGGFGRKL
FT                   ELDFIRQAAEISKAAGMPVKMLWTKEDDITHDFYRPMSIHKVEGVLGANGQLETMKAKM
FT                   VSQSVTARAFPGFVKDGFDPFMVEGSNNVTYEIPNMEITNVITDTGVRVGYWRSVSNAL
FT                   NAFAIESFVDEAAKAAGKDPVAFRLASLDKHPRAKAALELAVKKSGYSASSKRFGVAQM
FT                   ECYDTYSACVIELDPTASSTKVKKVTFVSDCGIAVHPDQARAQLTGGVIYGLSAALANE
FT                   ITIENGRIQQNNFNNYPSLRQNQVPIVEVHLIPSQEKPGGLGEVGVPLVAPALANAIAA
FT                   ATGKRIRELPIKA"
FT   sig_peptide     174912..175025
FT                   /locus_tag="Pnuc_0178"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.959 at
FT                   residue 38"
FT   gene            177114..178349
FT                   /locus_tag="Pnuc_0179"
FT   CDS_pept        177114..178349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0179"
FT                   /product="glutamate N-acetyltransferase"
FT                   /EC_number="2.3.1.35"
FT                   /note="KEGG: reh:H16_A3263 N-acetylglutamate synthase;
FT                   TIGRFAM: arginine biosynthesis bifunctional protein ArgJ;
FT                   PFAM: arginine biosynthesis protein ArgJ"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33400"
FT                   /db_xref="GOA:A4SV86"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV86"
FT                   /protein_id="ABP33400.1"
FT                   /translation="MTVNLPLPQKSELKPVKGFEMGIAKAGIKKADRKDLLVMRLAPGS
FT                   QVAGVFTLNRFCAAPVQVCREHLAQEGRHGEIRALVVNTGNANAGTGEQGMKHALETCA
FT                   ALAKDLGINPAQILPFSTGVILEPLPIEKIIAALPAAVANLGDDQWLDAAEAIMTTDTQ
FT                   PKASSVTIQTPAGSVVLTGICKGAGMIHPNMATMLGFIATDAGFAPGLLGDLTRDVADL
FT                   SFNAITIDGDTSTNDSFIIMATGQSSVQIQSISDPAYAIVRDALVGLARKLAQMIVRDG
FT                   EGATKFMTIEVVGGKTAEECRLVAKAVAHSPLVKTAFFASDPNLGRILAAIGYAGITDL
FT                   DVNHVQMWLGDVWVAKDGGRNPSYQEADGQRVMQAPEITVKIDLGRGTASQTMWTCDLS
FT                   HDYVSINADYRS"
FT   gene            178364..179221
FT                   /locus_tag="Pnuc_0180"
FT   CDS_pept        178364..179221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0180"
FT                   /product="protein of unknown function DUF815"
FT                   /note="PFAM: protein of unknown function DUF815; KEGG:
FT                   reh:H16_A3262 predicted ATPase, AAA+ superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33401"
FT                   /db_xref="InterPro:IPR008533"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV87"
FT                   /protein_id="ABP33401.1"
FT                   /translation="MNEKLDRLLEHLETFLPKPLSDDQWKSSVAFRWRRRDSIFGSIGF
FT                   LQPVKHVSDITFEDLQNIDRQRDAIRDNTKNFILQKPANNILLTGARGTGKSSLIKASL
FT                   HEFASQGLRLVEVEKEHLADLADITELLADRPERFIIFCDDLSFEDGESGYKAMKSALD
FT                   GSVSAQVDNILIYATSNRRHLLPEYMKDNEGYVHGDDGEIHPGEVVEEKISLSERFGLW
FT                   LSFYPPKQDEYLAIVAHWLEHFGLSAQQIEEARPEALVWALERGSRSGRVAWQFAKHWA
FT                   GSRA"
FT   gene            179231..179647
FT                   /locus_tag="Pnuc_0181"
FT   CDS_pept        179231..179647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0181"
FT                   /product="8-oxo-dGTPase"
FT                   /EC_number="3.6.1.-"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: bxe:Bxe_A0498 putative
FT                   mutator protein(7,8-dihydro-8-oxoguanine-triphosphatase),
FT                   MutT"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33402"
FT                   /db_xref="GOA:A4SV88"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV88"
FT                   /protein_id="ABP33402.1"
FT                   /translation="MNHENRPVTEVAAGILLDQSGRYLLGQRPEGKPYAGYWEVPGGKI
FT                   EAGESVFEALRRELQEELGINIHSSEELTVLEHDYPHAYVRLHVSVIREWSGIPKGCEG
FT                   QTLSWELLGAEKPSVSPLLPAAWPMLERLRALLA"
FT   gene            complement(179644..180396)
FT                   /locus_tag="Pnuc_0182"
FT   CDS_pept        complement(179644..180396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0182"
FT                   /product="protein of unknown function DUF1342"
FT                   /note="PFAM: protein of unknown function DUF1342; KEGG:
FT                   rso:RSc2829 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33403"
FT                   /db_xref="GOA:A4SV89"
FT                   /db_xref="InterPro:IPR009777"
FT                   /db_xref="InterPro:IPR027462"
FT                   /db_xref="InterPro:IPR036268"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV89"
FT                   /protein_id="ABP33403.1"
FT                   /translation="MIVYEYPFNELVRSMLRLEYLFARFNHFIRSDDPELHHNAISTLF
FT                   DLGDIGARGDIKSLLLKEFERQKYALNGLKSSQKVDQEALGQTLAEIDLVASKINQSSG
FT                   RPNQIITESEWLNAIRTRLNIPGGTSPIDLPSYHAWKNSPSSERRQLLENFVSPLLPWQ
FT                   DACQLFLRLLRQSGEAKDVVAHSGAFQQAPSGKVYQLMRIAVEDDTLYSEISANKYLLS
FT                   VRFLQSDRDRKAQPVTKDVSFKLTLCQF"
FT   gene            complement(180408..181028)
FT                   /locus_tag="Pnuc_0183"
FT   CDS_pept        complement(180408..181028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0183"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="KEGG: bam:Bamb_0478 dephospho-CoA kinase; TIGRFAM:
FT                   dephospho-CoA kinase; PFAM: Dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33404"
FT                   /db_xref="GOA:A4SV90"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV90"
FT                   /protein_id="ABP33404.1"
FT                   /translation="MLVGLTGGIGSGKTAVSDLLGQLGAGVIDTDLISHQITATNGKAI
FT                   PAIRHEFGPEFINNDGALDRPKMRALVFAQPEARKTLEVITHPLIRQEAVKQAEELSKA
FT                   GVPYLVFAVPLLIESKGWQNLVDYLVVVDCPEEVQIERVMHRNNLSREEVKKILAAQTS
FT                   RQERLACANAVIENQGSPDQLASQVRQLNQKILQIQKDLLSSS"
FT   gene            complement(181049..181549)
FT                   /locus_tag="Pnuc_0184"
FT   CDS_pept        complement(181049..181549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0184"
FT                   /product="peptidase A24A, prepilin type IV"
FT                   /note="PFAM: peptidase A24A, prepilin type IV; KEGG:
FT                   pfo:Pfl_4822 prepilin peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33405"
FT                   /db_xref="GOA:A4SV91"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR014032"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV91"
FT                   /protein_id="ABP33405.1"
FT                   /translation="MGFLTSSVFIRGLFILALIYLAYQDARTFRLSDRVTLPLLVLGLV
FT                   FNSFDSTRLVSFPDALTGAILGYSFFWLMNFLYRLIKKQNGIGMGDAKLLAALGAWLGF
FT                   NALPDVILIAALSGTLGGFIWLKVQDQRHRAPFPFGPFLAFAGIIELLWPHFLQTFILI
FT                   NLI"
FT   gene            complement(181549..182595)
FT                   /locus_tag="Pnuc_0185"
FT   CDS_pept        complement(181549..182595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0185"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   rme:Rmet_3109 type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33406"
FT                   /db_xref="GOA:A4SV92"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV92"
FT                   /protein_id="ABP33406.1"
FT                   /translation="MALNKQSQLDFAQQLLALLNAGLALLNAIELIQESSQKSWQPWLK
FT                   GLLSELKKGNSFSQSLKSQHNQFSVEFINLIRVSERTGDIERALRTICAQLESQIELRR
FT                   KIQQALSYPLITLTSSLLLVVVMMIWVVPVFKDVFAHFQAELPPPTKALIQVSNLINHY
FT                   FLEISICLISSSIFFLVAWNRSSTLQKMCDQWSFRIPLIGKLLRLATLTYWCRTLGHLL
FT                   ESGLPLPDALRVTAQSSNHWLSHDCSAEVFKHLTQGWPLGEALKRGDPKSRLFDHETLQ
FT                   LLHIASESGCLSQMLNKRAMTLGSQLSNRLNSLSQTLEPLLIIVVGFIIGSLVIILYLP
FT                   IFNLGQIV"
FT   gene            complement(182586..183668)
FT                   /locus_tag="Pnuc_0186"
FT   CDS_pept        complement(182586..183668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0186"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   rme:Rmet_3108 type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33407"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV93"
FT                   /protein_id="ABP33407.1"
FT                   /translation="MSSAHDDSLIIRTWYEIAVNALHARASDIHIEAGPQDTLVRFRVD
FT                   GLLNKQARYSVDLHERLITRIKILARLDIAEKRLPQDGRLCIGHDFTKPDVDCRVSIIP
FT                   TLHGEKAVIRILLNHLEELALEQIGLLPEQLAIFQKALSQPNGLILVTGPTGSGKTRTL
FT                   YSCLQELNQIHRNLCSIEDPIEIRLPGINQVAYHPRAGLDFPVIIKALLRQDPDVIMIG
FT                   EIRDGATAQLAIQAAQTGHLVLSTLHTRDARGALARLKNLGIDQEALESTLLSVSSQRL
FT                   LRKICTECSQKIPTPPLVNCSMCMGKGYWGRIGVHEVLSAKHLFIPSLPYLSMYEAGLH
FT                   YVKTGEVNQASLNNEVSAWR"
FT   gene            complement(183665..184954)
FT                   /locus_tag="Pnuc_0187"
FT   CDS_pept        complement(183665..184954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0187"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: CBS domain containing protein; protein of
FT                   unknown function DUF21; transporter-associated region;
FT                   KEGG: rso:RSc2824 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33408"
FT                   /db_xref="GOA:A4SV94"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV94"
FT                   /protein_id="ABP33408.1"
FT                   /translation="MDTFFDDWPLYAQAALVIFLLALSGFFSMAETSMLSSNRHRLRAM
FT                   ANNGNSGASLAERLLKRVDSLLSVLLISNNLINTILPILVTGIALHLFGDSGLVLSIAT
FT                   LVVALLIIIFSEITPKVIGAAFPEKIASNVGWLILPLTVILKPLLWFINNFVSGLMKVS
FT                   GLHSSSDSRVMSKEELRSLVLESNRFVSNHHRNILLNLFNLENITVDDVMTPRSKIEIL
FT                   DLSRPIDEVVQQLETCYHNKLPVCDGDSEKIIGILSVKKALSLLGDTDLKHGDFRSLVN
FT                   EPYFIPSGTPVLQQMQFFQDNQQRLGLVVNEYGEVLGLLTFEDIVEELIGEFTTSFSNL
FT                   STDPHWLKDGTYLASGSASLRDLNRLLNLNLPLDGPRTLNGLILEKLEAIPDHDVSVRI
FT                   AGIVMEIVQFDDQGVKTVKLYQPDYSQNQD"
FT   sig_peptide     complement(184862..184954)
FT                   /locus_tag="Pnuc_0187"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.898) with cleavage site probability 0.892 at
FT                   residue 31"
FT   gene            185033..185584
FT                   /locus_tag="Pnuc_0188"
FT   CDS_pept        185033..185584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0188"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /note="TIGRFAM: methylated-DNA--protein-cysteine
FT                   methyltransferase; PFAM: methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase; KEGG: reh:H16_A0591 methylated-DNA
FT                   [protein]-cysteine S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33409"
FT                   /db_xref="GOA:A4SV95"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV95"
FT                   /protein_id="ABP33409.1"
FT                   /translation="MSELLFIYVRMGIMKLSQQPASSNSAQYCVIAAPFGRLGILTELV
FT                   EGSLMVSKVDYLSKEAPLSTPKNELAKEVARQCKAYFADPLYQFDLPLKPAGTIHQQKV
FT                   WKHIQAIPVGKTQTYGELAAKIKSGPRAVGTACGANPYPLISPCHRVVSTQGIGGFMKE
FT                   NAPGLYRQIKLWLLQHEGVL"
FT   gene            complement(185581..186570)
FT                   /locus_tag="Pnuc_0189"
FT   CDS_pept        complement(185581..186570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0189"
FT                   /product="farnesyl-diphosphate farnesyltransferase"
FT                   /EC_number="2.5.1.21"
FT                   /note="PFAM: Squalene/phytoene synthase; KEGG: neu:NE1958
FT                   squalene and phytoene synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33410"
FT                   /db_xref="GOA:A4SV96"
FT                   /db_xref="InterPro:IPR002060"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR019845"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV96"
FT                   /protein_id="ABP33410.1"
FT                   /translation="MQIPRKTSIGSSESDLSYQKAILGSVSRTFALTIPLLPPDIEIVV
FT                   GNTYLLCRIVDTIEDAADLSPQIKQDLSKLFLDAVLEKSPVETFVEPCLTHLRHYGNSD
FT                   ELDLIANTPTVLRILHTCSANDQAAVSRCVSIMSEGMSRFHGKQNEAGLKNLTEFEEYC
FT                   YVVAGVVGELLTTIFSNHSQAFTKNIVGHEELAIAFGQALQMTNILKDSPEDKARGVSW
FT                   KPANMSQTTLLAIAYDKLKDSLNYILLIPKTDLGMRRFCFLAFGLAVMTLSKIAKRDKF
FT                   NCKDEVKLSRKSVMAFYAFTKVAVNSNLLMKVFFQVYAKPLRTAVSKS"
FT   gene            186678..188093
FT                   /locus_tag="Pnuc_0190"
FT   CDS_pept        186678..188093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0190"
FT                   /product="Na+/solute symporter"
FT                   /note="PFAM: Na+/solute symporter; KEGG: reh:H16_A0450 APC
FT                   transporter, SSS family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33411"
FT                   /db_xref="GOA:A4SV97"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV97"
FT                   /protein_id="ABP33411.1"
FT                   /translation="MLIWFVIIYWVVSVGIGLWAALRVKNTADFAAAGHSLPMPIVTAT
FT                   VFATWFGSETVLGIPATFLKEGLGGVVADPFGSSLCLILVGLFFARHLYNRRMLTIGDF
FT                   FREKYGRTVEVLVTLCIVVSYLGWVAAQIKALGLVFNVVSEGSITQTGGMLIGAASVLI
FT                   YTLFGGMWSVAITDFIQMIIIVIGMLYIGNEMSTQTGGISVVIEHAAAAGQFSNFWPDM
FT                   NLASILGFVAALCTMMLGSIPQQDVFQRITSSKNVNIAVNAAILGGVLYFIFAFVPMYL
FT                   AYSATLISPDLVKEYLDTDPQMILPKLILNHAPLIAQVMFFGALLSAIKSCASATLLAP
FT                   SVTFAENIVRGFFKHLSDRQLLKIMRITVLCFAIVVTFFAINSELSIFKMVESAYKVTL
FT                   VAAFVPLAFGIYWSRANSLGGLLAVVGGLTIWISSEILAPNAIVPPQLAGLLASIAGMI
FT                   LGSLVPKDLLKAV"
FT   gene            188199..189218
FT                   /locus_tag="Pnuc_0191"
FT   CDS_pept        188199..189218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0191"
FT                   /product="ketopantoate reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="KEGG: pol:Bpro_2793 2-dehydropantoate 2-reductase;
FT                   TIGRFAM: 2-dehydropantoate 2-reductase; PFAM: Ketopantoate
FT                   reductase ApbA/PanE, N-terminal domain protein;
FT                   Ketopantoate reductase ApbA/PanE, C-terminal domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33412"
FT                   /db_xref="GOA:A4SV98"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV98"
FT                   /protein_id="ABP33412.1"
FT                   /translation="MKICVIGGGGAIGGYLAVMLARAGNDVTVVARGATLAAIKERGLA
FT                   LIMDDQPEPLVAQVKAVEKIRDAETPDVVILAVKAHQVEPIINDLAAIMGPDTILIPMQ
FT                   NGIPWWYFQKLNGEYQDHSVETVDAGGLAKKTINPNNIIGCVVYPATFTQAPGVIRHVE
FT                   GNRFPLGELDGKTTERIQKISEMMGAAGFKSPILDDIRSEIWLKLWGNMTFNPISSLTH
FT                   GTLEGICQYPLTKELARNMMAEAQTIAEKLGVTFRVDIERRIAGAEKVGKHKTSMLQDL
FT                   EAGRSLEIDALLGSVIELGKITQTSTPCLNTVFALTKYLDENVQASKGSLALPSVSGY"
FT   gene            complement(189313..190080)
FT                   /locus_tag="Pnuc_0192"
FT   CDS_pept        complement(189313..190080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0192"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   rpe:RPE_1953 fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33413"
FT                   /db_xref="GOA:A4SV99"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR018833"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A4SV99"
FT                   /protein_id="ABP33413.1"
FT                   /translation="MAQWLRFQHQGKRGLGQLQGDQVVVYEGDLFNQPRATGATLKLSD
FT                   ITIDIPCTPSKMVAIVDNFHALVAKLEHAVPAEPLYFLKGNNSFLATNQVIRTPKSYSG
FT                   KVVYEGELGIVIGKRCHEVDEAEAAKAIFGYTCINDVTAIEILNRDPGYAQWTRSKSFN
FT                   TFGVFGPYITTDVDPSTLHIKTILNDQERQNYPIADMIFPPAKLVSLISQDVPLEAGDI
FT                   IACGTSVGVGSMKPGSNVSIIIDGVGRLDNRFE"
FT   gene            complement(190112..191116)
FT                   /locus_tag="Pnuc_0193"
FT   CDS_pept        complement(190112..191116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0193"
FT                   /product="Farnesyltranstransferase"
FT                   /EC_number="2.5.1.29"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: bxe:Bxe_A0506
FT                   octylprenyl-diphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33414"
FT                   /db_xref="GOA:A4SVA0"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVA0"
FT                   /protein_id="ABP33414.1"
FT                   /translation="MTSTVKTNELSQILAPISLEFKGLDEVIRLRLASKVALIDQISTY
FT                   IIQAGGKRVRPALLMLVAKALANGKESAHTLEMAAVVEFIHTATLLHDDVVDESTLRRG
FT                   RETANAAFGNAASVLVGDFLYSRAFQMMVAPNDLRVMQILSDATNTIAEGEVLQLLNMN
FT                   DPEVDEASYLQVIRYKTAKLFEASTELGAILASATDSQREQAAAFGRHIGTAFQLMDDL
FT                   LDYTANAAQMGKNAGDDLREGKPTLPLIYLLENGSNEERLLVRAAIEQNQDLPEDVFAQ
FT                   ILGAVQSSGALDYTQAVAKREADLALDCISEFPSNEATTALRDLCTYSLARQT"
FT   gene            191192..191503
FT                   /locus_tag="Pnuc_0194"
FT   CDS_pept        191192..191503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0194"
FT                   /product="LSU ribosomal protein L21P"
FT                   /note="PFAM: ribosomal protein L21; KEGG: rso:RSc2822
FT                   probable 50S ribosomal subunit protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33415"
FT                   /db_xref="GOA:A4SVA1"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SVA1"
FT                   /protein_id="ABP33415.1"
FT                   /translation="MYAVIKTGGKQYKVAAGEKLKIEQIPAEIGSEITLDQVLAVGEGA
FT                   SLKLGDPLVNGAAVMATVVSQGRHDKVTIFKMRRRKHYQKHQGHRQNFTEILINTIKA"
FT   gene            191523..191783
FT                   /locus_tag="Pnuc_0195"
FT   CDS_pept        191523..191783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0195"
FT                   /product="LSU ribosomal protein L27P"
FT                   /note="PFAM: ribosomal protein L27; KEGG: rme:Rmet_3105
FT                   ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33416"
FT                   /db_xref="GOA:A4SVA2"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SVA2"
FT                   /protein_id="ABP33416.1"
FT                   /translation="MAQKKGGGSTRNGRDSESKRLGVKVFGGEHINAGSIIIRQRGTRV
FT                   HPGANVGIGKDHTLFALIDGQVEFGVKGALKKAQVSVLPRS"
FT   gene            191872..192960
FT                   /locus_tag="Pnuc_0196"
FT   CDS_pept        191872..192960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0196"
FT                   /product="small GTP-binding protein"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM:
FT                   GTP-binding protein, HSR1-related; GTP1/OBG sub domain
FT                   protein; KEGG: bur:Bcep18194_A3668 GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33417"
FT                   /db_xref="GOA:A4SVA3"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SVA3"
FT                   /protein_id="ABP33417.1"
FT                   /translation="MKFIDEARIEVIAGQGGSGSASMRREKFIEFGGPDGGDGGKGGSV
FT                   WATADRNINTLIDYRYAKTHTAKNGEPGRGADCYGRAGDDIELRMPVGTIISDYETGEP
FT                   IADLTTHGERLCLAQGGVGGWGNIHFKSSTNRAPRQKTNGKEGERRKLKLELKVLADVG
FT                   LLGMPNAGKSTLITAVSNARPKIADYPFTTLHPNLGVVRVGNERSFVIADIPGLIEGAA
FT                   EGAGLGHRFLRHLQRTGVLLHLVDIAPFDENIDPVADAVAIVNELRKYDEALVEKPRWL
FT                   VLNKVDMIPEEDRKKVVADFIKRFKWKGPVFEISALTGLGCDKLCYALQDYLDSVRRDR
FT                   DDAEERAADPRYQDQAADKSPD"
FT   gene            192986..193768
FT                   /locus_tag="Pnuc_0197"
FT   CDS_pept        192986..193768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0197"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="KEGG: rme:Rmet_3103 glutamate 5-kinase; TIGRFAM:
FT                   glutamate 5-kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33418"
FT                   /db_xref="GOA:A4SVA4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVA4"
FT                   /protein_id="ABP33418.1"
FT                   /translation="MDLKQKKRIVVKVGSSLVTNNGEGLDHAAIALWAEQIATLLQAGH
FT                   EVLMVSSGAIAEGMQRLGWAKRPQDIHQLQAAAAVGQMGLVQVYESCFARFNLRSAQIL
FT                   LTNADLAHPERNANAKVTLDTLLKLGVVPIINENDTVVTDEIKFGDNDSLAALVTNLVH
FT                   ADLLVILTDQGGLFTADPRQNPDATLLATATAGDPALEKMAGGAASELSKGGMLTKVLA
FT                   AKIAVQTGASTVIASGHEPKVLTRLLNGESIGTLLSSQ"
FT   gene            complement(193755..194327)
FT                   /locus_tag="Pnuc_0198"
FT   CDS_pept        complement(193755..194327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0198"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: bpm:BURPS1710b_3520 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33419"
FT                   /db_xref="InterPro:IPR014861"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVA5"
FT                   /protein_id="ABP33419.1"
FT                   /translation="MSRLLRTLSNYSACMALAATLIACAGDPMESGMDPFAPMVFKEGS
FT                   TKMPESPPNKSSLLSFYVSPSTIFKFSVDTQSISIGADGVTRYIVVITNPSGEEQAQYE
FT                   GIRCDSYQWKLYGNFENGQWKENPLAEWRDIKMKVANRYQAALAQGAFCNFNSQEQSMN
FT                   TVMKSLNPNSFTGGTKPSNSNGVIIGY"
FT   sig_peptide     complement(194250..194327)
FT                   /locus_tag="Pnuc_0198"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.981 at
FT                   residue 26"
FT   gene            complement(194329..194928)
FT                   /locus_tag="Pnuc_0199"
FT   CDS_pept        complement(194329..194928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0199"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: rso:RSc2817
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33420"
FT                   /db_xref="GOA:A4SVA6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SVA6"
FT                   /protein_id="ABP33420.1"
FT                   /translation="MLDREGYRPNVGIVLLNSRNEVFWGKRVGQHSWQFPQGGIQHGES
FT                   PEQAMYRELHEEVGLLPEHVQIIGRTRDWLRYDVPEEYLRRQHATRVHRAAYRGQKQIW
FT                   FLLRLVGLDSDIQLRASEHPEFDAWRWVPFWIQLDAVIGFKREVYELALSELARYLSRG
FT                   VRMHQLAWGSPLDLLQSFYSKGEEGSPESSKTDKSK"
FT   gene            194977..196719
FT                   /locus_tag="Pnuc_0200"
FT   CDS_pept        194977..196719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0200"
FT                   /product="prolyl-tRNA synthetase"
FT                   /note="TIGRFAM: prolyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase, class II (G, H, P and S); Anticodon-binding
FT                   domain protein; YbaK/prolyl-tRNA synthetase associated
FT                   region; KEGG: rme:Rmet_3100 prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33421"
FT                   /db_xref="GOA:A4SVA7"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SVA7"
FT                   /protein_id="ABP33421.1"
FT                   /translation="MKASQSFLATLKEAPSDAEVVSHKLMVRAGLIRKISAGIYNYLPL
FT                   GLKVIRKVENIIREEMNRAGAIELLMPMIQPAELWQETGRWEKMGPELLRIKDRHDRDF
FT                   LIQPTSEEVITDLARNEIRSYKQLPVNFYQIQTKFRDERRPRFGIMRGREFSMKDAYSF
FT                   DRDTEGLKKSYQTMFEAYTQIFKRMGLEFRAVTADNGAIGGSGSQEFHVIADTGEDAIV
FT                   YCPSSDYAANLEAAESLALNATRGAATQTMAKVPTPDKTNCADVAKLLNLPLEQTVKSL
FT                   LFAADQESGPAKLFMLLVRGDHELNEVKASKVPGMTESRFATETEIKQACNAPAGYLGP
FT                   VGVSAEVTIVADRTVANMADFVCGANDAGHHLTGVNWGRDLPEPLVLDIRNAVIGDPSP
FT                   DGKGVVDICRGIEVGHVFQLGTRYSEAMGCTYLDQQGKAQPMVMGCYGIGVTRLLGAAI
FT                   EQGHDERGIIWPISMAPVEVVICPMGYEKSEPVKAACDQLHDELVAAGIDVILDDRNER
FT                   PGAMFADWELIGAPFRVVIGDRGLADSQVEFKGRTDADSQNIPLAQIKEKVISAVQAAK
FT                   NAVA"
FT   gene            complement(196755..198137)
FT                   /locus_tag="Pnuc_0201"
FT   CDS_pept        complement(196755..198137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0201"
FT                   /product="signal recognition particle subunit FFH/SRP54
FT                   (srp54)"
FT                   /note="KEGG: bte:BTH_I1149 signal recognition particle
FT                   protein; TIGRFAM: signal recognition particle protein;
FT                   PFAM: GTP-binding signal recognition particle SRP54, G-
FT                   domain; Signal peptide binding (SRP54) M- domain protein;
FT                   GTP-binding signal recognition particle SRP54, helical
FT                   bundle; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33422"
FT                   /db_xref="GOA:A4SVA8"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVA8"
FT                   /protein_id="ABP33422.1"
FT                   /translation="MLENLTDRLSRVVKTMRGQARLTEDNTAEMLREIRLALLEADVAL
FT                   PVVKSLLEQIKFKALGEEVVGSLSPGQALVGVVQRELAQVMMGDTNQSGELNLATQPPA
FT                   VILMAGLQGAGKTTSVGKLAKWLQEKKKKKVLTVSCDVYRPAAIEQLETVTKQVGAEFF
FT                   PSNVNQKPNDIATAALDWARRHYFDVVIVDTAGRLGIDEALMQEIKTLHASLNPIETLF
FT                   VVDAMLGQDAVNTAKAFHEALPLTGVILTKLDGDSRGGAALSVRQVTGVPLKFIGVAEK
FT                   MDGLEAFDAERMANRILGMGDILALVEQAQQHVDVAKAEKLANKISKGGFDLEDFRDQL
FT                   MQMQKMGGMASLMDKLPSQMAQAASKTNMNAADKQTKRMRGIIDSMTPRERTKPELLKA
FT                   SRKRRIAAGAGVEVQEVNRLLAQFEQMQTMMKQFKGGKMARTMAAMAAKGAAKGIGGLF
FT                   KK"
FT   gene            198158..199006
FT                   /locus_tag="Pnuc_0202"
FT   CDS_pept        198158..199006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0202"
FT                   /product="cytochrome c assembly protein"
FT                   /note="PFAM: cytochrome c assembly protein; KEGG:
FT                   bxe:Bxe_A0517 cytochrome c assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33423"
FT                   /db_xref="GOA:A4SVA9"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVA9"
FT                   /protein_id="ABP33423.1"
FT                   /translation="MDILGHSSYGLLPAVLYFFLLLFLSLSSRNKAVSPLSGILVQAFI
FT                   FVVLLIHGLQLHDSVFTPQGFVFGFAQDLSLIAWVGLAFYWFQSWFLPISSLRWLVILF
FT                   ALACSLLPNLFPGTLISPKAVSDPWFKGHFIVATIAVGLLSLAAIHAMLMSVQDRALHR
FT                   QLAIAPNGRIAHWLEDLPPLMTMESLLFNLLYVGFALLSLTVFSGLLFSQTLFGKPLVF
FT                   DHKTIFALISWFLFAGLLLARWRVGLRGRAAVRWVLSAYTALLLAYVGSRFVLEVILQR
FT                   V"
FT   gene            199139..199816
FT                   /locus_tag="Pnuc_0203"
FT   CDS_pept        199139..199816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0203"
FT                   /product="N-acetylmuramoyl-L-alanine amidase, family 2"
FT                   /note="PFAM: N-acetylmuramoyl-L-alanine amidase, family 2;
FT                   KEGG: reh:H16_A3236 N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33424"
FT                   /db_xref="GOA:A4SVB0"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVB0"
FT                   /protein_id="ABP33424.1"
FT                   /translation="MVQCQHCKVHLPKADAIANEQRFYCSAEHLHSLDEQGWLGFAQWR
FT                   ESPNQDARPENIEPDLLVIHHISLPPGEFKAQDSSQYIIDFFQNRLDPNRHPYFAEIEG
FT                   QKVSSHFLITRSGRLIQFVSTKHKAWHAGLSSFLGREKCNDFSIGIELEGDGETPFEEI
FT                   QYKVLSETVGKLSATYPSLQFAGHSDIAPERKTDPGISFDWKRFQKETGLSLDKLPFGL
FT                   ASR"
FT   gene            200089..203070
FT                   /locus_tag="Pnuc_0204"
FT   CDS_pept        200089..203070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0204"
FT                   /product="ribonucleoside-diphosphate reductase, alpha
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="KEGG: reu:Reut_A2941 ribonucleoside-diphosphate
FT                   reductase; TIGRFAM: ribonucleoside-diphosphate reductase,
FT                   alpha subunit; PFAM: ribonucleotide reductase large
FT                   subunit; ATP-cone domain protein; Ribonucleotide reductase
FT                   large subunit, N terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33425"
FT                   /db_xref="GOA:A4SVB1"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVB1"
FT                   /protein_id="ABP33425.1"
FT                   /translation="MTYANPQTAGQPSGANNPGMGGAGAMNQTPSAGFVAGGVGGNQAT
FT                   QLSDYKIIRRNGSVVAFEPSKIAIAVTKAFLAVNGGQGAASARVREQVEQLTHSVVRAL
FT                   LRSRPNGGTFHIEDIQDQVELALMRSGEHNVARAYVLYREKRNQERAAQQEVAQESQSA
FT                   GQATESGIKVTDNGVEKWLDMAALRTVIEAACEGLGNHIDATPIITETIKNLYDGVPMA
FT                   QVYDSAILASRTLIEKDPAFSQVTARILMHVIRKEILGKEVLQGDMQSEYGTYFAKYIN
FT                   EGISAELLDPRMREFDLPRLAAALNASRDLQFNYLGLQTLYDRYFLHIEDRRIEMPQAF
FT                   FMRVAMGLSLNELDRERRAIEFYEILSTFDFMSSTPTLFNSATTRPQLSSCYLTTVEDD
FT                   LDGIYEALKENALLSKFAGGLGNDWTNVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAV
FT                   NQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTSNWIPDLFMKRVMENG
FT                   DWTLFSPSNTPDLHDKYGKAFEEAYVAYEQKADRGELKPFRRIPAQQLWRKMLGMLFET
FT                   GHPWITFKDPCNIRSPQQHIGVVHSSNLCTEITLNTNETEIAVCNLGSVNLTAHMTTDA
FT                   NGKLVLDHEKLQRTVRTAMRMLDNVIDINYYAVAKARNSNLKHRPVGMGIMGFQDCLHM
FT                   QRIPYASEEAVKFADSSMEAVCYYAYQASNELAEERGVYSTYTGSLWDRGILPQDSVAL
FT                   LAQERGGYLEVDNSSTMDWSGLRARIKQYGMRNSNCVAIAPTATISNIIGVSACIEPTF
FT                   QNLFVKSNLSGEFTVVNEYLVRDLKDRGLWDEVMIADLKYFDGTLSKIDRIPQDLRDLY
FT                   ATAFEVEPSWLVEAASRRQKWIDQAQSLNIYMGGASGKKLDDTYKLAWLRGLKTTYYLR
FT                   TMAATHVEKSTVASGQLNSVSSGGGVNGTDATAASAAGGVEADGPVCTMRPGDAGFEEC
FT                   EACQ"
FT   gene            203116..204300
FT                   /locus_tag="Pnuc_0205"
FT   CDS_pept        203116..204300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0205"
FT                   /product="Ribonucleoside-diphosphate reductase"
FT                   /EC_number="1.17.4.1"
FT                   /note="PFAM: ribonucleotide reductase; KEGG: rso:RSc2804
FT                   putative transmembrane ribonucleoside reductase (small
FT                   chain) oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33426"
FT                   /db_xref="GOA:A4SVB2"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVB2"
FT                   /protein_id="ABP33426.1"
FT                   /translation="MLNWEEEVAPALAKAGLAPQPVAVEPQRPQPDQVAIAPQTTAPAP
FT                   VEAANLSGGAALRVNAADKRVINAKTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMN
FT                   RDIALWKDPNGLTEDERRIIKRNLGFFTTADSLAANNIVLGTYRHITAPECRQYLLRQA
FT                   FEEAIHTHAYQYIVESLGLDQSEIFNAYNEIESIRAKDEFLIPYIDVLTNPNFKTGTLE
FT                   TDQTLLRSLIVFACVMEGLFFYVGFTQILAMGRQNKMTGAAEQYQYILRDESMHCNFGI
FT                   DLINQIKLENPQLWTSAFKDEIKSIFEKAVELEYRYAEDTMPRGVLGLNAPMFKGYLRY
FT                   ICNRRCLQIGLDAMFPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE"
FT   gene            204635..204949
FT                   /locus_tag="Pnuc_0206"
FT   CDS_pept        204635..204949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33427"
FT                   /db_xref="GOA:A4SVB3"
FT                   /db_xref="InterPro:IPR009970"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVB3"
FT                   /protein_id="ABP33427.1"
FT                   /translation="MAIAKKKPAAKKPAAKKVAAKKPAAKKVAKKKPAAKKVAKKRVAA
FT                   KKPAAKKVAKKRVAAKKPAAKKVARKVAAKKPAAKKVARKVAAKKPAAKKVARKVAKKK
FT                   "
FT   gene            complement(205130..206089)
FT                   /locus_tag="Pnuc_0207"
FT   CDS_pept        complement(205130..206089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0207"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: reh:H16_A3176
FT                   carbohydrate kinase, PfkB family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33428"
FT                   /db_xref="GOA:A4SVB4"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVB4"
FT                   /protein_id="ABP33428.1"
FT                   /translation="MASLICGSIAYDTIMNFEGKFADQILPEQIHILNVAFLVPTMRRE
FT                   FGGCAGNIAYNLSLLGGDPIIMATVGGDAAPYMDRLEELKIDASHIRQIDHAFTAQAMI
FT                   TTDQANNQITAFHPGAMGESHLNQVSDVVAERSKNSKSAAKLGIVAPDGRQGMWEHCHQ
FT                   LADANIPFIFDPGQGLPMFNGPELLELVDIASYLAVNDYEGEMLSQRTGLSLAKVAERV
FT                   KALIVTKGAEGADIYTDGKCIAIPPVPATKVIDPTGCGDAFRGGLLFGLENGLDWETTG
FT                   RLASLMGSIKITHQGPQNHQLSHDQIAAQFKSAFGFSL"
FT   gene            complement(206134..207654)
FT                   /locus_tag="Pnuc_0208"
FT   CDS_pept        complement(206134..207654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0208"
FT                   /product="[LSU ribosomal protein L11P]-lysine
FT                   N-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: ribosomal protein L11 methyltransferase;
FT                   PFAM: ribosomal L11 methyltransferase; Methyltransferase
FT                   type 11; Methyltransferase type 12; KEGG: bam:Bamb_0505
FT                   ribosomal protein L11 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33429"
FT                   /db_xref="GOA:A4SVB5"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR021834"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVB5"
FT                   /protein_id="ABP33429.1"
FT                   /translation="MSYRELVFTVAAETAEPLGDALLDLGALSVTVEDDAAGGYDENPL
FT                   YGEPGLSPEVQAWDRSAVTALFNPDIDASGSAEFIPELLVALKEAGFQLAHPQEKTVEE
FT                   QDWVRLTQSQFAPIQIGERIWVVPSWHEAPTDPNAICLAVDPGLAFGTGSHPTTHLCLL
FT                   WLEQNSHLQNQSLLDYGCGSGILAIAAAKLGCNPVIGTDIDPQAMVAARSNAEINNTVI
FT                   RFVLPNENAPELAAETKYDIVMANILANPLQVLAPALVNKMCPGGQIVLSGVLARQADE
FT                   VIATYSQWLKLSVWKESEGWVCLHGTLAKEDKKSISALPAQKKSLKLTLLCGFFLLLLV
FT                   FGEHLSRNSLLPALAPRVDGSSNAFSVGAFSVLQKIDQKLCRALGCLNRPVSDFAAWKI
FT                   TLAVMSPENGLEGLKNASNPSMMQVEIQNRLAIAVLPPHLEIMLTDAEESEIQSIQLTP
FT                   KEWLPVALQEKHPEYLRIGIPSGDLIEAELPISLPQNTAGYRVRALYP"
FT   gene            complement(207671..209035)
FT                   /locus_tag="Pnuc_0209"
FT   CDS_pept        complement(207671..209035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0209"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxylase;
FT                   PFAM: phosphoribosylglycinamide synthetase; ATP-dependent
FT                   carboxylate-amine ligase domain protein, ATP-grasp;
FT                   Carbamoyl-phosphate synthase L chain, ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   biotin carboxylase domain protein; KEGG: rso:RSc2787
FT                   probable biotin carboxylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33430"
FT                   /db_xref="GOA:A4SVB6"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVB6"
FT                   /protein_id="ABP33430.1"
FT                   /translation="MFDKILIANRGEIALRIQRACRELGIKTVVVYSTADKEAKYVKLA
FT                   DEAVCIGPAPSPLSYLNMPAIISAAEVTDAEAIHPGYGFLSENADFAERVEKSGFAFIG
FT                   PTAASIRLMGDKVSAKRAMIKAGVPCVPGSEGALPDNPKEIIATAKKVGYPVIIKAAGG
FT                   GGGRGMRVVHTEAALLNAVNMTKEEAGRAFGNPEVYMEKFLEKPRHVEIQILADTHGNA
FT                   IWLGERDCSMQRRHQKVIEEAPAPGIDRRLIAKIGERCAEACRKIGYRGAGTFEFLYEN
FT                   NEFFFIEMNTRVQVEHPVTEMITGVDIVQEQIRIAAGLKLAYRQKDIVFRGHAIECRLN
FT                   AEDPFKFTPSPGRIGSFHMPGGPGIRVDSHAYSGYVVPSNYDSMIGKLISYGNTREQAI
FT                   RRMQIALSEMVIDGITTNVPLHRELMLDPNFMEGGTSIHYLEHRLEEQAASRGKS"
FT   gene            complement(209083..209547)
FT                   /locus_tag="Pnuc_0210"
FT   CDS_pept        complement(209083..209547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0210"
FT                   /product="biotin carboxyl carrier protein"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxyl
FT                   carrier protein; PFAM: biotin/lipoyl attachment
FT                   domain-containing protein; KEGG: bml:BMA10299_A1281
FT                   acetyl-CoA carboxylase, biotin carboxyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33431"
FT                   /db_xref="GOA:A4SVB7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVB7"
FT                   /protein_id="ABP33431.1"
FT                   /translation="MDLRKLKTLIDLVSESGISELEVNEGEDRVRIVNAGSPAPAGQVV
FT                   YANPAPQHAQAAPVASAAPAAVPVVEAAPVATGSVARSPMVGTFYRAPNPESPNFVNIG
FT                   DTVKVGQTLCIIEAMKLLNEIESEHAGVVKEILCENGQGVEFDQPLFIIA"
FT   gene            complement(209584..210033)
FT                   /locus_tag="Pnuc_0211"
FT   CDS_pept        complement(209584..210033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0211"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /note="KEGG: rso:RSc2785 putative 3-dehydroquinate
FT                   dehydratase (3-dehydroquinase) (type II dhqase) protein;
FT                   TIGRFAM: 3-dehydroquinate dehydratase, type II; PFAM:
FT                   dehydroquinase, class II"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33432"
FT                   /db_xref="GOA:A4SVB8"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SVB8"
FT                   /protein_id="ABP33432.1"
FT                   /translation="MSKKASILVIQGPNLNLLGTREPDVYGKTTLEDIHQKLGELAKAQ
FT                   SVDLSTFQSNHEGELIDRIQKAKQDGVDFIIINPGAFTHTSVALRDVLAGVAIPFTEVH
FT                   LSNIHQREEFRKHSYLSDIANGVICGLGAIGYELALQAAIARLQR"
FT   gene            complement(210282..210809)
FT                   /locus_tag="Pnuc_0212"
FT   CDS_pept        complement(210282..210809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0212"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   reu:Reut_A2863 putative thioredoxin-related transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33433"
FT                   /db_xref="GOA:A4SVB9"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVB9"
FT                   /protein_id="ABP33433.1"
FT                   /translation="MNRRQWITITGISLLALFAGILSSRWISKTGLASDPSIKAFFANT
FT                   WQTPDGKVVDTKNWQGKVLVVNFWASWCPPCVEEMPALDKLQQEYLQKNVLFVGIGIDS
FT                   PSNIREFLQKTPVSYPIVIGGLEGSNLSKQMGNSQGALPYTVIISPNGKSTYTKLGKIS
FT                   EEELRKAINSAL"
FT   sig_peptide     complement(210735..210809)
FT                   /locus_tag="Pnuc_0212"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.956) with cleavage site probability 0.504 at
FT                   residue 25"
FT   gene            210836..212233
FT                   /locus_tag="Pnuc_0213"
FT   CDS_pept        210836..212233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0213"
FT                   /product="UDP-N-acetylmuramate"
FT                   /note="TIGRFAM: UDP-N-acetylmuramate; PFAM: cytoplasmic
FT                   peptidoglycan synthetase domain protein; cytoplasmic
FT                   peptidoglycan synthetases domain protein; Mur ligase,
FT                   middle domain protein; KEGG: bpm:BURPS1710b_3496
FT                   UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-
FT                   diaminopimelate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33434"
FT                   /db_xref="GOA:A4SVC0"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005757"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVC0"
FT                   /protein_id="ABP33434.1"
FT                   /translation="MHIHILGICGTFMGGIAAIARQAGHRVTGCDANVYPPMSTQLEAQ
FT                   GIELIEGFSPDQLLQFETMPDLFVIGNVVSRGNSLMEAILNQGLPYISGPQWLGEQVLY
FT                   GRHVLAVAGTHGKTTTSAMLTWILEFNGYKPGYLIGGVPLNFTVSARLGDSQYFVIEAD
FT                   EYDTAFFDKRSKFVHYRPRTALLNNLEFDHADIFADLAAIETQFHHLVRTVPGDGLLVV
FT                   NGEEVALERVITRGAWAPVERFGQDLENAWSLVSQASDGFIVRQHGKEVATVAWAPDSG
FT                   VMGRHNQLNALAAIAAANHIGISPKDSARALAEFKNVKRRLETIGVANGVTVYDDFAHH
FT                   PTAITTTVDGLRRRVGKARILAVLEPRSNTMKLGVMKAQLPGSLMAADKVFAYGASTGK
FT                   ESLGWDLPDVLSPLNQTEAGKALAFNDLDALVNVVAQEARPGDHILVMSNGGFGGVHQK
FT                   ILNAILA"
FT   gene            212253..212990
FT                   /locus_tag="Pnuc_0214"
FT   CDS_pept        212253..212990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0214"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: rme:Rmet_3057 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33435"
FT                   /db_xref="GOA:A4SVC1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVC1"
FT                   /protein_id="ABP33435.1"
FT                   /translation="MMGDRLKDKIAIVTGAAKGIGFATALRFAQEGAKVMIADINLEAV
FT                   KGAAAKIPNAEAYAMNVTDRASIQATVGEIMQRHGRIDILINNAGITQDARLIKMTEAQ
FT                   FDTVIDVNLKGVFNCTQLVVPHMLEAGSGAIVNASSVVGLYGNFGQTNYSATKFGVIGF
FT                   TKTWARELGPKGIRVNAVCPGFIATEMVKAMPENILQDIERRSWLGRLGTPEEMANVYL
FT                   FLASDEASYVNGVALEASGGISL"
FT   gene            212993..215023
FT                   /locus_tag="Pnuc_0215"
FT   CDS_pept        212993..215023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0215"
FT                   /product="ribonuclease II"
FT                   /note="PFAM: ribonuclease II; KEGG: rme:Rmet_3056
FT                   ribonuclease II"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33436"
FT                   /db_xref="GOA:A4SVC2"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVC2"
FT                   /protein_id="ABP33436.1"
FT                   /translation="MNLLYEEGGDIKIATVQSSTGTGDAESWQATSLSGKKIKIKAKEV
FT                   WLRFEKPEAQAVMDEAQVLSKDIDLQLLWDCAPDEEFGLVDVSLEYFGAQASIPQQVAL
FT                   AIALQGAPVFFRRKGRGRFQRAPLEQLQAGLAALERKQKELEQQAIWQKEMVAGNFPET
FT                   LRSSAQQLLFSPDKNTFAYKALIAACTETGESPPQLMIRCGAIDSPLAYHQGMFLKAHF
FT                   PNGSTHQNIGVDESTYAQAIAALPEADVKAFSIDDSGTTEIDDALSVSTLAAGGHRIGI
FT                   HIAAPGLAIAKDDPLDQVARNRMSTVYFPGDKITMLPDVVIEQFSLDEGSARPALSIYV
FT                   DIDEDGVVQRETLQMRAERVPMAANLRLEDLEHLVSEETLFDESENYPYRKELGILWQA
FT                   AKLLHAGRQEKRVANGLRAEQLGVIDPNALARDFYFQIQDQDGIQHVEIVPRQRGSILD
FT                   TIVAEWMIFCNSASGQLLADHGLPGLFRTQKGWGPLRTRMQTTPGPHEGLGLDYYAWCT
FT                   SPLRRYSDLVNQWQLIALAKHGVTAKMVAPFPPRDATLMGIAADFESCYQAYGEYQDRL
FT                   EKYWCLRWIAQDDDSKGVFVRHLKEGMSRLELVPLHLPVPELASHPRMTRAQVLISDVD
FT                   LLQLSAAVRVLEIEVKQDAPEKTVEVTPEASENSEEDAGTD"
FT   gene            215007..215894
FT                   /locus_tag="Pnuc_0216"
FT   CDS_pept        215007..215894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0216"
FT                   /product="TonB family protein"
FT                   /note="TIGRFAM: TonB family protein; KEGG: rso:RSc2778
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33437"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVC3"
FT                   /protein_id="ABP33437.1"
FT                   /translation="MLAQIKFFEFTCPDKLKGVYQYLQNTWQRHPLRLALCLSLLIHIL
FT                   FLSFRWGVGEVQNRRLNTPLSVVLVNASNKLPPKQANKLAQADLQGGGKTETQDATALH
FT                   RARMGAEARLEILEKQQRQMLAKLDEQRTQSRGRKSGDAQKMVSQLNSLEAELAKRLQV
FT                   EGREPRRKVMTGANTKAVTFAHYYDAMRQKIEAYGSAFFPRANGRPLYGSLVIVVSVDS
FT                   QGGITTNPQGKEGLSIGRSSGNPELDRQALAIVRSSAPFGPFPAEMRQQIDVLDWISTF
FT                   EFTRDGNDHLELRH"
FT   gene            215943..216848
FT                   /locus_tag="Pnuc_0217"
FT   CDS_pept        215943..216848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0217"
FT                   /product="shikimate dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="KEGG: bte:BTH_I1171 shikimate 5-dehydrogenase;
FT                   TIGRFAM: shikimate 5-dehydrogenase; PFAM: Shikimate/quinate
FT                   5-dehydrogenase; Shikimate dehydrogenase substrate binding,
FT                   N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33438"
FT                   /db_xref="GOA:A4SVC4"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVC4"
FT                   /protein_id="ABP33438.1"
FT                   /translation="MSSHTSIDLHTDPSVYSGLDVYAVAGNPIAHSKSPAIHQRFAQQA
FT                   GQQMYYGRLQPELNSFAQTAKSFFSAGGKGMNVTVPFKLDAQALADQVTARAQLAGAVN
FT                   TLWMVDGKIHGDNTDGAGFVRDLLAQGIVIGKSRILLLGAGGAARGVIGPLLEQSPKSV
FT                   VIANRSSAKADELIGLFANLAASKEVAIESRTLADLEDTQKTQHPFDLVINATAAGLSD
FT                   QSPLSAQAVSNVFMPSSFAYDMVYGKTTAFMQQALQRGARISDGLGMLVEQAADAFLLW
FT                   RGTQLASKIDPRSILAELRR"
FT   gene            216857..217594
FT                   /locus_tag="Pnuc_0218"
FT   CDS_pept        216857..217594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0218"
FT                   /product="monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /note="TIGRFAM: monofunctional biosynthetic peptidoglycan
FT                   transglycosylase; PFAM: glycosyl transferase, family 51;
FT                   KEGG: rme:Rmet_3053 monofunctional biosynthetic
FT                   peptidoglycan transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33439"
FT                   /db_xref="GOA:A4SVC5"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVC5"
FT                   /protein_id="ABP33439.1"
FT                   /translation="MRWLSYPIKCLCCAFLAMQLFFAIQIALWTTLDPSTTAFQRAERW
FT                   RLCGLHWSCPVYSTWTPYTQISNNLKRAVLVSEDDIFFQHKGVRVEDMQKAWEKNQQKT
FT                   QAGAKAKVALRGGSTITQQLAKNLFLSSEQNYFRKGQELIITGFLELILSKQRLFEIYL
FT                   NSVEWGEGIFGVGAASRHYYNTSPTVLDREQAAALASALPAPKCFDKQQYCRRGSINYS
FT                   SRQEFILENMDRVALAPYPKSGK"
FT   sig_peptide     216857..216940
FT                   /locus_tag="Pnuc_0218"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.762) with cleavage site probability 0.597 at
FT                   residue 28"
FT   gene            complement(217598..218443)
FT                   /locus_tag="Pnuc_0219"
FT   CDS_pept        complement(217598..218443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0219"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /note="TIGRFAM: orotidine 5'-phosphate decarboxylase; PFAM:
FT                   Orotidine 5'-phosphate decarboxylase; KEGG: rme:Rmet_3050
FT                   orotidine 5'-phosphate decarboxylase subfamily 2"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33440"
FT                   /db_xref="GOA:A4SVC6"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR011995"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVC6"
FT                   /protein_id="ABP33440.1"
FT                   /translation="MNSRSNTFHQQLQSAWASQGSMLCVGFDPDPKRLPLPLQGKSEGI
FT                   FEFCRDIADATADLVCAFKPQFAYFASQRAEAQLEKLIKHLKDKYPHIPVILDSKRGDI
FT                   GTTADHYALEAFDRYGADAVTVNPYMGFDTIEPYLRHAGKGVIVLCRTSNPGGSDLQFL
FT                   NTAPSGEPLYLHVAKLAAQEWNSSGQIGLVVGATFPDEIAKVRAIVGEMPLLIPGIGAQ
FT                   GGDIDATVKAGAIPGKPGIGMIINSSRAILYASSGADFAQAARNVALSTREDLRTATAK
FT                   "
FT   gene            218517..219482
FT                   /locus_tag="Pnuc_0220"
FT   CDS_pept        218517..219482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0220"
FT                   /product="magnesium and cobalt transport protein CorA"
FT                   /note="TIGRFAM: magnesium and cobalt transport protein
FT                   CorA; PFAM: Mg2+ transporter protein, CorA family protein;
FT                   KEGG: reu:Reut_A2853 magnesium and cobalt transport protein
FT                   CorA"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33441"
FT                   /db_xref="GOA:A4SVC7"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVC7"
FT                   /protein_id="ABP33441.1"
FT                   /translation="MINLFVLQNGRLSQEQVEDRNELLQYANPIWIDVVDPEEEELIWI
FT                   KEAFGVLLPELDDLGDLEASARYFEADDGHLHIRTDFLLDEEETSRNVRVAFVLTKNVL
FT                   FSIHDEDLPVFRLVRLRARLRPGSVSNAKDVLLDLYSTDAEYSADALEEVYENLEAAGK
FT                   QVLQDDINDADAEQVLETIAKEEDTNGRIRRNVMDTRRALSFLMRSKLLSDEQQEEARQ
FT                   ILRDIDSLENHTAFLFDKINFLMDATVGFINLNQSKIIKIFSVVSVALMPPTLLASIWG
FT                   MNYKNIPELDLSWGYPMALVAMLISAIIPLWYFHHKGWMK"
FT   gene            complement(219484..219978)
FT                   /locus_tag="Pnuc_0221"
FT   CDS_pept        complement(219484..219978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0221"
FT                   /product="CinA domain protein"
FT                   /note="PFAM: CinA domain protein; KEGG: lpf:lpl1767
FT                   competence/damage-inducible protein CinA C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33442"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVC8"
FT                   /protein_id="ABP33442.1"
FT                   /translation="MSTSETVLTLAAILKAKQWRLALAESCTGGLVCATLTELAGSSDW
FT                   FERGYVTYSNEAKTECLGVPAELIQSFGAVSEPVAKAMAEGAQLNAGVNAAISITGVAG
FT                   PSGGSAEKPVGTVCFAWAIQNDAGENRVPSKTMYFVGDRQAIREQACQYALSELAKILE
FT                   D"
FT   gene            complement(219975..220547)
FT                   /locus_tag="Pnuc_0222"
FT   CDS_pept        complement(219975..220547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0222"
FT                   /product="phosphatidylglycerophosphatase"
FT                   /EC_number="3.1.3.27"
FT                   /note="PFAM: phosphatidylglycerophosphatase A; KEGG:
FT                   pol:Bpro_4475 phosphatidylglycerophosphatase A"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33443"
FT                   /db_xref="GOA:A4SVC9"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVC9"
FT                   /protein_id="ABP33443.1"
FT                   /translation="MNQTPDQEVKPGFKWMIQTATRTLAFGFGSGLSPVAPGTAGTLWA
FT                   WAAFLLGEYLFTTEDFFWIIGGGILLGCWICGHVSEELGKKDFGGIVWDEMVAFWLVLI
FT                   FVMPTSIWMQIIAFILFRFFDAVKPGPIGMIDRHFKNIDSGNAPSTLLQILWRGFGIIV
FT                   DDLAAAFFTLLIFAAIQAITQQLGWVL"
FT   gene            complement(220544..221563)
FT                   /locus_tag="Pnuc_0223"
FT   CDS_pept        complement(220544..221563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0223"
FT                   /product="thiamine-phosphate kinase"
FT                   /note="TIGRFAM: thiamine-monophosphate kinase; PFAM: AIR
FT                   synthase related protein; AIR synthase related protein
FT                   domain protein; KEGG: rso:RSc2768 thiamine monophosphate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33444"
FT                   /db_xref="GOA:A4SVD0"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVD0"
FT                   /protein_id="ABP33444.1"
FT                   /translation="MHSPSNPIGEFDLIERFFKTGTSATEQNENIPLGIGDDCALIKQA
FT                   TDSEIAITTDMLVEGRHFFAGADPEQLGRKALAVNLSDLAAMGAEPLGFTLAIAMPKAD
FT                   IAWLEAFSKGLLDSANLYGCPLIGGDTTAGPLTLSITALGNIPQGKAIRRSGAKIEDDV
FT                   WVSGNVGDARLALAALRHEIPLSAEDLKQVEKRMHQPTPRIELGIGLRDIATAALDISD
FT                   GLLGDLNHVLKQSQVDAQIFLNQIPKSETLKKQSTDIQNQFAASGGDDYEICFTAPNHQ
FT                   REAIKKLSKSLDLPLTLIGRIIPIKNKNPQVHLINSDGATMSAIESKKLLQSFDHFSS"
FT   gene            221648..223969
FT                   /locus_tag="Pnuc_0224"
FT   CDS_pept        221648..223969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0224"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) (NADP(+))., Phosphate
FT                   acetyltransferase"
FT                   /EC_number="1.1.1.40"
FT                   /EC_number="2.3.1.8"
FT                   /note="PFAM: phosphate acetyl/butaryl transferase; malic
FT                   enzyme domain protein; malic enzyme, NAD-binding; KEGG:
FT                   rso:RSc2767 phosphate acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33445"
FT                   /db_xref="GOA:A4SVD1"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR032683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVD1"
FT                   /protein_id="ABP33445.1"
FT                   /translation="MSKENNKEQQIAALREAALQYHEFPVPGKIEIAPTKQLTNQRDLA
FT                   LAYTPGVAAPCEEIVKDPANAFKYTARGNLVGVITNGTAVLGLGNIGPLASKPVMEGKA
FT                   VLFKKFAGIDVFDIEVNENDPDKLVEIIAALEPTFGGINLEDIKAPDCFVVERKLQARM
FT                   KIPVFHDDQHGTAIVVAAAILNGLKVVGKDVGNVKLVTSGAGAAALACLDLLVDLGIPR
FT                   KNIWVTDLAGVAYKGRKELMDPEKEPFCQETDLRTLDQAIEGADIFLGLSAGGVLKPEM
FT                   VKKMADKPLVYALANPTPEILPEEVKAVRPDAVMATGRTDYPNQVNNVLCFPFIFRGAL
FT                   DVGATTITRGMEVAAVKAVAELAQAEQSEVVTSVYGIENLSFGPEYLIPKPFDPRLITV
FT                   IAPAVAKAAMDDGVALRPIKDFDAYRNQLQQFVYHSGTLMKPLFSIAKRVPANQKRIVF
FT                   AEGEDERVLRAVQIILDEHLATPILIGRPAVIEHRIEKFGLRMKAGDDFEIVNPENDLR
FT                   FRDFWQTYLGLTERKGVTQSFAKLEVRRRNSLIGSLLIEKGMADGMISGTVGNIATHLK
FT                   YIDEVIGHEEGANVYGAMSGLILPGRQVFLVDTHINIDPTAQQLSDLTLMAASEMRKLG
FT                   LIPKVALLSHSNFGSSNAPSAIKMREVLALLQKADPTLEVDGEMHGDSALDASIREGAV
FT                   SSSTLKGDANLLVLPNIDAANISYNLLKTAAGNGIAIGPLLLGVAKPIHILTPAATVRR
FT                   IVNVTTLAVVEAASNARGIS"
FT   gene            224098..224718
FT                   /locus_tag="Pnuc_0225"
FT   CDS_pept        224098..224718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0225"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rso:RSc2765 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33446"
FT                   /db_xref="InterPro:IPR000468"
FT                   /db_xref="InterPro:IPR035905"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVD2"
FT                   /protein_id="ABP33446.1"
FT                   /translation="MNNRSENTNTASFDEHSRAESWDSNDRLETESSAANIYAQGGLSR
FT                   LQTYAANQVSGKKVTASWRAALAVRDAGPPAMLRSVRTNIVQSIRAFRTPDLQEAATEL
FT                   GQHFIYANCANAMTKGEVLESIAIAYSFTKQQAKNFDPLLDALTTTIDKTGPQPGFVVV
FT                   LEGLPCTQKFDKEARETLLDVFRDAVDFWAERRTPYRVFYSFA"
FT   gene            complement(224748..225509)
FT                   /locus_tag="Pnuc_0226"
FT   CDS_pept        complement(224748..225509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0226"
FT                   /product="protein of unknown function DUF558"
FT                   /note="PFAM: protein of unknown function DUF558; KEGG:
FT                   rso:RSc2763 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33447"
FT                   /db_xref="GOA:A4SVD3"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVD3"
FT                   /protein_id="ABP33447.1"
FT                   /translation="MPQFYLPGPWESQKPTALTPEVAHHLRVRRIQVGETFPVFDGLGQ
FT                   VAQGELLSLSGKSGLAQLSNIRSDTHREAPYAITLAQGLAGGDKMDWIVEKAVETGAQI
FT                   IAPLQCERSILKLTRSSDLERAQKRLLHWEGIIQAACEQCDRTVLAKLEPIQTFSSYLQ
FT                   DGVKPKLKLLLSPDATQSLYSVLIENEPQNIILMIGPEGGHSPDEEKQAETAGYQLVSL
FT                   GERVLRTETAGVVAITAVHSVWGPEMQNRLK"
FT   gene            225575..227548
FT                   /locus_tag="Pnuc_0227"
FT   CDS_pept        225575..227548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0227"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /note="TIGRFAM: transketolase; PFAM: Transketolase domain
FT                   protein; Transketolase, central region; KEGG: rso:RSc2750
FT                   transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33448"
FT                   /db_xref="GOA:A4SVD4"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVD4"
FT                   /protein_id="ABP33448.1"
FT                   /translation="MANAIRALSMDAVQQANSGHPGMPMGMADIAVGLWNEHLKHNPTD
FT                   PHWIDRDRFVLSNGHGSMLLYSLLHLSGYDLPIEELKNFRQLHSKTPGHPEYGITPGVE
FT                   TTTGPLGQGISNAVGMALAEKLLAEEFNRPGMDIIDHYTYVFLGDGCLMEGISHEVCSL
FT                   AGTLKLNKLIALWDDNGISIDGKVVSWFNEDTPKRFEAYGWNVIRAVDGHDAEAVSAAI
FT                   AKAKKSDKPTLICCKTAIGQGSPNMAGSDKVHGSPLGAAEIAATRVALNWPYAPFEVPK
FT                   DIYTAWDFKKRGQAAEHEWNKEFQKYKNKYPELASELQRRMEGELSKDFSATLNAYLKT
FT                   CQSKAETIATRKASQNAIEALAPALPEFMGGSADLTGSNLTNWSTCKAVRADQWGNHIN
FT                   YGVREFGMSAIMNGIALHGGYIPFGGTFLTFSDYSRNALRMAALMKLRSIFVFTHDSIG
FT                   LGEDGPTHQSVEQVASLRLIPNLMVWRPCDTTESAVAWGAAIERKNGPSALIFSRQNCP
FT                   FVSRTAAQIKDIARGGYVLLDPQSGKVDAVIIATGSEIALALQTAQQLEKEGLGIRIVS
FT                   MPSTTVFDQQDAAYKSTVLPAKIPRIAVEAGVSDFWWKYGCAAVHGVDTFGESAPAPQL
FT                   YEYFGLTADQISKTVKQCIANK"
FT   gene            227574..228602
FT                   /locus_tag="Pnuc_0228"
FT   CDS_pept        227574..228602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0228"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /note="KEGG: mpt:Mpe_A0260 glycerladehyde-3-phosphate
FT                   dehydrogenase; TIGRFAM: glyceraldehyde-3-phosphate
FT                   dehydrogenase, type I; PFAM: glyceraldehyde 3-phosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33449"
FT                   /db_xref="GOA:A4SVD5"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVD5"
FT                   /protein_id="ABP33449.1"
FT                   /translation="MTIRVAINGYGRIGRMVLRALYEDQVNGKPRRDIKIVAINAMGDI
FT                   DINAHLTQYDSAHGRFPAEVSVDGDHMVVNGDRIKMFSTRNPLETPWGELGVDLVLECS
FT                   GKFTSKEKAMVHISQGAKKVLISAPGEKDVDATIVYGVNQNVLKPSDVVVSNASCTTNC
FT                   LAPLVKPLLEKIGIESGLMTTIHAFTNDQVLTDVYHKDMRRARSAVTSMIPTKTGAAKA
FT                   VGLVLPALAGRFDGFAMRVPVINVSVVDLTFAASRATSVDEVNSILKTASEGELKGILG
FT                   FNTLPLVSIDFNHDPRPSIYDASQTRVSADGKLVKVLAWYDNEWGYSVQMLNAAEALMA
FT                   VK"
FT   gene            complement(228696..229151)
FT                   /locus_tag="Pnuc_0229"
FT   CDS_pept        complement(228696..229151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0229"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: rso:RSc2747
FT                   probable ferric uptake transcriptional repressor
FT                   transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33450"
FT                   /db_xref="GOA:A4SVD6"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVD6"
FT                   /protein_id="ABP33450.1"
FT                   /translation="MTTNQNPTPENLRDIGLKATGPRMKILDFFHQNGGTHFSAEDIFM
FT                   ALAKDDQEIGLATVYRVLTQFEQAGLLLRSHFESSKGDSRAIYELNEGRHHDHLVCLDC
FT                   GHVEEFVDDAIEKRQQDIAKSLGFKLQEHSLAMYGHCTKKNCRNKQK"
FT   gene            229195..229944
FT                   /locus_tag="Pnuc_0230"
FT   CDS_pept        229195..229944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0230"
FT                   /product="SmpA/OmlA domain protein"
FT                   /note="PFAM: SmpA/OmlA domain protein; KEGG: reh:H16_A3142
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33451"
FT                   /db_xref="GOA:A4SVD7"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="InterPro:IPR026592"
FT                   /db_xref="InterPro:IPR037873"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVD7"
FT                   /protein_id="ABP33451.1"
FT                   /translation="MQNCLELFNRFFSHFLRGVSSSARAGYITLAIFGLLTVAGCTSAV
FT                   NDTQRAWMNYIFRPYVPDVVQGNFISSEQYAKLQLGMSREQVRQILGTPLLASYFHANR
FT                   WDYVFEFKRAGKRVGDERHVTVFFDGDKVVKFEGDALPTDVELVAEIDNYSKSKRSFWE
FT                   VITGTNKPPITPPLQQPEIMEPSPVDNLPAGTPLPAATSSSDSASSGSFWDFLSFSSKD
FT                   SATQPLPQSETLGPGDLNIPPASEAKQ"
FT   gene            230009..230812
FT                   /locus_tag="Pnuc_0231"
FT   CDS_pept        230009..230812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0231"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="PFAM: dihydrodipicolinate reductase; KEGG:
FT                   bch:Bcen2424_0651 dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33452"
FT                   /db_xref="GOA:A4SVD8"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVD8"
FT                   /protein_id="ABP33452.1"
FT                   /translation="MMKIAIAGATGRMGRMLIETVFNSPDAQLVGALEHNSCPQLGEDA
FT                   GSFLGKKTGVIISSDVAAVLANAEFLIDFTRPDGTMAHLAVAEKTGTKMIIGTTGLSSE
FT                   QIGDLKKASAKLAIVFAPNMSVGVNATFKLLEIAAKMLNEGYDIEIVEAHHRHKVDAPS
FT                   GTALKMGEVIAEALGEKLDDVAVYAREGHTGERKPGSIGFATIRGGDIVGDHTVLFAGD
FT                   GERIEISHKSSSRQSYAQGSLRAARFLQNQTFGLYDMQDVLGLRK"
FT   gene            230862..233534
FT                   /locus_tag="Pnuc_0232"
FT   CDS_pept        230862..233534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0232"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /note="TIGRFAM: leucyl-tRNA synthetase; KEGG:
FT                   reu:Reut_A2834 leucyl-tRNA synthetase
FT                   bacterial/mitochondrial, class Ia"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33453"
FT                   /db_xref="GOA:A4SVD9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SVD9"
FT                   /protein_id="ABP33453.1"
FT                   /translation="MSKDYDHRGIEAAAQADWERTQVYRVTENAVNASGKKKPKYYACS
FT                   MLPYPSGKLHMGHVRNYTINDVMARQLRMQGYNVLMPMGWDAFGMPAENAAIQNKVPPA
FT                   KWTYDNIAYMKKQMAAMGLAIDWSREVATCSPDYYRWNQWLFLKMLEKGVAYRKTQVVN
FT                   WDPIDQTVLANEQVIDGRGWRSGALVEKREIPGYYFNITAYAEQLLSGLDGLGWPERVK
FT                   TMQQNWIGKSRGVRFAFKHEIADAHGNFIQDGLLYVFTTRADTIMGVTFCAVAAEHPLA
FT                   SKAAENNPTLAAFIEKCKTGSVIEADLATQEKEGMFTGLYVTHPLTNESVPVWVGNYVL
FT                   MSYGDGAVMGVPAHDERDFAFALKYELPIKQVIALKDESPMFNGTHWQDWYAQKENVVC
FT                   FNSGKFDGLSHEEAVNTVASDLEKMGIGELKTTYRLRDWGISRQRYWGTPIPIIHCGDE
FT                   GNPGCGAVPVPEADLPVVLPEDCVPDGSGNPLNKRADFLNVKCPQCGKPARRETDTMDT
FT                   FVDSSWYFMRYTGPDATSMVDGRNEYWMPMDQYIGGIEHAILHLLYARFWTKVMRDLDL
FT                   ITFDEPFQNLLTQGMVLNETYYSEEASGKKTWLNPLDVELDLDEKGRPQGAKLKGDSSG
FT                   TPVIIGGVEKMSKSKNNGVDPQALIDQYGADTARLFVMFAAPPEQQLEWSGAGVDGASR
FT                   FLRRVWMYSSSQASAIKDAQDALPSTLNDAEKELRREVHAILKQANFDYQRRQYNTVVS
FT                   AAMKMLNVLEPIKLGQDSPISASVLRECLSILLRVLYPVVPHLTHVLWKDMGYSENFGS
FT                   LLDAPWPTVDETALIQTEITLMLQINGKLRGELKVPADASKEQIEAIALQSEPATKALN
FT                   GGAPKKVIVVPGRLINIVA"
FT   gene            233553..234080
FT                   /locus_tag="Pnuc_0233"
FT   CDS_pept        233553..234080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0233"
FT                   /product="rare lipoprotein B precursor"
FT                   /note="KEGG: reh:H16_A3138 rare lipoprotein B precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33454"
FT                   /db_xref="GOA:A4SVE0"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVE0"
FT                   /protein_id="ABP33454.1"
FT                   /translation="MNINLPRRGLLGVIAIVPLAGLLACGFRIRGMVDLPFKAIAITGS
FT                   VSPPLRGDIQTAILTGTDAKVAINPKDADLILDITNDVSGREILAYGSTGQVSAYRLSI
FT                   RVGFRAYDTSGADIVPESEIYMTRDMDFSNSTVLATDVQQAQFLTQMRKDLAVQILRRV
FT                   SASARAPQTKAF"
FT   sig_peptide     233553..233627
FT                   /locus_tag="Pnuc_0233"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.778) with cleavage site probability 0.739 at
FT                   residue 25"
FT   gene            234096..235157
FT                   /locus_tag="Pnuc_0234"
FT   CDS_pept        234096..235157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0234"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, delta subunit; PFAM:
FT                   DNA polymerase III, delta; KEGG: rso:RSc2742 probable DNA
FT                   polymerase III (delta subunit) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33455"
FT                   /db_xref="GOA:A4SVE1"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032780"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVE1"
FT                   /protein_id="ABP33455.1"
FT                   /translation="MVKVDALQTHLKSLNAGGVMGSLYIFSGDEPLLMMEAMDQLRSVA
FT                   KKLGFTEREVLLQERGFDWSALLNAGQTMSLFGDKRWVELRIPTGKPGRDGADALKQFA
FT                   AQMESQANSSDGPDTVVCIVLPRLDGKTKTSAWFSALDDAGMAIQIDSLDRGHLPHWIS
FT                   GRLKKQEQEVEGGPEGQRALEFIADQVEGNLIAAHQEILKLGLLYPSGTLTEEQVRSSI
FT                   LKVARYNVFELTEAMLAGDLPRLNRMLDGLKGEGEPLVLILWSVTEELRLLSKLKMASD
FT                   AGESMQQLMRANRIWGNKERLYPSALKRIQPLKLRRAMQVAAGLDRQVKGLSAAELPAD
FT                   PWDGLRLVGNLLR"
FT   gene            235204..236493
FT                   /locus_tag="Pnuc_0235"
FT   CDS_pept        235204..236493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0235"
FT                   /product="glutamate-5-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.41"
FT                   /note="KEGG: reu:Reut_A2831 gamma-glutamyl phosphate
FT                   reductase GPR; TIGRFAM: gamma-glutamyl phosphate reductase;
FT                   PFAM: aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33456"
FT                   /db_xref="GOA:A4SVE2"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SVE2"
FT                   /protein_id="ABP33456.1"
FT                   /translation="MSTEKTSAIKEMMQDIGKCARSASRAMARASSEQKNQALLHIAKV
FT                   VRQKSEEIQQVNQVDVERAKVNGQDAAFIDRLTMTPKTIETMALGLEQIVLLDDPIGKI
FT                   GTLKKQASGIELGQMRVPLGVIGIIYESRPNVTIDAAALCLKSGNAVILRGGSEAIDSN
FT                   TLLAQIIQEGLAAAGLPKDAVQVVTITDRAAVGEMITMTQYIDVIVPRGGKSLIARLMA
FT                   EARVPMIKHLDGICHTYIDADADIAMAIKVCDNAKTQRYAPCNAMETLLVNRDIAPKVL
FT                   PSLCKVYQDKGVELRVDALTRQTLEQNGFQNLVDATEADWQTEYLAPILSIKTVADIDE
FT                   AMNHIEHYGSKHTDAIITNNKAQADRFLREVDSASVMVNASTRFADGFEYGLGAEIGIS
FT                   NDKLHARGPVGLDGLTSLKYVVLGHGEIRT"
FT   gene            236537..236962
FT                   /locus_tag="Pnuc_0236"
FT   CDS_pept        236537..236962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0236"
FT                   /product="conserved hypothetical protein 701"
FT                   /note="PFAM: conserved hypothetical protein 701; KEGG:
FT                   bbr:BB3690 putative conserved inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33457"
FT                   /db_xref="GOA:A4SVE3"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVE3"
FT                   /protein_id="ABP33457.1"
FT                   /translation="MTNSYLWVKTFHIVLITSWFAGLFYLPRIYVNLAEEKNPEVYARL
FT                   LGMADRLFRFMTILAIPAVLLGLVLFLGFGIGKGEVWMHAKLLFVILVIGYHHACWSLL
FT                   KKFRAGVNTKSNVWYRWFNEVPVILLLVIVALVIFKP"
FT   gene            237009..238466
FT                   /locus_tag="Pnuc_0237"
FT   CDS_pept        237009..238466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0237"
FT                   /product="putative RNA methylase"
FT                   /note="PFAM: putative RNA methylase; THUMP domain protein;
FT                   KEGG: bxe:Bxe_A4003 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33458"
FT                   /db_xref="GOA:A4SVE4"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVE4"
FT                   /protein_id="ABP33458.1"
FT                   /translation="MRFFVVCPGGLEVPLAQELAEIAQRPDSKALGAWVIDPTPTSPTG
FT                   GVGLAGPLSAAMALNLHSRIASRVLLQMAQAPYRQEEDLYKLASGLAWEDWFTSKQTLR
FT                   VDVTAHRSPLKSLNFATLKIKDAIVDRLRDVTGDRPSIDTAFPDVRVQAHLTATQVTIY
FT                   LDTSGEALFKRGWRDEKGDAPLKENLAAGILSITGWKSGEILFDPMCGSGTFLIEAAQK
FT                   TLAIPPGAIRAGMYGDDAKPSRLAYRPLVTSVHGFGFQRLKPFNEVAEQKRWAALKEGS
FT                   LNEILAQRKQYPSAESLRISGGDINEKLVAMFKGNWQRAQLPEQPVVRQIDALASRPPV
FT                   NSDSGVMLLNPPYGERLVIKGGRGQDRNAQESYDESEEPENRFELNLETGRQSAKRSSR
FT                   ESLKKLQAQEEQDPKFVEFLRQFGQHLKEAFGGWNIFVLTADMALPGQLRIKESKRTPL
FT                   FNGPLECRLFKFEMHAKRSVANDSEKE"
FT   gene            238523..238693
FT                   /locus_tag="Pnuc_0238"
FT   CDS_pept        238523..238693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0238"
FT                   /product="Rubredoxin-type Fe(Cys)4 protein"
FT                   /note="PFAM: Rubredoxin-type Fe(Cys)4 protein; KEGG:
FT                   rme:Rmet_0668 rubredoxin-type Fe(Cys)4 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33459"
FT                   /db_xref="GOA:A4SVE5"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024922"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVE5"
FT                   /protein_id="ABP33459.1"
FT                   /translation="MEFKTYMCLICGWVYDEAAGLPEEGIAPGTLWKDVPMNWTCPECG
FT                   ARKEDFEMMAI"
FT   gene            238706..240010
FT                   /locus_tag="Pnuc_0239"
FT   CDS_pept        238706..240010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0239"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /EC_number="5.4.3.8"
FT                   /note="TIGRFAM: glutamate-1-semialdehyde-2,1-aminomutase;
FT                   PFAM: aminotransferase class-III; KEGG: reu:Reut_A2625
FT                   glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33460"
FT                   /db_xref="GOA:A4SVE6"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SVE6"
FT                   /protein_id="ABP33460.1"
FT                   /translation="MTKRDQNEVLFERAQKTIPGGVNSPVRAFRQVGGTPRFISKAKGP
FT                   YFWDAENKRYIDLIMSWGPMIAGHANPEVVEAVQKAAETSFSYGAPTEGEIELAERICA
FT                   LVPSIEQVRMVSSGTEATMSALRLARGYTNRDLIIKFEGCYHGHADSLLVKAGSGLLTF
FT                   ADSTQNAPSSGGVPQDLVKHTLVLPYNDVEAIEAVFKKQGNEIAAVILEPIAGNMNLIK
FT                   PSAEFLKALRDLTSQYGSVLIYDEVMTGFRVALGGAQSLQGIVPDLTCLGKVMGGGMPM
FT                   AAFGGKKEIMSKLAPLGNVYQAGTLSGNPVAVAAGLKTLEIVSRAGFYECLSAQTEKLM
FT                   LGLKQGADKSGIPFAVDSVGGMFGFYFADAVPSTYEAVTKTNIDAFKKFFHLMLDEGVY
FT                   LAPSAYEAGFTSIAHDDAVLQVIIDAAEKSFPQLR"
FT   gene            complement(240027..240866)
FT                   /locus_tag="Pnuc_0240"
FT   CDS_pept        complement(240027..240866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0240"
FT                   /product="Bis(5'nucleosyl)-tetraphosphatase, ApaH"
FT                   /note="KEGG: reh:H16_A2910 putative serine/threonine
FT                   phosphatase; TIGRFAM: bis(5'-nucleosyl)-tetraphosphatase
FT                   (symmetrical); PFAM: metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33461"
FT                   /db_xref="GOA:A4SVE7"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVE7"
FT                   /protein_id="ABP33461.1"
FT                   /translation="MSKIYAVGDVQGCGPSLKNLVKKIPKKSKLIFLGDLVNRGPDSLG
FT                   ALRQLKSLQEAGRAECVLGNHDLHLLAIDAGIRKTKGLDTVESILKAPDRAELLDWVRN
FT                   RPLALSNGKVLTVHAGVLPQWDLQQTIECAHEVEKVLRGKSYKRFLENMYGNTPNQWSN
FT                   SLKGYERLRAITNSLTRMRFCTPNGKMEFESKEGLNAAPKGYVPWFKVPKRKTRDTLVY
FT                   FGHWSTLGLLREQNVIGLDTGCVWGGKLTAMEIPDSNKDSKDLEIIQVDGYDHPLRM"
FT   gene            complement(240900..242378)
FT                   /locus_tag="Pnuc_0241"
FT   CDS_pept        complement(240900..242378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0241"
FT                   /product="deoxyribodipyrimidine photo-lyase type I"
FT                   /EC_number="4.1.99.3"
FT                   /note="PFAM: DNA photolyase, FAD-binding; DNA photolyase
FT                   domain protein; KEGG: bxe:Bxe_B2844 deoxyribodipyrimidine
FT                   photolyase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33462"
FT                   /db_xref="GOA:A4SVE8"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVE8"
FT                   /protein_id="ABP33462.1"
FT                   /translation="MQKGLVWLRRDLRLYDNAALHYALKESKQVWVTFIFDEEILKPLL
FT                   KGELDAQRLKHDRRVDFIWQGLEQIDEELRKQGGGLIVRFGKPVECIPQIAKDLGVDTV
FT                   FTNHDYEPSAIARDEAVKTLLAKSDIQFESFKDQVIFEKKEILTNSNTVFSIFTPYKNN
FT                   WLKTLQEKDLVAYECSAKPGQFAAIPKKLAQEIPTLESMGFCKTGIEAYLPPGAEGGQA
FT                   FLEDFLPRIDQYQVGRDFPAIKGVSYLSTHLRFGMLSIRGLVREAHRRMLAGSMGATIW
FT                   LSELIWRDFYFMILANHPRLAKGASFKPDYDNIVWEQGSVAKKLFAAWCEGKTGYPLVD
FT                   AAMHQLNQSGYMHNRLRMVVASFLTKDLGVDWRWGEAYFAEHLNDFELSSNNGGWQWAS
FT                   SSGCDAQPYFRIFNPITQSEKFDPEGKFIRRYLPQLNHLSKKSIHAPWKAGHIELEAAG
FT                   ITLGRDYPLPVVDHDEARKKTLVRYSVVKKVTEA"
FT   gene            242455..243273
FT                   /locus_tag="Pnuc_0242"
FT   CDS_pept        242455..243273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0242"
FT                   /product="protein of unknown function DUF218"
FT                   /note="PFAM: protein of unknown function DUF218; KEGG:
FT                   nwi:Nwi_1708 protein of unknown function DUF218"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33463"
FT                   /db_xref="GOA:A4SVE9"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVE9"
FT                   /protein_id="ABP33463.1"
FT                   /translation="MDTIFFIFSKVVQFCIEPLNWVIIFVSLSLLFLSLRKPHLCKRFL
FT                   LLTLFDLLIVGWLPSSEVFLRALENAVPKTNLSQIADSDIGGIIILGGAIQSGMIGLDR
FT                   GEVPLQSSAERVTKALELIRKYPNLPFIFSGYSGRLNPKGLSEADAFKQLIAEQGLSQE
FT                   TEKTAHYENQSRNTYENVLYLRPMMQDFGARSESGAIQPWLLITSASHMYRAEKIFQMQ
FT                   GIEVIPVPVDYQTANSLNWTSFDLEDGTQNWHKLVHEVVGLLAYWITGKL"
FT   gene            243296..243928
FT                   /locus_tag="Pnuc_0243"
FT   CDS_pept        243296..243928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0243"
FT                   /product="protein of unknown function DUF179"
FT                   /note="PFAM: protein of unknown function DUF179; KEGG:
FT                   rso:RSc0675 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33464"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVF0"
FT                   /protein_id="ABP33464.1"
FT                   /translation="MSTANKAPYDSDPGSLISYSADHLANQFLIAMPGMVDANFAGSVI
FT                   YLFEHNARGAMGLVVNKPTEVDLATLFDKIELKLEIAPLLEQPVYFGGPVQIERGFVLH
FT                   ESNKNLSYSSSLIIPGGLTMTTSKDVLEAVAIGNGPRKFLMTLGYAGWSAGQLEEEITL
FT                   NGWMNVPLSREQMMEIIFNTPPSQRYEKTMNHLGFDLSHLSGEAGHA"
FT   gene            243921..244337
FT                   /locus_tag="Pnuc_0244"
FT   CDS_pept        243921..244337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0244"
FT                   /product="Holliday junction resolvase YqgF"
FT                   /note="PFAM: Holliday junction resolvase YqgF; SMART:
FT                   Resolvase, RNase H domain protein fold; KEGG:
FT                   bpm:BURPS1710b_3169 conserved hypothetical protein
FT                   TIGR00250"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33465"
FT                   /db_xref="GOA:A4SVF1"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVF1"
FT                   /protein_id="ABP33465.1"
FT                   /translation="MPKSITVMAFDYGTRRVGVAVGNSVTQLGQALKTIAAANSEILFL
FT                   EVASLLKEWQPDQLVVGRPLHPDGTPHEMTAKASRFGNQLHGHFALPVSWVDERYTSAI
FT                   LEGDAKMQDNLDAHSAALILEQYFAEQPNTNESN"
FT   gene            244354..244857
FT                   /locus_tag="Pnuc_0245"
FT   CDS_pept        244354..244857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0245"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG: bte:BTH_I1464
FT                   pyrimidine operon regulatory protein PyrR"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33466"
FT                   /db_xref="GOA:A4SVF2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVF2"
FT                   /protein_id="ABP33466.1"
FT                   /translation="MNAEPLYDKLLGVLRTRLERGSFELAGLAMGGAWIAERLAQDLSL
FT                   QHYGIINVAFHRDDYAEKGMTALRTASTMSTHLPFDVNGAHIILIDDVLFTGRTVRAAL
FT                   NELFDFGRPAQVELMVLADRGNRELPVVANFVGENIEVPDHQILVLEKDNAGKFSFQLE
FT                   ERAE"
FT   gene            244854..245834
FT                   /locus_tag="Pnuc_0246"
FT   CDS_pept        244854..245834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0246"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /note="TIGRFAM: aspartate carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase, Asp/Orn-binding
FT                   region; aspartate/ornithine carbamoyltransferase,
FT                   carbamoyl-P binding domain; KEGG: rme:Rmet_2740 aspartate
FT                   carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33467"
FT                   /db_xref="GOA:A4SVF3"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SVF3"
FT                   /protein_id="ABP33467.1"
FT                   /translation="MSSENNAGANLVNQFNAAGELTHLLTLEGLPKEQILHILDTAQQF
FT                   VSVTDPSREVKKVPLLRGKSVFNLFFENSTRTRTTFEIAAKRLSADVINLDISTSSTAK
FT                   GESLLDTIDNLVAMQADIFVVRHSVSRAPIEIANHVPTHVHVVNAGDGSHQHPTQGLLD
FT                   MYTMRHFKQNFKGLKVAIVGDIVHSRVAKSNIHALTTLGCEDIRVIGPESLLPSDLDML
FT                   GVKVYHSMEEGLKDVDVVMTLRIQKERMEAGQVPEGDAFFNQYGLTPTRLALAKSDAIV
FT                   MHPGPMNRGVEIDSVVADGPQSVILNQVTFGIAVRMAVMSIVAGN"
FT   gene            245868..247199
FT                   /locus_tag="Pnuc_0247"
FT   CDS_pept        245868..247199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0247"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gsu:GSU2251 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33468"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVF4"
FT                   /protein_id="ABP33468.1"
FT                   /translation="MSEKKSWLILSHGFNMDGRASSQTITDKIPYLLEAGIQPIVFSAI
FT                   TGIQDQRFPHRRFLAWGPAAFRFDFRHWIANQYGRGFIYKLLTRTVSIVLAPFIGLEKL
FT                   ILGYSSQWSWAMPAFIHGLGLVRSGKVDLVFSTGGAWSAHLAGLWLKKWTGIAWIAEIH
FT                   DPLVIRKNPNDQGFEQPKNRDARFRHYLERQLTKYADHVWWFTDGAVHYAKVRNPNLNT
FT                   PENAHGFMVLPGAEPPGGVTAEKPHRYSEKLNLCHFGSLANDRSLSTILNALVPLLEKY
FT                   PVARDHIQVHAYGAALDPLTIQAIKTLGFNDVLLAHGRLEKDPITGKSGREQVLEKMQE
FT                   ADVLILLHGNDEWCAEYIPSKFYEYLWTGRPIWGITHRNPQLDQMLEERGAYLSQEGDA
FT                   IGIATALERIWLDWKQQKLHQPLGSPMGVDQAVRKILTEIQWQS"
FT   gene            247205..248116
FT                   /locus_tag="Pnuc_0248"
FT   CDS_pept        247205..248116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33469"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVF5"
FT                   /protein_id="ABP33469.1"
FT                   /translation="MGSELKDLVLYCKSYRNDFLRLKRLLSSIEQFNSEKLPFYISTPR
FT                   ADKAELVQAIGNAGYLWVADEDIVVANPRAPFEKYQAMPGGLSQAIVKSEFWRLGLAEN
FT                   YLCLDSDCVFIRPFGRADFMTPEGVPLTVLHQNKEYFQLSVDRGQLKVMQNLQEEAQRV
FT                   QGLFGRVGPEFYCAPAPFIWSAKVWESLDRECLQPKGITLWDMVTPQYPETLIYGEALL
FT                   KYRAIPLLAIEPLFRVYHYDWQYFLLKRLGETEEKLKTNFLGVLYQSNWESNLSFGEKQ
FT                   KSLPSRILKNIKRTLRQLQSYL"
FT   gene            248117..248836
FT                   /locus_tag="Pnuc_0249"
FT   CDS_pept        248117..248836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0249"
FT                   /product="glycosyl transferase, family 25"
FT                   /note="PFAM: glycosyl transferase, family 25; KEGG:
FT                   hhe:HH0323 glycosyl transferase, family 25"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33470"
FT                   /db_xref="GOA:A4SVF6"
FT                   /db_xref="InterPro:IPR002654"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVF6"
FT                   /protein_id="ABP33470.1"
FT                   /translation="MSDIQALVISLAGSDSRQEKVRAELGKTHLEWRFLDAVRGSALVE
FT                   VPAEYKPEKVKALLGFELTPNELGCFLSHKKAWQECVDKNIPTIIFEDDFYFLPHFEEA
FT                   IHFLSTQCNDWDAIRLQGLSDVPQECILENGQMSLVRNVGDAVGATAYLLKPTAAKKLI
FT                   AASNDIYEPLDHFLEHYQKHHVEFLAISPYPVDITRVQSTIADRPERLPIKGWAKLKRS
FT                   ILRTLDRQFSENPWFPK"
FT   gene            complement(248848..249906)
FT                   /locus_tag="Pnuc_0250"
FT   CDS_pept        complement(248848..249906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33471"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVF7"
FT                   /protein_id="ABP33471.1"
FT                   /translation="MKIGFHTNGLSLRGTEIALYDYARNNQDILGNQSVVFYRKNSSVE
FT                   QSVYEKFSKQFSLRPYDGQTELNHLIEQEKIDLTYFIKSGERDDAICESSPSVIHAVFP
FT                   TKPEEFHGDKYAFVSQWLSKEYSNNKIPFVPHMIELPNHDGNLRKELNIPETATVLGWY
FT                   GGSDSFNLDFVKKEVLAAVQKRKDLYFLFMNMAPFAQHERLLFLPGNSDLIYKVNFINT
FT                   CDGMLHARGIGESFGLACGEFSIKGKPVITYALSPQRSHIEILGDKAILYKGRKDLASI
FT                   FEHYSRDVQREKNWDAYSQNFCAKEIMRKFDEVFIQGGKREDISISSFDRLIIQKHRFE
FT                   RKIRNLQKKLYL"
FT   gene            complement(249910..250854)
FT                   /locus_tag="Pnuc_0251"
FT   CDS_pept        complement(249910..250854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0251"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hpa:HPAG1_0636 alpha 1,3-fucosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33472"
FT                   /db_xref="GOA:A4SVF8"
FT                   /db_xref="InterPro:IPR001503"
FT                   /db_xref="InterPro:IPR038577"
FT                   /db_xref="InterPro:IPR041058"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVF8"
FT                   /protein_id="ABP33472.1"
FT                   /translation="MRSVRISTTGCPSDYSRGLFPIIAQSLGYQLHWVKPTEADLLILG
FT                   PFLNGGRKKLSWCPKPLRPTMQSMINLVPARNHEPLRVFHSAENLRHDTVASDYSITFE
FT                   LNITSSNHFRLPYWMEMIDWSHEGVVGNANPRYGHLMKIERLMQPLGERFLEKPKAAAF
FT                   LSSHIREPRKTLFEAVQKVMPVTGFGAHFNRNIKNHHLSGFLKQELLQEFGFNLCPENG
FT                   MYPGYYTEKIPEAFFADCLPISWTDENVKVDFNPNAFINLAPMSWCNYTPLAEIINTPK
FT                   LLEGYSSQALLLKAPSIEPFKNFVKNILEDACS"
FT   gene            250877..251644
FT                   /locus_tag="Pnuc_0252"
FT   CDS_pept        250877..251644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33473"
FT                   /db_xref="InterPro:IPR019290"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVF9"
FT                   /protein_id="ABP33473.1"
FT                   /translation="MAEHLDPYSVVITTFDKRFDAFFVPLLAQIKSQRPNIEVIVTING
FT                   PAKSSFDEGYRAHILSYLAQFPQVFPTMFPSFQSLAKMWNRGALNTSHNRALVLNDDLE
FT                   LKTENGVSFFDGLETALASQAGTFKINGSFSHFILDKRELIDVGFFDERLLGLGEEDGD
FT                   FFWRFYKKYKKEIPSVDIGLIDNVQSDLADDGYTKGIRTASKFNRDFLQTQKYKNTLLG
FT                   GYRGMFDKKVNQILEDEKQYPYESFYLENKNKL"
FT   gene            251688..252746
FT                   /locus_tag="Pnuc_0253"
FT   CDS_pept        251688..252746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0253"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /note="TIGRFAM: dTDP-glucose 4,6-dehydratase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; short-chain
FT                   dehydrogenase/reductase SDR; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; polysaccharide biosynthesis
FT                   protein CapD; dTDP-4-dehydrorhamnose reductase; Male
FT                   sterility C-terminal domain; KEGG: cvi:CV4010 dTDPglucose
FT                   4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33474"
FT                   /db_xref="GOA:A4SVG0"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVG0"
FT                   /protein_id="ABP33474.1"
FT                   /translation="MILVTGGAGFIGGNFVLDWLANSNAEGIVNLDKLTYAGNLATLDS
FT                   LKDDARHVFIHGDIGDKELVTKLLTQYKPRAIVNFAAESHVDRSIHGPAEFVQTNIVGT
FT                   FNLLECAREYWNSLDGAEKEQFRFHHVSTDEVYGSLSAADPAFTETNSYEPNSPYSASK
FT                   AASDHLVRAWFHTYSFPVVTTNCSNNYGPYHFPEKLIPLVILNALNGKPLPIYGDGQQV
FT                   RDWLYVGDHCSAIREVLAKGKLGETYNIGGWNEKANIDVVKIICQILDQLKPRADGKSY
FT                   AEQITFVKDRPGHDRRYAIDASKVERDLGWRPAETFDTGIRKTVQWYLENPAWIEGVVS
FT                   GSYRDWLQKQYN"
FT   gene            252748..253707
FT                   /locus_tag="Pnuc_0254"
FT   CDS_pept        252748..253707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0254"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   dTDP-4-dehydrorhamnose reductase; KEGG: reh:H16_A1850
FT                   dTDP-4-dehydrorhamnose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33475"
FT                   /db_xref="GOA:A4SVG1"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVG1"
FT                   /protein_id="ABP33475.1"
FT                   /translation="MKVLVFGKDGQLGKAFQQVFSALTPPHPIHVEFLGRAECDLCNPE
FT                   AIATTLDKFKPNIIINSSAYTAVDKAETEVDLAYAINARAPELMAAYAAEHGATFLHYS
FT                   TDYVFDGEKYGFYLEDDVRSPLGVYGKSKAAGEEGIARIFANSKLGQYAILRTSWVYGD
FT                   GGNFIRTILRLAKEREELKVIADQYGVPTSAQWLAQVSLGLTLNQDGSIKHFPSGIYHA
FT                   VPAGETTWHGLATLAVSAAIKAGVALKVQPGLIKPIPATEYPLPAPRPANSRMSTDKLQ
FT                   SALGGSRSYNEAQQSPEFPQWEQMVQEYVSRLASRGEI"
FT   gene            253734..254663
FT                   /locus_tag="Pnuc_0255"
FT   CDS_pept        253734..254663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0255"
FT                   /product="Glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /note="TIGRFAM: glucose-1-phosphate thymidylyltransferase;
FT                   PFAM: Nucleotidyl transferase; KEGG: reu:Reut_A0714
FT                   glucose-1-phosphate thymidylyltransferase, long form"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33476"
FT                   /db_xref="GOA:A4SVG2"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVG2"
FT                   /protein_id="ABP33476.1"
FT                   /translation="MTVNRKGIILAGGSGTRLYPVTQAVSKQLMPVYDKPMVYYPLTTL
FT                   MLAGIRDILLISTPHDTPRFAELLGDGSQWGLNIEYCVQPSPDGLAQAFTLGKHFVGNN
FT                   PSALVLGDNIFYGHELVDQLDSANDRASGATVFAYHVNDPERYGVVEFDQHYKALSIEE
FT                   KPLKPRSSYAVTGLYFYDNQVCDIAASIKPSARGELEITDVNRVYLEKNELSVEIMGRG
FT                   FAWLDTGTHDSLLDAAGFIATLQKRQGLMVACPEEIAYRQGWISAETVQKVAAQLSKNS
FT                   YGQYLSKIVNELNNSAQPISLSTKKANK"
FT   gene            254660..255214
FT                   /locus_tag="Pnuc_0256"
FT   CDS_pept        254660..255214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0256"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="KEGG: eba:ebA2275 dTDP-4-dehydrorhamnose
FT                   3,5-epimerase; TIGRFAM: dTDP-4-dehydrorhamnose
FT                   3,5-epimerase; PFAM: dTDP-4-dehydrorhamnose 3,5-epimerase
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33477"
FT                   /db_xref="GOA:A4SVG3"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVG3"
FT                   /protein_id="ABP33477.1"
FT                   /translation="MKLKVTPTAIHDVLVIEPTVFGDERGWFTESFNAVDFADATGLTV
FT                   NFVQDNHSFSRQWTLRGLHYQLEKTQGKLVRVVAGSVFDVAVDIRKESPTYGKWVGIEL
FT                   SAQNHKQLWVPPGLAHGFLVLSETAEFLYKTTDYYHPQSEACLVWNDPTVAIAWPLPEG
FT                   VNPNMNAKDMSGLAWDAAPKF"
FT   gene            255216..256244
FT                   /locus_tag="Pnuc_0257"
FT   CDS_pept        255216..256244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0257"
FT                   /product="lipopolysaccharide heptosyltransferase I"
FT                   /note="TIGRFAM: lipopolysaccharide heptosyltransferase I;
FT                   PFAM: glycosyl transferase, family 9; KEGG: rme:Rmet_2715
FT                   lipopolysaccharide heptosyltransferase I"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33478"
FT                   /db_xref="GOA:A4SVG4"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011908"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVG4"
FT                   /protein_id="ABP33478.1"
FT                   /translation="MKSLPPKILLVKLSSLGDVLHNLPIVWDIRARLPDAQIDWVVEEA
FT                   YVHLLQPLLSRGNFKGIDRIIPFSLRRWKKSLFSLTSWRQFFSFKKELQKVTYDVVIET
FT                   QGLLKSAFVCALAKKTSDAVVAGLANATEYSGYEPLARLFYNQSVQVPFQCHAVDRSRY
FT                   VLCSALNWPLINRDERAQFYPSSYVDAVLHQSPSNFKSPYILFFHSTAREAKRWSNENW
FT                   IYLGNELAGQGYQVILPWGNASEKVVSNELASKIKGAMVPKPFSVQEAFLIVGNAALVV
FT                   GVDTGLTHLAAVMNKPTIEIYCDSPRWKTEGYWSNHIRNVGDIQDPPSGAVVLAAATEL
FT                   LQ"
FT   gene            complement(256267..257886)
FT                   /locus_tag="Pnuc_0258"
FT   CDS_pept        complement(256267..257886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0258"
FT                   /product="type I secretion outer membrane protein, TolC
FT                   family"
FT                   /note="TIGRFAM: type I secretion outer membrane protein,
FT                   TolC family; PFAM: outer membrane efflux protein; KEGG:
FT                   reh:H16_A2879 cation/multidrug efflux system outer membrane
FT                   porin"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33479"
FT                   /db_xref="GOA:A4SVG5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVG5"
FT                   /protein_id="ABP33479.1"
FT                   /translation="MTPARFRHSRLTIFGLLLSQALGLNSWYSNALAQTPTGAARSALP
FT                   SLVSPSSLTGLDQPPQIAPLPKQALPSQDAPSYLGNGKQNSQGQLTDLIALYQDAAFSD
FT                   PVLTAARFNYQASKELYWQGLSLLLPQAIATPGATRYYQHGAGTTVVSTGPGNSRVFDQ
FT                   KSYTVTLTQPVFNVGALEAFKQGDLNTKIADMNFFQAQQDLILRVSQAYFDALTSQDNV
FT                   TLYRNKKDLIKQQLDVAQAKFDAGLATIVDVNTAQASYDLTVSQEIAAQADLVVKKGIL
FT                   EQLVGHPVGPLKPLVKQAKIDGVLKDPRSKSKDNKTTPLVESVNPQLPPGQTLEDWINQ
FT                   TEAANFKVLASQLSVSLAESTYRASMALNYPSLNLVGTSGYNTSNGTPNSYTPSQTNVY
FT                   NNTLGLQLSIPLVSGGYNTSVIRQNSALVDSAKANYDNARRTAAQNTRAAFTGFYGGLA
FT                   SVKAFEAAERSSESAVESSRLGFQVGTLINIDVLIAVDTLFTTRSQLQQARYNTILNAL
FT                   RLKASASTLTDEDLLAINSLMR"
FT   sig_peptide     complement(257785..257886)
FT                   /locus_tag="Pnuc_0258"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.911 at
FT                   residue 34"
FT   gene            257938..258849
FT                   /locus_tag="Pnuc_0259"
FT   CDS_pept        257938..258849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0259"
FT                   /product="Undecaprenyl-diphosphatase"
FT                   /EC_number="3.6.1.27"
FT                   /note="KEGG: reu:Reut_A0757 undecaprenyl pyrophosphate
FT                   phosphatase; TIGRFAM: putative undecaprenol kinase; PFAM:
FT                   Bacitracin resistance protein BacA"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33480"
FT                   /db_xref="GOA:A4SVG6"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVG6"
FT                   /protein_id="ABP33480.1"
FT                   /translation="MVNLDQFCQIFFISSYTYKICPMELILLIKAVILGVVEGLTEFLP
FT                   ISSTGHLILVGDLLDFNDERGKAFEVIIQFGAILAVCWEFREKLLKVACSLTSNANSRR
FT                   FFLNLLIASAPAMGLGFVFGKHIKAILFSPVPVATAFIVGALIIFWAERRQEKIGTTST
FT                   HIHTVDDLSYLDALKVGIAQCAALIPGTSRSGATIIGGMLFGLPRVVATEFSFFLAIPV
FT                   IGGATAYELLKLWKAPVTISGDYGLAIGVGFVAAFISAFICVRWLIHYVAHHNFIPFAW
FT                   YRIVFGLLVLVTSYSGLIAWSH"
FT   gene            258885..259343
FT                   /locus_tag="Pnuc_0260"
FT   CDS_pept        258885..259343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0260"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="KEGG: azo:azo2606 conserved hypothetical membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33481"
FT                   /db_xref="GOA:A4SVG7"
FT                   /db_xref="InterPro:IPR021279"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVG7"
FT                   /protein_id="ABP33481.1"
FT                   /translation="MDVSIDAITNNIQLALAPVFLLTAVATLINAISGRLARTVDRMRS
FT                   IHTAIYVGSVKDEKTLLNMRKEAEEAKTRGRLCTAAIFFDVLSGVFISLTVLELFFFQA
FT                   GAVRSLQTSYVIWTFVLGLISFMTSLSIVLAEVVYAYRSAGWNISRHY"
FT   gene            259368..260303
FT                   /locus_tag="Pnuc_0261"
FT   CDS_pept        259368..260303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0261"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility C-terminal
FT                   domain; KEGG: xft:PD1543 dTDP-glucose 4-6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33482"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVG8"
FT                   /protein_id="ABP33482.1"
FT                   /translation="MNKILITGGAGFLGSHLTEKLLKEGNDVLVVDNYFTGTKENLAHL
FT                   LPNPKLELMRHDVTFPLYVETNQIYNLACPASPVHYQYDPVQTTKTSVHGAINMLGLAK
FT                   RTRARILQASTSEVYGDPEVHPQPEEYWGKVNPIGIRSCYDEGKRCAETLFFDYNRQHN
FT                   LDIKVVRIFNTYGPRMHPNDGRVVSNFIVQALQGKDITIYGDGQQTRSFCYVDDLIDAM
FT                   VKMMNSEDGFTGPVNIGNPGEFTMLQLAETVLKLSGSKSKIIHQPLPSDDPKQRQPNIE
FT                   LAKAKLGWEPKVNLEDGLKETIAYFRKVVA"
FT   gene            260305..261120
FT                   /locus_tag="Pnuc_0262"
FT   CDS_pept        260305..261120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0262"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="KEGG: bxe:Bxe_A0859 conserved hypothetical protein
FT                   91; TIGRFAM: tRNA (guanine-N(7)-)-methyltransferase; PFAM:
FT                   putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33483"
FT                   /db_xref="GOA:A4SVG9"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVG9"
FT                   /protein_id="ABP33483.1"
FT                   /translation="MTEQVNSKPGVQRFERIRSFVLRAGRTTAGQQRAIDELGPQFLLP
FT                   YQDQILNLVDAFAGSTKPKILEIGFGMGETTAKIAALRSEDDFLAIEVHPPGVGALLKL
FT                   IGENQLTNLRLIRHDAVEVLENMIAPNSLDGIHIYFADPWHKKRHHKRRLIQAEFVKLL
FT                   VSRLKSGGYLHLATDWHNYAEQMLLVLNAEPTLQNTSAEKVKVETFTPEDIAPEGSEKD
FT                   LKEFKPSAEQLSSEHPGYVERPAYRPTTKFENRGIKLGHGVWDLVYRKK"
FT   gene            complement(261149..262621)
FT                   /locus_tag="Pnuc_0263"
FT   CDS_pept        complement(261149..262621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0263"
FT                   /product="succinate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /note="KEGG: mpt:Mpe_A2324 succinate-semialdehyde
FT                   dehydrogenase (NAD(P)+); TIGRFAM: succinic semialdehyde
FT                   dehydrogenase; PFAM: aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33484"
FT                   /db_xref="GOA:A4SVH0"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVH0"
FT                   /protein_id="ABP33484.1"
FT                   /translation="MQKIDIRSFLKDPSLFKEQAFINGQWVGSKENFNVQNPATDELIA
FT                   SVSNLGPQDAELAIAAAEKALPAWRNKTGKERAHIMRKWFDLITESTQDLATIMTLEQG
FT                   KPLAEAAGEVAYGASFVEWFAEEAKRVAGSIPATTWGDKRMMVLKQPIGVCVAITPWNF
FT                   PIAMITRKVAPALAAGCTIVIKPAELTPLSALALAELAIRAGIPDGVINILTADANQSI
FT                   LIGKTLCASPTVRHLSFTGSTEVGRILMGQCAPTVKKLALELGGHAPFIVFDDADIDAA
FT                   VIGAIASKFRNSGQTCVCANRFYVHKKVHDQFVEKFAQAITKIKVGNGMEPGVTQGPLI
FT                   ETAALEKAEKHVADAISKGAKLVTGGKPTTQGKNFYEPTILANVNSDMLITQEETFGPV
FT                   APIIPFENDEEAVALANNSPFGLASYFYSRDIGRIWKVAEALDYGMVGVNTGLITNEVA
FT                   PFGGVKQSGLGREGSAYGMDEYLEMKYVCVGL"
FT   gene            complement(262776..263300)
FT                   /locus_tag="Pnuc_0264"
FT   CDS_pept        complement(262776..263300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0264"
FT                   /product="NusB antitermination factor"
FT                   /note="TIGRFAM: transcription antitermination factor NusB;
FT                   PFAM: NusB/RsmB/TIM44; KEGG: mfa:Mfla_0493 NusB
FT                   antitermination factor"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33485"
FT                   /db_xref="GOA:A4SVH1"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVH1"
FT                   /protein_id="ABP33485.1"
FT                   /translation="MSKLIPTPSQLAVGKETKVDAKSAAPKRSLTPRRRAREYALQGVY
FT                   QSLVMRRAGSLPNAAAIAKQLGEDPAFRRCQLDLFQGIFDGVLERTDELEAIITPALDR
FT                   PINELSPVEHAALLIGAYELAIDLSVPYKVAINEAVELAKTFGGTDGHKYVNGVLDLLA
FT                   QKLRSAEIQAG"
FT   gene            complement(263305..263817)
FT                   /locus_tag="Pnuc_0265"
FT   CDS_pept        complement(263305..263817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0265"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="2.5.1.9"
FT                   /note="PFAM: 6,7-dimethyl-8-ribityllumazine synthase; KEGG:
FT                   bxe:Bxe_A0892 6,7-dimethyl-8-ribityllumazine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33486"
FT                   /db_xref="GOA:A4SVH2"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SVH2"
FT                   /protein_id="ABP33486.1"
FT                   /translation="MTNSNNDFVGVLEADLNGQDLRIGIVQARFNEEHCVALSTACITE
FT                   LLALGVTQADIKLVTVPGALEIPFALQKLAATGEFDGLVALGAVIRGETYHFELVSNES
FT                   AAGITRISIDSGLPIANGVLTCETDEQASVRVNLKGADCAKAVVEMANLALALTPDFDI
FT                   EVNAGEE"
FT   gene            complement(263847..264992)
FT                   /locus_tag="Pnuc_0266"
FT   CDS_pept        complement(263847..264992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0266"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /note="PFAM: 3,4-dihydroxy-2-butanone 4-phosphate synthase;
FT                   GTP cyclohydrolase II; KEGG: reu:Reut_A0770
FT                   3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33487"
FT                   /db_xref="GOA:A4SVH3"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVH3"
FT                   /protein_id="ABP33487.1"
FT                   /translation="MPNKLAPTEEIIAELRAGKMVILVDEEDRENEGDLVLAADHVTAE
FT                   AVNFMAKHGRGLICLTLTRERCQQLNLPLMVRDNGTSMGTNFTVSIEAATGVTTGISAA
FT                   DRALTIKTAVAPNAKPSDLVQPGHIFPLMAQPGGVLIRSGHTEAGCDLAAMAGCSPTAV
FT                   ICEIMKDDGSMARLPDLLKFAEEHQLKIGSIADLIQYRSQHESIVVREGQREFVTPWGK
FT                   FQGIIYRDTPSSCIHIALVHGQPSEAQETLVRVHEPVTVLDFLDADVSTHSWPLAKALE
FT                   QLANSPAGVAVLLNASGIAAPNDADWLAQFQKLNQTQDETKIPLTRKTDFRSYGIGAQI
FT                   LKDIGVGKMRLLANPSPTPSLSGYKLEVTGYAPYQPVTKPA"
FT   gene            265276..265968
FT                   /locus_tag="Pnuc_0267"
FT   CDS_pept        265276..265968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33488"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVH4"
FT                   /protein_id="ABP33488.1"
FT                   /translation="MLTRLRVVIQIAAILFIKAQKMSLLECLVGIALCTILLTPLLQSA
FT                   ADLVVHQIQYEKKQLLISEADRAFEIIGRAIRIAGYRNIKSSHLASNKAQIQWIELSKR
FT                   VGFRGSDAITVRHELSDGIDFDCIGNNLTVDRTKNHLALQGFLVDRQASAPKGVKANGG
FT                   SLICQSLDRQGRLQNTTLMNGVNTLLIEELDVAKDSGERLFKVGLEMTDGASLNLRLER
FT                   TFRTRNLL"
FT   sig_peptide     265276..265413
FT                   /locus_tag="Pnuc_0267"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.900) with cleavage site probability 0.829 at
FT                   residue 46"
FT   gene            265965..266294
FT                   /locus_tag="Pnuc_0268"
FT   CDS_pept        265965..266294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33489"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVH5"
FT                   /protein_id="ABP33489.1"
FT                   /translation="MILAWVISLLLLCSSLVIHLEKLTALRIIELNTIEFSQKKLMASE
FT                   KAILDCQNNLSHLSQLQDNACFIEPTGKNQWRISSKEKPTIQVYVNMDETTGFITRLNW
FT                   RQVFE"
FT   gene            266344..266853
FT                   /locus_tag="Pnuc_0269"
FT   CDS_pept        266344..266853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33490"
FT                   /db_xref="GOA:A4SVH6"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVH6"
FT                   /protein_id="ABP33490.1"
FT                   /translation="MAVILIIAILAVITMPLLQQQIAVREIDTVARRFIAHAHFARQQA
FT                   LHLGEPVRLSPHPLNHWESGWVVSSGCIGKTVLARCIPKPWFSQGKIDPVYFKGGGKQF
FT                   TDPHTGKLGILFNAAGAAKTAQGGFVANRLILGHHRLVDLERQLILGSGGRWRICDPQR
FT                   DAKRCH"
FT   gene            266870..267985
FT                   /locus_tag="Pnuc_0270"
FT   CDS_pept        266870..267985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0270"
FT                   /product="5-amino-6-(5-phosphoribosylamino)uracil
FT                   reductase"
FT                   /EC_number="1.1.1.193"
FT                   /note="KEGG: rme:Rmet_2688 riboflavin biosynthesis protein
FT                   RibD; TIGRFAM: riboflavin biosynthesis protein RibD; PFAM:
FT                   CMP/dCMP deaminase, zinc-binding; bifunctional
FT                   deaminase-reductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33491"
FT                   /db_xref="GOA:A4SVH7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVH7"
FT                   /protein_id="ABP33491.1"
FT                   /translation="MYSAVDHQWMGEALGEAQKALYLANPNPRVGCVIVKDGQVIGRGH
FT                   TQRVGGAHAEIQAIADAKANGKDIAGSTIYVTLEPCSHTGRTPPCVNALVVARPAKVIV
FT                   SMLDPNPLVSGGGLARLTDAGIEVQCGLLESEAQAINRGFISRMTRGLPWVRMKIAASL
FT                   DGKTALPNGQSQWITGPLARADGHHWRAQACAIVTGVGTVKEDDPSLNVREVSTHRQPW
FT                   RIIVDSKLETPPNAQILNDLQDSGVIIVCAALDDVDKVAKAKQFQKRGIEVIAFANPQG
FT                   KVDLPKLFTYLAQEREMNEIHIESGFKLNGSMLREGCVDELLLYYAPFFMGEGIGMANV
FT                   PTLPNLSTREDWRILDQSMIGTDLRIRLIKN"
FT   gene            267995..268612
FT                   /locus_tag="Pnuc_0271"
FT   CDS_pept        267995..268612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0271"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /note="TIGRFAM: riboflavin synthase, alpha subunit; PFAM:
FT                   Lumazine-binding protein; KEGG: pna:Pnap_2916 riboflavin
FT                   synthase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33492"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVH8"
FT                   /protein_id="ABP33492.1"
FT                   /translation="MFTGIITAVGQIKSTQPKGDGLHLVVEVPDGYLDDVALGDSIAIQ
FT                   GACMTATNFEGNTFALDISRESLNKTIGLDKTGPVNLEKALRLNDRLGGHLVSGHVDGV
FT                   GKVTHFSQVANDAYGSWLLRIEAPKSLAGFLAYKGSIVVNGVSLTVNKTADSASACVVD
FT                   INLIPHTLQSTTLGMLRQGDAVNLEVDLIARYVARMLETQAK"
FT   gene            complement(268640..269380)
FT                   /locus_tag="Pnuc_0272"
FT   CDS_pept        complement(268640..269380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0272"
FT                   /product="preQ(0) biosynthesis protein QueC"
FT                   /note="TIGRFAM: exsB protein; PFAM: ExsB family protein;
FT                   KEGG: reh:H16_A2826 predicted PP-loop superfamily ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33493"
FT                   /db_xref="GOA:A4SVH9"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SVH9"
FT                   /protein_id="ABP33493.1"
FT                   /translation="MSSLSAAYQNLAPRKDGAPAVILFSGGLDSTTVLALAKDLGYTPY
FT                   ALSVGYGQRHSSELAAAKHIAKQIGVARHEVVNLDLTRFGGSALTDSSIAVPTTPGKDQ
FT                   EIPVTYVPARNTILLSLALGWAESLGGLDVFYGANSVDYSGYPDCRPEYVASFETMANL
FT                   ATKAGVEAINNENRFRVHAPIISLTKAEIIQLGSTLGVDYSQTVSCYQANDLGEACGEC
FT                   ESCRLRQIGFKQANVIDPTRYQKK"
FT   gene            complement(269389..270120)
FT                   /locus_tag="Pnuc_0273"
FT   CDS_pept        complement(269389..270120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0273"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein; KEGG:
FT                   reh:H16_A2827 hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33494"
FT                   /db_xref="GOA:A4SVI0"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR014162"
FT                   /db_xref="InterPro:IPR032519"
FT                   /db_xref="InterPro:IPR034706"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVI0"
FT                   /protein_id="ABP33494.1"
FT                   /translation="MKTSSQAFKQTLSRAFCLSAAVICLGASNSAWALFSDDEARKAIL
FT                   DLRKSLATTQLELQGEIDKLKTENAELRGKLENLEKQGEDISSSQKTYYQDLDTRLGNF
FT                   EPRTITIEGLSGTVQPGEKKAYDDALKAFQAGNLKKADEGFSAFAAKYPKSPYLPLALY
FT                   WSGNSKYANKDYAGAISQLQSLIKRYPNHPRIPAAMVTLGNSQLESGNKAAAKKTFSEI
FT                   IAKYPDTDAAKDAQQLMAATK"
FT   sig_peptide     complement(270019..270120)
FT                   /locus_tag="Pnuc_0273"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.927 at
FT                   residue 34"
FT   gene            complement(270121..270624)
FT                   /locus_tag="Pnuc_0274"
FT   CDS_pept        complement(270121..270624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0274"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: reh:H16_A2828
FT                   outer membrane protein or related peptidoglycan-associated
FT                   (LipO)protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33495"
FT                   /db_xref="GOA:A4SVI1"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR014169"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039001"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVI1"
FT                   /protein_id="ABP33495.1"
FT                   /translation="MKVSIARRAATFALIGATAFLMAACSSVKLDDVDGANGSGGSGSY
FT                   GSQPWNDPKSPLFEKSVYFGFDEYTVQTKYQKMLSAHASYLKANPKQKIIIQGNTDERG
FT                   TAEYNLALGQRRSDAVRKSLNLMGVSDDQMEAVSFGKEKPKAEGDSEAAFAENRRADIV
FT                   YITN"
FT   sig_peptide     complement(270532..270624)
FT                   /locus_tag="Pnuc_0274"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.522 at
FT                   residue 31"
FT   gene            complement(270770..272080)
FT                   /locus_tag="Pnuc_0275"
FT   CDS_pept        complement(270770..272080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0275"
FT                   /product="TolB, N-terminal domain protein"
FT                   /note="PFAM: peptidase S9B, dipeptidylpeptidase IV domain
FT                   protein; TolB, N-terminal domain protein; WD40 domain
FT                   protein beta Propeller; KEGG: rme:Rmet_2675 TolB-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33496"
FT                   /db_xref="GOA:A4SVI2"
FT                   /db_xref="InterPro:IPR007195"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR014167"
FT                   /db_xref="InterPro:IPR036752"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVI2"
FT                   /protein_id="ABP33496.1"
FT                   /translation="MLQSMNKMILKLLSLSAIVAALLCGFATPALAQMNIEITGVGQSL
FT                   YPIAVMRFKDENKLPTNITEIIRQDLARSGYFKNTENGNATESDEGTPNYKSWAARGAD
FT                   ALVVGSVVQTGNGQFDIHYKLFDIRKSQGLGGLNLNSSADNLRAVAHKIADDIIFKLLG
FT                   ERGVFSTRLSYVIKDGKRYRLVISDADGQNIRNAMNSSEPIISPSWSPDGKKVAYVSFE
FT                   DRKPVIYVHELATGRRISLSNQKGNNSAPAWSPDGKKLAVSLSKDGNTQIYGINADGSG
FT                   LHRLTRGNTIDTEPQYSADGRYIYFTSDRGGNPQIYRMSAEGEQVEGAKRVTFKQGFVT
FT                   SPRISPDGKYLAYIANVGGAYRLYILNLATGDSQALTDGTSDESPSFAANGRYVLYSTK
FT                   VGGKRVLAAVSVDGNSKQVLSIPGSDVRQPSWGPFMD"
FT   sig_peptide     complement(271982..272080)
FT                   /locus_tag="Pnuc_0275"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 33"
FT   gene            complement(272084..272935)
FT                   /locus_tag="Pnuc_0276"
FT   CDS_pept        complement(272084..272935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0276"
FT                   /product="Cell division and transport-associated protein
FT                   TolA"
FT                   /note="TIGRFAM: TonB family protein; TonB, C-terminal
FT                   domain; KEGG: reh:H16_A1671 hypothetical membrane
FT                   associated protein; TC 2.C.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33497"
FT                   /db_xref="GOA:A4SVI3"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVI3"
FT                   /protein_id="ABP33497.1"
FT                   /translation="MNSAQTFPSSSAPFKRGRFTKQESTKRAFTFSLIAHLGLLAFLMI
FT                   GISWNNSTPAGVEVELWDSAPQVETPPEPELKTAIKEEAADIALKKKPVEKEPPKKVEA
FT                   AKETPKPVKPVPPKEKEKPKPVEKVKPVETPKKAEAPKKVEAVSPAETKANAAAEKVRA
FT                   DQLARLRAAAGAEGGKGGTVGSGVGGGGNAPPGWTDKVIKKVKPLIVFNPESVSGNPAA
FT                   VIQVSLAPDGAILSTSILSSSGNASWDRAVLLALSRAESLPKDDNGKIPQREVKLTFKP
FT                   KD"
FT   gene            complement(272960..273379)
FT                   /locus_tag="Pnuc_0277"
FT   CDS_pept        complement(272960..273379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0277"
FT                   /product="Cell division and transport-associated protein
FT                   TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   bxe:Bxe_A3918 biopolymer transport protein ExbD/TolR; TC
FT                   2.C.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33498"
FT                   /db_xref="GOA:A4SVI4"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014168"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVI4"
FT                   /protein_id="ABP33498.1"
FT                   /translation="MAGSSLRKNKRRAMSDINVVPYIDVMLVLLVIFMVTAPMVNPGVV
FT                   NLPTVGGAKVQSLPPVFLTIDANENVIVRKDGDPVQTLNKFELGAFARSQAEKSADQPI
FT                   VIAADKTIKYETVMDVMSKLKENGIKRVGLAVKTQ"
FT   gene            complement(273389..274045)
FT                   /locus_tag="Pnuc_0278"
FT   CDS_pept        complement(273389..274045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0278"
FT                   /product="Cell division and transport-associated protein
FT                   TolQ"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   bam:Bamb_0680 MotA/TolQ/ExbB proton channel; TC 2.C.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33499"
FT                   /db_xref="GOA:A4SVI5"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014163"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVI5"
FT                   /protein_id="ABP33499.1"
FT                   /translation="MTSTQDLSFLSLVLNASLLVQLVMLLLLGMSVASWTIIFKKTAVL
FT                   RGVRQDTERFERDFWSGGDLNTLLEAAQRNTRSDAVLEHIFEAGMQEFMKVHEIDAARR
FT                   AMKATYQREMDTLEANLPFLASVGSVSPYIGLFGTVWGIMHSFRGLANVQNATLSAVAP
FT                   GIAEALIATAIGLFAAIPAVVAYNRAATDVDRLSIRFETFIEEFTNILQRQNSGR"
FT   sig_peptide     complement(273944..274045)
FT                   /locus_tag="Pnuc_0278"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.868) with cleavage site probability 0.715 at
FT                   residue 34"
FT   gene            274122..275366
FT                   /locus_tag="Pnuc_0279"
FT   CDS_pept        274122..275366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0279"
FT                   /product="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="PFAM: glycine hydroxymethyltransferase; KEGG:
FT                   tbd:Tbd_2165 glycine/serine hydroxymethyltransferase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33500"
FT                   /db_xref="GOA:A4SVI6"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SVI6"
FT                   /protein_id="ABP33500.1"
FT                   /translation="MFDRQNTLAKTDPQLWAAIQNENKRQEDHIELIASENYTSPAVME
FT                   AQGSQLTNKYAEGYPGKRYYGGCEFVDVAEQLAIDRVKALFGAEAANVQPHCGASANQA
FT                   VFLAFLKPGDTFMGMSLAEGGHLTHGMALNMSGKWFNPIAYGLDKNEEIDYEQMERLAR
FT                   EHKPKLIIAGASAYSKKIDFERIGKLAKEVGAIFMVDMAHYAGLVAAGVYPNPVPHADI
FT                   VTSTTHKSLRGPRGGIILMKAEHEKAINSAVFPGLQGGPLMHVIAGKAAAFKEAAEPGF
FT                   KDYQKQVVANAKALAETLIARGLRIVSGGTDSHVMLVDLRAKKMTGKEAEHVLGEAHIT
FT                   CNKNGIPNDPEKPMVTSGIRLGSPAMTTRGFKEAEAVQVGNFIADVLDNPNDPENIAKV
FT                   RAQVAELTKRFPVYG"
FT   gene            275392..275838
FT                   /locus_tag="Pnuc_0280"
FT   CDS_pept        275392..275838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0280"
FT                   /product="ATP-cone domain protein"
FT                   /note="PFAM: ATP-cone domain protein; KEGG: rme:Rmet_2681
FT                   protein of unknown function DUF193"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33501"
FT                   /db_xref="GOA:A4SVI7"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SVI7"
FT                   /protein_id="ABP33501.1"
FT                   /translation="MRCPFCHNDDTQVLDTRVSDEGDTIRRRRRCAKCDKRFTTYERVE
FT                   LVLPAIVKKNGSRVEYSHDKLASSLKLALRKRPVSSDSVDESIARIEEKLLSLGEKEIP
FT                   SERVGELVMRELKRLDKVAYIRFASVYRSFADIESFESALKELK"
FT   gene            complement(275921..276586)
FT                   /locus_tag="Pnuc_0281"
FT   CDS_pept        complement(275921..276586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0281"
FT                   /product="Adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="PFAM: adenylate kinase; adenylate kinase, lid domain
FT                   protein; KEGG: rso:RSc2533 adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33502"
FT                   /db_xref="GOA:A4SVI8"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SVI8"
FT                   /protein_id="ABP33502.1"
FT                   /translation="MRLILLGAPGAGKGTQAQFICEKFAIPQISTGDMLRAAVKAGTEF
FT                   GVAAKKIMDAGGLVSDDIIIGLVKDRLTQPDCSKGYLFDGFPRTIPQAQAMKDAGVPID
FT                   YVLEIDVPFDAIIDRMGGRRVHPASGRTYHIKYNPPKVEGKDDVTGDALIQRDDDKEET
FT                   VRKRLQVYDDQTRPLVEYYSSWAAQANAADKVKAPAYRKVSGTGSVEDITTSIFAQLK"
FT   gene            complement(276690..277454)
FT                   /locus_tag="Pnuc_0282"
FT   CDS_pept        complement(276690..277454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0282"
FT                   /product="3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.38"
FT                   /note="KEGG: reu:Reut_A0591 3-deoxy-manno-octulosonate
FT                   cytidylyltransferase; TIGRFAM: 3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase; PFAM: acylneuraminate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33503"
FT                   /db_xref="GOA:A4SVI9"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SVI9"
FT                   /protein_id="ABP33503.1"
FT                   /translation="MSTAPKAPDFLVVIPARLGSTRLPRKPLADIGGKPMVVRVAERAK
FT                   QSLAHSVIVATDSPEIQAACDEHRIECLLTSPDHPTGTDRIAEVAQLLKLPSNALVVNV
FT                   QGDEPLIPPELINQVAQTLAEHPQCAISTVAVLISEPSEIDNSNVVKVVLNREGEALYF
FT                   SRAPIPYVRDPQELIKTEHLRHLGIYAYRADFLQAYTRLDPAPPEQAEALEQLRALWNG
FT                   YRIAVHTAPEAPPAGVDTLDDLERVRQLLGNT"
FT   gene            complement(277467..277649)
FT                   /locus_tag="Pnuc_0283"
FT   CDS_pept        complement(277467..277649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0283"
FT                   /product="protein of unknown function DUF343"
FT                   /note="PFAM: protein of unknown function DUF343; KEGG:
FT                   ppr:PBPRA2383 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33504"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVJ0"
FT                   /protein_id="ABP33504.1"
FT                   /translation="MMDKRLLDILVCPLCKSQLHLDTEKHELICKADRLAYPIRDDVPV
FT                   MLVDEARSLSADEVA"
FT   gene            complement(277718..278809)
FT                   /locus_tag="Pnuc_0284"
FT   CDS_pept        complement(277718..278809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0284"
FT                   /product="lipid-A-disaccharide kinase"
FT                   /EC_number="2.7.1.130"
FT                   /note="KEGG: rso:RSc2530 tetraacyldisaccharide 4'-kinase;
FT                   TIGRFAM: tetraacyldisaccharide 4'-kinase; PFAM:
FT                   Tetraacyldisaccharide-1-P 4'-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33505"
FT                   /db_xref="GOA:A4SVJ1"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SVJ1"
FT                   /protein_id="ABP33505.1"
FT                   /translation="MSFSLFRKAPKFWERRGPTSLLLWPLSWLYGLILRARKLIHDLGI
FT                   VRTKPTPVPIIIVGNIRVGGTGKTPIVIALAKRLSQLGWKPGIISRGYGSSSQTAPLLV
FT                   RSDSSPSLVGDEPVLIAKRTDNQFPIWVYPKRQQSIQALLKHSPEVDVIISDDGLQHRG
FT                   LTRWPAREGGRDIEFVVRDSRGEGNRFLLPAGPLREPATRDRDATLFTGNPSFNEKKTG
FT                   ILDEYFLGRRAFSLGTYLGRPYQLIDHANTQSLEQIAEQFLPKSMTAIAGLGNPQRFFD
FT                   DLAKQGVTCKQIPLPDHAQYTPEFFAKVKAQCLLITEKDAVKCAEISDERIWVVPMSLH
FT                   LPENFVEWLQSILQRPDPHRYTL"
FT   gene            complement(278830..279279)
FT                   /locus_tag="Pnuc_0285"
FT   CDS_pept        complement(278830..279279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0285"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   aav:Aave_2565 biopolymer transport protein ExbD/TolR"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33506"
FT                   /db_xref="GOA:A4SVJ2"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVJ2"
FT                   /protein_id="ABP33506.1"
FT                   /translation="MSWLDTHPHSRKRFSLGASSVSTEPEINLIPFIDVLLVILIFLMI
FT                   STTFTRYQELAISLPSANGSENQAEVKQIHIAVSRDGRFAINGKVINPTQMSTALMQLT
FT                   EQGGNNLQVNIDADAKAPHQAVMTALEAARDANLSNIVFSSQTKK"
FT   gene            complement(279304..279942)
FT                   /locus_tag="Pnuc_0286"
FT   CDS_pept        complement(279304..279942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0286"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   reh:H16_A0608 biopolymer transport channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33507"
FT                   /db_xref="GOA:A4SVJ3"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVJ3"
FT                   /protein_id="ABP33507.1"
FT                   /translation="MYSILLSAGWPIWPLLIISIIGLAIVIERSWYLRQIHIFPKGSLE
FT                   LTFGMCNQIANQKNVSEAQVTELAQLSPATPLFACVLKEKLSGSSAAVALEELQALAQA
FT                   TWLKLDRYLGALATIATVAPLLGLFGTVVGMIEIFGSQGAVNGVAGSPQELAHGISVAL
FT                   YNTAFGLLIAIPALAAWRGLRAMANQRQRECEEFTRQLFKKLYPSDAAQ"
FT   gene            280257..281483
FT                   /locus_tag="Pnuc_0287"
FT   CDS_pept        280257..281483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0287"
FT                   /product="Exodeoxyribonuclease VII large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="KEGG: bur:Bcep18194_A5875 exodeoxyribonuclease VII;
FT                   TIGRFAM: exodeoxyribonuclease VII, large subunit; PFAM:
FT                   Exonuclease VII, large subunit; nucleic acid binding,
FT                   OB-fold, tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33508"
FT                   /db_xref="GOA:A4SVJ4"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVJ4"
FT                   /protein_id="ABP33508.1"
FT                   /translation="MSEMTREILSVGDLNRAIAASLEDRFDTVWVSGEISNFKAYDSGH
FT                   WYFSLKDEEGQIRCVMFRGRNGQVGFMPQSGDLVEVSASLGMYVPRGDIQLTIQTLRRA
FT                   GMGGLYEAFLKLKAKLAKEGLFDEGRKREIPTHPRSIGIITSPQAAALKDVLSTLARRA
FT                   PHIPIVIYPTLVQGPDASAGIIKALKAAEKEQAVDVILLVRGGGSIEDLWAFNDEQLAY
FT                   AIAQSSIPVVSGVGHETDFTIADFVADLRAPTPTGAAELAAPRKDQMLQELEAIKQALL
FT                   QRINQRIEREAQTLDQLALRLSHALPNPDRMREQIAGWQQRLNQAWSVRMENWKRNQTY
FT                   YQSQLEMLNPQRTLERGYAVILNKENDQLHAVRNPAELNTQNTYQIRLAGGRVDIRVAE
FT                   VAKANSDSK"
FT   gene            281532..282581
FT                   /locus_tag="Pnuc_0288"
FT   CDS_pept        281532..282581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0288"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_3563 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33509"
FT                   /db_xref="InterPro:IPR022550"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVJ5"
FT                   /protein_id="ABP33509.1"
FT                   /translation="MINSFYKPLSLTAQTAYAELQDQLRIHNIDRLRVLPGAFHKQTQK
FT                   GKSYIYYGYRDLDGSGRMAYVGPEDQRVNELIQKHQALKGDELSQKIKGLAKSAEALGC
FT                   ASTLTKHFRVVNRLDQYGFFRAGSILIGTHAFLAMGNMLGVKWLSSNLTMDVDFAHAGK
FT                   NVSIALGANVKISVHDALNSLEMGLLPIAEFSGKTGAQYRNPKDPELRLDFVTPQTRDG
FT                   GPVILPNLGLTLECLKFMEYSLVGTTQTVLLSKEGACMVNIPAPERYAVHKLIIYGERP
FT                   LNEHAKANKDLGQAAAIFKALFDMGNGDLVRSAWSDALSRGPGWVKRLNQGRAALLKRY
FT                   PELLALANE"
FT   gene            complement(282601..283638)
FT                   /locus_tag="Pnuc_0289"
FT   CDS_pept        complement(282601..283638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0289"
FT                   /product="UDP-N-acetylmuramate dehydrogenase"
FT                   /EC_number="1.3.1.98"
FT                   /note="KEGG: rso:RSc2550 probable
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase
FT                   oxidoreductase protein; TIGRFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; PFAM: FAD
FT                   linked oxidase domain protein;
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33510"
FT                   /db_xref="GOA:A4SVJ6"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SVJ6"
FT                   /protein_id="ABP33510.1"
FT                   /translation="MNRAQNAPQPSKLTRNLGLQGRNTFGFDASAELAYEITSAEQIPE
FT                   VMESIAAQKLSWRVLGGGSNVILPKVLPGATLLMNITGAEITSSNQEHSLVAVGGGVNW
FT                   HDFVLWSLDNDLPGLENLALIPGTVGAAPIQNIGAYGIEVADYIDSIEAFDAHTDSFVT
FT                   LPKSACHFAYRDSYFKQHPHRFIVTKVVFKLPKQWQARIHYADLANQFAANATPCPEEI
FT                   FLAVCKIRTRKLPDPKVIGNAGSFFQNPIVPNEQHETLLGKHPNLVSYPDAPGKRKLAA
FT                   GWLIDQCGFKGERMGNVGVYENQALVLVNHGGGTAQDILGLAKCIQEKVRKEFGVSLEI
FT                   EPNIL"
FT   gene            283744..284229
FT                   /locus_tag="Pnuc_0290"
FT   CDS_pept        283744..284229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0290"
FT                   /product="protein of unknown function DUF520"
FT                   /note="PFAM: protein of unknown function DUF520; KEGG:
FT                   bxe:Bxe_A0754 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33511"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SVJ7"
FT                   /protein_id="ABP33511.1"
FT                   /translation="MPSFDVVCEPDMVELKNAIEQSNKEISNRFDFKGSDSRVEQKDEA
FT                   LILFGDDDFKLGQVRDVLVNKMAKRNVDVRYLKDDKTETIGGDKRKQTMKIQKGITSEL
FT                   SKKVVRIIKDSKIKVQASIQGDAVRVTGGKRDDLQETMALLKKEVTEAPLGFNNFRD"
FT   gene            284318..284590
FT                   /locus_tag="Pnuc_0291"
FT   CDS_pept        284318..284590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0291"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpc:RPC_2134 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33512"
FT                   /db_xref="InterPro:IPR022148"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVJ8"
FT                   /protein_id="ABP33512.1"
FT                   /translation="MKKPNKIIPKFKTEKEERTFWEKNDASEYFDLSKAVRVTMPNLKP
FT                   TTASISLRLSQSFLENIKLQANKLDVPYQSLMQIWLAEKLEEATR"
FT   gene            284636..285553
FT                   /locus_tag="Pnuc_0292"
FT   CDS_pept        284636..285553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0292"
FT                   /product="tyrosine recombinase XerD subunit"
FT                   /note="TIGRFAM: tyrosine recombinase XerD; PFAM: phage
FT                   integrase family protein; phage integrase domain protein
FT                   SAM domain protein; KEGG: rso:RSc2544 probable
FT                   integrase/recombinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33513"
FT                   /db_xref="GOA:A4SVJ9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011932"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVJ9"
FT                   /protein_id="ABP33513.1"
FT                   /translation="MATQLPIHPASQEAIERFCDACWLEDGLAKNSLSAYRRDLLLLAQ
FT                   WLYQQSGVDLYAVTEKDLTAYIAHRRADKATTANRRLTVFKRFYRHALRINLVKSDPCI
FT                   GLRAAKQALRFPKTLSEDQVTALLNAPDIETPLGLRDRTMLELMYASGLRVSEIVSLKT
FT                   VALGLNEGVVRVVNGKGGKERLVPFGGEAGQWLRRYLAEARTPLLEGKTTDAVFVGRHT
FT                   GTGLTRQAFWALIKRYATVANIPVALSPHTLRHAFATHLLNHGADLRVVQLLLGHADIS
FT                   TTQIYTHVARERLKSIHQQHHPRG"
FT   gene            285601..286233
FT                   /locus_tag="Pnuc_0293"
FT   CDS_pept        285601..286233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0293"
FT                   /product="acyl-phosphate glycerol-3-phosphate
FT                   acyltransferase"
FT                   /note="PFAM: protein of unknown function DUF205; KEGG:
FT                   reu:Reut_A0575 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33514"
FT                   /db_xref="GOA:A4SVK0"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVK0"
FT                   /protein_id="ABP33514.1"
FT                   /translation="MTLTLDLLLIPLAYLIGSISFAVVVSKCMRLPDPHTYGSGNPGAT
FT                   NVLRTGNKKAAVLTLIGDALKGYFAVMLARHILGDQSLTASLNSWLLCGVVIAVFLGHL
FT                   FPVFHGFKGGKGVATACGILFGINWILGLATLATWIIVAKFMRYSSLAAIAAAIFGPVY
FT                   FVFLFGFQPMGIALLIVCFLLIWRHHSNIQNLMNGTESRIGSKKETQ"
FT   sig_peptide     285601..285669
FT                   /locus_tag="Pnuc_0293"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.903) with cleavage site probability 0.897 at
FT                   residue 23"
FT   gene            286236..286607
FT                   /locus_tag="Pnuc_0294"
FT   CDS_pept        286236..286607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0294"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: ajs:Ajs_2347 membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33515"
FT                   /db_xref="GOA:A4SVK1"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVK1"
FT                   /protein_id="ABP33515.1"
FT                   /translation="MTIAYACILIMGLLPYVATGIAKKGFEGYDNSMPRQWLAKQDGYR
FT                   ARANAAQANLFESLPLFFATVIIAQIANAPQFRIDILAVGFVIARIAYLVCYVANWPTT
FT                   RSIVWLAGMVCTVSIFFQI"
FT   gene            286648..287436
FT                   /locus_tag="Pnuc_0295"
FT   CDS_pept        286648..287436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0295"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="PFAM: GTP cyclohydrolase I; KEGG: mpt:Mpe_A1074 GTP
FT                   cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33516"
FT                   /db_xref="GOA:A4SVK2"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVK2"
FT                   /protein_id="ABP33516.1"
FT                   /translation="MVTKNTKTPAKTQTKAVAKKLSVKKMTPQKIQSKNDDAGLPLSVM
FT                   IRRRIEAQNARFHANDNISAFIKPGELEGLVDEVAEKMQAVLESLVIDTNSDHNTKNTS
FT                   RRVAKMYVQEVFNGRYVEQPTLTKFPNVSRLNELMIVGPITIRSACSHHLCPIMGRIWI
FT                   GVLPSKESALIGLSKYSRLTEWVMCRPQIQEEAVVELADMLEKKIKPIGVAIVMDADHF
FT                   CMQWRGVKDRDSKMVNSVMRGAFLKDSNLRREFLSLLDKR"
FT   gene            287833..288141
FT                   /locus_tag="Pnuc_0296"
FT   CDS_pept        287833..288141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0296"
FT                   /product="High potential iron-sulfur protein"
FT                   /note="PFAM: High potential iron-sulfur protein; KEGG:
FT                   rfr:Rfer_3162 twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33517"
FT                   /db_xref="GOA:A4SVK3"
FT                   /db_xref="InterPro:IPR000170"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036369"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVK3"
FT                   /protein_id="ABP33517.1"
FT                   /translation="MKNSRRQFMILSAAGACTLALNSKVQAQAMVADTDPQATALGYKS
FT                   DATKVDKAKYAKYAAGQECGNCALFQGKAGAAAGGCPLFAGKQVSSKGWCSAYAKKA"
FT   sig_peptide     287833..287916
FT                   /locus_tag="Pnuc_0296"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 28"
FT   gene            288273..288806
FT                   /locus_tag="Pnuc_0297"
FT   CDS_pept        288273..288806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0297"
FT                   /product="ISPsy8, transposase OrfA"
FT                   /note="KEGG: psb:Psyr_4859 ISPsy8, transposase OrfA"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33518"
FT                   /db_xref="GOA:A4SVK4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVK4"
FT                   /protein_id="ABP33518.1"
FT                   /translation="MSKYSKEFKLTVIQHYLSGKGGFKNIGDQFGVKYAYVRKWVHAFK
FT                   AHGQKSLNKSAIQYSSIFKLSVLQHMEQHQLSVNQAATHFNIPAPSSVLAWQRLYNEGG
FT                   ITALEPKPKGRPPMSKPSDIKALLAKPLTSLTHEELLRKAQYLEVENAYLKKLEALAQQ
FT                   KHLASKNKPKSSLS"
FT   gene            288821..289633
FT                   /locus_tag="Pnuc_0298"
FT   CDS_pept        288821..289633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0298"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   bca:BCE_A0056 IS3-family transposase, OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33519"
FT                   /db_xref="GOA:A4SVK5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVK5"
FT                   /protein_id="ABP33519.1"
FT                   /translation="MQVILLAAQMPKSVYYYWQKASSNTDPHANAKIEIKAIFNTHQGR
FT                   YGYRRVHLELRNRGQYLNHKTVQKLMGQLGLRSMVRPKRYQSYKGGVGKAAPNLLERNF
FT                   RASKPNQKWVTDVTEFSIRGQKVYLSPILDLYNQEIISYEIGDRPQLSMVTTMLSSAFK
FT                   HLKQADKPMLHSDQGWQYQMGFYQQALKKQGVTQSMSRKGNCLDNAVMENWFGIMKTEF
FT                   FYPKRFETIESFKQGLHEYIHYYNHDRIKQKLKGLSPVQYRTQSLVLT"
FT   gene            289763..290305
FT                   /locus_tag="Pnuc_0299"
FT   CDS_pept        289763..290305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0299"
FT                   /product="HPP family protein+B94"
FT                   /note="PFAM: HPP family protein+B94; KEGG: pol:Bpro_0211
FT                   CBS domain containing membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33520"
FT                   /db_xref="GOA:A4SVK6"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVK6"
FT                   /protein_id="ABP33520.1"
FT                   /translation="MKRSLKYLVKHYSFYLGGDQPPVNWAERLRSVAGAFLGLLTVFVI
FT                   AKYLGERSGIDEWLMASLGASALLVFALPGSPMAQPWAVIAGNTLSALIGISCFHLIGE
FT                   PLLALPMAAAFSILGMFILRCLHPPAAAVSLIVVLGHVGNYRYALFPVMIDSILLILAG
FT                   AAYSNLTGKPYPNRPAI"
FT   gene            complement(290331..290576)
FT                   /locus_tag="Pnuc_0300"
FT   CDS_pept        complement(290331..290576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33521"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVK7"
FT                   /protein_id="ABP33521.1"
FT                   /translation="MPLFSKDSEFIKMTVAAPQAHNSAVFQTITNGATNMSNIPKINLR
FT                   NSLTECGQSIRKENAGKFQNYGILDCKASIAAGKIK"
FT   gene            290637..292112
FT                   /locus_tag="Pnuc_0301"
FT   CDS_pept        290637..292112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0301"
FT                   /product="mannose-6-phosphate isomerase, type 2 /
FT                   mannose-1-phosphate guanylyltransferase (GDP)"
FT                   /EC_number="2.7.7.22"
FT                   /EC_number="5.3.1.8"
FT                   /note="KEGG: mpt:Mpe_A0629 mannose-1-phosphate
FT                   guanylyltransferase (GDP); TIGRFAM: mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase; PFAM:
FT                   mannose-6-phosphate isomerase, type II; Nucleotidyl
FT                   transferase; Cupin 2, conserved barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33522"
FT                   /db_xref="GOA:A4SVK8"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVK8"
FT                   /protein_id="ABP33522.1"
FT                   /translation="MALVIPVILCGGSGTRLWPLSRSGFPKQFLVLSGDGSSQSLFQQA
FT                   VERIRTVANKEIQLGSTLVVTNEDHRFLVLDQLRELKNVDATLLLEPVGRNTAPALNMA
FT                   ALCAQQIAQGQDPILVITPADQTIQNQIAFTKALQDCIQTVQSSDDAIAILGITPTAPE
FT                   TGYGYIQRSGEKDQNNAFTVARFVEKPDSKTAQTYLAEGSYLWNSGMFVLKASTWLSAV
FT                   KAFRPDIFEASQKAWSCKSEDSSGGIGFIRPGKKEFSAIPGESIDYAVIEKCPGSQYPI
FT                   KMVELDAGWNDLGAWDAVWQVGQQDVSGNVTSGDTLLTNSKNSLVHASSRLVSAVGIEN
FT                   LIIVETADAVLVADRKHSQDVKNIVTQLESQKREEKNLHRKVARPWGWYDSVDEGERFK
FT                   VKRIQVKPGASLSLQMHHHRAEHWIVVKGIAEITNGDQVITLTENQSTYIPQGQTHRLA
FT                   NKGAEPLEIIEVQSGSYLGEDDIVRFEDTYGRS"
FT   gene            292163..293293
FT                   /locus_tag="Pnuc_0302"
FT   CDS_pept        292163..293293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0302"
FT                   /product="GDP-mannose 4,6-dehydratase"
FT                   /note="TIGRFAM: GDP-mannose 4,6-dehydratase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; KEGG: stm:STM2109
FT                   GDP-D-mannose dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33523"
FT                   /db_xref="GOA:A4SVK9"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVK9"
FT                   /protein_id="ABP33523.1"
FT                   /translation="MTSKQKVALITGITGQDGSYLAEFLLEKGYIVHGIKRRASSFNTE
FT                   RIDHLYQDPHVNHPDLILHYGDLTDTSNLVRIIQQTQPDEIYNLGAQSHVAVSFESPEY
FT                   TADVDAIGPLRMLEAIRILGLEKKTRFYQASTSELYGLVQEIPQKETTPFYPRSPYAVA
FT                   KMYAYWITVNYREAYGIYACNGILFNHESKRRGETFVTRKVTRGLANIAQGLEKCLFMG
FT                   NIDALRDWGHAKDYVRMQWLMLQQDKPEDYVIATGVQFTVREFITRSAQQLGITLKFEG
FT                   VAENEKAIVAAIEGDKAPALKVGDVIVQIDPRYYRPTEVETLLGDPAKAKAKLGWVPEI
FT                   TLDQMIVEMVANDLDKAKQHALLLKHGHSVAVGKEN"
FT   gene            293320..294297
FT                   /locus_tag="Pnuc_0303"
FT   CDS_pept        293320..294297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0303"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   rfr:Rfer_1235 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33524"
FT                   /db_xref="GOA:A4SVL0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR028614"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVL0"
FT                   /protein_id="ABP33524.1"
FT                   /translation="MSIHLSQKIYVAGHRGMVGSAIVRTLKEKGYENIITRTHAELDLI
FT                   NQAAVQAFFETEKPDQVYLAAAKVGGIYANNTFPAEFIYQNLMMESNVIHQAFVSGVKK
FT                   LLFLGSSCIYPKLAPQPMAEDALLTGLLESTNEPYAVAKIAGIKLCESYNRQYGASHGI
FT                   DYRSVMPTNLYGPGDNYHPENSHVIPALIRRFHEAKESKLPTVTIWGTGTPRREFLYVH
FT                   DMAAASVFVMDLDKSIYDQQTEPMCSHINVGYGADVTIAELANAVGAAVGYQGNIDFDP
FT                   TKPDGTPRKWMDSSRLNRLGWNPLVNLNDGLQSAYQEFLQRTTK"
FT   gene            294310..295056
FT                   /locus_tag="Pnuc_0304"
FT   CDS_pept        294310..295056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33525"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVL1"
FT                   /protein_id="ABP33525.1"
FT                   /translation="MRFKDSNLKRAFKNLFLPIREDILVLEPHFGLGDNLVCLGLMRAL
FT                   SKRNPKTRYYYACLPRCYQSLAWMFQDLDNVFLFPIEGGREVRQFTSFLNARYAPIGID
FT                   GVDIKRFDESFYEQHQVPFEARWEDCDVPPGPKSDWLYEKLNSNHEPYILVCNFESGLV
FT                   SYDLKINNPTDKKIITVSPETNNIFDWTKLALMADEIHTIDTSFVHFVESLFHNKPHKP
FT                   FFYHLARNSPTEFTRRLPWQVIRYRD"
FT   gene            295063..296463
FT                   /locus_tag="Pnuc_0305"
FT   CDS_pept        295063..296463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33526"
FT                   /db_xref="GOA:A4SVL2"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVL2"
FT                   /protein_id="ABP33526.1"
FT                   /translation="MNRVGTLDKQIYSPSSSIIFLQCFLFAILFGVWVLPETILIRHLC
FT                   LFIGAAISLYTIFRNLNLFLSKHALPIWMIGALFSWVIFHLIFLASDFDAQWLEFGTIW
FT                   KRSAIGFIFACGLGLALNAQLQSAPEKAKISKGILFIGFALPTLIYWIKFGAGILVARY
FT                   GIDVPELMLLQPEATKYFVHKSAYVFFCLPLYAISLGCLYELYLKGNLLSRNALVYLIC
FT                   IAAVLLNFIVEKDRNGEIYAFFLTLCFCGLILKDQIKSFSYQKIFLGCLITAIPVIGAL
FT                   YQFRNNSQWNSIVSDARIAVQIDQYNNWQDQATLKPPKDEEGRQISGTNYERIAWGTAA
FT                   LRLIKQNPLGFGLVERSFGRLGKKVWPDAKLHQSHSGWLDFTLGLGLPGVFLLLGAGAL
FT                   AWYQSLSSSSLAQIIGGWALASLLLSMFTTELSQKVYIDGLIFMIGLAATLSVSIKSGT
FT                   FKPIGSFK"
FT   gene            296491..297297
FT                   /locus_tag="Pnuc_0306"
FT   CDS_pept        296491..297297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0306"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   plt:Plut_1853 glycosyltransferase involved in cell wall
FT                   biogenesis-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33527"
FT                   /db_xref="GOA:A4SVL3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVL3"
FT                   /protein_id="ABP33527.1"
FT                   /translation="MHNQPLTPKVSIIMPSFNQVDFIERSIQSVLNQDYPNIELIVIDG
FT                   GSTDGSVEIIERYADKLAYWVSEPDEGQAQAINKGIKKATGEWIGWQNSDDLFSPYAIK
FT                   EMIACAQKNPKVNLVIGDMAMIDAQDQKIRNIRYIRPTYKSILAEGMVLTNQSAIWRRN
FT                   IHESIGFLNEKLHYGFDYEWFLRVLKGYSAAHVPLVLGYLRMHSQTKTSLQQPQFVKEY
FT                   ELIWGGQRPNKLIRTFYKVRRYSMHILKGQFYHLVEQTKHFFNKTS"
FT   gene            297315..298223
FT                   /locus_tag="Pnuc_0307"
FT   CDS_pept        297315..298223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0307"
FT                   /product="hemolytic protein hlpA-like protein"
FT                   /note="KEGG: tel:tlr2386 hemolytic protein hlpA homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVL4"
FT                   /protein_id="ABP33528.1"
FT                   /translation="MYQLNSPVVFVIFNRPDKARVTFEAIAKARPKKLLIIADGARTNV
FT                   VGEHQKCLETRAIIDRVDWDCEILTNFSDINLGCKMRLATGLDWVFQNVPEAIILEDDC
FT                   LPAPEFFQFCDELLKRYRFDDHVGMISGCNFQEGIKRGDADYYFSQFCHIWGWATWARA
FT                   WQKYDVQMSAWPQLKSAGWLNDLGLSGSEQRHWEKSFDKVYFQGLDTWDHQWTFASWKN
FT                   KMISIMPNINLISNIGFGVGATHTQGRSIFSNIPTGTLRFPMTHPSKVEANKEADGFTA
FT                   KHQFTDSYLWKIYRKLRAYLR"
FT   gene            complement(298227..299021)
FT                   /locus_tag="Pnuc_0308"
FT   CDS_pept        complement(298227..299021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0308"
FT                   /product="glycosyl transferase, WecB/TagA/CpsF family"
FT                   /note="TIGRFAM: glycosyl transferase, WecB/TagA/CpsF
FT                   family; PFAM: glycosyl transferase WecB/TagA/CpsF; KEGG:
FT                   syn:slr1118 UDP-N-acetyl-D-mannosaminuronic acid
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33529"
FT                   /db_xref="GOA:A4SVL5"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVL5"
FT                   /protein_id="ABP33529.1"
FT                   /translation="MIENLTNPLRMSLRTQCDVIDIPVDIGNINSISQGLNELANQKAT
FT                   AGKYVCVANVHMLTVARENPLLKTVLEKAHLVIADGMPLVWTQKRKGFTQAQRVSGPDL
FT                   MLDLCKLCAANNHSIFLLGTDEATLKELSAMLLEQFPKLKIAGYHAPARLPENPPLDEE
FT                   IARKINASGASFLFVGLGCPKQEFWCSTFAPHLNPISIGVGAAFDFHSGKKKRPPLWVQ
FT                   HFGLEWCYRLLSEPGRLWKRYLISNTQFIYLSMIDLVKSKRP"
FT   gene            complement(299032..300069)
FT                   /locus_tag="Pnuc_0309"
FT   CDS_pept        complement(299032..300069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0309"
FT                   /product="glycosyl transferase, family 9"
FT                   /note="PFAM: glycosyl transferase, family 9; KEGG:
FT                   sus:Acid_2356 glycosyl transferase, family 9"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33530"
FT                   /db_xref="GOA:A4SVL6"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVL6"
FT                   /protein_id="ABP33530.1"
FT                   /translation="MQLIPQYSSVCLLSARRYGDAIINAVILKQAAKSRPDIKWIIWTK
FT                   PEFEPLFKLMGFDQIITAEFPIAGGHKKLIAGGWKNLWRSISHLRTLKIDASIDFIGDT
FT                   REAFLGSLINTRTHYSPKWENDHWMRKLIWKIPVASAKYLPIASIDDQVYKFIPDLLSK
FT                   ILGVDIALDSKPQPINSKPKIAFHPFSSQLFKQWPAQNWLHLFKELSSNGSETIIFCSQ
FT                   SELKEAQRQFAHLNPQIPIRSCKSIEDLIEQVNKIDLLIGVDSFLVHLASALGKQTIVI
FT                   NAGNKPQWWQPPNSIALGQSGNCPSYPCMNEPTCLGKVGESKCVDSISPDSVLKAVEQM
FT                   LSTTI"
FT   gene            complement(300084..301448)
FT                   /locus_tag="Pnuc_0310"
FT   CDS_pept        complement(300084..301448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0310"
FT                   /product="sugar transferase"
FT                   /note="PFAM: sugar transferase; KEGG: tcx:Tcr_1675
FT                   undecaprenyl-phosphate galactosephosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33531"
FT                   /db_xref="GOA:A4SVL7"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017473"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVL7"
FT                   /protein_id="ABP33531.1"
FT                   /translation="MKMNASSNSGLLRPYSSELSNLNRLLDTLLIWGTLQILCMIYGIQ
FT                   NLDIYQYTALLGIIFYFLIAEVRSLYRSSRLESYGSISTKILSTWILVAISLIFLAFIT
FT                   KSSATFSRLTIGGWLVLTPLLLVIERLFIYILLRRLRSKGSNTRSYAILGDSKTAEQLL
FT                   SKINNLPWMGLTHFGNYQGLNNLLEDVQSKSIDYVFLCYTDNQQEEIIQAINALADSTA
FT                   SVYLTPNVFLADLLGSQWITLGNMPIITINDHPFYGARWLIKKLEDTLLSILILVLISP
FT                   LLLLISIAVRISSPGPILFKQRRYGLNGEVIQVLKFRTMTTQDDGAVVIQARKNDSRVT
FT                   VVGKFLRRTSLDELPQFMNVLQGSMSIVGPRPHAVSHNEHYRKLINGYMLRHKVKPGIT
FT                   GWAQVNGLRGETDTLEKMKARVDYDLYYINHWSLWFDLKIIFMTIVNGFTHKSAY"
FT   gene            301792..303048
FT                   /locus_tag="Pnuc_0311"
FT   CDS_pept        301792..303048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0311"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   ecs:ECs2842 O antigen flippase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33532"
FT                   /db_xref="GOA:A4SVL8"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVL8"
FT                   /protein_id="ABP33532.1"
FT                   /translation="MMLVMLVSVRISLPHLGVDRFGVWMTIASLVGLLNFLDFGIGNAL
FT                   TNRVALYAAPANAKHLRKCVGASLFILGVASVIILFVLYPFAYYLPWQTILKLPTQALY
FT                   EETQSAMKLFAILFACNIFTSGINKVFFGLQQGYWANIASAVGSVLSLVLIWLAVRSEG
FT                   GISTLLLASMTGGLIASLGLLVLLVIRNQVEFVAPAESFRLESHYLLRVGGSFFFLQIG
FT                   GIVVFGADSLIVANALGVAVVAIYSVLQRLFQFVTQPFSVINSGLWPAYANAHAHDDKA
FT                   FIASTLRRSMMITVGGGLMLSGVLIVLGKPIIAWWTHGEIAVSYALLISFGLWAACDSS
FT                   ANAFSMFLNGVSLMRPQIKGLAALILIGMPLKIYLLNEYGLVAMMLGFTMFFVANILFW
FT                   IGIVYRETITSFFHEKRSI"
FT   gene            303045..304208
FT                   /locus_tag="Pnuc_0312"
FT   CDS_pept        303045..304208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0312"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent enzymes; DegT/DnrJ/EryC1/StrS
FT                   aminotransferase; aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase; KEGG: ecs:ECs2841 perosamine
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33533"
FT                   /db_xref="GOA:A4SVL9"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVL9"
FT                   /protein_id="ABP33533.1"
FT                   /translation="MIEIPVYQPSLSGNEKKYVLDCLESTWISSKGAYLSKFEDAFAQK
FT                   INVKHATAVSNGTVALHLALLALGVGPGDEVIVPTLTYIASVNAIRYVGATPIFVDSLR
FT                   DTWQADPADIEKKITSKTKAILLVHLYGHPCNMDEVMRIAKQHGVYVIEDAAEAFGSKY
FT                   RDVCVGAIGDIATFSFFGNKTITTGEGGMVVTNDQTLIDRVKHLKGQGLATHRQYWHDV
FT                   VGYNYRMTNICAAIGLAQLEQADQFIEQKRNVANLYKKYLKDLPVEIQEEAPDVFHTYW
FT                   MFSILVADAKIRDQLRDYLLERGIETRPLFYPVHTMPMYSTPFQSHKVAEDLGWRGINL
FT                   PSYPGLQESQIIKVCDCIKTFLGKRQNNLYRNRAEIAAVPIRCNKQN"
FT   gene            304222..305454
FT                   /locus_tag="Pnuc_0313"
FT   CDS_pept        304222..305454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0313"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   ecs:ECs2840 putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33534"
FT                   /db_xref="GOA:A4SVM0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVM0"
FT                   /protein_id="ABP33534.1"
FT                   /translation="MKIGILSQGFTGWGGGIDFIRYMLSYLDEEQKTNPDLHKTLFLPK
FT                   DNFLEKLKKISYPVRNLLKQFKKRRALRWEKRPGFSSGYLQNTYKVFSSSTDIVLAGSN
FT                   FNAQLRSAISEGSDVVFPCMDVPDKSFSLPWVGYLFDFQHRYYPEFFSKDEIQSRNDAF
FT                   AKMLFDAQHIVVNGRAVINDAKMFYPEHTAKLHALPFCPCPMPHWLDVQLDVRGKYEIT
FT                   QPYFLICNQFWKHKDHRTAFLAFKEYYDRGGDALLICTGSTDDFRFPKYFQEINHLINE
FT                   LNLTKKIKILGHIPKDDQISLMKNALSVIQPTLFEGGPGGGASYEAISLGIPVIASDIP
FT                   INKEMNCGELTFFAAGNPMELAKIMLERGEVPSARSDNATLLAQGLERRKNAGRVLYNV
FT                   FLEAIKDKRAN"
FT   gene            305659..306342
FT                   /locus_tag="Pnuc_0314"
FT   CDS_pept        305659..306342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0314"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; KEGG: reu:Reut_A1128 transferase hexapeptide
FT                   repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33535"
FT                   /db_xref="GOA:A4SVM1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR020019"
FT                   /db_xref="InterPro:IPR041561"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVM1"
FT                   /protein_id="ABP33535.1"
FT                   /translation="MQGKASPNSEHHLRPLVILGAGVHAVSVANVALSAGYEIECFVDR
FT                   NKKGSNLLGYSIIDKLDELNILDGFSFAIAVGDNALRERIYKELLSEASDLHFPSLVHS
FT                   SAVISFFAEIGEGVVVMPKAVIGPNSKVGRFCLINTQASIDHDCVMLDYSSIAPAVSTG
FT                   GGVTIGLRSAVSIGATIKHGVKIGDDCVVGASSYLNKDLASNQVAYGIPAKPVRMRSIG
FT                   DEYLK"
FT   gene            306659..307966
FT                   /locus_tag="Pnuc_0315"
FT   CDS_pept        306659..307966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33536"
FT                   /db_xref="GOA:A4SVM2"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVM2"
FT                   /protein_id="ABP33536.1"
FT                   /translation="MRNTCLGIGALLSIYPICTSRHLFLQKRVLPIWLLIALFGWVIFH
FT                   FLFLSQDPAAQIAELNSIWKRVAIGVIFAIGMGLSISRLANSNQSNEKNKSCLKACWII
FT                   FYIGLLAPTLIYIVKLLITSYSSRFGIVIPTVMQMYIGPNAPYVAKTAYVAFCLPVFAV
FT                   ALGSLLRNISAYRWLSLSNLVYLATLPTVMTVFYFENIKNGIAYALLLLVFFLLLIFKT
FT                   GSKGSWMPKIFLSILLLGASLSFLSAHLQGNESWKTFQLDAKVALNTTQNQQWKYNGEK
FT                   GYPLNDQGAVVSITNYERIAWAKEGARSILDYPLGFGLVERSFGHIAKLQWPDSKLHQS
FT                   HSGWIDLTLGIGIPGTALILVAMLMLIFQMGYPSMGVLQWTQATRWVLLSLLLMWCTTE
FT                   ISQKLYVENLLFWLALGAGLIANSLEAKMSGGTNYR"
FT   gene            complement(308012..309094)
FT                   /locus_tag="Pnuc_0316"
FT   CDS_pept        complement(308012..309094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0316"
FT                   /product="glycosyl transferase, family 4"
FT                   /note="PFAM: glycosyl transferase, family 4; KEGG:
FT                   rso:RSc0689 putative undecaprenyl phosphate
FT                   N-acetylglucosaminyltransferase transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33537"
FT                   /db_xref="GOA:A4SVM3"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVM3"
FT                   /protein_id="ABP33537.1"
FT                   /translation="MSSLLTAFIASLFLTFLIIHSRLSHENHSGDMADAGIQKLHLVTI
FT                   PRVGGIGIFFGLIAGLTLHIISTPYESITWQLPLIASIPFAIGLSEDISKKVGVRIRLM
FT                   AVAISACLASYFLDLKISSIDIAGIDYLLSFPGLTIAITVFAITGLTNSYNIIDGLNGL
FT                   SSMTGMLAASCLAYLAYRLGDTTLLFLSLVLLAAILGFFILNYPRGHIFLGDGGAYLIG
FT                   FWIAILSICLSYKHTQVSPWFALLINAYPVTETLFTIYRRSFYKNSSAMDADRLHLHSL
FT                   IYRRILHSHALKTENKFIGKNSKAAPYLWIINLITLVPAILWWDKTGMLIGAFIIYFTV
FT                   YLWLYKKIISFQTPKWLLFK"
FT   sig_peptide     complement(309020..309094)
FT                   /locus_tag="Pnuc_0316"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.907 at
FT                   residue 25"
FT   gene            309377..310345
FT                   /locus_tag="Pnuc_0317"
FT   CDS_pept        309377..310345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0317"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   pfl:PFL_5496 glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33538"
FT                   /db_xref="GOA:A4SVM4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVM4"
FT                   /protein_id="ABP33538.1"
FT                   /translation="MIDFIEKNLDLSATSHAPLVAILLCTYNGARFLAEQLDSLESQTH
FT                   QNWVVFASDDGSTDQTLEILQQYQAKWPSGKLTIRSGPQKGFCQNFLSLACDSKIKADY
FT                   YAFCDQDDVWLPEKLSTALNNIIFNQDSRLPYLYCGRTRYVNENLKPCGMSPQFVFPPS
FT                   FRNALVQSIAGGNTMVFNQSAKMLITKVGAVDVPSHDWWLYQLITGVEGDVFYDRKAYV
FT                   LYRQHEFALVGGNNSFPAKMERIWMLLQGRFQRWNTKNIEALKKVNHLLVKNHQEILRM
FT                   FELLRGARLRDRLRLMGVCGLYRQTRRGTFSLFLAALIKKI"
FT   gene            310366..311208
FT                   /locus_tag="Pnuc_0318"
FT   CDS_pept        310366..311208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0318"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: pol:Bpro_4002
FT                   ABC-2"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33539"
FT                   /db_xref="GOA:A4SVM5"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVM5"
FT                   /protein_id="ABP33539.1"
FT                   /translation="MTQMSNPHKAQPTSLKALVASLVKNRQLVYQMTKREVIGRYKGSV
FT                   FGLAWSFFNPIVMLIIYTFVFSVVFKARWGANSSDSKTEFALILFVGLIIFNLFAEVIN
FT                   RAPGLILNNVNYVKKVVFPLEILPVISFGVVLFHACISVAVMLFAFLLLNGFINWTAIF
FT                   LPIVLLPFALLILGISWFIASLGVFARDIGQAIGVFTTLIMFLSPVFYPTAALPRQFQF
FT                   WILLNPVSFIIEQARAVLFFGQIPDWLGLSLYFIFAAIVMLLGFAWFQKTRKGFADVL"
FT   gene            311198..312565
FT                   /locus_tag="Pnuc_0319"
FT   CDS_pept        311198..312565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0319"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bmv:BMASAVP1_A0928 putative lipopolysaccharide ABC
FT                   transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33540"
FT                   /db_xref="GOA:A4SVM6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029439"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVM6"
FT                   /protein_id="ABP33540.1"
FT                   /translation="MSSNEIVIQVTDLSKRYEIYDRAGDRLKQFIFPKLAKLLGSSKNN
FT                   YYRDFWALQDLSIAVQKGETVGIIGRNGSGKSTLLQIICGTLSPTHGVVKVNGRVAALL
FT                   ELGSGFNLEFTGRENVYLNAAVLGLTAEQIAKRFSAIEEFADIGEFIDQPVKTYSSGMM
FT                   VRLAFSVIVHVDADILVIDEALAVGDAFFSQKCMRFLREFKKSGSIIFVSHDISAVKSF
FT                   CDKVLWIEKGKMLQLASPKTVCESYLEAFYEAQQGSSTSTKLKSTTAKNIFSNPVKDQR
FT                   LDFINTSNLRNDLEIFKFDSAASSFGTGEAKITDVILLDAGGHALSWIVGGEEVTLRIT
FT                   AQAINNISMPIVGFSIVDRLGQNLFGDNTFLTYRDHPLCLDAGEVVTAEFKFNIPLLPS
FT                   GSYSINTAIASGVQSDHRQLDWVHDAIIFQSHSSSVCTGLMGIPMLDINMNIVKGR"
FT   gene            312575..315823
FT                   /locus_tag="Pnuc_0320"
FT   CDS_pept        312575..315823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0320"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: xom:XOO_0728
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33541"
FT                   /db_xref="GOA:A4SVM7"
FT                   /db_xref="InterPro:IPR007739"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR032719"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVM7"
FT                   /protein_id="ABP33541.1"
FT                   /translation="MHRSAKMLGNLFFQTYCLNRGPLVVLDIGSQDINGSLKNELPDEI
FT                   KYIGVDFSGGNNVDVVLEDPYILPFESNSIDALVCSSVFEHSDFYWVLFLELVRIIKPG
FT                   GLIYINAPSNGYIHRYPVDSWRFYPDAGHSLALWATRNGYDIKLLESFIHGKIRSAGEE
FT                   GEWNDFVAIFVKGSSNANTFDKRILDSIVDYSNAYCDKNTIAKNDSFYPEDLQITKRLN
FT                   IVELDLVQRNNQISELEQSLRDTSADLVQRNNQISELEQSLRDTSADLVQRNNQISELE
FT                   QSLRDTSVDLVQRNNQISELEQSLRDTSVDLVQRNNQISELEQSLRDTSVDLVQRNNQI
FT                   SELEQSLRDTSADLVQRNNQISELEKHYTIEIKKVEMMFKNSRSMRFTKPLRVLGDFYR
FT                   SIFSAKELKVKNSSFIDESRYIFLQLRKSLTNYGLHDTLRKIFNKLKKVKTSKIAFKNT
FT                   NKLISNLKYQLPVIDFDPLSEEFSSYQVNKKIDPKVKAIAFYLPQFHPFPENDEWWGKG
FT                   FTEWTNVCKATAKFIGHNQPHRPIHLGYYDLRVEAIMEEQAKIAQEYGVYGFSYYFYWF
FT                   SGKVLMELPLINMLNNKKIDIPFCLTWANENWSRRWDGQENEILISQNHSLEDSENFIR
FT                   YLIKYFKDDRYIKIENKPVLIVYRANIIPNIIDITKLWNNILIENGFSGIYLIAAQTFG
FT                   IRDPRPLGFDAAVEFPPHTIISEEISSNIQGLNKDFEGNVYCYNQIVNNEVKKLEPEYK
FT                   QYRAAMLSWDNTARRKNNSHIMANFSIRRYKQWLSNIASCTKNSIRLNENEKFIFINAW
FT                   NEWAEGTHLEPDTKYGFKYLQATYDILKNYINPEHAEIIRESQENSIAIVVHIHYMDTW
FT                   EDIKKIIKKILSVHDSDIYITITNLEQYQSIKNDFPSANIELVENRGRDILPFINVLKK
FT                   IIHKNYVAICKIHSKKSEYRSDGEVIRKELYFSLINNEITLEKIPKFFEVNKKLGMLVP
FT                   GKYFLQHNDINMYFNRENISKVCSVIGVNFKESKFPAGSMFWARPAALQKLLKLESGEL
FT                   FDVEEGLADGTVAHAVERLFGLVSESSGFYNIDL"
FT   gene            315851..316684
FT                   /locus_tag="Pnuc_0321"
FT   CDS_pept        315851..316684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0321"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: bce:BC0309 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33542"
FT                   /db_xref="GOA:A4SVM8"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVM8"
FT                   /protein_id="ABP33542.1"
FT                   /translation="MREFINYTDQKWLEMLLKSVSSTCVDGIKFPSFPSHEIQSQFVGS
FT                   SFQASLSEANQFYSLLKKCLIKENLKINDETKALDFGCGWGRFMRFFRKDISLNNLYGV
FT                   DIDPSILEVCRSTGVEGILSKISNFEQLKFSENFFDITIAYSVFTHLPENVHLFWMREL
FT                   ARVSKSGSLFILTLEPLRFLEFIQSIDENNPDSGWHAGLVRFKKEIPSFIDRFKKGEFV
FT                   YLPTGGGDYRGADIYGDAVVSKEYIENNWSEYFEIIDYIDEPQKFWQAVLVVKRK"
FT   gene            316681..318021
FT                   /locus_tag="Pnuc_0322"
FT   CDS_pept        316681..318021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33543"
FT                   /db_xref="GOA:A4SVM9"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVM9"
FT                   /protein_id="ABP33543.1"
FT                   /translation="MILDNKTPSYVLIILISLAFFLVLLPLGRPYPYADDWMYVYQLSD
FT                   LNQALMKSLFLPHNEHYIPLQNLIHLALLKISGLDFRILIGFNVLCSALVSFLWINILD
FT                   DSSDNKEGYLPFCIVPLISMGWGFNTVYWGFNFQFISGILFMSCSLYYWVKSIRNNDLY
FT                   CHQIFIFLLLCALCGGNGLIESLFIGAGILIAIIIFKRKFLKSKSNLIIIILWFSTILL
FT                   LTGATWLNSINNQGHHGALLEVLKFYNGLTGSWLGIFGSRLTKFESLFMIFLSLAPIFY
FT                   CGYGLANQFSKNQINKISLYSYSILLVSTQTIILCFVISISRASMQPWWAGLELHYGYL
FT                   FITIPFAGIYMLLKLKNKYLKNSISFASFMIFLLIFVSNAAWRIAAARAENHQFIMAVG
FT                   AIMSSEPSNTVAENFIKEFYWGSGGAEINSVSLGLDQLRKHGIWLKN"
FT   sig_peptide     316681..316785
FT                   /locus_tag="Pnuc_0322"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.739) with cleavage site probability 0.678 at
FT                   residue 35"
FT   gene            318052..318993
FT                   /locus_tag="Pnuc_0323"
FT   CDS_pept        318052..318993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0323"
FT                   /product="Phytanoyl-CoA dioxygenase"
FT                   /note="PFAM: Phytanoyl-CoA dioxygenase; KEGG: xac:XAC3597
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33544"
FT                   /db_xref="GOA:A4SVN0"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVN0"
FT                   /protein_id="ABP33544.1"
FT                   /translation="MNLNKLPEIPWYMDLGAKARNLYRDCPLDIKNEISFFLDHGYVVL
FT                   KNSLPPERIESARNAFYRHKKKYANIYARHADVNGLQRRIVNLHMALYEFQDIFSLNTR
FT                   ALKIQDYLFQSPSTCFTSLTFESGSEQSIHRDSPYFTTTPEYYYLGVWVALERVDHLNG
FT                   ALEIYDGGHLVHEVDRFEIFERYYKYGDQIDQMDPRLWADYQQATIESCIAKGLEKKIV
FT                   PMEPGDTLIWHPHLPHGGSAISSQGRSRLSIVNHVVPSGVPVSGLNVFYRNSNPPDSVN
FT                   YGYMNHADRNFLIHKNVEFQHADPQPANEFRN"
FT   gene            319022..319996
FT                   /locus_tag="Pnuc_0324"
FT   CDS_pept        319022..319996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0324"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility C-terminal
FT                   domain; KEGG: dar:Daro_1706 NAD-dependent
FT                   epimerase/dehydratase:3-beta hydroxysteroid
FT                   dehydrogenase/isomerase:dTDP-4-dehydrorhamnose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33545"
FT                   /db_xref="GOA:A4SVN1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVN1"
FT                   /protein_id="ABP33545.1"
FT                   /translation="MCVGTSKFTRRLFINKKIILPGGAGLVGQNLVARLIARGYSTIIV
FT                   IDKHGANLEILKDMHPEVLVERADISQKGNWQRHFVGADVVVMLQAQIGGLFYQDFIDN
FT                   NVSSTSLILDLVKLNNIPSLVHISSSVVESIADDFYTRSKIKQENIVLQSGISCPILRP
FT                   TIMYGWFDRKHLGWLARLMQKIPIFPIPGNGKFMRQPLYVGDFCDVIISCIENKIPSGI
FT                   FNISGHQKINYIDMIRIIKKTIGAKTAILKIPYGLFYGLLWVWALFDKNPPFTTQQLQA
FT                   LVAKDEFEVTNWPETFGVSYTPFEKAIEETFNHPVYSKVVLEF"
FT   gene            320007..321293
FT                   /locus_tag="Pnuc_0325"
FT   CDS_pept        320007..321293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0325"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; FAD dependent oxidoreductase;
FT                   KEGG: aav:Aave_0059 amine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33546"
FT                   /db_xref="GOA:A4SVN2"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVN2"
FT                   /protein_id="ABP33546.1"
FT                   /translation="MGKKVAVLGAGPMGLAVAYQLARDGHHPIVYEADDRIGGMTAAFD
FT                   FSGLRIERYYHFHCISDHAFLKVLDELGLSEKMRWIPTKMGYWYLNQLQDWGNPVALLK
FT                   FRGLSFIAKFRYGLHAFISTKRDDWKPLDKGNAVQWIQRWVGPEAYEVLWRRLFDYKFY
FT                   EYTSNLSAAWIWSRIRRIGRSRYSLFKEKLGYLEGGSDTLLHGMQFDIKKNGGEVFLKT
FT                   PVTKVVIENDSVKGIQTPNGFEQFDTVISTIPLPFIPRVIPDLPSKILTQFKNVKNIAV
FT                   VCVIVKLSKPLTEYFWLNINDPEMDIPGIVEYSNLRPLEYSIVYVPFYMPGEHPKFAQP
FT                   DEVFLGKVKKYFKKINPKLTDDDYLDIRASRYRFAQPIGVPGYLETIPNAKLPINGLWV
FT                   ADTSYYYPEDRGISESIDFGRKMAQDAVR"
FT   sig_peptide     320007..320063
FT                   /locus_tag="Pnuc_0325"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.967) with cleavage site probability 0.686 at
FT                   residue 19"
FT   gene            321290..321691
FT                   /locus_tag="Pnuc_0326"
FT   CDS_pept        321290..321691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0326"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0167 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33547"
FT                   /db_xref="GOA:A4SVN3"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVN3"
FT                   /protein_id="ABP33547.1"
FT                   /translation="MIHQFFSKQFISFLITGGIAATVNFLSRIFYNQYCSFSSAVIFAY
FT                   LTGMVSAFVLARLFVFKSTSQSLKRSAVFFTLVNVIAALQTWIISMGFNYYVLPAFGVD
FT                   QYAAEIASAIGIAFPVFTSYLGHKRWSFK"
FT   gene            complement(321841..322590)
FT                   /locus_tag="Pnuc_0327"
FT   CDS_pept        complement(321841..322590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0327"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   dar:Daro_1708 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33548"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVN4"
FT                   /protein_id="ABP33548.1"
FT                   /translation="MNNTKRIAIIGATSSIAEHCARIWAQQGSVELILVGRDQRKLEIV
FT                   AADLLVRSQNTKIEIVVTDFIDPTAIQNTVDALFTFQPIDIALIAHGTLPEQQDCQSNL
FT                   GLNYSTLEINGISPVLYAEAFAQHMTKLNQGSIAIIGSVAGDRGRKSNYVYGAAKGLVT
FT                   RYAQGLQHRFAGTGVNVSLIKPGPTNTPMTAAMKGSEKFATPEEVAKTITAGIESKKAV
FT                   IYAPAKWWLIMMVIRHLPSLIFNKMNI"
FT   gene            complement(322592..323893)
FT                   /locus_tag="Pnuc_0328"
FT   CDS_pept        complement(322592..323893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0328"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   dar:Daro_1709 FAD linked oxidase, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33549"
FT                   /db_xref="GOA:A4SVN5"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR010031"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVN5"
FT                   /protein_id="ABP33549.1"
FT                   /translation="MKPISSWGRLSHEDHQVIPLNDRHQAFNQIRANETQGGIAHGMGR
FT                   SYGDVGLNPKGALWLTTGLHHLIHFDEHTGRLICESGVLLRDIQRLLIPRGWILPVTPG
FT                   SQMVTVGGAIANDVHGKNHHLLGSFGDHVQNIKLIRTDGTIIECGPLHNTEWFSATLGG
FT                   LGLTGVILEAEIQMRPTAGPWLDTESIPYSNLSEFFELADSSEKDWEHTVSWIDCISGK
FT                   GQGIFMRANPNKELKHAPKMKAEKKMPFVPPISLVNSLTLRPFNFLYRNHQKYKAGTST
FT                   VHYEPFFYPLDKLLEWNRMYGPKGFFQYQSVVPRNVGQDATQAMLKEIEKSGEGSFLAV
FT                   LKTFGNRESLGMLSFPEPGVTLALDFPNHASRTHKLMNRLDAIVKEAKGRIYPAKDARM
FT                   PRELFEAGYPKLNEFLKYRDAGISSSLSRRLLGS"
FT   gene            324082..324966
FT                   /locus_tag="Pnuc_0329"
FT   CDS_pept        324082..324966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0329"
FT                   /product="UbiA prenyltransferase"
FT                   /note="PFAM: UbiA prenyltransferase; KEGG: maq:Maqu_1645
FT                   UbiA prenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33550"
FT                   /db_xref="GOA:A4SVN6"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVN6"
FT                   /protein_id="ABP33550.1"
FT                   /translation="MKIEKTGFSLKDRLIALIKLLRPKQWVKNGFVFAPLVFSGEMLNT
FT                   YALAQASLAAFFFCMASSATYIVNDIHDIDHDRRHPKKSTSRPLASGIVSKNAALVVLA
FT                   ALYIVLALGYLVMPKVILVIVAYAVLNLAYTFVLKHEPVIDIFTIAIGFVLRVIAGATA
FT                   LNLDPSAWMCVTTLCLALYLAAVKRRQELAQSGSDGRKVLQKYSVSLVDRYAEMSATGA
FT                   LLFYSMFVMSARPALVITIPLVLFGLFRYWYVVEALDGGESPTDALLADWQLMAVVVLW
FT                   VATCVFVLSGFSL"
FT   gene            324963..325385
FT                   /locus_tag="Pnuc_0330"
FT   CDS_pept        324963..325385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0330"
FT                   /product="acid phosphatase/vanadium-dependent
FT                   haloperoxidase related protein"
FT                   /note="PFAM: acid phosphatase/vanadium-dependent
FT                   haloperoxidase related; KEGG: maq:Maqu_1644 acid
FT                   phosphatase/vanadium-dependent haloperoxidase related"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33551"
FT                   /db_xref="GOA:A4SVN7"
FT                   /db_xref="InterPro:IPR003832"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVN7"
FT                   /protein_id="ABP33551.1"
FT                   /translation="MKEFSYILIPFLAWLVAGILKFLINSLRARRFAFDLIGYGGLPSN
FT                   HSAIVSSIAMLIALREGINNPAFGVAIALAFIVILDASSLRRQVGKHASAINKLNSLNA
FT                   SHASFLRERMGHTRIEILAGVLTGLAVAYSVNFLAS"
FT   gene            complement(325374..326543)
FT                   /locus_tag="Pnuc_0331"
FT   CDS_pept        complement(325374..326543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33552"
FT                   /db_xref="GOA:A4SVN8"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVN8"
FT                   /protein_id="ABP33552.1"
FT                   /translation="MREKAFFRYLPIMVLGIFAVISVAKGIQNALVFSQDFQWSPTVLF
FT                   LEGINPYQYFLNGNIDNRIILSQAPNYAHLAYFICAPFAIMDWWYAKLIWALTNILLAI
FT                   VCVNIISKEVELTKRDILIVLFVFLASASLRNTISNGQHSLVVLLAFCAFFLRPLGLRL
FT                   FLMGFAYFKYSFMPVLSVFILFKHGIKGFFISCISCMLGWLAFSIVLSEPPLTALLEPL
FT                   KVGSSSVGLGTADLMSFSEVFGFTKNSAPYLMFTYGIPAVVSVLIAYVIAKKETVCRLQ
FT                   TLSLLCIGSLMTVKHLPYDFVVLLPAFVLAYQNKKTLQGKIALGLILFFWFGIKYEFQL
FT                   SELINVKIEYFIGLNFCGLLMLFIYFLKQASSVQKAIKYPNSETHYSTS"
FT   sig_peptide     complement(326469..326543)
FT                   /locus_tag="Pnuc_0331"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.799) with cleavage site probability 0.751 at
FT                   residue 25"
FT   gene            complement(326564..328021)
FT                   /locus_tag="Pnuc_0332"
FT   CDS_pept        complement(326564..328021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33553"
FT                   /db_xref="GOA:A4SVN9"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVN9"
FT                   /protein_id="ABP33553.1"
FT                   /translation="MSKIRPQTTVDSFIFWSTIGLATFFFLAFFWINWQTFPIPWDDES
FT                   SFTLQAIAWAEHSTLFTSALSNERTIMWMNPGYMILTGSIYKIFGYSFALSREISWAFY
FT                   LLGFLTLSITLKDIVSKISILLLATSFLLPSSLASGNLARMESMEIFFASLIFLALIYK
FT                   RFWIAIAILIICALFHFNAIYISLPIIGAIALELKSARSLKILQPNKWDVLAISVSLAL
FT                   LALYLGFVFKNLDAFNQDMIYQFSRKFGRTPFYKIPKNIFYLFVISSTVLFAFFKNHRN
FT                   LTILGLLSLSFFLTYAIGQEMWYQIFFNLSLGLISIVGLNLLPEKKFIKVLALMILIAL
FT                   NAYQAGSSFAGMRPAFSKNPYIDGPTTLEIEQQILSLAQGVDSNGPVTVSFMSRGVGMM
FT                   FYPFLKRNDLQLRYKLPDQMNSNFPSNICVYITRSLDPDWLKIALSGPTAQACDKGLIV
FT                   SEVNGDVRVFRTEKNIFTEINRQQNKP"
FT   gene            328183..328575
FT                   /pseudo
FT                   /locus_tag="Pnuc_0333"
FT   gene            complement(328785..329372)
FT                   /locus_tag="Pnuc_0334"
FT   CDS_pept        complement(328785..329372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0334"
FT                   /product="Adenylyl-sulfate kinase"
FT                   /EC_number="2.7.1.25"
FT                   /note="PFAM: adenylylsulfate kinase; KEGG: net:Neut_0164
FT                   sulfate adenylyltransferase., adenylyl-sulfate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33554"
FT                   /db_xref="GOA:A4SVP0"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVP0"
FT                   /protein_id="ABP33554.1"
FT                   /translation="MNEQTIKHLTPPILTVDRTQRESLLSQTGKIIWFTGLSGAGKSTL
FT                   ANALEIQLHEQGKQTFLLDGDVVRQGLNQDLGFSDQDRTENIRRIAHVAKLMMDAGLIV
FT                   ICAFISPFKIERRLARELAGDSRFIEVYLNTPMSVCEERDVKGLYQKARSGNLSNFSGI
FT                   GSEYELPEHAELTIDPSQESVDQATEKILPLI"
FT   gene            329767..331197
FT                   /locus_tag="Pnuc_0335"
FT   CDS_pept        329767..331197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0335"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; Methionine
FT                   biosynthesis MetW; Methyltransferase type 11;
FT                   Methyltransferase type 12; KEGG: gvi:gll2778 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33555"
FT                   /db_xref="GOA:A4SVP1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVP1"
FT                   /protein_id="ABP33555.1"
FT                   /translation="MNTHHQEFVQYQLTRQSFWKRIHASISRSWGSYYQGRLTDIYQHL
FT                   IPVGSRVLELGCANGRLLAALDSSYAVGVDFSSPALDSAKKKSPQVNFIEMDAHEIKLD
FT                   DQTFDFIILSDLVNDLWDVQTVLEQLRPYCHPETRIIFNFFSHLWSLPLRFARWLGLAT
FT                   PNLSQNWLTRHDMKNLLEISGYEPLREWREVIAPLPIPLLSNFCNRYLARIWPFELLDI
FT                   TNFVMARPIGLALKKNPTVSVIVAARNESGHIEELMERIPEMGGGTEIIFVEGNSTDDT
FT                   YDKIALEISKNPNRNCKLLKQDGKGKGNAVRNGFDLASGDILMILDADITVPPEDLTRF
FT                   FNVIANGSAEFVNGVRLVYPMQEDAMRFLNLIGNKFFSWAFSWLLGQPIRDTLCGTKVL
FT                   WNNDYKRIAHNRTYFGDFDPFGDFDLLFGAARLNLKIMEVPIRYRARRYGETNISRWSH
FT                   GWLLLKMVVFAARRIKFT"
FT   gene            complement(331297..332829)
FT                   /locus_tag="Pnuc_0336"
FT   CDS_pept        complement(331297..332829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33556"
FT                   /db_xref="GOA:A4SVP2"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVP2"
FT                   /protein_id="ABP33556.1"
FT                   /translation="MKRCLQTLSSIWPYLALSAIVLILFYATGYKQNWPHWVDQELTLS
FT                   YNGLLVYSGSNQEYLDHPGFFSIHLIAYLIGIANYLGFYHLQNITDLNQSSSMLESMRI
FT                   LIITTRHAALLTTIAYVLVAYYIAQKITRERVLSFLIALLIFISNGVFFHFTLTRTEPI
FT                   AFLFLLGSLYFYIQYFNSQGKQVLSLLACLLMLFCGALNKAQVLVLAPFYFTWTYYFIS
FT                   AKVEGKPIESNESNDSDNPLKLASLASFIALALFYSLISSGLSLVINFGLIVFFYGLTF
FT                   VSAKKVKINVFKATSLFNIFYLIAFEALNYFSFKLNQNISIFTNIEDPISMTRWLAPDP
FT                   NAEKIAMDSNALYVLSKIANSLLEPLITLFSKVSSPLILVIFCLVLLYGLRKKLNKVDI
FT                   TFGIYSFLAFYAVSLINRTRYIDAPHYLLLAEFFLLGFALVLIRKLDSIKAQVKAVSLL
FT                   IFLILLVNLVPHTRYVNLLMRKGGQPFCSSPQIFLEKIDAKRIAAECQGNPI"
FT   sig_peptide     complement(332740..332829)
FT                   /locus_tag="Pnuc_0336"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.647) with cleavage site probability 0.423 at
FT                   residue 30"
FT   gene            332901..334973
FT                   /locus_tag="Pnuc_0337"
FT   CDS_pept        332901..334973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0337"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: xfa:XF0778 O-antigen
FT                   acetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33557"
FT                   /db_xref="GOA:A4SVP3"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVP3"
FT                   /protein_id="ABP33557.1"
FT                   /translation="MSFNPLFVDQAPLHLKYRKDIDGLRALAVLLVVIYHAFPNWAHGG
FT                   FIGVDIFFVISGYLITSIILDGLADKTFSLVDFYCKRIIRIFPALILVLACSIGLGWFM
FT                   LYPAELQLLGKHLLSAVGFFSNFTYLSEAGYFDSRAVEKPLLHLWSLAIEEQFYLIWPI
FT                   LLCFLYKLRSRSPSSLGFSLRGYLLLLIACSFAWNMHLIHVNKSAAFFLPFSRFWELLV
FT                   GALLAHVFSSDQSGSRGGDGISSWGLRLQTIAENTLFRQLVSFLGLTCLVVGVMVIYPR
FT                   SLFPGWLALLPVVGAALILYGGEKTWINRYLLSNRFMVAIGLISYPLYLWHWALLSFAQ
FT                   IWGPIFIEQRLLIVGLSLMFSWLTYRLIEKPLRNRQFIRKKSSVLIGLMIAILAVGFIL
FT                   TSNGFSERGVNTLSQFEQSAQDGSDGGFVIQGCGLSDLAFKEYFAGCFEDRREPAKFAL
FT                   VGDSKAMALFPGLVRSSQAGGRWLTIYGPGGDKAIMPYLSDSRADVKPSQSTYTDQAIK
FT                   QVSKNSQVKVVALAFSSKGVMTTDVDSLYKGEHQAQAIQGLDAIVAKLVESRKQVVLIV
FT                   DNPTLALPQDCFHRKLGISWLDQFEKIDPRCSMTYEKHTQMTAKYLEVLNAVAKKYPGQ
FT                   VRVFDSGPILCDVQNNICSYQKDGRKMYSYTDHISDYAAGRVGEVLNHQLVDSSR"
FT   gene            335020..335916
FT                   /locus_tag="Pnuc_0338"
FT   CDS_pept        335020..335916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33558"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVP4"
FT                   /protein_id="ABP33558.1"
FT                   /translation="MKIVLASQFKNEAVRAVEWLEYYKARGIVDFILCDDHSTDDSIAR
FT                   INSVEGIKVKHFSSQSVPTRFSGSSDTELYKWDLEHPQNQHTNFRRMFAYACEHYSSDT
FT                   AIGFLDMDEFIFTNSDVPLHQVITEKIKPYAVMSICSFEVDSRTFVLNGSNLLDQTTRS
FT                   MSVESRARSTRRTTVKSFIQLGHPLSKYAFTEPISEIGAGIHTSGLPLSSRQTWPKLIR
FT                   KRLKNWLRMMVGGGPKRWYALESVWVPQNPHDSFALEDLWLRVDPYSLSYLHYRTPSYD
FT                   MPINGPLFDCDYDLKKS"
FT   gene            complement(336004..337035)
FT                   /locus_tag="Pnuc_0339"
FT   CDS_pept        complement(336004..337035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0339"
FT                   /product="sodium/calcium exchanger membrane region"
FT                   /note="PFAM: sodium/calcium exchanger membrane region;
FT                   KEGG: mpt:Mpe_A0997 Ca2+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33559"
FT                   /db_xref="GOA:A4SVP5"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVP5"
FT                   /protein_id="ABP33559.1"
FT                   /translation="MATLIHELAGQTWFIVFMAIALFGGVLTAVHHAEVIAHKTGEPFG
FT                   TLVLAICVTIIEVSLIISMMLSGHEGSEFIARDAVFATVMIVMNGVIGLCIFIGGLKHY
FT                   EMSFRNDGTNSALAVLTALATFILVMPIVTTSSPGPDFTKSQLAFAGIASFALYIAFLF
FT                   FQTVSHRDYYLPKAIDKKTDINFHAQKPSNLKTGVSVVLLILSLIIVVGLAELLSPAIE
FT                   AGVKAAGAPKTIVGIAIALLVLLPEGYAAVRAARANRLQSSLNLALGSALASIGLSIPV
FT                   IAAIAIFFNLPISLGISSLNITLLYLTLFIGALTLAIGKTTRLQGVVHLIIFFEYLFLS
FT                   LVP"
FT   gene            337121..337486
FT                   /locus_tag="Pnuc_0340"
FT   CDS_pept        337121..337486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0340"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiX
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiX
FT                   protein; KEGG: reu:Reut_A2686 cobalamin (vitamin B12)
FT                   biosynthesis CbiX protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33560"
FT                   /db_xref="GOA:A4SVP6"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVP6"
FT                   /protein_id="ABP33560.1"
FT                   /translation="MKAIILFGHGARDSRWREPFDRLASLWQEQHASTPVELAFLEMMQ
FT                   PSLEEAVTALAAKGATQITIVPVFFGQGGHLRNDFPVLLQACQEKFPAVSLSATLAVGE
FT                   DLGVLQAIIDFGSQKIS"
FT   gene            337549..337890
FT                   /locus_tag="Pnuc_0341"
FT   CDS_pept        337549..337890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0341"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: yps:YPTB1722 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33561"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVP7"
FT                   /protein_id="ABP33561.1"
FT                   /translation="MSKKPRPKLESQLERETFKLKSSNGGGLLSFEVWGYVQDGKTVVA
FT                   RYNLAYINKLICQKDNGRVLGFDNAHDYHHRHYMGKVAPVQFVSYEKTLEQFEQDWQEI
FT                   IKGFKKGKK"
FT   gene            337887..338261
FT                   /locus_tag="Pnuc_0342"
FT   CDS_pept        337887..338261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0342"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="KEGG: yps:YPTB1721 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33562"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVP8"
FT                   /protein_id="ABP33562.1"
FT                   /translation="MTKVIIRTDKVEGFFDRARKAAQKVDRSESFKKSVTFSFEDPAEM
FT                   FMVLSEARRRLMLEVMSEPKTITQLTAKLHRDRSAITKDIGLLEKVGLLVSHKIANPGH
FT                   GIEKLVQTVASKIEMIATLG"
FT   gene            complement(338272..339093)
FT                   /locus_tag="Pnuc_0343"
FT   CDS_pept        complement(338272..339093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0343"
FT                   /product="uroporphyrinogen-III C-methyltransferase"
FT                   /EC_number="2.1.1.107"
FT                   /note="TIGRFAM: uroporphyrin-III C-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; KEGG: reu:Reut_A2691 uroporphyrin-III
FT                   C-methyltransferase, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33563"
FT                   /db_xref="GOA:A4SVP9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVP9"
FT                   /protein_id="ABP33563.1"
FT                   /translation="MNQSTSKPTSQAQGKVYLVGAGPGAADLITVRGAKLLAQADIVFH
FT                   DALVEPEMLALCPQAIQIAVGKRCGKLSSAQEFINKRLVDAAQKYQTVVRLKGGDPMLF
FT                   GRADEEIQALNAAGIEMEVVPGITAALAGAASIQQSLTLRGVSRSVAFITLAQGAENLT
FT                   SDQPIANPTADTLVYYMGRKDAAKIAQQLIAQHSHMSQGTPVHILEAVSTPRERQWTST
FT                   LQELAEGKADGWFDSTSPALIMIGAALKIDAIEKKALSANRDVEVLLKKTG"
FT   gene            complement(339115..339717)
FT                   /locus_tag="Pnuc_0344"
FT   CDS_pept        complement(339115..339717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0344"
FT                   /product="Uncharacterized conserved protein UCP030820"
FT                   /note="PFAM: Uncharacterised conserved protein UCP030820;
FT                   KEGG: bte:BTH_I0815 bacterial protein of unknown function
FT                   (DUF934) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33564"
FT                   /db_xref="InterPro:IPR008318"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVQ0"
FT                   /protein_id="ABP33564.1"
FT                   /translation="MSQTNTPSSNTIAAHDQVLHFPKGSKPSLAPNVWLIWSGSQDEGG
FT                   LPDLEHGPANITKVLVPFSWWVQHHNESDIAAKAKEGKIGVWFAADEDILKHEQLIEVG
FT                   KTVWPVVAAHFPIFRDGRSFSTAALLRDRFQWQGEIRAIGDVLIDQLLQGARVGFDSFA
FT                   LRPDQNTDVALKQFDLFSVTTQNSWRGLRTTRASLSA"
FT   gene            complement(339714..341426)
FT                   /locus_tag="Pnuc_0345"
FT   CDS_pept        complement(339714..341426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0345"
FT                   /product="sulfite reductase (NADPH) beta subunit"
FT                   /EC_number="1.8.1.2"
FT                   /note="PFAM: nitrite/sulfite reductase, hemoprotein
FT                   beta-component, ferrodoxin domain protein; nitrite and
FT                   sulphite reductase 4Fe-4S region; KEGG: bxe:Bxe_A3664
FT                   putative sulfite reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33565"
FT                   /db_xref="GOA:A4SVQ1"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVQ1"
FT                   /protein_id="ABP33565.1"
FT                   /translation="MYKYDHIDQTLVDQRVAQFRDQVARRLDGTLAEEEFRPLRLQNGL
FT                   YHQRHAYMLRVAIPYGLFNSKQLRTMALISEKYDRGYGHFTTRQNIQYNWVTLEDTPDI
FT                   LAELATVEMHAIQTSGNCIRNITSDAFAGVAGDEYVDPRPICELLRQWSTLHPEFAHLP
FT                   RKFKFAINGAKEDRTILLCHDVGIELKKNAQGELLADIYAGGGMGRTPILGSLIKTGLP
FT                   WQLLPSYLTALLRVYNRFGRRDNLYKARIKILVKALSPEEFARQVEGEWLHIKEGDDNF
FT                   TQAEWDRVAKHFTKPAYKDLPALTTDQVIAGASQADQAAFARWLGRNVKPHQVPGYASV
FT                   ILSLKPHGSVAPGDATTAQMYAIADLSDQYSFGELRATHEQNLVLADVEQAKLYELWQE
FT                   AKKQKVALPNVGLLTDIIACPGGDFCSLANAKSLPIAKAIQERFDDLDYLFDLGDISLN
FT                   ISGCINSCGHHHVGNIGVLGVDKDGEEWYQITLGGEQGNDAAIGKVIGPSFYADEIPDV
FT                   ITNIINTYVQDRKDDESFIQAYRRLGVTPFKEAAYKNAKKKEKAAQVSGEDAS"
FT   gene            341589..341966
FT                   /locus_tag="Pnuc_0346"
FT   CDS_pept        341589..341966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0346"
FT                   /product="putative transcriptional regulator, XRE family"
FT                   /note="KEGG: rfr:Rfer_2813 putative transcriptional
FT                   regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33566"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVQ2"
FT                   /protein_id="ABP33566.1"
FT                   /translation="MTASTQFKPISSPASVLAKAVTRAADRLEISHALLARILGLSPTS
FT                   ITRLYQGGYVLREGSKEWDFSLLFIRLYRSLDSIVSDDAVAKQWLQSENLGLHAQPISL
FT                   IQTTEGLVRVVQYLDSSRGIV"
FT   gene            342028..342636
FT                   /locus_tag="Pnuc_0347"
FT   CDS_pept        342028..342636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0347"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_2812 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33567"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVQ3"
FT                   /protein_id="ABP33567.1"
FT                   /translation="MKLVDDFEEQEMLEVLLEKNKPPLPMDAFGLEYLLATPFRYNPKR
FT                   GGSRFRSEIDPGIFYGAQSIQAAGAELGYWRWKFLQDAIELNNLSPVAHTVFSCKPTCL
FT                   AVDLRQNPFLGHQEAWCNSTDYLATQEFARIARKANMQAIVYQSARDTDDSWCVAILDP
FT                   TALKGVKVQIDPHTWFLSVHQDGVRLKSQNAFYNYRALM"
FT   gene            complement(343165..343509)
FT                   /locus_tag="Pnuc_0348"
FT   CDS_pept        complement(343165..343509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0348"
FT                   /product="death-on-curing family protein"
FT                   /note="TIGRFAM: death-on-curing family protein; PFAM:
FT                   Death-on-curing protein; KEGG: ana:alr9029 putative death
FT                   on curing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33568"
FT                   /db_xref="GOA:A4SVQ4"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR006440"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVQ4"
FT                   /protein_id="ABP33568.1"
FT                   /translation="MHEVLIQRFGGSPGIRNTDALEAALNRPQCGYYPDLIGQASALFE
FT                   SLAVNHPFIDGNKRIAFAAMDTFLRINGMQLNINSRDAYTKILDMFDRQELEHHVIDAW
FT                   LRSICQKKLN"
FT   gene            complement(343853..344224)
FT                   /locus_tag="Pnuc_0349"
FT   CDS_pept        complement(343853..344224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0349"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33569"
FT                   /db_xref="GOA:A4SVQ5"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVQ5"
FT                   /protein_id="ABP33569.1"
FT                   /translation="MNEQLKGILNKAKLNFLILGCILIIAIVGKVVAPELTNTIFNTAD
FT                   QLASELYLIFVAITLGAFIPNFKYVAAGSVAAFVAAAILIHLGVFNYLTTEYLFSVLLV
FT                   VLGFSAIANLYRHYREFKL"
FT   gene            344667..345245
FT                   /locus_tag="Pnuc_0350"
FT   CDS_pept        344667..345245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0350"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sus:Acid_4082 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33570"
FT                   /db_xref="GOA:A4SVQ6"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVQ6"
FT                   /protein_id="ABP33570.1"
FT                   /translation="MTELNTTQLNEIRSKVLGAAGKVPGALIGLGILFIILGMIGISGQ
FT                   ILFSFISINVLGIFLFAGGVLQGVHAFQSKGWKSVSIQIAFAVLYIVAGLYTWAFPLPA
FT                   LEAITLWLAAIFFITGFLRLVSAFQHRQFAEWFWLALSGAISILMGFLIMNSWPASSLW
FT                   LPGLLIAIELLLQGWSLLFLGFAARSITK"
FT   gene            345477..346565
FT                   /locus_tag="Pnuc_0351"
FT   CDS_pept        345477..346565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0351"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: dar:Daro_0178
FT                   acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33571"
FT                   /db_xref="GOA:A4SVQ7"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVQ7"
FT                   /protein_id="ABP33571.1"
FT                   /translation="MQSKNHFLLVDFLKTFAALTIILHHFSSYGQIAEDARQVLPGIMT
FT                   WLFEYGRYAVQIFLVMGGYLAAQSLTRTGGLKTSRELLKVIFNRYLRLFAPYVVALLVT
FT                   ILCAWVARFWVQDEFVGESETMGQFLAHLFFLQGILGLDSISAGVWYVAIDWQLYAILA
FT                   LILGMFPGYRSVIWMLAVLCVTSLLYFNRHGDYENYFIYFMGAYGLGVLAQLCKNYPDP
FT                   MINRFARVFIALIGIAIVVSSFHQFWLRNILAYGVAILLIFWGDWAYKDQYKDHSNKLK
FT                   NPRTHKLVNAILWGSRRSYCAFLIHFSFILLVNSLYIGWGMSKRHDGVLAIALMLVALA
FT                   GSWMAANYLYRWVEVPARKIKL"
FT   gene            complement(346587..347114)
FT                   /locus_tag="Pnuc_0352"
FT   CDS_pept        complement(346587..347114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0352"
FT                   /product="protein of unknown function DUF615"
FT                   /note="PFAM: protein of unknown function DUF615; KEGG:
FT                   bam:Bamb_0956 protein of unknown function DUF615"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33572"
FT                   /db_xref="InterPro:IPR006839"
FT                   /db_xref="InterPro:IPR023153"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVQ8"
FT                   /protein_id="ABP33572.1"
FT                   /translation="MHINEKNRTPKLVEADEGPSKSELKRQMTERQKLAEVLAALSSDA
FT                   LKTIPLDEAIKTAIAETNKIKSFEAIRRHKQYLGKLMRFLDDEELEAIQKRLDAIQGVS
FT                   KAETAKLHFLESYRDRLIANDETFTKMIEQYPDMDIQNMRTLIRNARKEKEQNKPPKAF
FT                   REIFRVLKDMGL"
FT   gene            347229..348848
FT                   /locus_tag="Pnuc_0353"
FT   CDS_pept        347229..348848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0353"
FT                   /product="Choline dehydrogenase"
FT                   /EC_number="1.1.99.1"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; GMC
FT                   oxidoreductase; KEGG: rso:RSc3345 putative choline
FT                   dehydrogenase lipoprotein oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33573"
FT                   /db_xref="GOA:A4SVQ9"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVQ9"
FT                   /protein_id="ABP33573.1"
FT                   /translation="MTQANTYDYIIIGAGSAGCMLAKRLTENPQKKVLLIEAGKKDNYI
FT                   WIHIPVGYLYCIDNPRADWRFKTVAEQGLNGRSLLYPRGRVLGGCSSINGMIYMRGQAA
FT                   DYEAWVQATGDESWSWENALKRYKQFEDYHGAANQWHGKGGEWTVSKQRLRWPIMDKFK
FT                   EAAVEAGIPASDDFNRGDNLGVGYFDVSQRAGWRLNTSKAFLRDAAKRGNLTVLTQAVV
FT                   SKLKIDPVTKNCLGVEYVKDNVASEALIGSNGEVLLSAGAIGSVQILERSGVGAAAHLN
FT                   SLGIPVIADLPGVGENLQDHLQLRMVYKVNGIKTLNTKANSLWGKMMIGLEYLLKRSGP
FT                   MSMAPSQLGAFAFSSPEQKSANVEYHVQPLSLEKFGEDLHSFNAFTASVCNVRPTSRGS
FT                   VHITSTDPEAPPAIHPNYLSTEEDRQVAAESLRLTRNIVKSPALQPFDPEEYKPGVQYQ
FT                   TDAELIKAAGDIGTTIFHPVGTCKMGRADDPMAVLDSQLRVRGIHHLRVVDASAMPTIT
FT                   SGNTAAPTMMIAERVAELLAGE"
FT   gene            348841..349764
FT                   /locus_tag="Pnuc_0354"
FT   CDS_pept        348841..349764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0354"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: ccr:CC3090 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33574"
FT                   /db_xref="GOA:A4SVR0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVR0"
FT                   /protein_id="ABP33574.1"
FT                   /translation="MSKLSAKSESAYQLPISHLLLALAIVAVWGTNFVVIKISLASFPP
FT                   FLFAALRYVFALLPMVFFVPRPKASWTSLCVYGVAVGVGQFGVLYLAIDGNISPGLASL
FT                   VIQTQVFFTIGFAMFFAKEWLKLYQVVALAVAITGLGIIAVHTDATTTALGLAMVVFCG
FT                   LSWGIANTTSRRAGSINMFSYVVWASAFAIPPLFLLAWIFEGGWGSMAAAMSSAPTGAW
FT                   IGVLWQSWANTLFGYAAWGWLLSKHPAAVVAPAPLLVPIFGMGASAFFLSEPLPLWKIL
FT                   AAGLVIAGLMVNLFWPSLRIRLARYF"
FT   gene            349908..351092
FT                   /locus_tag="Pnuc_0355"
FT   CDS_pept        349908..351092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0355"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bxe:Bxe_A3706 ABC branched chain amino acid family
FT                   transporter, periplasmic ligand binding protein; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33575"
FT                   /db_xref="GOA:A4SVR1"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVR1"
FT                   /protein_id="ABP33575.1"
FT                   /translation="MNIRRHIFAVAAATLFATGAYAADIKVGVTGPYTGGSSSMGVSMR
FT                   DGVRLAAKEINAAGGVNGNKIVLVERDDEAKNERGVQIAQELINNEKVVATLGFINTGV
FT                   SLASQRFYQDAKIPVFNNVATGSLITHQFPNAAENYIFRNAAADNIQAPMIAKEAVEKR
FT                   GLKKVAILADSTNYGQLGREDLEKALKTYGVTPVAEEKFNLGDVDMTSQLLKAKNAGAD
FT                   VVLTYAIGPELAQIANGMAKLGWKKPMIGSWTLSMASFIDTAGKNGDGATMPETFIQSP
FT                   ATTPKRKAFVDAYLKEFKPKNGVIASPVSAAQGYDSVYLLAAAIKQANSTEGPKILAAL
FT                   QGLNAPVDGVVMTYNKPFSATDHEAIKAKDVVMGVVEGGRVQFLNAEDATPKKK"
FT   sig_peptide     349908..349976
FT                   /locus_tag="Pnuc_0355"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            351239..352117
FT                   /locus_tag="Pnuc_0356"
FT   CDS_pept        351239..352117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0356"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bxe:Bxe_A3707 ABC branched chain amino acid family
FT                   transporter, inner membrane subunit; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33576"
FT                   /db_xref="GOA:A4SVR2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVR2"
FT                   /protein_id="ABP33576.1"
FT                   /translation="MDMLAQILSSGIAVGMIYAVIAFGFQLTFATSGTLNFGQGEALML
FT                   GALVGLTCVDTFGMNYWAMIPIVCIFGMIQGSFVELIGVRPAIKIKSEFGWIMSTIALG
FT                   IIFKNVAENIWGRDALPFPSPLPMEPMSFLGANILPMEILVVVGALVMMLLVEFFNRKT
FT                   IYGKAVVATSNDRDAAGLMGINTSLVITFSYALSSLTAAFAGVLIAPLTLTGATMGGAL
FT                   GLKAFAVAIIGGLSSGLGIIVGGLILGIIETATGFYFSTGYKDVPGLILLLLVLAYKPS
FT                   GLFGKSAIKKV"
FT   gene            352117..354048
FT                   /locus_tag="Pnuc_0357"
FT   CDS_pept        352117..354048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0357"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family / amino acid/amide ABC transporter
FT                   membrane protein 2, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; ABC transporter
FT                   related; SMART: AAA ATPase; KEGG: pna:Pnap_3519 ABC
FT                   transporter related; TC 3.A.1.4.-; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33577"
FT                   /db_xref="GOA:A4SVR3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVR3"
FT                   /protein_id="ABP33577.1"
FT                   /translation="MMKLKSHIPLLIAIVGLFCLPLFIHNPYYIHLAETILIYTILLFG
FT                   LDIVVGYVGQVSLGHAALFGIGSYTAGIMFFHLGLPIWATIPASVIVTACFGGLLALPA
FT                   LKVVGPYLAMVTLAFGTIAQILINEMTWLTEGPLGIKLTRPELMGVPMTKAEYFWLVSI
FT                   VTILALIVIDRFVKSQMGRAFEALRDSPVACDCMGVSVYRFKVIAFVISAGFAGLAGCL
FT                   YAYSEQYISPNTYNNELAVLFLLGIIMGGRKSRLGAVIGAAIIVLLPKLLDDINAFRIV
FT                   ASIIAIVVTAGAILALSKKVTTPKRVAIPLAGVIGLAVFSFWLDSISDWRLSIFGFMIL
FT                   LVVYYLQNGIVGFAKSFYHSIVGKTKTVRGGDAELVDDSISFISAVGNQNSGAELLKVD
FT                   SVLMQFGGLKALNNVDLSIKRGTIHGLIGPNGSGKSTMMNVLTGIYVPTAGNVLYAGQS
FT                   VVGKTSSDIALSGIARTFQNVQLFGEMTAIQNILVGLHHTFKSNIVEIALHLPRYKKEE
FT                   AEAHARAMALLKFVGLDDLANEEARNLPYGKQRLLEIARALALDPELLLLDEPAAGLTA
FT                   PDIKELLRIIRKIRDNGITFILIEHHMDVVMSVCDTVSVLDFGQKIAEGKPAEVQTNEK
FT                   VIHAYLGT"
FT   gene            354080..354808
FT                   /locus_tag="Pnuc_0358"
FT   CDS_pept        354080..354808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0358"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pna:Pnap_3518 ABC transporter related; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33578"
FT                   /db_xref="GOA:A4SVR4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVR4"
FT                   /protein_id="ABP33578.1"
FT                   /translation="MLSIKNLEAGYGKVKVLHGISIDVPKGQVITLIGSNGAGKTTTMR
FT                   AITGMIKPTGGEVTLSGEKINGYDSHKIARLGLAHSPEGRRVFTTMSVTDNLLLGAFPR
FT                   FTGSRPKGDIKHDLEKALEMFPRLKERQYQLAGTLSGGEQQMLAMARAVMLNPEIILLD
FT                   EPSMGLAPILVEEVFKIISNLKSQGVTMLLVEQFAAAALNVADYGYVLENGKIATHGPA
FT                   SKLKDDPAVKAAYLGGASSH"
FT   gene            complement(354880..355383)
FT                   /locus_tag="Pnuc_0359"
FT   CDS_pept        complement(354880..355383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33579"
FT                   /db_xref="GOA:A4SVR5"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVR5"
FT                   /protein_id="ABP33579.1"
FT                   /translation="MSTNKPNGFLSTSVSTVSGTVSNLNNELLEYVNSEKPTHDHSSVY
FT                   YKRFFVSTFNLGNKAISASFSKPMTIADGDQIIVSGYMKNDALQVLAYNNQTQQVSHHE
FT                   NWIILILGAIFFAAVAIGLLNSQLALDGAIIPKIFLFGFTLVAIYMVYRALLVREAIKL
FT                   LSNG"
FT   gene            complement(355443..356207)
FT                   /locus_tag="Pnuc_0360"
FT   CDS_pept        complement(355443..356207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0360"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   pen:PSEEN0009 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33580"
FT                   /db_xref="GOA:A4SVR6"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVR6"
FT                   /protein_id="ABP33580.1"
FT                   /translation="MGLTGAGGGILSVPLLVFALHLTVAEAAPISLLAIALAAGVGALL
FT                   GFKNKILRYKAAGFMAIFGLLLSPLGLWLAQRIPNAPLLILFSGILFYVSIRLYLQAHR
FT                   KILGVPEKESKPAPCLLNTSIGKLDWNLPCAKALMLSGATAGFLSGLLGVGGGFVLVPA
FT                   LRRYTDLSAQSIVATSLGVLAIVSGGGAVFSAVSGSLHIFVAAPFALGALGGLLIGRVI
FT                   GGKISGPRLQQVFAIMAFCVAISLIIKGGNAL"
FT   sig_peptide     complement(356124..356207)
FT                   /locus_tag="Pnuc_0360"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.802) with cleavage site probability 0.527 at
FT                   residue 28"
FT   gene            complement(356314..357228)
FT                   /locus_tag="Pnuc_0361"
FT   CDS_pept        complement(356314..357228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0361"
FT                   /product="conserved hypothetical secreted protein"
FT                   /note="KEGG: gbe:GbCGDNIH1_1686 hypothetical secreted
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33581"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVR7"
FT                   /protein_id="ABP33581.1"
FT                   /translation="MKLTIQRLIAFSFFLAATLHFSFAHAGEGVFGWIYTLDLQPKGTL
FT                   EFEQRLQLNQQQAAGKFESWTARSELEYGLTNDLQIAGYINSYYTSANQNYTNAEACED
FT                   SPSCTGGYGVPSSHDPSSPYKQSGVEGVSLEAIYRITNPVTSPVGVGLYLEPSWGKNKD
FT                   EIEARLLLQSNFIDDRLVLASNIVVANERLKFIENGNVPESMLDILVGGSYRFAPKWSA
FT                   GVEARFHNDYSELNLRNQVQRATFVGPNLHYAAKDWWVTGAWRYQLAGGNCMGGGEAEC
FT                   SDARVWDSHTVNEYILKVGFPLN"
FT   sig_peptide     complement(357148..357228)
FT                   /locus_tag="Pnuc_0361"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 27"
FT   gene            357378..357620
FT                   /locus_tag="Pnuc_0362"
FT   CDS_pept        357378..357620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0362"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: azo:azo3861 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33582"
FT                   /db_xref="InterPro:IPR024530"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVR8"
FT                   /protein_id="ABP33582.1"
FT                   /translation="MDSQALEKLVLMKMPFGKHAGRALADLPGNYLAWFAREGFPKGEL
FT                   GELLELMHTLDHNGLRGLLAPIQRAHGLQARSKLL"
FT   gene            complement(357612..358658)
FT                   /locus_tag="Pnuc_0363"
FT   CDS_pept        complement(357612..358658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0363"
FT                   /product="DNA/RNA non-specific endonuclease"
FT                   /note="PFAM: DNA/RNA non-specific endonuclease; KEGG:
FT                   rme:Rmet_4634 DNA/RNA non-specific endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33583"
FT                   /db_xref="GOA:A4SVR9"
FT                   /db_xref="InterPro:IPR001604"
FT                   /db_xref="InterPro:IPR020821"
FT                   /db_xref="InterPro:IPR040255"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVR9"
FT                   /protein_id="ABP33583.1"
FT                   /translation="MTALRKLLALLTPLALLATLLSPLQAFALFEECKDLFPNQQVPTS
FT                   SQVGRDLCFDSFAIYYSPQDKKPIYTVEKLNRAQLLAPHPRRSNQFYEEARLPFAERAQ
FT                   LSDYRSSGYDRGHNAPAGDMSNERAMAQSFSLANMMPQARQNNQGIWAKNVEEPTRLYA
FT                   KRAAGDIYVFTGSTGKQGSIGRGRVTIPSHLYKLVYDPQKNSAWAYWIENNNEAMMSPP
FT                   ISYAELMEKTGIDFQLPIKTDAQPSKQSVLTPLPAKLQKPLVGGWYPIFFDEYSPEKVN
FT                   ALIARIQESKVSSVQIQYDLNSELAKRIAAQIESQTALFVSPIQSSPPDSASVTYERNR
FT                   VTAIVRSK"
FT   sig_peptide     complement(358572..358658)
FT                   /locus_tag="Pnuc_0363"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.815 at
FT                   residue 29"
FT   gene            359153..360118
FT                   /locus_tag="Pnuc_0364"
FT   CDS_pept        359153..360118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0364"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /note="PFAM: Lytic transglycosylase, catalytic; KEGG:
FT                   reh:H16_A2858 hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33584"
FT                   /db_xref="GOA:A4SVS0"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVS0"
FT                   /protein_id="ABP33584.1"
FT                   /translation="MSKCLSNNLGDMQNTQPAMLAAKDLLAHAMAPVYRVINGVLVVTV
FT                   FMVVGLWLSGNGTNAGPFDLARILVPDEARHMVWSNGFGMLDQYKSANESTATAAPETD
FT                   IAAVIYNKSSVKQHTVALLMPSVAQVQVKSISHLADRIPTSKVDPQALDSNLMGSIQNQ
FT                   RAVADFFEKKYSLDRAKIEEYVSNTILIAKEVNIDPVLLLAVISIESNFNPNTKSQAGA
FT                   EGLMQVMTSVHRDKYAVYGGTTQAVKPEVNIRVGAYILKYLIATAGSLRNGLKFYVGAA
FT                   NAEDDGGYADKVMAERNRLIGLCQTRSVNRLTLNGKDLRS"
FT   gene            complement(360186..360533)
FT                   /locus_tag="Pnuc_0365"
FT   CDS_pept        complement(360186..360533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0365"
FT                   /product="peptidylprolyl isomerase, FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase, FKBP-type; KEGG:
FT                   mfa:Mfla_0379 peptidylprolyl isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33585"
FT                   /db_xref="GOA:A4SVS1"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVS1"
FT                   /protein_id="ABP33585.1"
FT                   /translation="MSELKKIDTVVGDGTEAKAGNHVDVHYTGWLFDEKAADHKGQKFD
FT                   SSLDRGQLFSFPLGAGHVIKGWDQGVEGMKIGGKRTLIIPSELGYGARGAGGVIPPNAT
FT                   LVFDVELHGVS"
FT   gene            360802..363036
FT                   /locus_tag="Pnuc_0366"
FT   CDS_pept        360802..363036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0366"
FT                   /product="isocitrate dehydrogenase, NADP-dependent"
FT                   /EC_number="1.1.1.42"
FT                   /note="KEGG: reh:H16_B1931 isocitrate dehydrogenase [NADP];
FT                   TIGRFAM: isocitrate dehydrogenase, NADP-dependent; PFAM:
FT                   Isocitrate dehydrogenase NADP-dependent, monomeric type"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33586"
FT                   /db_xref="GOA:A4SVS2"
FT                   /db_xref="InterPro:IPR004436"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVS2"
FT                   /protein_id="ABP33586.1"
FT                   /translation="MASEKSKIIYTLTDEAPLLATCAFLPIIRTFTAPAGVEIVNSDIS
FT                   VAARILAEFSECLTTEQKVPDNLAELGKMTLMPDTNIIKLPNISASVPQLLAAIKELQS
FT                   KGYKIPNFPEDPKTDEEKSIRTRYSKCLGSSVNPVLREGNSDRRAPPAVKRYARKNPHS
FT                   MGEWSQASRTHVSHMHGGDFYSSEKSMTMTKACDVKMDLVTKSGKTIVLKPKVSLLAGE
FT                   IIDSMNMSKKALCEFYEKEIEDAYKTGMMLSLHVKATMMKVSHPIVFGHAVKIFYKDAF
FT                   EKHAKLFEELGVNANNGMSSLYEKIKTLPESKREEIIQDLHACHEHRPALAMVDSAKGI
FT                   TNLHSPSDVIVDASMPAMIRVGGKMWGADGRLHDTKAVIPESTFARIYQEMINFCKTHG
FT                   NFDPTTMGTVPNVGLMAQQAEEYGSHDKTFEIPEAGVARIVADDGTVLLEQNVEEGDIW
FT                   RMCQCKDAPIRDWVKLAVNRARLSNTPAVFWLDEYRPHEAELIKKVNTYLKDYDLTGVD
FT                   IQIMSQTRAMRYTLERVIRGKDTISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAG
FT                   GGLFETGAGGSAPKHVQQLVEENHLRWDSLGEFLALAVSLEDIGDKTGNNKVKILARTL
FT                   DEATGTLLDNNKSPSPRTGELDNRGSQFYLAMYWAKALAAQTEDKELQAYFAPLAKALS
FT                   ENEEKITAEFKAVQGKPVDIGGYFVADPEKCKAVMRPSQTFNAALKAARA"
FT   gene            363138..363545
FT                   /locus_tag="Pnuc_0367"
FT   CDS_pept        363138..363545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0367"
FT                   /product="BLUF domain protein"
FT                   /note="PFAM: BLUF domain protein; KEGG: tel:tll0078
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33587"
FT                   /db_xref="GOA:A4SVS3"
FT                   /db_xref="InterPro:IPR007024"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVS3"
FT                   /protein_id="ABP33587.1"
FT                   /translation="MSKPKDLVELSYLSEAVSDMSFLGLMRLLEAARAFNLKNGITGIL
FT                   FYDNQQFGQIIEGERANVMKVWKRIQDDKRHHRVELLEIREISERSFPDWLLRFYGGET
FT                   LTRDYPVLAGMVGGMDKHSLALMNKMRETER"
FT   gene            363600..364562
FT                   /locus_tag="Pnuc_0368"
FT   CDS_pept        363600..364562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0368"
FT                   /product="oxidoreductase, molybdopterin binding protein"
FT                   /note="PFAM: oxidoreductase, molybdopterin binding; KEGG:
FT                   reu:Reut_A3141 twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33588"
FT                   /db_xref="GOA:A4SVS4"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR022867"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVS4"
FT                   /protein_id="ABP33588.1"
FT                   /translation="MRFIDKTLFPSDITPKTVFENRRSLIKAAAAGSFGAALAPWFSRE
FT                   ALAATPEKLSATLNSAYSLKEETTPYKYVTTYNNFYEFGTDKADPAANAGSLQTRPWTI
FT                   SIEGLVKKPITLDIDALLKLAPMEERIYRMRCVEGWSMVIPWDGYPLSKLINKVEPLGS
FT                   AKYVEFISLADRKQMPGLSSNVIDWPYREGLRMDEAMNPLTLLTFGLYGEVLPKQNGAP
FT                   VRIVVPWKYGFKSAKSIVKIRFTEEMPKTSWNMFDAREYGFYSNVNPQVDHPRWSQATE
FT                   RRIGDAKGVFAPKIKTQMFNGYGDQVASMYAGMDLKKYY"
FT   sig_peptide     363600..363746
FT                   /locus_tag="Pnuc_0368"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.982 at
FT                   residue 49"
FT   gene            364566..365120
FT                   /locus_tag="Pnuc_0369"
FT   CDS_pept        364566..365120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0369"
FT                   /product="Lipocalin family protein"
FT                   /note="PFAM: Lipocalin-related protein and Bos/Can/Equ
FT                   allergen; Lipocalin family protein; KEGG: pna:Pnap_1457
FT                   lipocalin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33589"
FT                   /db_xref="GOA:A4SVS5"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002446"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022271"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVS5"
FT                   /protein_id="ABP33589.1"
FT                   /translation="MRKIYTAVFGILLLLFTSYGYSQSEAPVKTIPSLDVPRYMGTWYE
FT                   VAKFPNWFQRKCVANTKAEYSIQPDGNLKVLNSCKTASGEVTDAEGVAKQIGAKDSPKL
FT                   LVRFAPAWLSFLPMVWGDYWVIDLDPQYQVAAVSDPKREYLWVLSRTPQLNQKTYEELL
FT                   QRLKAQQFDVRKLELTTQTGN"
FT   sig_peptide     364566..364634
FT                   /locus_tag="Pnuc_0369"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.605 at
FT                   residue 23"
FT   gene            complement(365117..366706)
FT                   /locus_tag="Pnuc_0370"
FT   CDS_pept        complement(365117..366706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0370"
FT                   /product="vinylacetyl-CoA delta-isomerase /
FT                   4-hydroxybutyryl-CoA dehydratase"
FT                   /EC_number="5.3.3.3"
FT                   /EC_number="4.2.1.-"
FT                   /note="PFAM: 4-hydroxyphenylacetate 3-hydroxylase; KEGG:
FT                   mpt:Mpe_A2516 vinylacetyl-CoA delta-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33590"
FT                   /db_xref="GOA:A4SVS6"
FT                   /db_xref="InterPro:IPR004925"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR024674"
FT                   /db_xref="InterPro:IPR024719"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVS6"
FT                   /protein_id="ABP33590.1"
FT                   /translation="MSQSTSQFMNSKDYQESLRSLKPTVYVDGRLIESVADEPSLRPGV
FT                   QALGVTYDMVHDPALAPLMLADSNGTPVPRMLHINQSSGDLLNKLEAVRVLCQETGCAQ
FT                   RYLAHDALNAIAQVSARIDDAKGSNEHSAKFSEYLSHVQTKDLALGIAMTDAKGDRSRR
FT                   PHEQENPDTYVHIVSQDAKGVVISGTKAIVTGAPYMHEFLVMPGRNMTKEDAAFAICCA
FT                   VPVDAKGITIVARPAGRPGDKVEHGKPIFSSKYGQSTGVVIFDKVFVPWDRVFYAGEWE
FT                   HSSVLTYNYATHHRHSCIAARAGFGDLLIGAGALMCEANGLDPATKSNLRDPMVELIKI
FT                   TEGFYACGVAASVYGTQDPYSKSFMPEPVFSNIGKLLLATQIYDMHRLAHEVSGGLIVA
FT                   LPGPDEDHNPATAATLAEVLRANPAVPYDKRIEVARFIEDLTASYQGGWYSVISLHGGG
FT                   SPAAMKQEIYRQYPIGNKVELVERLLDRGVLTSSEERAITKNKQPGRCCDQGCSAPGQA
FT                   VMVPLPEPGRRT"
FT   gene            366791..367474
FT                   /locus_tag="Pnuc_0371"
FT   CDS_pept        366791..367474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0371"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mpt:Mpe_A2515
FT                   putative TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33591"
FT                   /db_xref="GOA:A4SVS7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVS7"
FT                   /protein_id="ABP33591.1"
FT                   /translation="MYNFGMNQAAATARDLRQQALADAKRSHILNAATSVFIEFGLEAV
FT                   SMREIAKRAGYTAGAIYSYFANKEEIYGALLAESLERLNAFVSEAERAISLNEDTGSSN
FT                   DFLVLQKSVLAFYQFYRDNPRDLDLGFYLFQGLKPRGLTNEWDSQLNARLRDAMRPQEI
FT                   ALSKLGFSKNEIDTEVTAIFAHIVGVLLLNHTGRIRMFGKSADELIKHYLDNLALRIPK
FT                   MTKQK"
FT   gene            367488..368042
FT                   /locus_tag="Pnuc_0372"
FT   CDS_pept        367488..368042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0372"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: mpt:Mpe_A2514
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33592"
FT                   /db_xref="GOA:A4SVS8"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVS8"
FT                   /protein_id="ABP33592.1"
FT                   /translation="MFNQATSALILVDYQTRLLPSIHGGEAAVKAALMLAQAAALMEVP
FT                   VIGTEQNPEGLGPNDERIRNCCNETVLKYSFNGVEDGLVASIQKINSSINQTVLAGCET
FT                   HVCLMQTALGLKAKGFDVAVVAEACGSRSPNDKQLAIERMRDQGITILGIEMIIFEWLT
FT                   TLNHPQFKNILQLIKNREVKN"
FT   gene            368072..368842
FT                   /locus_tag="Pnuc_0373"
FT   CDS_pept        368072..368842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0373"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR; KEGG:
FT                   rso:RSc0730 probable oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33593"
FT                   /db_xref="GOA:A4SVS9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVS9"
FT                   /protein_id="ABP33593.1"
FT                   /translation="MEHTVLVTGATAGFGEATARRFLAHGHKVIAVGRRIERLEALKAS
FT                   LPVDQQKKLLTMVVDVCDAAKVDVLASALPADFANVSVLVNNAGLALGLEPAHKAFLSD
FT                   WDRMIDTNIKGLAHMSRAFLPGMVERKRGHVINLGSVAANYPYPGGNVYGGTKAFVKQF
FT                   SLNLRADLVGTPVRVTCIEPGMCSGTEFSNVRFKGDDDKAGQVYTGVKALSADDVAEAI
FT                   YWTATLPSHMNINVLEMMPVQQSFNAFNVHRGEF"
FT   gene            complement(368839..369387)
FT                   /locus_tag="Pnuc_0374"
FT   CDS_pept        complement(368839..369387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0374"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_1755 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33594"
FT                   /db_xref="InterPro:IPR021312"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVT0"
FT                   /protein_id="ABP33594.1"
FT                   /translation="MLSSPEKRSPLHTREITFYGYAREDGLWDIEGHLKDTKAAPFQTG
FT                   TKIWQPGEAFHDMWVRLTVNNELVIQDIEVAMDGHPHPECPLVVPPMNALIGARLGKGW
FT                   RKTIQTHLGGIQGCTHLRELLNSMATAAFQSIPGALFDPDENKPPLYLGGCKSWDFNGP
FT                   VVMRIYPQFYQWKDQDKSS"
FT   gene            369474..370199
FT                   /locus_tag="Pnuc_0375"
FT   CDS_pept        369474..370199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0375"
FT                   /product="ribosomal small subunit pseudouridine synthase A"
FT                   /EC_number="5.4.99.-"
FT                   /note="PFAM: RNA-binding S4 domain protein; pseudouridine
FT                   synthase; KEGG: rso:RSc0674 probable ribosomal small
FT                   subunit pseudouridine synthase A protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33595"
FT                   /db_xref="GOA:A4SVT1"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVT1"
FT                   /protein_id="ABP33595.1"
FT                   /translation="MAKPISLEKILFSQGFGTRRYCSDLVYADLVKVNGVLAEDPEERI
FT                   ATEGLVLTVEDRDWEYHEKAYIAFNKPENYECSHKTTHHPSVYSLLPSPFVERGLQCVG
FT                   RLDFDTTGLLLISDDGQFIHKMTTPKKNIGKVYEITTPEPITQSQIDHLLNGVVLDDDP
FT                   KPCFAVACNQLTEYTLAMTIVEGRYHQVKRMMAAVGNHVAKLHRTEIGAYLMPTDLAEG
FT                   EWRWLYPQDLQMLSKSVAA"
FT   gene            370207..370518
FT                   /locus_tag="Pnuc_0376"
FT   CDS_pept        370207..370518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0376"
FT                   /product="pterin-4-alpha-carbinolamine dehydratase"
FT                   /EC_number="4.2.1.96"
FT                   /note="PFAM: transcriptional coactivator/pterin
FT                   dehydratase; KEGG: syn:ssl2296 pterin-4a-carbinolamine
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33596"
FT                   /db_xref="GOA:A4SVT2"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVT2"
FT                   /protein_id="ABP33596.1"
FT                   /translation="MTSNSILPADYDFEGVIPLWKVNVEEKKMTRQFTFQHFIQAFEFM
FT                   THCASYAEELNHHPDWSNSWNIVKVELSTHSAGALTELDIKMASFMDAMALQLETKSK"
FT   gene            370870..371184
FT                   /locus_tag="Pnuc_0377"
FT   CDS_pept        370870..371184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33597"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVT3"
FT                   /protein_id="ABP33597.1"
FT                   /translation="MKIKCTLFTIYFLGFASSVSAQTPPPLGSKTFSPYTPAQLKALNS
FT                   RSLTPVEGPFGATTLNGQPVTTTQSSGKYFSAPEGEEEAEALETESADPYTPMSPVMTF
FT                   "
FT   sig_peptide     370870..370935
FT                   /locus_tag="Pnuc_0377"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 22"
FT   gene            complement(371191..371814)
FT                   /locus_tag="Pnuc_0378"
FT   CDS_pept        complement(371191..371814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0378"
FT                   /product="protein of unknown function DUF159"
FT                   /note="PFAM: protein of unknown function DUF159; KEGG:
FT                   rfr:Rfer_4344 protein of unknown function DUF159"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33598"
FT                   /db_xref="GOA:A4SVT4"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVT4"
FT                   /protein_id="ABP33598.1"
FT                   /translation="MCVQYLTTVNIDWVKSHFDLDLPASTAHDVFPTYPGPIVLKSHNT
FT                   DRMAIGLARFGLIPAWAKDEDFGRKTYNARAETVAIKPSYKNAWAKRHYALTLVDAFYE
FT                   PSYESGKAVRTRIHQAQHKPMAIASIWDTWTEPDTGEFIVSFSMLTIDASNHPVMKRFH
FT                   KPEDEKRTVVPLRPELFNDWLNATPEAASALLCCESMTELAIAE"
FT   gene            371910..372749
FT                   /locus_tag="Pnuc_0379"
FT   CDS_pept        371910..372749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0379"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   KEGG: neu:NE1418 PpiC-type peptidyl-prolyl cis-trans
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33599"
FT                   /db_xref="GOA:A4SVT5"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVT5"
FT                   /protein_id="ABP33599.1"
FT                   /translation="MKLLISRLKPSVAQLITSSILLGCFGSAFAQQSGLPINAAASVNG
FT                   AIITNDMVEQGIKVAISQGQKDSPELRKAVIQKFVEVMLLSQQAEKDGLANSEKANSQL
FT                   ALIRQNYLADLELSTFMAQNPITDADVQAEYNREVSSLGPQGMITEYKISDIAVATEAE
FT                   AQAALDRIKKGEPFDKVARSVSLGPNKAQGGAAGWVQPGQVPPQIGSVLATLGKGQVCS
FT                   APIQMQQGWYLVKVEDKKSSKPPTFEQAKQAVRAGLIQKKQYEFVAKIAKDSKIVVQ"
FT   sig_peptide     371910..372002
FT                   /locus_tag="Pnuc_0379"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 31"
FT   gene            complement(372826..373314)
FT                   /locus_tag="Pnuc_0380"
FT   CDS_pept        complement(372826..373314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0380"
FT                   /product="dihydrofolate reductase"
FT                   /EC_number="1.5.1.3"
FT                   /note="PFAM: dihydrofolate reductase region; KEGG:
FT                   reh:H16_A2704 dihydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33600"
FT                   /db_xref="GOA:A4SVT6"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVT6"
FT                   /protein_id="ABP33600.1"
FT                   /translation="MTQPAISMIVARSRNHVIGRDNQMPWKISADLQFFKRVTMGHPVI
FT                   MGRKTWESIGRPLPGRRNIVVSRNADLQLTGAELAGSLDEALNRLSEARRVFVIGGEQL
FT                   FKQAFDKADRLYITEIDIDINDGDTFFEVPDESSWTEVERTPGSEGEIHFNFLTLERK"
FT   gene            complement(373325..374119)
FT                   /locus_tag="Pnuc_0381"
FT   CDS_pept        complement(373325..374119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0381"
FT                   /product="thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /note="PFAM: thymidylate synthase; KEGG: rso:RSc0947
FT                   probable thymidylate synthase (translation regulation
FT                   repressor RNA-binding) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33601"
FT                   /db_xref="GOA:A4SVT7"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SVT7"
FT                   /protein_id="ABP33601.1"
FT                   /translation="MRQYHNLMKEVLAKGVQKSDRTGTGTISVFGHQMRFNLADGFPMV
FT                   TTKKLHMKSIVYELLWFLKGSTDNNWLKERGVSIWNEWAAPDGDLGPIYGYQWRSWPAP
FT                   NGQHIDQISEVVETIKKNPDSRRIIVSAWNVADIPRMALAPCHAFFQFYVADGKLSCQL
FT                   YQRSADIFLGVPFNIASYALLTHMVAQQCNLEVGDFIWTGGDCHLYSNHLEQVDLQLSR
FT                   DFLPLPKLNILRKPDSLFDYEFEDFEIVGYESHPHIKAPVAI"
FT   gene            complement(374155..375201)
FT                   /locus_tag="Pnuc_0382"
FT   CDS_pept        complement(374155..375201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0382"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: rfr:Rfer_2462 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33602"
FT                   /db_xref="GOA:A4SVT8"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SVT8"
FT                   /protein_id="ABP33602.1"
FT                   /translation="MLHSPIEADAVIIGAGPVGLFQVFELGLLEIKAHVIDSLPEAGGQ
FT                   CIELYPDKPIYDIPAVPVCTGRELTQNLLKQIEPFGAQFHLGQEVRTLEQQADGRLLIG
FT                   TSQNQYFLSKTVFIAAGVGAFQPRKLALEGIEALEDKHIFYHVKHPEQFSGKKIVICGG
FT                   GDSALDWALFLVEKAASVTLIHRRDDFKAAPKSIAKMRELCASKQMQLLIGQITSYEAQ
FT                   DDHLKEIVVTDIDGKTQALPVDDLLIFFGLSPKLGPIAEWGLDIERKQLVVDTEKFQTS
FT                   IPGIYAVGDINIYPGKKKLILSGFHEAALAAFAAAAYLNPEKQIQLQYTTTSPKLHKAL
FT                   GVGSPTFE"
FT   gene            complement(375246..375569)
FT                   /locus_tag="Pnuc_0383"
FT   CDS_pept        complement(375246..375569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0383"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: bxe:Bxe_A1051 putative ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33603"
FT                   /db_xref="GOA:A4SVT9"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR022569"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVT9"
FT                   /protein_id="ABP33603.1"
FT                   /translation="MTYVVTESCIRCKYTDCVDVCPVDCFREGPNFLVIDPDECIDCAV
FT                   CVPECPVNAIYAEDDVPGDQQSFIKLNAELSPDWTSITKSKPALPDADEWKDVKNKLDQ
FT                   LVK"
FT   gene            375667..376683
FT                   /locus_tag="Pnuc_0384"
FT   CDS_pept        375667..376683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0384"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase, NAD-binding; KEGG: pol:Bpro_3078 D-isomer
FT                   specific 2-hydroxyacid dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33604"
FT                   /db_xref="GOA:A4SVU0"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVU0"
FT                   /protein_id="ABP33604.1"
FT                   /translation="MNTSTNTQTNAQKPKILVARAIFPEALAKLEESFEVRSNQADQIL
FT                   TPEELKKELAGVVGALVTGSERIDAQALAQAKDLKIVANISVGYNNFDVPAITTAGVMA
FT                   TNTPDVLTDTTADFGFALLMATARRITESEHWIRAGKWDKWSIVNNPLGMDLHGSTLGI
FT                   IGMGRIGQGVAKRALGFGMKVIYHNRSRLSEADEKACAASYVSKEELLRTADHVVLVLP
FT                   YSAQSHHTIGEKELALMKPTATLINIARGGIVDDLALAKALREKTIFAAGLDVFEGEPS
FT                   VNPELLKLSNVVLAPHIASATEKTRRAMVDLAIDNLRAALGGKKPPSLINAEVFKAE"
FT   gene            complement(376719..377012)
FT                   /locus_tag="Pnuc_0385"
FT   CDS_pept        complement(376719..377012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0385"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reu:Reut_A2279 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33605"
FT                   /db_xref="GOA:A4SVU1"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVU1"
FT                   /protein_id="ABP33605.1"
FT                   /translation="MKLTKKELVFLDPTHTAKTLVLVYLCFSVPIVLLALFVAFIRDGA
FT                   IPGFTVLSALILNALLGYGLLWIACKVYNWVAGKFGGIELALRELPEEIEAE"
FT   gene            complement(377025..378338)
FT                   /locus_tag="Pnuc_0386"
FT   CDS_pept        complement(377025..378338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0386"
FT                   /product="molybdopterin molybdochelatase"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain; PFAM:
FT                   molybdopterin binding domain; MoeA domain protein, domain I
FT                   and II; MoeA domain protein, domain IV; KEGG: rso:RSc1037
FT                   probable molybdopterin biosynthesis MoeA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33606"
FT                   /db_xref="GOA:A4SVU2"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVU2"
FT                   /protein_id="ABP33606.1"
FT                   /translation="MKYSPNSPILLTPSLHVDEARKAITNLVAELLQEANAAQDPQEIE
FT                   TVSLDKAINRILAADLLSPIDVPAADNSAMDGYAFDGACLSVGSPKISLRIVGTALAGK
FT                   PYEGSIGKDECLKIMTGALMPQGCDTVIPQEFTSEQDGTIRFKQDQLKVGENRRLRGED
FT                   LKQGKAAISAGRLLRPSDLGLVASLGISTLPVRRKLKVAILSSGDELRALNQTLDAGSV
FT                   YDSNRYSLTGLLNRLDLEIIDCGIVRDDPTSLRKAFIEASEKADVLISSGGVSVGEADF
FT                   TKQIMQELGDVGFWKIAMRPGRPMAFGVLKAAPGNPSARKTLFFGLPGNPVAVMVTFYQ
FT                   FVRSALLQLNGAKQTEPPLIQAISETAIRKKPGRTEFQRAILGRGSDGKPTLRLTGSQG
FT                   AGILRSMSEANCFVILAHEQGNIAAGDWVDIALFEGLL"
FT   gene            complement(378335..378934)
FT                   /locus_tag="Pnuc_0387"
FT   CDS_pept        complement(378335..378934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0387"
FT                   /product="molybdenum cofactor guanylyltransferase"
FT                   /note="TIGRFAM: molybdopterin-guanine dinucleotide
FT                   biosynthesis protein A; KEGG: bbr:BB2115
FT                   molybdopterin-guanine dinucleotide biosynthesis protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33607"
FT                   /db_xref="GOA:A4SVU3"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SVU3"
FT                   /protein_id="ABP33607.1"
FT                   /translation="MISPENITGLILAGGRAQRMGGIDKGLISFHQKPLIESAINRLKN
FT                   QVGPILINANRNITKYAGYGYPVVMDETPDFSGPLAGFSVGLKACKTSYLLTSPCDSPL
FT                   LPLDLAARLAAEMERGPFDLVYASSLESGKTWAQPVFCLMRANLQDSLTAFLTKGDLKI
FT                   DRWFKELKSSTVIFDDAQAFANVNTPEELKILEAAL"
FT   gene            complement(378934..380049)
FT                   /locus_tag="Pnuc_0388"
FT   CDS_pept        complement(378934..380049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0388"
FT                   /product="GTP cyclohydrolase subunit MoaA"
FT                   /note="KEGG: reh:H16_A2581 molybdopterin biosynthesis
FT                   protein; TIGRFAM: molybdenum cofactor biosynthesis protein
FT                   A; PFAM: Radical SAM domain protein; molybdenum cofactor
FT                   synthesis domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33608"
FT                   /db_xref="GOA:A4SVU4"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVU4"
FT                   /protein_id="ABP33608.1"
FT                   /translation="MVEKVIPIRIDEGKGLVPSIGTQLITPHGRTQDTRGRVLRDLRIS
FT                   VTDRCNFRCTYCMPKEVFDQNYPYLAHQELLSFEEITRLTSIFSSLGVEKIRLTGGEPL
FT                   LRKNLEILIEMLAKIHTTVGKPLDLTLTTNGSILRKKAAALKAAGLQRLTVSLDGLNND
FT                   VFKKMNDVDFPVEDVLDGIAAAQEVGFANIKVNMVVKKGTNDHEIIAMAKHFKGSGIIL
FT                   RFIEFMDVGSSNGWNMEQVLPSKEVIAQINAVFPLEPIDANYTGEVAQRWRYLDGSGEV
FT                   GLISSVTQAFCHECTRARISTDGQLYLCLFANEGFDFKSLLRSGGSDLEIANAIMNTWA
FT                   QRNDHYSEIRGSQTANPTSSSRKVEMSYIGG"
FT   gene            complement(380133..382772)
FT                   /locus_tag="Pnuc_0389"
FT   CDS_pept        complement(380133..382772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0389"
FT                   /product="RNAse E"
FT                   /EC_number="3.1.4.-"
FT                   /note="TIGRFAM: ribonuclease, Rne/Rng family; PFAM: RNA
FT                   binding S1 domain protein; KEGG: rso:RSc1040 probable
FT                   ribonuclease E (RNase E) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33609"
FT                   /db_xref="GOA:A4SVU5"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR028878"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVU5"
FT                   /protein_id="ABP33609.1"
FT                   /translation="MKRMLFNATQQEELRVAIVDGQKLIDIDIEAAGREQRKGNIYKGV
FT                   ITRIEPSLEACFVNYGEERHGFLPFKEVARTYFKEGIDVRNASIKDALREGQEIIVQVE
FT                   KEERGQKGAALTSFVSLAGRYLVLMPNNPRGGGVSRRIEGEDRQELREAMSQLEVPEGM
FT                   SIIARTAGIGRDATELQWDLSYLMQLWKAIDEAAKGNSAPLLIYLESSLVIRAIRDYFQ
FT                   PDIGEILIDTDDIYEQAAAFMSVVMPDNLPRVKRYHDDVPLFSRFQIEHQIETAYSRTV
FT                   PLPSGGAIVIDHTEALVSVDVNSARATRGSDIEETATRTNLEAADEIARQARLRDLGGL
FT                   IVIDFIDMESSKAQKDVENRLRDALRHDRARVQMGKISKFGLMEMSRQRLRPALSEGSH
FT                   VTCPRCNGTGHIRDTESSALQVLRIIQEEAMKENTAAIHTQVPVEVAAFLLNEKRAEVI
FT                   KIETRFKVNVLMVPNKHLETPHYKLERLRHDDPRLDDQKASYVMAEEAARELETDTTVS
FT                   RKDAELKVRPEAAVKGITPAQPAPISQPRPARTEKTTTESSGGLFGFIKKLFSSSPAVE
FT                   EKPAPSNTRGRNQGRNGDRNNRNGNRGRRGDRNERNSERAERPAAAAAEGPASTPAEGT
FT                   NNRTRNNRTRNNQNGPKPERQEGNRNQANPAAVTPATEAAPGTDATPGVEGEERRGRGR
FT                   NRRGRGRGQRERGERTEGGTDASPAVVASSASPFAGPPVGMAGASASMPIQNITNSFSN
FT                   AKPVAEKQERAPRAPRQSNRSAPSSTPVAIPVAVVAAKATVEVITKPAPELPKVAFQAL
FT                   EETPLHSVVQSAGMIWVATDSSKHAEAQSQIKAEPVASNLGRTPKPAAALPDGPMVLVE
FT                   TGGQEKTV"
FT   gene            383238..384257
FT                   /locus_tag="Pnuc_0390"
FT   CDS_pept        383238..384257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0390"
FT                   /product="ribosomal large subunit pseudouridine synthase C"
FT                   /EC_number="5.4.99.-"
FT                   /note="TIGRFAM: pseudouridine synthase, RluA family; PFAM:
FT                   RNA-binding S4 domain protein; pseudouridine synthase;
FT                   KEGG: reh:H16_A2578 pseudouridylate synthase, 23S
FT                   RNA-specific"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33610"
FT                   /db_xref="GOA:A4SVU6"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVU6"
FT                   /protein_id="ABP33610.1"
FT                   /translation="MKPSPIPKPSKTQSAPPAVHLQTIGPEEAGQRLDNYLLRWAKGVP
FT                   KSHVYRIIRSGEVRVNKKRAEPTTRLVEGDVVRVPPVRIAEPAQMAAVNTAQTKSRAQG
FT                   YSDKMPILFEDEALLIVNKPAGLAVHGGSGIALGVIETLRITRPELKFLELVHRLDRDT
FT                   SGVLLLAKKRSALVELHRQIREGQTDKRYYLLAHGEIEQGAQVMQLKYPLHKYLLANGE
FT                   RRVRVDPDGLPSHTALRVTQVFKREGAAITLAEAQLKTGRTHQIRVHLLKLGHAILGDD
FT                   KYGFEDQDKLLKSKRLYLHAHLAGFTHPRTGEKMRIESPLPSEFAAMMKTFDVADVSE"
FT   gene            384254..384943
FT                   /locus_tag="Pnuc_0391"
FT   CDS_pept        384254..384943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0391"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: rso:RSc1042 putative phosphoglycolate
FT                   phosphatase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33611"
FT                   /db_xref="GOA:A4SVU7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVU7"
FT                   /protein_id="ABP33611.1"
FT                   /translation="MTQTNKPERRYDLIVWDWDGTIMDSTPTIVYCIQQACRDLGFKEP
FT                   DDTLASSVIGLGIHDSLRRAVPWIEPIHFQKLTDRFRYHYLAKDHELDLFVGIRELLEE
FT                   LRADNYLLGVATGKSRVGLDRSLKHHQIGHLFHETRTADESFSKPHPGMLLELSDVLQV
FT                   PTRRILMIGDTTHDLDMAANAGVDAVAVTYGAHPPDTLKTSQSLTHVDDVTQLSAWLKS
FT                   NLTAPLK"
FT   gene            384990..385937
FT                   /locus_tag="Pnuc_0392"
FT   CDS_pept        384990..385937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0392"
FT                   /product="peptidase S49"
FT                   /note="PFAM: peptidase S49; KEGG: rme:Rmet_2436 peptidase
FT                   S49"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33612"
FT                   /db_xref="GOA:A4SVU8"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVU8"
FT                   /protein_id="ABP33612.1"
FT                   /translation="MENNPNPNWERQALEHLLLESLKETRKARRWKAVMRVLTLLVIVG
FT                   VLLVVFDFHLPGRGMGVEKHTAMVTLDGEISSSSMANAMDINSALTAAFENEHSAGVIL
FT                   RINSPGGSPVQAGMMNDEIHRLRKLHPNKPFYVVVEDICASGGYYVAVASDQILVDKAS
FT                   LVGSIGVIMEGFGFTGLMDKLGVTRRMITAGSNKGMLDPFSKEEPKQVEMVKTMIDEIH
FT                   QQFIAVVKEGRGARLKETPDLFSGRIWNGEQAVKLGLVDGYGTVDSVARDIFKAPDILD
FT                   YTQKENFAERVAKRFGAEAGAAAGKALVKAPDLK"
FT   gene            complement(385969..386739)
FT                   /locus_tag="Pnuc_0393"
FT   CDS_pept        complement(385969..386739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0393"
FT                   /product="uroporphyrin-III C/tetrapyrrole
FT                   (corrin/porphyrin) methyltransferase"
FT                   /note="KEGG: reu:Reut_A2270 uroporphyrin-III C/tetrapyrrole
FT                   (corrin/porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33613"
FT                   /db_xref="GOA:A4SVU9"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVU9"
FT                   /protein_id="ABP33613.1"
FT                   /translation="MAKLGTLYLVPNTLGDDARIEQLPWVLPSETMTQAAKLQHWIVED
FT                   AKTARALLKAIDSVTPLSCSIQEMQMGEWRGAARNAKYGDAVKPSDLLKPLLAGNDMGL
FT                   MSEAGVPGVADPGAELVLAAYQLGAVVKPLVGPSSILLGLMGSGLNGQRFAFQGYLPHD
FT                   THERSAKLKQLEAESRKLQQTQIWIETPYRNTAMLMACLNSLSPQTLLCLGIDLTLQSE
FT                   MLATLSIADWKKRYPNEAACAPLQNRPTVFLLLA"
FT   gene            complement(386762..387367)
FT                   /locus_tag="Pnuc_0394"
FT   CDS_pept        complement(386762..387367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0394"
FT                   /product="maf protein"
FT                   /note="TIGRFAM: maf protein; PFAM: Maf family protein;
FT                   KEGG: aav:Aave_1179 maf protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33614"
FT                   /db_xref="GOA:A4SVV0"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVV0"
FT                   /protein_id="ABP33614.1"
FT                   /translation="MSNSQNLRLILASTSQYRRELLERLRIPFEVISPKVDETPRTGES
FT                   TLDLALRLAHAKAAAVSKQHPDAWVIGSDQVADLCGAAIGKPGNFERAFAQLQLMRGAT
FT                   VTFHTALCLMKGDTQTTLNVPTEVTFRKLSDEVLESYLLAEEPYDCAGSAKSEGLGISL
FT                   LEAIQSDDPTALIGLPLIALTGLLRDAGFAIPSKTNTK"
FT   gene            387410..387985
FT                   /locus_tag="Pnuc_0395"
FT   CDS_pept        387410..387985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0395"
FT                   /product="protein of unknown function DUF177"
FT                   /note="PFAM: protein of unknown function DUF177; KEGG:
FT                   reu:Reut_A2268 protein of unknown function DUF177"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33615"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="InterPro:IPR039255"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVV1"
FT                   /protein_id="ABP33615.1"
FT                   /translation="MNRNQVLPQVHLSTEPSALKRVDFCAPQPYKGSGFLAISDLPRIA
FT                   EEASTVIAGDGFEWQLETHFEDSPGSEPRQILELGLSGRLHLICQRCLQDCAVDLAEKR
FT                   RFVMVASEEEADNYPMEDEGQDPLVASQHFNLLETIEDEVLLSLPLIPKHPDEFCEPHA
FT                   SIFGDEEVLEVSEERENPFNVLKNMKKN"
FT   gene            388091..388270
FT                   /locus_tag="Pnuc_0396"
FT   CDS_pept        388091..388270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0396"
FT                   /product="LSU ribosomal protein L32P"
FT                   /note="TIGRFAM: ribosomal protein L32; PFAM: ribosomal L32p
FT                   protein; KEGG: cvi:CV3418 50S ribosomal protein L32"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33616"
FT                   /db_xref="GOA:A4SVV2"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SVV2"
FT                   /protein_id="ABP33616.1"
FT                   /translation="MAVQQNKKSPSKRGMHRAHDFLTAPATAVEATTGEAHLRHHISPN
FT                   GYYRGRKVVKTKND"
FT   gene            388354..389367
FT                   /locus_tag="Pnuc_0397"
FT   CDS_pept        388354..389367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0397"
FT                   /product="phosphate:acyl-[acyl carrier protein]
FT                   acyltransferase"
FT                   /note="TIGRFAM: fatty acid/phospholipid synthesis protein
FT                   PlsX; PFAM: fatty acid synthesis plsX protein; KEGG:
FT                   rso:RSc1049 probable fatty acid/phospholipid synthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33617"
FT                   /db_xref="GOA:A4SVV3"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SVV3"
FT                   /protein_id="ABP33617.1"
FT                   /translation="MSVTLAIDAMGGDHGVVVTVPAACDFLEKHSDVKIILVGDPDLIK
FT                   QVLDKSPKAPIERIQIIAASEVVLMDDPIEIALRRKKDSSMRVAIVQVKEGAADAVVSS
FT                   GNTGALMAISRYILKTLDGVDRPAIATAIPNELGLGTTMLDLGANADCEPMHLVQFAQM
FT                   ANVMVQVVDGKPNPSIGLLNIGEEVIKGNEVVKQTSELLRQTNLNFYGNVEGNDIFKGT
FT                   TDIVVCDGFVGNVVLKASEGLAKMMSGLIRKEFNRSLFTKLMAVCAMVPLLRVRKRVDH
FT                   RRYNGAVLLGLRGCVIKSHGSADRFAFGFALERAYEASKNHMVERIAAAFVVETTE"
FT   gene            389364..390350
FT                   /locus_tag="Pnuc_0398"
FT   CDS_pept        389364..390350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0398"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="KEGG: bch:Bcen2424_1121
FT                   3-oxoacyl-(acyl-carrier-protein) synthase III; TIGRFAM:
FT                   3-oxoacyl-(acyl-carrier-protein) synthase III; PFAM:
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C
FT                   terminal domain protein; 3-Oxoacyl-[acyl-carrier-protein
FT                   (ACP)] synthase III"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33618"
FT                   /db_xref="GOA:A4SVV4"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SVV4"
FT                   /protein_id="ABP33618.1"
FT                   /translation="MSIFSRIAGTGSYLPELRLTNQDLVERLAKTGLETSDEWIATRSG
FT                   ISARHFAAENELTSDLALKAAQAALSSAGITSSDLDLIILATSTPDHLGGFPSTACVVQ
FT                   DKLGAHTACAAFDVQAVCAGFTYALATADAFIRTGSYKKVLVIGAETFSRILDFQDRGT
FT                   CVLFGDGAGAVVLEASSEPGILSTALHADGSQRDILCVPGRSGNGAVHGSPFMTMDGQA
FT                   VFKLAVKVLEQVAHEVLAKANLKPEQIDWLVPHQANIRIMEGTAKKMGMSMDKVIVTVH
FT                   EHGNTSAASIPLALDCGIRSGQIQRGQHLLLEGVGGGFAWGAVALKY"
FT   gene            390393..391328
FT                   /locus_tag="Pnuc_0399"
FT   CDS_pept        390393..391328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0399"
FT                   /product="[Acyl-carrier-protein] S-malonyltransferase"
FT                   /EC_number="2.3.1.39"
FT                   /note="TIGRFAM: malonyl CoA-acyl carrier protein
FT                   transacylase; PFAM: acyl transferase domain protein; KEGG:
FT                   reu:Reut_A2264 malonyl CoA-acyl carrier protein
FT                   transacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33619"
FT                   /db_xref="GOA:A4SVV5"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVV5"
FT                   /protein_id="ABP33619.1"
FT                   /translation="MTFAFVFPGQGSQSVGMLNSIAHHPEVRATLQEASEALGEDVAKL
FT                   IAEGPAEALSLTTNTQPVMLTAGVAFYRAWLAAGGPPPRVMAGHSLGEYSALVGAGVIS
FT                   FKDAVPFVRFRAEAMQNAVPVGTGGMAAILGLDDAIVIQVCAEASAASSAVVEAVNFNA
FT                   PGQVVIAGASDAVTKACEMLKAAGAKRALPLPVSAPFHSSLLQPASEKLKGYLANIEFK
FT                   APTIAVINNVDVEILNEPQAIKDALVRQAAKPVRWHETIRAMAGQGVTHVVECGPGKVL
FT                   AGLTKRIHDQMTGVPVFDEASLNEVLASLK"
FT   gene            391368..392111
FT                   /locus_tag="Pnuc_0400"
FT   CDS_pept        391368..392111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0400"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="TIGRFAM: 3-oxoacyl-(acyl-carrier-protein) reductase;
FT                   PFAM: short-chain dehydrogenase/reductase SDR; KR; KEGG:
FT                   rso:RSc1052 3-ketoacyl-(acyl-carrier-protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33620"
FT                   /db_xref="GOA:A4SVV6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVV6"
FT                   /protein_id="ABP33620.1"
FT                   /translation="MNLDLSGQIALVTGASRGIGQAIADELVSCGAKVIGTATSESGAN
FT                   AINERLKPSGGAGLVLNVTAPNACEEIIDQIVKEYGGINILVNNAGITRDNLSMRMKGD
FT                   EWTDVIDTNLSAVFRLSQAVMRPMMKARGGRIINITSIVGHMGNPGQANYAAAKAGVSG
FT                   MTRALAREIGSRNITVNCVAPGFIDTDMTRALSEDQQNALKVNIPLARLGSPEDVAQAV
FT                   AFLASPAAAYITGNTLHVNGGLYLA"
FT   gene            392212..392451
FT                   /locus_tag="Pnuc_0401"
FT   CDS_pept        392212..392451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0401"
FT                   /product="acyl carrier protein"
FT                   /note="TIGRFAM: acyl carrier protein; PFAM:
FT                   phosphopantetheine-binding; KEGG: rme:Rmet_2427 acyl
FT                   carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33621"
FT                   /db_xref="GOA:A4SVV7"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVV7"
FT                   /protein_id="ABP33621.1"
FT                   /translation="MDNIEQRVKKIVAEQLGVAEGDIKNESSFVNDLGADSLDTVELVM
FT                   ALEDEFGIEIPDEEAEKITTVQLAIDFATSKAQG"
FT   gene            392473..393720
FT                   /locus_tag="Pnuc_0402"
FT   CDS_pept        392473..393720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0402"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase II"
FT                   /EC_number="2.3.1.41"
FT                   /note="PFAM: beta-ketoacyl synthase; KEGG: rso:RSc1054
FT                   probable 3-oxoacyl-[acyl-carrier-protein] synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33622"
FT                   /db_xref="GOA:A4SVV8"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVV8"
FT                   /protein_id="ABP33622.1"
FT                   /translation="MSASNGRRRVVITGLGLISPVGNSVDVAWSNVLAGKSGIATITKF
FT                   DHTPLSVHFAGEVKDFNVEEYVSAKEARHMDTFIHYGIAAGTQAIRDSGLEINEQNAER
FT                   VGVMVGSGIGGLPMIEETGAELLARGPRRISPFFVPGSIINMISGHLSILFGLKGPNVA
FT                   AVTACTTGLHSIGLAARLIQYGDADVMVAGGAESTISALGVGGFASARALSTRNDDPAT
FT                   ASRPWDRDRDGFVLGEGAGVVVLEEYEHAKARGAKIYCELLGFGMSGDAYHMTAPNMDG
FT                   PRRCMLNAMRDAGLNADQIQYINAHGTSTPLGDKNETGAIKAALGDHAKKVLINSTKSM
FT                   TGHLLGGAGGLESVFTILALHNQKSPPTINIFNQDPECDLDYCANTARDVKIDHAVKNN
FT                   FGFGGTNGTLIFGKLT"
FT   gene            393768..395219
FT                   /locus_tag="Pnuc_0403"
FT   CDS_pept        393768..395219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0403"
FT                   /product="protease Do"
FT                   /note="TIGRFAM: protease Do; PFAM: peptidase S1 and S6,
FT                   chymotrypsin/Hap; PDZ/DHR/GLGF domain protein; KEGG:
FT                   reu:Reut_A2256 peptidase S1C, Do"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33623"
FT                   /db_xref="GOA:A4SVV9"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVV9"
FT                   /protein_id="ABP33623.1"
FT                   /translation="MMKKHLIALLAILSLGQSPFISQSVAETPRVTIPDFADLVERASP
FT                   AVVNIRTTEKVNVQQTQGGIPGMPEDQAEFFRRFFGVPIPGIPNSPKQVQPAPGKPQEA
FT                   DRGVGSGFIIDSNGMILTNAHVVEGATTIYVTLTDKREFKAKLLGMDKRTDVAVVKIDA
FT                   RDLPRLPLGDSSKVRVGEWVLAIGSPFGLENTVTAGIVSAKSRDTGDYLPFIQTDVAVN
FT                   PGNSGGPLLNTAGQVIGINSQIFSRSGGYMGISFAIPIDEAIRVADQLRTNGKMTRGRI
FT                   GVALGDMTKEVAESLGLGKPRGAYVRNVEPGGPAAGGGIESGDVILSFNGHEINKSTDL
FT                   PRVVGETKPGTSVVVQVWRKGTTRDLTVTVTDAESNQAAIKKQEVPAASGNGGNVLGIQ
FT                   VNDLSDAKKKDWNIKGGVEVTGLGDGPLARAGVRPGDVIIRIADTDITGVKQFEALVKG
FT                   LDSNKAVPVFIRRADSTLVIPVRSK"
FT   sig_peptide     393768..393848
FT                   /locus_tag="Pnuc_0403"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.948 at
FT                   residue 27"
FT   gene            395366..397171
FT                   /locus_tag="Pnuc_0404"
FT   CDS_pept        395366..397171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0404"
FT                   /product="GTP-binding protein LepA"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein LepA; PFAM: elongation factor G domain protein;
FT                   protein synthesis factor, GTP-binding; elongation factor
FT                   Tu, domain 2 protein; GTP-binding protein LepA-like; KEGG:
FT                   reh:H16_A2558 membrane GTPase LepA"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33624"
FT                   /db_xref="GOA:A4SVW0"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SVW0"
FT                   /protein_id="ABP33624.1"
FT                   /translation="MDLIRNFSIIAHIDHGKSTLADRIIQHCGGLSDREMEAQVLDSMD
FT                   IERERGITIKAQTAALTYKSRDGKTYNINLIDTPGHVDFSYEVSRSLSACEGALLVVDA
FT                   SQGVEAQTVANCYMALELGVEVVPVLNKIDLPQADPERAKKEIEDVIGIDASHAVTCSA
FT                   KTGLGVQDVIEEMIARVPPPTGNAADPLQALIIDSWFDNYVGVVMLVRVVNGSLKPKDK
FT                   ITLMANGSSHLVEHVGVFSPKSIDRPELSAGQVGFVIAGIKELKAAKVGDTVTHSPGQQ
FT                   GRVPATEPLPGFKEVKPQVFAGLYPVESSEYDQLRESLEKLQLNDASLLYEPEVSQALG
FT                   FGFRCGFLGLLHMEIVQERLERQYGMNLITTAPTVVYQVEQSDGSILSVDNPSKMPEAS
FT                   KINTILEPIVTVNLYMPQEYVGAIITLCVGKRGIQMDMNYLGRQVKLTYELPMAEIVLD
FT                   FFDKMKSISRGYASMDYEFKEYRPADVVKVDILINGERVDALSVIVHRSNSQHRGREVV
FT                   AKMRGIIPRQMFDVAIQAAIGSNIVARENVKALRKNVLAKCYGGDISRKRKLLEKQKEG
FT                   KKRMKQVGNVEIPQEAFLAILQVDD"
FT   gene            397171..397977
FT                   /locus_tag="Pnuc_0405"
FT   CDS_pept        397171..397977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0405"
FT                   /product="signal peptidase I, Serine peptidase, MEROPS
FT                   family S26A"
FT                   /EC_number="3.4.21.89"
FT                   /note="KEGG: rme:Rmet_2420 peptidase S26A, signal peptidase
FT                   I; TIGRFAM: signal peptidase I; PFAM: peptidase S24, S26A
FT                   and S26B"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33625"
FT                   /db_xref="GOA:A4SVW1"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVW1"
FT                   /protein_id="ABP33625.1"
FT                   /translation="MNFALILFILVVISGIAWIADRYYFAPQRRLAGIDRMPLWLEYTA
FT                   GFFPVICAVFVLRSFIVEPFKIPSGSMIPTLQIGDFILVNKFTYGIRLPVINQKVIDLG
FT                   APKRGDVIVFRYPRDESIDYIKRVVALPGDVIEYQDKRLIINGQPLAYSGGEPYLDPEN
FT                   MRYAKLFTETFPPDLGGNRHEILNDPDRPATVFPTERFPGVEFCQYQESGLTCKVPAGH
FT                   YFAMGDNRDNSADSRYWGFVPDKNIVGKAFFVWLNLGNLRRIGGFE"
FT   gene            397982..398773
FT                   /locus_tag="Pnuc_0406"
FT   CDS_pept        397982..398773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0406"
FT                   /product="RNAse III"
FT                   /EC_number="3.1.26.3"
FT                   /note="PFAM: ribonuclease III; double-stranded RNA binding
FT                   domain protein; KEGG: rso:RSc1063 probable ribonuclease III
FT                   (RNAse III) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33626"
FT                   /db_xref="GOA:A4SVW2"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVW2"
FT                   /protein_id="ABP33626.1"
FT                   /translation="MNARAVIETATLQERLGYVFKKTELLNQALTHRSHSKKNNERLEF
FT                   LGDSILNCVVADLLYERYSDLDEGDLSRVRANLVKQQALYEIAQTLLLSDHLRLGEGEL
FT                   KSGGFRRPSILADTLEAVTGAIFLDGGFDAAKDCLRKLYSVILAQVDPKTLGKDDKTLL
FT                   QECLQGYQLPLPTYNVTGTTGAAHNQQFEVECLIPSLKVSVKGDGASRRAAEQSAAKIA
FT                   LVAVLKALPQESRKPKKTRSAKKKAAKKEVTEEQLNLKLKG"
FT   gene            398776..399711
FT                   /locus_tag="Pnuc_0407"
FT   CDS_pept        398776..399711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0407"
FT                   /product="GTP-binding protein Era"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein Era; PFAM: GTP-binding protein, HSR1-related; KH,
FT                   type 2 domain protein; KEGG: rme:Rmet_2417 GTP-binding
FT                   protein Era"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33627"
FT                   /db_xref="GOA:A4SVW3"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVW3"
FT                   /protein_id="ABP33627.1"
FT                   /translation="MFRCGTIAIVGRPNMGKSTLLNALVGQKISITSRKAQTTRHRILG
FT                   IQNREEAQFIFIDTPGFQTRLMNTLNKALNRTVTTALQDVNVACFVVEAGYFGEDDKKV
FT                   LKLLPDDLPVVLVLNKLDLFNSRFQTPSERDQALLSFIKEMALPWCELGGHEDQKSEFA
FT                   EIVPMSAKSPGDIERLLDVLEGYLPEAEAVYDGDTITDRSERFLAAEILREKVFRFTGE
FT                   ELPYTSTVVIDQFKMDGKMRRIAATILVDRDSHKAMIIGQKGERLKKISTDARIDMEKL
FT                   FDGKVFLETWVKVKRGWADDRAELRAQGLE"
FT   gene            399718..400452
FT                   /locus_tag="Pnuc_0408"
FT   CDS_pept        399718..400452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0408"
FT                   /product="DNA replication and repair protein RecO"
FT                   /note="TIGRFAM: DNA repair protein RecO; PFAM:
FT                   Recombination protein O, RecO; KEGG: rso:RSc1065 probable
FT                   DNA repair protein recO (recombination protein O)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33628"
FT                   /db_xref="GOA:A4SVW4"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SVW4"
FT                   /protein_id="ABP33628.1"
FT                   /translation="MASIRVADEPAFVLHSIPYKETSLILDVFTRQHGRMALIAKGAKR
FT                   PHSVLRPVLQRFQPLLVSWSGKSELRTLTKSEWVGGMPSLVGDALLCGFYLNELLVKFL
FT                   AREDDYERLYDRYSETINALSNLEFESKGLEEILRPFELSLLQETGYAAALDRCVETND
FT                   SPVFEALYVYQPERGVRPIQVDDPGHWPVLRGKSLLAIAAGDFSDPETLSESKQLMRFL
FT                   LGLHLQDQVLTTRQILIDLKKI"
FT   gene            400465..401211
FT                   /locus_tag="Pnuc_0409"
FT   CDS_pept        400465..401211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0409"
FT                   /product="pyridoxine 5'-phosphate synthase"
FT                   /EC_number="2.6.99.2"
FT                   /note="TIGRFAM: pyridoxal phosphate biosynthetic protein
FT                   PdxJ; PFAM: Pyridoxal phosphate biosynthetic protein PdxJ;
FT                   KEGG: bte:BTH_I1733 pyridoxal phosphate biosynthetic
FT                   protein PdxJ"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33629"
FT                   /db_xref="GOA:A4SVW5"
FT                   /db_xref="InterPro:IPR004569"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036130"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVW5"
FT                   /protein_id="ABP33629.1"
FT                   /translation="MTASHALELGINIDHVATLRNARGTIYPDPLRAAQLAESAGADLI
FT                   TLHLREDRRHIKDADLFALRPLIKTRMNLECAVTPEMIDIACKVKPHDVCLVPEKREEV
FT                   TTEGGLDVVGHYEAVKAATSQLKNAGIRVSLFIDPEEKQIQAAKDIGATVVELHTGRYA
FT                   DLSGSEQVVELERIRKAAKFGKSIGLRVNAGHGLHEGNVMPMAAIDELSELNIGHAIVA
FT                   EALFKGWQKAITDMKALMVQGRNNQK"
FT   gene            401208..401600
FT                   /locus_tag="Pnuc_0410"
FT   CDS_pept        401208..401600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0410"
FT                   /product="holo-acyl-carrier-protein synthase"
FT                   /note="TIGRFAM: holo-acyl-carrier-protein synthase; PFAM:
FT                   4'-phosphopantetheinyl transferase; KEGG: rso:RSc1067
FT                   probable holo-[acyl-carrier-protein] synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33630"
FT                   /db_xref="GOA:A4SVW6"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SVW6"
FT                   /protein_id="ABP33630.1"
FT                   /translation="MIIGIGTDILQIERLQAAYDRTNGRLAEKVLGPDEMLVFKHRLAR
FT                   NHKRGIAFLATRFAAKEAFSKAIGLGMHMPMTWRSLQTLNEPSGKPITSYLGALAQFMA
FT                   EKNWEAHITVSDEQDMAIAHVIVTQK"
FT   gene            401635..402708
FT                   /locus_tag="Pnuc_0411"
FT   CDS_pept        401635..402708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0411"
FT                   /product="glycoside hydrolase, family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase, family 3 domain protein;
FT                   KEGG: reu:Reut_A2247 beta-hexosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33631"
FT                   /db_xref="GOA:A4SVW7"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR022956"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVW7"
FT                   /protein_id="ABP33631.1"
FT                   /translation="MSKATMNPGPITLDVVGQVLNAEDRRRILHPLTGGVILFGRNFAN
FT                   RKQLTKLTADIKKLRPDVLISIDHEGGRVQRAKTDGFTHLPAMRKLGELWGAKHHSSHA
FT                   AESAALAMAAATACGYVLAAELRACGVDFSFTPVLDLDFGRSGVIGDRSFSRDPQIVFV
FT                   LAKSLNEGLRLGGMENCGKHFPGHGWAEADSHVAIPVDERSLQEILNDDAKPYEWLDLS
FT                   LAAVMPAHVIYPKVDSNPAGFSKIWLHSILRQELGFEGVIFSDDLSMEGASVAGSVVKG
FT                   AELALEAGCDAVLICNRPDLADQLLSKLKVSKTKLDESKRRLNRLMPTSPAVAWDLLQN
FT                   EPEYQHAKGLLKQFNLI"
FT   gene            402737..403474
FT                   /locus_tag="Pnuc_0412"
FT   CDS_pept        402737..403474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0412"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: carbonic anhydrase; KEGG: reh:H16_B2403
FT                   periplasmic alpha-carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33632"
FT                   /db_xref="GOA:A4SVW8"
FT                   /db_xref="InterPro:IPR001148"
FT                   /db_xref="InterPro:IPR023561"
FT                   /db_xref="InterPro:IPR036398"
FT                   /db_xref="InterPro:IPR041891"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVW8"
FT                   /protein_id="ABP33632.1"
FT                   /translation="MKKSFLSLVLLASSTVVFSAGDSHWGYEGKTGPDNWGNLSPEFAT
FT                   CKLGQQQAPIDIPTKSLGKATAAIKPAYKASAGEIINNGHTIQVALSDAGGANLSGVDY
FT                   KFLQMHFHAPGEEKVDGKSYPFNAHLVHQSADGKLAVIGVFFKEGTENPVFKEAFAQMP
FT                   SAEGKVAIKGKIDPSGLLPKSLAYYSYTGSLTTPPCSEGVTFYILKTPMEMSKAQLEQF
FT                   RKLYPMNARPTFPLNGRKITETN"
FT   sig_peptide     402737..402796
FT                   /locus_tag="Pnuc_0412"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 20"
FT   gene            complement(403561..404121)
FT                   /locus_tag="Pnuc_0413"
FT   CDS_pept        complement(403561..404121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0413"
FT                   /product="translation elongation factor P (EF-P)"
FT                   /note="TIGRFAM: translation elongation factor P; PFAM:
FT                   Elongation factor P/YeiP protein; Elongation factor, KOW
FT                   domain protein; Elongation factor P/YeiP-like; KEGG:
FT                   bxe:Bxe_A1093 elongation factor P (EF-P)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33633"
FT                   /db_xref="GOA:A4SVW9"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SVW9"
FT                   /protein_id="ABP33633.1"
FT                   /translation="MKTAQELRVGNVVMIGTDAMVVLKAEYSRSGRNSSVVKMKFKNLL
FT                   TGAPNEGVFKADDKFDVVILDKKECTYSYFADPMYVFMDTEYNQYEVEAEFMGDALNYL
FT                   EESMPCEVVFYEGKALSVAMPNSLVREIIYTEPAVKGDTSSGKVLKNAKLATGYELQVP
FT                   LFCNTGDKIEIDTRTGEYRSRAN"
FT   gene            complement(404209..405279)
FT                   /locus_tag="Pnuc_0414"
FT   CDS_pept        complement(404209..405279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0414"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pfl:PFL_4265 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33634"
FT                   /db_xref="InterPro:IPR016633"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVX0"
FT                   /protein_id="ABP33634.1"
FT                   /translation="MRWDIFCQIVDNYGDAGVCWRLARSLSSLHGQEVRIFCDDLPTLN
FT                   LLASGVDPRIKEKIDIQPWEASHENVRHPVKVPDVVVEAFGCELPERYLTNLFIAPIKP
FT                   IIINLEYLSAEPWVSEFHGKASPQSHGIPKYFFFPGFQDDVGGLLLDPIPPIGSLVENQ
FT                   IPKDLQALWSTLRPNAKRISIFCYPGAPLRKWLSDLAALGENVDILLAHGHAEQLNLYG
FT                   EQPIELPNNLKLFSMPFVSQDEYDWVLSQCDFNIVRGEDSFIRAQLAGKPFIWHIYPQE
FT                   DRAHEVKLAAFLDLYLSDASQDLKLATIAAMTWAMPSDWFNSLQIWNKHAQAWRTHLLE
FT                   KQGDGGLAARLVRFIA"
FT   gene            405332..407194
FT                   /locus_tag="Pnuc_0415"
FT   CDS_pept        405332..407194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0415"
FT                   /product="Excinuclease ABC subunit C"
FT                   /note="TIGRFAM: excinuclease ABC, C subunit; PFAM:
FT                   Excinuclease ABC, C subunit domain protein; excinuclease
FT                   ABC, C subunit domain protein; UvrB/UvrC protein; KEGG:
FT                   rme:Rmet_2410 excinuclease ABC, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33635"
FT                   /db_xref="GOA:A4SVX1"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVX1"
FT                   /protein_id="ABP33635.1"
FT                   /translation="MPGVYRFFDEAGNILYVGKARNLKKRVSSYFQRTQLSPRIELMVG
FT                   KIARYETTVTRTETEALILENNLIKELAPPFNILFRDDKSYPYVMLTGHQFPRLASYRG
FT                   KVDKRNHYFGPFPNSWAVRNSVQILQKVFRLRTCEDSVFKNRSRPCLLHQIHRCSAPCV
FT                   GRLSVEQYSQDVAQATRFLEGDHSRVLSELEKEMHVHSEAMEFEMAAILRDRIADLSSV
FT                   LQQQAMDTVAEGEGDVDVIAVALMEGMVCVNLAMVRGGRHLGDRAYFPKGLRSSSGELP
FT                   SPTEILEAFIAQHYLDETAGEEVSVTNLIPPVIVMNHALQAAGDEITTLSESPPEDLHD
FT                   LLNAQAGRKITFLHQPQGQRRHWLAMAEGNAKIALTKRLVETGGQLARARALVDILSLD
FT                   LEGLEHLRIECFDISHTSGEATQASCVVYAKNAMQSSEYRRFNINDITPGDDYAAMRQV
FT                   LQRRYANFQELPPEKMPQVILVDGGKGQVEMARQVLTEFGMDVSLIVGVAKGEGRKVGL
FT                   ETLIFADGREPLELGIDSAALLLVAQIRDEAHRFAITGMRAKRAKARTVSRLEEIEGIG
FT                   AKRRQKLLARFGGLKGVANASIEEIASVEGVSLTLAEQIYRQLH"
FT   gene            407229..407804
FT                   /locus_tag="Pnuc_0416"
FT   CDS_pept        407229..407804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0416"
FT                   /product="CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /EC_number="2.7.8.5"
FT                   /note="KEGG: reh:H16_A2546
FT                   CDP-diacylglycerol-glycerol-3-phosphate
FT                   3-phosphatidyltransferase; TIGRFAM:
FT                   CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase; PFAM: CDP-alcohol
FT                   phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33636"
FT                   /db_xref="GOA:A4SVX2"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVX2"
FT                   /protein_id="ABP33636.1"
FT                   /translation="MPFNLPIALTWLRVAAIPLLVAIFYLPNTWLTPFDKNLFAVVIFI
FT                   SAAITDWLDGFLARRLKQESAFGQFLDPVADKLIVAAALLVLLNLDRVQVWVALVIIGR
FT                   EITISALREWMALLGAGKSVAVHMVGKLKTTAQLVAIPFLLLNDTLFGWLDCAKIGTWL
FT                   IWIAAFLTLWSMFYYLKKALPQLAGKID"
FT   gene            407922..407997
FT                   /locus_tag="Pnuc_R0012"
FT                   /note="tRNA-Gly2"
FT   tRNA            407922..407997
FT                   /locus_tag="Pnuc_R0012"
FT                   /product="tRNA-Gly"
FT   gene            408047..408120
FT                   /locus_tag="Pnuc_R0013"
FT                   /note="tRNA-Cys1"
FT   tRNA            408047..408120
FT                   /locus_tag="Pnuc_R0013"
FT                   /product="tRNA-Cys"
FT   gene            408206..408667
FT                   /locus_tag="Pnuc_0417"
FT   CDS_pept        408206..408667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0417"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mag:amb4330 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33637"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVX3"
FT                   /protein_id="ABP33637.1"
FT                   /translation="MIKLHTLKLSASAIFLSALLGACASSGDSPTGTPEEVQELQSQLL
FT                   GDMLLPQGARLNGTDSIIIGRGNEWVGRAVVNAVQGATDVYAFFQSEYPKNGWTTVTAV
FT                   KAKTSILVFTKADRTATIEVMDGSLGGPKSIIIITSSPKNANVIAPTRK"
FT   sig_peptide     408206..408289
FT                   /locus_tag="Pnuc_0417"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.686 at
FT                   residue 28"
FT   gene            complement(408733..409452)
FT                   /locus_tag="Pnuc_0418"
FT   CDS_pept        complement(408733..409452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0418"
FT                   /product="SOS-response transcriptional repressor, LexA"
FT                   /note="KEGG: pol:Bpro_2954 SOS-response transcriptional
FT                   repressor, LexA; TIGRFAM: LexA repressor; PFAM: peptidase
FT                   S24, S26A and S26B; LexA DNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33638"
FT                   /db_xref="GOA:A4SVX4"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVX4"
FT                   /protein_id="ABP33638.1"
FT                   /translation="MDINTVDYPEELTALPKLTPRQSEILELITKAIDESGLPPTRAEI
FT                   ATQLGFASANAAEEHLRALAKKGYIELTPGTSRGIRIPQRFNQTHHTNKYRQMSLPSGA
FT                   LQQLTLPLIGRVAAGSPIMAVEHIEKQVPIDPSLFSKGADYLLKVKGMSMRDAGILDGD
FT                   YLAVRKTTEVRNGDIVVARLDDEVTVKRWQQKKTANGMVIELQAENPDFKNIVVDSRQP
FT                   NFAIEGQAVGLIRAEGL"
FT   gene            409512..410588
FT                   /locus_tag="Pnuc_0419"
FT   CDS_pept        409512..410588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0419"
FT                   /product="Asparaginase/glutaminase"
FT                   /note="PFAM: Asparaginase/glutaminase; KEGG: reu:Reut_A2007
FT                   L-asparaginase, type II"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33639"
FT                   /db_xref="GOA:A4SVX5"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVX5"
FT                   /protein_id="ABP33639.1"
FT                   /translation="MSSLQNNPTNSPHILVLGMGGTIAGLAANPSDKPMEYEAGQIEVA
FT                   SLLTQIASAVPEGVQLVSKQVANINSRNLTEPLMSILGQAVRTSLADPVVLGVVVTHGT
FT                   DTLEETGIFLQLTCGKYAQNLGKRVILTGAMLPANAPKADGPSNLLDAIRWASTPIDNC
FT                   PGGIYAVMDGRGCMAMDLAKRHGSALNAPIQNSPSSSVGLINPSWLSGVKAVQELWTED
FT                   LPIPKEDEWPWVEILTSHAGARSETITHWLTTKVKGLVLAGSGMGGFHDAWRDSLFAAV
FT                   KHGIALVRTTRTGAGETFQDIPDKDPSGCLASGSLSAPRARIALQLALNAEKQSLSSGK
FT                   PLTWQDFFARIAVLPVIR"
FT   gene            410724..411098
FT                   /locus_tag="Pnuc_0420"
FT   CDS_pept        410724..411098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0420"
FT                   /product="SSU ribosomal protein S6P"
FT                   /note="PFAM: ribosomal protein S6; KEGG: bxe:Bxe_A2456 30S
FT                   ribosomal protein S6, RpsF"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33640"
FT                   /db_xref="GOA:A4SVX6"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SVX6"
FT                   /protein_id="ABP33640.1"
FT                   /translation="MRHYEIVFIVHPDQSEQVPAMIDRYKATLAAAGGKIHRIEDWGRR
FT                   QMAYMIDKLAKAHYVCMNIECDQKTLEELEHAFKFNDAVLRHLIIKTKKAETEPSIMMK
FT                   EVQREEARKSAQSDAPAVAA"
FT   gene            411159..411452
FT                   /locus_tag="Pnuc_0421"
FT   CDS_pept        411159..411452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0421"
FT                   /product="putative primosomal replication protein N, PriB"
FT                   /note="KEGG: bxe:Bxe_A2455 putative primosomal replication
FT                   protein N, PriB"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33641"
FT                   /db_xref="GOA:A4SVX7"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR023646"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVX7"
FT                   /protein_id="ABP33641.1"
FT                   /translation="MNHFTLTAILVSKDAIRFTPAGIPVMHCQLEHSGQANEVGVARKI
FT                   QMSVEAIAIGPIQKDLEQMDLGAQAVFEGFLAPKTLRNQRLVFHITHIQLKN"
FT   gene            411466..411738
FT                   /locus_tag="Pnuc_0422"
FT   CDS_pept        411466..411738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0422"
FT                   /product="SSU ribosomal protein S18P"
FT                   /note="PFAM: ribosomal protein S18; KEGG: bte:BTH_I2181
FT                   ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33642"
FT                   /db_xref="GOA:A4SVX8"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SVX8"
FT                   /protein_id="ABP33642.1"
FT                   /translation="MAFGKKPDFKKKPAQNPLFKRKRYCRFTVAGVEQIDYKDVDTLKD
FT                   FIGENAKITPARLTGTKAKYQRQLDTAIKRARYLALLPFSDQHKK"
FT   gene            411752..412204
FT                   /locus_tag="Pnuc_0423"
FT   CDS_pept        411752..412204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0423"
FT                   /product="LSU ribosomal protein L9P"
FT                   /note="PFAM: ribosomal protein L9; KEGG: rso:RSc1310 50S
FT                   ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33643"
FT                   /db_xref="GOA:A4SVX9"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SVX9"
FT                   /protein_id="ABP33643.1"
FT                   /translation="MQIILLEKVTNLGNLGDVVRVKDGFARNFLIPQRKARRATEAAIA
FT                   DFAVRRAELEKLAAEKLAAAEAVGTKLKDLVLEIGQKAGVDGRLFGSVTNHDIADALKA
FT                   KGFTIEKSSVRMPTGPLKMVGDHPVAVAVHTDVVADITIRVVGEQA"
FT   gene            412229..414724
FT                   /locus_tag="Pnuc_0424"
FT   CDS_pept        412229..414724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0424"
FT                   /product="DnaB domain protein helicase, C-terminal domain
FT                   protein"
FT                   /note="PFAM: DnaB domain protein helicase, N-terminal
FT                   domain protein; DnaB domain protein helicase, C-terminal
FT                   domain protein; KEGG: pol:Bpro_3033 DnaB-like
FT                   helicase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33644"
FT                   /db_xref="GOA:A4SVY0"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR004860"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVY0"
FT                   /protein_id="ABP33644.1"
FT                   /translation="MAESRSRSVTLNPGMMGSGDPVVQALKVPPHSVEAEQSLLGGLLI
FT                   DNTAWDRLGGVLSEKDFYRPEHALIYKVIARLVSDNHPADVITVHEAVKSEQGGDLVGI
FT                   DYLNSLAQSTPSAANIKGYADIVRDRSILRRLIEVSDNIVNSAFVPEGRSVRTLLDEAE
FT                   SRILQIGEEGSRKADYLEIEPLLRTVVARIDELYNRQGGSDITGIATGFIDLDKQTSGL
FT                   QKGDLVIVAGRPSMGKAQPLDAKVKTVDGWKLMGDLRFGDRLASVDGQHSMVTGIYPQG
FT                   IKQIYKVTFSDGREAECCDEHLWRVMYREWNEPRVINTARLIEMLSCSRYKSRLWFDPV
FT                   SGDFGHSEELPIHPWVLGALLGDGTLALSHSSVMFSTKSSELIERMNMLAGYEMELVHA
FT                   NAYDWRLVSKERVAVNGQRQSVPTNYFRSALQDLGVLGCRSFDKYIPATYLEANKASRL
FT                   ALFQGLMDTDGWIEKWGSIRFCTASKQLSEDVASLARSLGGFCSIARKQSSYTYKGEKK
FT                   QGRLAYVLNMSFGPSFQAFTLPEKCERLRSQWDRQRRITFKSIEPNRTAQAQCVSVSHP
FT                   SRTYVTNDYVVTHNTAFALNIAENVALAEGLPVVVFSMEMSGEQLAARLLGSVGRVDQG
FT                   RMRTGKLQDDEWPRVTDAIARLSNTQILIDETGALSSLELRARARRIARNFGGTLGLVV
FT                   IDYLQLMSGSGSENRATEISEISRSLKSLAKELQCPVVALSQLNRGLEQRPNKRPIMSD
FT                   LRESGAIEQDADLIMFIYRDEVYHPDTTTDKGMAEIIIGKQRNGPIGTVRLSWQGPYTK
FT                   FDNLAMGSIGYSSGGYEPF"
FT   gene            complement(414823..415089)
FT                   /locus_tag="Pnuc_0425"
FT   CDS_pept        complement(414823..415089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0425"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:bsl4187 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33645"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVY1"
FT                   /protein_id="ABP33645.1"
FT                   /translation="MKKIIIALSIALSFALPTYAFADQAACEAKAVSKEGKPLYGAAKD
FT                   ASIKKCMGGAKTDDCEAKAVSKDGKPLYGAAKTASIKKCEGGK"
FT   sig_peptide     complement(415021..415089)
FT                   /locus_tag="Pnuc_0425"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 23"
FT   gene            complement(415164..415985)
FT                   /locus_tag="Pnuc_0426"
FT   CDS_pept        complement(415164..415985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0426"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   rso:RSc2662 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33646"
FT                   /db_xref="GOA:A4SVY2"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVY2"
FT                   /protein_id="ABP33646.1"
FT                   /translation="MKDIEFDRIQDLVINAATDVGLKILAALAFWIIGRWLIGVALRIT
FT                   KSALGHQKIDHTILRYLNSALSITLNILLVIGILGFFGIQTTSFAALIATAGVAIGASW
FT                   AGLLSNFAAGVFIIALRPFKVGDGVTICGITGTVREIGLFSSTISTPDNVITLIGNNKI
FT                   LGDTIQNYSDTPYRRVDLKCQLSASADREAAMKLLREKISTIPNVLQNPPVEVNILEFN
FT                   LVGAVLAVRPYCSNSNYWQVYFETNRVMSAALEEANFPTPVASQHMIMKQD"
FT   gene            complement(416011..416544)
FT                   /locus_tag="Pnuc_0427"
FT   CDS_pept        complement(416011..416544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0427"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: bxe:Bxe_A2393 putative
FT                   transmembrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33647"
FT                   /db_xref="GOA:A4SVY3"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVY3"
FT                   /protein_id="ABP33647.1"
FT                   /translation="MLPTHFKKALSCRTLIGCGIFICIILTLSGCSIFSSKSNSSRVAQ
FT                   FKQDTSVGTEDISIAAVGLVDVPYRYGGNTPKGGFDCSGLIVYVYNKAAGIKLPRTIQL
FT                   MSTQGRSVENQPPAPGDLVFFNTTGEKYSHAGIYVGQGRFVHAPSAGGTVRLDHITTPY
FT                   WAAKFTEARRITSQ"
FT   sig_peptide     complement(416422..416544)
FT                   /locus_tag="Pnuc_0427"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.770) with cleavage site probability 0.562 at
FT                   residue 41"
FT   gene            complement(416525..418171)
FT                   /locus_tag="Pnuc_0428"
FT   CDS_pept        complement(416525..418171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0428"
FT                   /product="PhoH family protein"
FT                   /note="PFAM: PhoH family protein; SMART: Nucleotide binding
FT                   protein, PINc; KEGG: rme:Rmet_1970 PhoH-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33648"
FT                   /db_xref="GOA:A4SVY4"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVY4"
FT                   /protein_id="ABP33648.1"
FT                   /translation="MPLPPIPTQIADQVKLSRKDTPDLKKRPSQAKPVVVEASNWTNDA
FT                   EEDLSAAEVALEKIKMDRSPTRNAQKAAAPAKPKRVIRTGPPSLFVLDTNVLMHDPSSL
FT                   FRFSEHDLYLPMTTLEELDNHKKGMTEVARNARTVSRSLDQLIANTSGTLDDGIPLNKL
FT                   GNDDVSGRLYFQTKLATQALPEGLPEGKGDNLILAVVSELQKTRKGQEVVLVSKDINMR
FT                   IKARALGLPAEDYFNDQVLEDRDLMYSGVMSLPADFWPKHGKDMESWADSKSGTMFYRV
FT                   TGPSVPSMLINQFVYQENPDGSTPFYALVKEINGKTALLQTLRDFSHQKNNVWSVTARN
FT                   REQNFAMNLLMNPDVDFVTLLGQAGTGKTLLALAAGLEQVLDSKRYNEIIITRATVPVG
FT                   EDIGFLPGTEEEKMQPWMGAFDDNLEVLQRNDDAGEWGRAATQELIRSRIKVKSMNFMR
FT                   GRTFVSKFVIIDEAQNLTPKQMKTLVTRAGPGTKIVCLGNIAQIDTPYLTEGSSGLTYV
FT                   VDRFKGWRHGGHITLARGERSRLADHAADAL"
FT   gene            complement(418404..418871)
FT                   /locus_tag="Pnuc_0429"
FT   CDS_pept        complement(418404..418871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0429"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   rso:RSc1317 probable bacterioferritin comigratory
FT                   oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33649"
FT                   /db_xref="GOA:A4SVY5"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVY5"
FT                   /protein_id="ABP33649.1"
FT                   /translation="MTVAIGQPIPPCSIPATSSLTFSPASAKGKKLVLYFYPKDMTPGC
FT                   TAESGEFRDNIEAFTKANTLIVGVSRDSLKSHDNFRSKLQLPFELVADTEEILCQLFGV
FT                   IKMKNMYGKQVRGIERSTFLFDSSGKLAQEWRGLKVPGHVTDVLQAAQATK"
FT   gene            complement(418904..419821)
FT                   /locus_tag="Pnuc_0430"
FT   CDS_pept        complement(418904..419821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0430"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   bam:Bamb_1801 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33650"
FT                   /db_xref="GOA:A4SVY6"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVY6"
FT                   /protein_id="ABP33650.1"
FT                   /translation="MAKIALKVDVDTLRGTKEGVPNLARTLKRFDLKASFLFSLGPDHT
FT                   GWALKRVFRPGFLKKVSRTSVVEHYGIKTLLYGVFLPGPDIGKKAAAEMREIDQAGHET
FT                   GIHTWDHVAWQDAVRDQDATWTKAMMQKSWDRFVQIFGHSPVTYGAAGWQMNTAAFEQL
FT                   DQWGIQYSSDGRAEPNLMPYRLALPSGKAKHVQYPTTLPTFDELIGIDGADEFGAVKKL
FT                   LEITQSNPNDQVFTLHAELEGQKLLPAFEQLLAGWLNQGHELVTMGELHKSWEATKQLD
FT                   KIAVLPLTWGEIPNRSGELIIQHN"
FT   gene            complement(419834..420880)
FT                   /locus_tag="Pnuc_0431"
FT   CDS_pept        complement(419834..420880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0431"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   bur:Bcep18194_A5163 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33651"
FT                   /db_xref="GOA:A4SVY7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVY7"
FT                   /protein_id="ABP33651.1"
FT                   /translation="MKKVLILGVNGFIGHHLSKRILETTSWDVYGMDMQNDRLGDLINH
FT                   PRMHFFEGDITINKEWVEYHIRKCDVILPLVAIATPATYVQQPLKVFELDFEANLPIVR
FT                   SAVKYKKHLVFPSTSEVYGMCEDSEFDPSKSNMVYGPINKPRWIYACSKQLMDRVIWGY
FT                   GMEGLRFTLFRPFNWIGPGLDSIYTPKEGSSRVVTQFLGHIVRGEPINLVDGGAQKRAF
FT                   TYIDDGIDALMHIIANKDGIANGKIYNIGNPKNNHSVRELANQMLDIARSIPEYAKTAN
FT                   DVKIVETTSGAYYGEGYQDVQNRVPAIDNTMSELGWKPTTTMADALKNIFEAYRQDVDK
FT                   ARHLVDKE"
FT   gene            complement(420916..421785)
FT                   /locus_tag="Pnuc_0432"
FT   CDS_pept        complement(420916..421785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0432"
FT                   /product="formyl transferase domain protein"
FT                   /note="PFAM: formyl transferase domain protein; KEGG:
FT                   rso:RSc1320 methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33652"
FT                   /db_xref="GOA:A4SVY8"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVY8"
FT                   /protein_id="ABP33652.1"
FT                   /translation="MHAVVFAYHNVGVGCLKALIAAGIKVDLVVTHQDDPNENVWFGSV
FT                   AQLCQEKNIDCITPNASQLVELIPRLRALAPDYIFSFYYRHMISAEILAIAKIAALNMH
FT                   GSLLPKYRGRAPVNWAILHGESETGATLHVMEAKPDAGDIVGQASVAIGPDETATEVFG
FT                   KVSQAAVKVITQVLPDLITGKITRKPNELEKGSYFGGRKPSDGQIHWDQTALQVHNLVR
FT                   AVAPPYPGAFTDHQGKTMIVSKTSLKGPFAANLDLGLAGIQVVDNRVFGICGDRQAVEI
FT                   LEWFPAGK"
FT   gene            complement(421786..422748)
FT                   /locus_tag="Pnuc_0433"
FT   CDS_pept        complement(421786..422748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0433"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   rso:RSc1321 putative polymixin resistance
FT                   glycosyltransferase transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33653"
FT                   /db_xref="GOA:A4SVY9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVY9"
FT                   /protein_id="ABP33653.1"
FT                   /translation="MTANLVANPKLSIVIPVYNEEDGLQALFDRLYPALDALAAKRKIA
FT                   YEIVFVNDGSKDRSAGILAKQVELRPDVTRAVIFHSNFGQHMAIMAGFEYAQGEHIITL
FT                   DADLQNPPEEIDALTEQLLNGHDYVGTIRSARQDSFFRKFASRLMNRLREKITRITMTD
FT                   QGCMLRGYSRRIVDLVRQCDESNTFIPALAYTFAANPTEITVKHEERFAGESKYSLYQL
FT                   IRLNFDLVTGFSVMPLQIFSILGMLLALAAGSLFVYLLVRRFVLGAEVEGVFTLFALTF
FT                   FLIGVMLFGLGLLGEYIGRIYQQVRERPRYVVQTVLEKK"
FT   gene            complement(422790..423950)
FT                   /locus_tag="Pnuc_0434"
FT   CDS_pept        complement(422790..423950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0434"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase;
FT                   aromatic amino acid beta-eliminating lyase/threonine
FT                   aldolase; KEGG: rso:RSc1322 putative aminotransferase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33654"
FT                   /db_xref="GOA:A4SVZ0"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVZ0"
FT                   /protein_id="ABP33654.1"
FT                   /translation="MSAPTFIPFTRPNFNQETIDAVAEVLRSGWVTSGPKLAEFESTLS
FT                   EYFGGRPVRCFANGTATMKIALQVAGIGPGDEVITTPISWVATSNVILGVGAKPVFVDI
FT                   DPITRNIDLNKVANAITPKTRAIMPVYLAGLPVDMDRLYAIANQYKLRVIEDAAQAFGS
FT                   QWQGKRIGSIGDLVSFSFQANKNLSTVEGGCLVLNNEAEAKLAEKLRLQGLTRQGMDGM
FT                   DVDVLGGKDNLTDVNAVIGLEQLKQLPSYQTRRAALARQYFDLIRTELKSAGLEDLNLE
FT                   LPVESFTDTNWHMFQVVLPLDQITIDRAQVMMELKDLGIGTGVHYPAITGFTLYKDQGY
FT                   KTSDTPIAERIGRSILTLPLFPAMTDEDIGRIAKGLVGILKKYRKN"
FT   gene            complement(423960..425654)
FT                   /locus_tag="Pnuc_0435"
FT   CDS_pept        complement(423960..425654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0435"
FT                   /product="glycosyl transferase, family 39"
FT                   /note="PFAM: glycosyl transferase, family 39; KEGG:
FT                   bxe:Bxe_A2384 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33655"
FT                   /db_xref="GOA:A4SVZ1"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="InterPro:IPR040845"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVZ1"
FT                   /protein_id="ABP33655.1"
FT                   /translation="MQFGQIRQSSALHPGKILLLVIIYGLLWFGTLNYRHLIPSDEGRY
FT                   AEMAREMLVTGDWVTPRYNGYQYFEKPPLQVWATAVTFQIFGIGDWQARLWTALTGFLT
FT                   ILAIGFTGARIYNARVGWLAAVVLASSPMWVISGHFNSLDMGLSAFLVGAVCSLLLAQT
FT                   SHNKSSSRNWMWACWFFMALATLSKGLIGVAIPAMVFIVYSFSAGDWKIWTRLRFFSGS
FT                   ILFLIVTAPWFVLVSIRNPVFLEFFFIHEHLQRFTQDAHSRTGPLYYFIPLLVIGLLPW
FT                   VLQLPGALIQGWNERKPTFSITWLLVCWSVVIFAFFSVSQSKLPGYIIPIFPALALLIG
FT                   NRLERLLGHTNVMPITWQLQALGFAALGCIGFFFLSAIGKQARPDEIDAYAQYVYWVIV
FT                   ALIALITFSLYAAWQCKRNGLQSIVSFAAGFFLCATIAGTGHETLGRAVSGIDLANRIK
FT                   NTIPEKVNFYSVRMLDHTMPFYLGHTMIMVEDPDELRFGVDQEPELWLPTLDAFIARWK
FT                   EDQTAYAMMVPEQFVALQSLNLPMQEVDRDSRRVIVKHPDTSTATPQ"
FT   gene            complement(425654..426031)
FT                   /locus_tag="Pnuc_0436"
FT   CDS_pept        complement(425654..426031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0436"
FT                   /product="protein of unknown function DUF498"
FT                   /note="PFAM: protein of unknown function DUF498; KEGG:
FT                   reh:H16_A2268 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33656"
FT                   /db_xref="InterPro:IPR007523"
FT                   /db_xref="InterPro:IPR036748"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVZ2"
FT                   /protein_id="ABP33656.1"
FT                   /translation="MKLQSDPHSGANTITGYGDGYVEINQTPYAHAVLLSSDGAIAEWP
FT                   VKTFEDLEAGHFSQMIDLKPELILIGTGKRQRFPKPELLKSLITAKIGFEIMDSQAACR
FT                   TYNILVGEGRQVLLALIVEPN"
FT   gene            426111..427367
FT                   /locus_tag="Pnuc_0437"
FT   CDS_pept        426111..427367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0437"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   reh:H16_A2267 aspartate/tyrosine/aromatic aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33657"
FT                   /db_xref="GOA:A4SVZ3"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVZ3"
FT                   /protein_id="ABP33657.1"
FT                   /translation="MKPILKSQKLNDVCYDIRGPVLELAQRMEEEGHKIIKLNIGNVGV
FT                   FGFDPPEEIQLDMIRNLSNASAYSDSKGIFSARKAIMQYCQEKGIQGVTLDDVYTGNGV
FT                   SELIVLSMNALLNDGDEVLVPAPDYPLWTAAVSLSGGTPVHYLCDESKEWAPDLADLRK
FT                   KITPSTKAIVVINPNNPTGAIYSKEVLVELTQIARENGLILFADEIYDKMLYDGEKHLS
FT                   LASLSTDVVIITFNGLSKNYRSCGYRAGWMVVSGDKEMVRDYIEGLNMLCSMRLCANVP
FT                   GQYAIQTALGGYQSINDLVNEGGRLARQRDLAWKLITEIPGVSCVKPKSALYLFPKLDP
FT                   EIYPIEDDQQFVADLLKDEKVLLVQGSGFNWGKPDHFRVVFLPHEDVLKEAIGRLARFL
FT                   ERYRQKHGRKASSTATKAS"
FT   gene            427364..428674
FT                   /locus_tag="Pnuc_0438"
FT   CDS_pept        427364..428674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0438"
FT                   /product="homoserine dehydrogenase"
FT                   /EC_number="1.1.1.3"
FT                   /note="PFAM: homoserine dehydrogenase; amino acid-binding
FT                   ACT domain protein; homoserine dehydrogenase, NAD-binding;
FT                   KEGG: aav:Aave_1238 homoserine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33658"
FT                   /db_xref="GOA:A4SVZ4"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR016204"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVZ4"
FT                   /protein_id="ABP33658.1"
FT                   /translation="MKPIQVGLLGIGTVGGGVFTVLERNQDEIQRRAGRGIRIHTVADL
FT                   NVERAKELVKDRAQVVSDARAVINNPEIDIVVELIGGYGIARDLVLEAIAAGKHVVTAN
FT                   KALIAVYGNEIFKAAHAKGVMVAFEAAVAGGIPIIKALREGLTANRIEWIAGIINGTTN
FT                   FILSEMRDKGLDFETVLKEAQRLGYAEADPTFDIEGVDAAHKATIMSAIAFGIPMQFEK
FT                   AHVEGITKLAAIDIRYAEQLGYRIKLLGIAKKTSSGVELRVHPTLIPSKRLIANVEGAM
FT                   NAVQVFGDAVGTTLYYGKGAGSEPTASAVIADLVDITRLLSADAEHRVPYLAFQPDAVQ
FT                   DTPVLPIGEITTSYYLRMRVADQAGVLADITKILASHGVSIDALLQKEADEGESQTDLV
FT                   ALTHETKEKNMLAAIQEIQDLKTVAGEVVKIRLENLS"
FT   gene            428683..430125
FT                   /locus_tag="Pnuc_0439"
FT   CDS_pept        428683..430125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0439"
FT                   /product="L-threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /note="KEGG: rme:Rmet_1965 threonine synthase; TIGRFAM:
FT                   threonine synthase; PFAM: Pyridoxal-5'-phosphate-dependent
FT                   enzyme, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33659"
FT                   /db_xref="GOA:A4SVZ5"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVZ5"
FT                   /protein_id="ABP33659.1"
FT                   /translation="MRYQSTRGNSPQQSFLEILLGGLAPDGGLYLPTEYPQVTLAQLNS
FT                   WRGLSYADLAYEVLSLYCDDIPEADLRALLRKTYTEQVYCNGRSQDNAKDITPLHWLGE
FT                   EHGTKIGLLSLSNGPTLAFKDMAMQLLGNLFEYALKRAGQKLNILGATSGDTGSAAEYA
FT                   MRGKEGVRVFMLSPRGKMSSFQSAQMYSLQDPNIFNLAVAGVFDDCQDIVKAVSNDHAF
FT                   KAQSQIGTVNSINWGRVVAQVVYYFQGYLLATKSSKEKVSFTVPSGNFGNVCAGHIARM
FT                   MGLPIEHLIVATNENDVLDEFFRTGVYRARKSAETLQTSSPSMDISKASNFERFVFDFM
FT                   GKDGKATAGMFKQVDETGGFDISQDKVFKELGKYGFQSGRSTHQNRLETIRDIDQKYGV
FT                   MIDTHTADGVKVAREHLQAGIPMLVLETALPIKFEETIQEALGRPAECPPAFRDIKSHP
FT                   QRVENIDADVNQVKAFITAHLN"
FT   gene            430157..431398
FT                   /locus_tag="Pnuc_0440"
FT   CDS_pept        430157..431398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0440"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain; PFAM:
FT                   molybdopterin binding domain; MoeA domain protein, domain I
FT                   and II; MoeA domain protein, domain IV; KEGG:
FT                   reu:Reut_A1991 molybdopterin binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33660"
FT                   /db_xref="GOA:A4SVZ6"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVZ6"
FT                   /protein_id="ABP33660.1"
FT                   /translation="MTKPPMLTAQQALDHLLSNAQVVSDSERVPMQAALGRVLAEDVKS
FT                   LVDVPPQDNTSMDGYAVRTADTAIPGNVLVIAQRIPAGSMGTPLHAGSAARIFTGAPIP
FT                   SGADAVVMQEDCVIPDGASDQVQINIAPSAGQWIRRQGEDLSVGKTALSAGILLRPQEL
FT                   GVAASAGLTHLNVKRRVKVAAFFTGDELALPGEPLKPGGIYNSNRDTLLACLRSLGCEA
FT                   TDLGIVPDRLDATREALRKASKDHDLIITSGGVSVGEEDHIKPAVSAEGRLDLWQIAIK
FT                   PGKPLAFGAVRKSSEPQDGEAWFIGLPGNPVSSFVTFLLFVRPFILKLQGRDVKPMQSY
FT                   FMRADFDWLKADRRNEFLRVKVNAEGGLELFPNQSSGVLTSASWGDGLVDCPPGQPVKK
FT                   GDLVKYIPFDALLT"
FT   gene            431417..431674
FT                   /locus_tag="Pnuc_0441"
FT   CDS_pept        431417..431674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0441"
FT                   /product="molybdopterin synthase subunit MoaD"
FT                   /note="TIGRFAM: molybdopterin converting factor, subunit 1;
FT                   PFAM: thiamineS protein; KEGG: bur:Bcep18194_A5152
FT                   molybdopterin converting factor, subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33661"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVZ7"
FT                   /protein_id="ABP33661.1"
FT                   /translation="MKLELRFFASLREALGVGQENIEIPDSIHTITELRVYLAQRGGAW
FT                   AEVLADGKSMRCALNHHMVDTSTRLEEGAEVAFFPPVTGG"
FT   gene            431676..432140
FT                   /locus_tag="Pnuc_0442"
FT   CDS_pept        431676..432140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0442"
FT                   /product="molybdopterin synthase subunit MoaE"
FT                   /note="PFAM: molybdopterin biosynthesis MoaE; KEGG:
FT                   dar:Daro_2729 molybdopterin biosynthesis MoaE"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33662"
FT                   /db_xref="GOA:A4SVZ8"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVZ8"
FT                   /protein_id="ABP33662.1"
FT                   /translation="MSNSVIRIQEQDFDLSAEIVALRKGDARVGAVVSFLGTVRDLSDG
FT                   SQVKGMTLEHYPGMTEKSLQAILDQAATRWNIFQTLVIHRVGLLLPEDQIVLVAVTSAH
FT                   RGEAFSACEFIMDYLKTAAPFWKKEDTPEGSRWVDARVTDETAMARWNKS"
FT   gene            432172..433830
FT                   /locus_tag="Pnuc_0443"
FT   CDS_pept        432172..433830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0443"
FT                   /product="Carboxylesterase, type B"
FT                   /note="PFAM: Carboxylesterase, type B; KEGG: nar:Saro_1730
FT                   carboxylesterase, type B"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33663"
FT                   /db_xref="GOA:A4SVZ9"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4SVZ9"
FT                   /protein_id="ABP33663.1"
FT                   /translation="MKKLIAWLFSAIALNVCAADRPVAQIEAGRLQGAIEHNMQAFKNI
FT                   PYAAPPVAELRWRPPQPALSWSGTRDASQFGDSCPQPYVKNLSTGLSLPGNEDCLKLNV
FT                   FAPKKTGKHLPVMVWIHGGGLFVDGSRDAQFTPINLVKNGVIVVTFDYRLGTFGFFATK
FT                   ELIEEAKAKGEPVGNYGTMDQIAALKWVKNNIAAFGGDPNNVTIFGESAGGRSVTWLMV
FT                   SDAAKGLFHRAIAESAQQSPLRGMTEKRLGMTPEVEIDAKYMNALGVKNLKELRNLPTK
FT                   QLVLTPAIFEEGEFGGPFIDGQILQGDPVPLFAAGKQAKVPFMIGTNSWDSSFLVPGQP
FT                   PVDKLVKMFRENPKIIDTLYAQDNDKCILSSDIMGDMFYRGSTKSLADSMRGVAPGYAY
FT                   YFDYLTKNIRPAYPGVPHTFEISFVFGSYGLMPQAPKQVESGADQCGRIAKATAELKEK
FT                   GVWSKYWYPITDKNSPEDKAMSEKMSASWAAFAKSGNPNVNGQANWPIYSLNDDVMRNF
FT                   SYDKETVTGLLKERVAYQILHMREMYAEEEIKAKF"
FT   sig_peptide     432172..432228
FT                   /locus_tag="Pnuc_0443"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 19"
FT   gene            434063..435331
FT                   /locus_tag="Pnuc_0444"
FT   CDS_pept        434063..435331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0444"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   reu:Reut_B4329 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33664"
FT                   /db_xref="GOA:A4SW00"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR026355"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW00"
FT                   /protein_id="ABP33664.1"
FT                   /translation="MTSAVMGAKSTSSNPLKSKWVQLALGVICMMSISSPQYVWALFTK
FT                   PIMGQLGVTLTELQVTFSILIVLQTFFSPFQGYLVDKFGPRLLLSIGTILTGASWVLSA
FT                   NLTTVSNLYITYGVLGGLGTGIVYIGVVGLMVRWFPNNRGFAVGMVAAGYGIGALLTTF
FT                   PIADSLAVSGIQGTLTFFGYIIGAVGLLAAQGIRVPHADRVQTAGQIEAAAAGVAPKTM
FT                   LKTPVFWVMFLMMSMMSTSGLMVISQMGAFAKDFGITSALVFGMAALPLALTIDRVTNG
FT                   LTRPLFGWVSDRIGREYTMTIAFGLEAIAMFVWVTTRTDPVLFVLLSGVVFFGWGEIFS
FT                   LFPSTLTDTFGQKHATTNYGFLYMAQGVGSIIGGPIAAYIHGATDSWMPVFAIMIVLDA
FT                   TAAILAFFVLRPMRAKYLKSRTA"
FT   sig_peptide     434063..434188
FT                   /locus_tag="Pnuc_0444"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.749) with cleavage site probability 0.690 at
FT                   residue 42"
FT   gene            complement(435404..437002)
FT                   /locus_tag="Pnuc_0445"
FT   CDS_pept        complement(435404..437002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0445"
FT                   /product="gamma-glutamyltransferase 2, Threonine peptidase,
FT                   MEROPS family T03"
FT                   /EC_number="2.3.2.2"
FT                   /note="KEGG: bxe:Bxe_B1050 gamma-glutamyltransferase;
FT                   TIGRFAM: gamma-glutamyltransferase; PFAM:
FT                   gamma-glutamyltranspeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33665"
FT                   /db_xref="GOA:A4SW01"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW01"
FT                   /protein_id="ABP33665.1"
FT                   /translation="MQPKWGIRGMAVAPHSLASESALAVLREGGNALEAMVAAAATIAV
FT                   VYPHMNSIGGDSFWVIHSPGKAMGGIDACGAAAGLATKKWYAERGITKAIPFRGAVAAN
FT                   TVAGTISGWGAAHQLSKQGLGGKLPLSRLLADAIHYAEAGTPVTFSQSSLTTKKAEELS
FT                   PIPGFAETFLVNGKAPIVGSIFKQERLAKTLRQIAKKGTDDYYRGELAESLAKELTELG
FT                   SPLRLDDLHRHHAKLIDPLELQHSMGNVYNMTPPTQGVVSLMIIGILDQLNLKRFKVDS
FT                   AQYVHHCVEATKQAFKVRDQFVTDPAYMKKHAQSFLAPAFLKKLAKNIDPEKALPWGQG
FT                   KGPADTIWMGVIDGDGNCVSFIQSIYHEFGAGIVLPTSGVNWQNRGCSFSLDPKTLNHL
FT                   EPYRKPFHTLNPAMALFKDGRSMVYGTMGGDGQPQTQCAVFTRTATYGLDPQDAISRPR
FT                   WLLGRTWGQTSDSLKLESRFSPWVAKELHALGHEIEMLDAFDETVGHAGCIIRNPSGTL
FT                   QGGWDPRSDGAVSSF"
FT   gene            complement(437122..437364)
FT                   /locus_tag="Pnuc_0446"
FT   CDS_pept        complement(437122..437364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0446"
FT                   /product="Excinuclease ABC, C subunit domain protein"
FT                   /note="PFAM: Excinuclease ABC, C subunit domain protein;
FT                   KEGG: xac:XAC3202 putative endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33666"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW02"
FT                   /protein_id="ABP33666.1"
FT                   /translation="MTWLVYLLECADGTYYAGITNRLEHRLEAHNSGQGARYTRSRRPV
FT                   ILLATQKHPNRSEASKAELRLKRLPRTEKLAFFEF"
FT   gene            437468..440071
FT                   /locus_tag="Pnuc_0447"
FT   CDS_pept        437468..440071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0447"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: AAA ATPase, central domain protein; Clp N
FT                   terminal domain protein; ATPase associated with various
FT                   cellular activities, AAA_5; ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase; KEGG: rme:Rmet_1959 ATPase AAA-2"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33667"
FT                   /db_xref="GOA:A4SW03"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW03"
FT                   /protein_id="ABP33667.1"
FT                   /translation="MRIDKLTTKFQEALSEAQSIALAKDNQYIEPAHLLLAMLRDSDGG
FT                   AKSLLTRAGVNVLGLEKGVEKLIGNLPEVQGTSGEVQVGRDLSNWLNLCEKEANKKNDQ
FT                   FIAGELFLLVVADDKGELGKVARENGLNRKSLEAAIDLVRGGESVNSADAEGQREALKK
FT                   YTVDLTERARAGKLDPVIGRDDEIRRTIQILQRRGKNNPVLIGEPGVGKTAIVEGLAQR
FT                   IVNGEVPETLKNKRVLVLDMALLLAGAKYRGEFEERLKAVLSDVAKDEGQTIIFIDEIH
FT                   TMVGAGKGDGAMDAGNMLKPALARGELHCIGATTLDEYRKYIEKDPALERRFQKVMVEE
FT                   PSVEATIAILRGLQERYELHHGIEITDPAIVAAAELSHRYITDRFLPDKAIDLIDEAGS
FT                   RIRMEIDSKPEVMDKLERRLIQLKIEREAVKKEKDEASQKRLGLIEDEIKRLGAEYADL
FT                   EEIWKAEKGAVLGAANLKEEIEKIRADIVKLQREGKLEQVAELQYSKLPELEAKLKSAA
FT                   AAEAKGDKNGVVKNKLLRTQVGAEEIAEVVSRATGIPVSKMMQGERDKLLKMEELLHKR
FT                   VVGQEEAIRAVSDAIRRSRAGLAEENRPYGSFLFLGPTGVGKTELCKALAGFLFDSEDH
FT                   LIRIDMSEFMEKHSVARLIGAPPGYVGYEEGGYLTEQVRRHPYSVILFDEIEKAHPDVF
FT                   NVLLQVLDDGRLTDGQGRTVDFKNTVIVMTSNIGSHLIQSMVDKKQAEIKEAVFEELKN
FT                   HFRPEFLNRIDEIVVFHGLDKGNIANIAKILLKNLSDRLAKVDMQLEVSDAALSKIAEV
FT                   GFDPVFGARPLKRAIQQHIENPVSKMILEGTFGPKDTVPVDVDNKGDFSFTRQVH"
FT   gene            440117..440872
FT                   /locus_tag="Pnuc_0448"
FT   CDS_pept        440117..440872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0448"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_6813 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33668"
FT                   /db_xref="InterPro:IPR018724"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW04"
FT                   /protein_id="ABP33668.1"
FT                   /translation="MTAANLSPLLTPASGLADALRNNGFAVASAETVGDIANTSLVSLE
FT                   DISHFWEGLPRDPYLKDGGRYRYRRHASYEIQSNTLTLVPHRAHWQSVDYNALHGGIER
FT                   WFEPMQAHLIANPAWQSLLLGLGALLSGQKPVTTWFVEAHQFRIDTTDGIGRPTPEGAH
FT                   RDGVDFVAVFLIDRVGIKGGETRIFEASGSTGLRFTLSQPWSLLLMNDARMIHESTPIQ
FT                   PLGNYGYRDTLVLTYRSNGFQDSPNRSQQ"
FT   gene            complement(440883..441866)
FT                   /locus_tag="Pnuc_0449"
FT   CDS_pept        complement(440883..441866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0449"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   pol:Bpro_4169 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33669"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW05"
FT                   /protein_id="ABP33669.1"
FT                   /translation="MKIKYSMKQLSLLGMGLLISLYCTLTIADNYPTKPIKAIVPFAPG
FT                   SATDQIGRAFAAKMGEALGQPVIVENRPGASGMIGADVVAKSPADGYTLLFGTNSTNAA
FT                   LKSLAKNLPYNQDTAFTPIGYFGSVPLIIAVNNDLPVKSLNGFVTLAKSDPGKVTFAYA
FT                   SASQRVSSEMLASVAGIKMTGVSYKSGPNAMTDLIGGQVNMFSSDFAVSLPQVQAGKIH
FT                   GLAVTSLKRSPAIPQLPTVNEALGIKNYELIAFFAAFGPANMPKDIVLKLNNAINEAAK
FT                   SKDLVERFSAMGFETQPGSPEALDKKIKLETAKWAKAIKEAGMEPE"
FT   sig_peptide     complement(441780..441866)
FT                   /locus_tag="Pnuc_0449"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.997 at
FT                   residue 29"
FT   gene            441951..443183
FT                   /locus_tag="Pnuc_0450"
FT   CDS_pept        441951..443183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0450"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mag:amb3967 permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33670"
FT                   /db_xref="GOA:A4SW06"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW06"
FT                   /protein_id="ABP33670.1"
FT                   /translation="MRFRSTSYTPLMLMAQTCALLGFACYAVVLTPLQEEWGLSNLQSG
FT                   LIASAFFFGYMLAVPVATALTDRIDARKVYLIGGLSAAIGLLGMGIFSHNFWTALLFMA
FT                   INGAGLAGTYMPGLKILSDRIKSGELTRHIAFYTAFFGIGTGFSYLCSGWILSLLGWRY
FT                   VFGLIALGPLLAFVIVLCFIPPLDHEKWSGPLQIRLRDLFPVDKWKIVLQDKKAAGFIF
FT                   GYTAHTIELFASRSWIVAFFAFCAISSGESFFLAITTLAGIINFFGVPASILGNEIALR
FT                   IGRQRWVCIAMITSAVLGIILASSTGHTWWLIIILAVAHAVFIMADSATLTAGLVMSAQ
FT                   ENIKGAAMGLHSLMGFGGGLLGPAIFGFVLDIAGSRSSHAAWIWAYAAIVIWGVLFVLY
FT                   ERRNGWAGKSA"
FT   sig_peptide     441951..442034
FT                   /locus_tag="Pnuc_0450"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.942 at
FT                   residue 28"
FT   gene            443192..445627
FT                   /locus_tag="Pnuc_0451"
FT   CDS_pept        443192..445627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0451"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; heavy metal translocating P-type
FT                   ATPase; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; E1-E2 ATPase-associated domain protein; KEGG:
FT                   reh:H16_A2321 putative heavy metal transporting P-type
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33671"
FT                   /db_xref="GOA:A4SW07"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR021993"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW07"
FT                   /protein_id="ABP33671.1"
FT                   /translation="MNKATHMTCYHCSSVILPGELIEAELGGILRPFCCPGCMAIAQTI
FT                   HGEGLEVFYVRRAQSGDKPAAYLASNDIPEKLKPYDDLSLRGRFTRPYGDTGVLETTLR
FT                   LEKIRCAACVWLCEQHLRRIDGVSDVQINYVTQKVMVRFSPEKTSLARLLFEIERIGYE
FT                   AWPFEPSLSLDRVKKERRQLLTRLGVALLGMMQVMMYAWPSYVGANDITPEFDLLLGWT
FT                   SWALTVPVMVYSAGPIFQSAWRSVQSFRQIHMLNMDVPIALALALAFIAGTINLITGSG
FT                   QSYFDSITMFVAFILAARYVELLARQDAQGGAEALAKQLPATCERLHSYPDSFEVEVVP
FT                   VVNCNPGEVLRVSPGEVVPADGVLIENASALDESLLTGESKPVEKKIGDRVYAGTHNIL
FT                   NPLLMRIDAVGQSTRIAGIASLLDQALLAKPVMVSLAEKWAAYFVGCLLLSAFISSAIW
FT                   LYFDPSKAWTVLVSVLVASCPCALSLAVPTAMAAAQGAVTKLGLLIVRGHVLEGLVKAS
FT                   DLVLDKTGTLTMGRPELQEVIHLRAGYRREDALALAAALESGQRHPLALSLLRAIESER
FT                   LSLPILADPVINLLGKGLSSGSYRLGSAAWLGITPDARVGQYGQVHLADDQGLIATFVF
FT                   LDTPRPGLVNLLQAAKTRNIRVHLVSGDDPATVAWWASHVGIHSYRGGCTPEDKYEYIE
FT                   QLQESGRFVWAIGDGVNDAPLLARADISIAVGAGAPLAAAGADAILTASSLEPLAKTLK
FT                   LADKTAVIIKENLLWALIYNLLAIPVAMMGLVNPWIAGIGMSLSSLAVTLNAWRLRKA"
FT   gene            445637..445813
FT                   /locus_tag="Pnuc_0452"
FT   CDS_pept        445637..445813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0452"
FT                   /product="cytochrome oxidase maturation protein, cbb3-type"
FT                   /note="TIGRFAM: cytochrome oxidase maturation protein,
FT                   cbb3-type; PFAM: cytochrome oxidase maturation protein
FT                   cbb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33672"
FT                   /db_xref="GOA:A4SW08"
FT                   /db_xref="InterPro:IPR004714"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW08"
FT                   /protein_id="ABP33672.1"
FT                   /translation="MESLYILIPLSLVLVGLLAWILHWSVKSGQFDDLNGPGESILMDD
FT                   DVPAQHKVSEHSQ"
FT   gene            445984..447426
FT                   /locus_tag="Pnuc_0453"
FT   CDS_pept        445984..447426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0453"
FT                   /product="cytochrome c oxidase, cbb3-type, subunit I"
FT                   /note="TIGRFAM: cytochrome c oxidase, cbb3-type, subunit I;
FT                   PFAM: cytochrome c oxidase, subunit I; KEGG: rme:Rmet_2044
FT                   cytochrome c oxidase, cbb3-type, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33673"
FT                   /db_xref="GOA:A4SW09"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR004677"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW09"
FT                   /protein_id="ABP33673.1"
FT                   /translation="MGLTVGSNQDNFNYKVISQFAIVTVLWGIVGMLVGVILAAQLIWP
FT                   EITFNIPWLSYGRLRPLHTNAVIFAFGGSALFATSYYIVQRTCQVRLFCDKLAAFTFWG
FT                   WQAVIVSAAITLPLGITTSKEYAELEWPIDILITVVWVAYAVVFFGTVIKRKTKHIYVS
FT                   NWFFGAYILTIAVLHIVNNIEMPASLFKSYSAYSGAQDAMIQWWYGHNAVGFFLTTSFL
FT                   GMMYYFIPKQAERPIYSYRLSIVHFWALNFTYMWAGPHHLQHTSLPDWTQSLGMVFSLI
FT                   LLAPSWGGMINGIMTLSGAWYKLRRDPILKFLVVALSFYGMSTFEGSMMSIKTVNSLSH
FT                   YTDWTIGHVHSGALGWVAMITIGSLYYLIPRLVGQRDMYSTKLIELHFWIATIGVVIYI
FT                   AAMWIAGVMQGLMWRAFEPDGTLTYSFVESVKATYPFYVIRLLGGLCYLSGMFIMAYNV
FT                   YKTVAHKKFIDAPIPQASIAAH"
FT   gene            447437..448087
FT                   /locus_tag="Pnuc_0454"
FT   CDS_pept        447437..448087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0454"
FT                   /product="cytochrome c oxidase, cbb3-type, subunit II"
FT                   /note="TIGRFAM: cytochrome c oxidase, cbb3-type, subunit
FT                   II; PFAM: cytochrome C oxidase, mono-heme subunit/FixO;
FT                   KEGG: rme:Rmet_2043 cytochrome c oxidase, cbb3-type,
FT                   subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33674"
FT                   /db_xref="GOA:A4SW10"
FT                   /db_xref="InterPro:IPR003468"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW10"
FT                   /protein_id="ABP33674.1"
FT                   /translation="MSEQRRFFSHETLERNVGWLIIATIAAISVAGLVQIVPLFFQHST
FT                   TEPSPGVVPYSALRLAGRDIYQREGCVGCHSQQIRTLRSEVERYGPYSLAGESVFDHPF
FT                   LWGSKRTGPDLARVGGKYSDAWHQIHLNNPRDVVPESNMPAYPWLAKNAADANTIQSHM
FT                   VAMRRLGVPYTDDDIANAPKELEGKTELDALVAYLQGLGINRRYIIVDEVVAK"
FT   gene            448087..448272
FT                   /locus_tag="Pnuc_0455"
FT   CDS_pept        448087..448272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0455"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbr:BB3327 cytochrome C oxidase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33675"
FT                   /db_xref="GOA:A4SW11"
FT                   /db_xref="InterPro:IPR008621"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW11"
FT                   /protein_id="ABP33675.1"
FT                   /translation="MLVRYLMQNIAPYLSAISTVIGLIVFIGIVWWAWSSKRQAANQES
FT                   AELPFDLPDEFIKDKS"
FT   gene            448269..449207
FT                   /locus_tag="Pnuc_0456"
FT   CDS_pept        448269..449207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0456"
FT                   /product="cytochrome c oxidase, cbb3-type, subunit III"
FT                   /note="TIGRFAM: cytochrome c oxidase, cbb3-type, subunit
FT                   III; PFAM: cytochrome c, class I; KEGG: rso:RSc1279
FT                   probable cytochrome C oxidase (subunit III) transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33676"
FT                   /db_xref="GOA:A4SW12"
FT                   /db_xref="InterPro:IPR004678"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR032858"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="InterPro:IPR038414"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW12"
FT                   /protein_id="ABP33676.1"
FT                   /translation="MSDFLGAGWSTYIALVTLVGIFWCIWLLFSQRKTKVTLKPDGQVA
FT                   DTGHVWDGDLRELNNPLPRWWMWMFLISCIFALVYLVLYPGLGSFPGILGYSTDGALMK
FT                   SMTTANDDLKPVYAKYVKMDIEQIAADPQAREMGQRLFLNSCAQCHGSDAGGAKGFPNL
FT                   TDGDWLYGGSPENIKASITNGRGGVMPPFPQLDSKQIVDVANYVRSLSGLPADDLKAAR
FT                   GAEVFKANCVACHGPDGKGNIAIGAPNLTDKTWLYGSSEATIVETVTKGRMAMMPAQDK
FT                   VLSPEKIQLLTAYVWGLSNNKQPANTSADTK"
FT   gene            449211..450668
FT                   /locus_tag="Pnuc_0457"
FT   CDS_pept        449211..450668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0457"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: rso:RSc1280 probable iron-sulfur 4Fe-4S
FT                   ferredoxin transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33677"
FT                   /db_xref="GOA:A4SW13"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014116"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR032879"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW13"
FT                   /protein_id="ABP33677.1"
FT                   /translation="MSDNSPVGKPIPIEVIEESLYEVRRKIYPRSVSGLFARWRLILVF
FT                   ATQLLFYGLPWVSWNGRQAVLFDLIQRKFYIFGLVLWPQDVIYLTLLLILSALALFLFT
FT                   AVAGRLFCGYACPQTVYTEIFMWIERKVEGDRFARIRLDGEEWPWGFKKWRLKITKHFL
FT                   WLLIAFWTGFTFIGYFTPIETLGAAVLHLSLGPWQTFWLCFYSFATWGNAGFMREQVCK
FT                   YMCPYARFQSVMVDKDTFLVTYDKVRGEPRGSRSKSADQSSLGLGDCVDCSICVQVCPT
FT                   GIDIRDGLQYMCIGCGACIDACNQVMEKVDYPKGLIRYTTERAIEDKESNQSAIRHILR
FT                   PRVLIYIAFITVLASAFLVSLVTRNPLRVDVMRDRGALAREVDGVRIENIYRIQIMNAS
FT                   EHAMKVQMKATGLDGLKILNSQGQEVTEVNVGPASNQLMPVKVSTAIGVNEPGNYPIYF
FT                   DVTAQELTGNESVTRKRDEKSSFIIPR"
FT   gene            450684..450902
FT                   /locus_tag="Pnuc_0458"
FT   CDS_pept        450684..450902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0458"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpe:BP2174 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33678"
FT                   /db_xref="GOA:A4SW14"
FT                   /db_xref="InterPro:IPR008620"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW14"
FT                   /protein_id="ABP33678.1"
FT                   /translation="MESTHMTEQEINKPWWKQLWPWLLISGPAVAVIGCAITIWLAVNL
FT                   YADKSLRDGVVKQGLKVEQIKDSQASK"
FT   gene            450899..451159
FT                   /locus_tag="Pnuc_0459"
FT   CDS_pept        450899..451159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0459"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RSc1282 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33679"
FT                   /db_xref="GOA:A4SW15"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW15"
FT                   /protein_id="ABP33679.1"
FT                   /translation="MKYRLLIWILWPSFLVAGMAEGLLFTVIQPEDLLFFGHHPDISDE
FT                   GIYTIGFFLIWTFCAVSSALTAYILPGIESPDSKEIDRGLI"
FT   sig_peptide     450899..450961
FT                   /locus_tag="Pnuc_0459"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.852) with cleavage site probability 0.632 at
FT                   residue 21"
FT   gene            complement(451156..451926)
FT                   /locus_tag="Pnuc_0460"
FT   CDS_pept        complement(451156..451926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0460"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein,
FT                   Crp; KEGG: rso:RSc1283 putative fumarate and nitrate
FT                   reduction regulatory transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33680"
FT                   /db_xref="GOA:A4SW16"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW16"
FT                   /protein_id="ABP33680.1"
FT                   /translation="MNYKPTDTPTSKCSVCVLGQFCLPVGLSATDVTKIDSLVKERVHL
FT                   QKGESLYRHGDPLSSVYSVRFGTLKTEFCLQDGRQQVIGFHLPGEILGLDGIGDGHYQS
FT                   DAIALEESEVCIIRYEAFEDLARQIPVLQNQFHKIMSRELTQDQRHLLSLGTMRAEERL
FT                   AAFLLSLSQRLAARGYLNNEFDLRMSRVEIGSYLGMQIETVSRMLSRFAESGLIQIKQR
FT                   HIKLIDMDGLYELAGVPNPDRATCVSAEIPVKQA"
FT   gene            452000..452719
FT                   /locus_tag="Pnuc_0461"
FT   CDS_pept        452000..452719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0461"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: reu:Reut_A2033 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33681"
FT                   /db_xref="GOA:A4SW17"
FT                   /db_xref="InterPro:IPR039447"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW17"
FT                   /protein_id="ABP33681.1"
FT                   /translation="MLTSSLVLAIFLGALVSGWHCALMCGGIAAAIERPIASETPLRSK
FT                   SELFYLQLIMHLGRITTYVLLGALAAWVGVEVWRQSLIPVQRPLFALAALILILMGIRL
FT                   LSVGKSRSLVGAKWLNAKIATYWAKYIGRFASGPSRWFSGMLWGLVPCGLVYSVLPLAF
FT                   LSGDVFTGAVFMLAFGLGTLPNLLLISKFSAVLTQFGQYIWVRYFAACLLFIAGGFGLY
FT                   RAWVLPEALLKGGFCLS"
FT   sig_peptide     452000..452095
FT                   /locus_tag="Pnuc_0461"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.514 at
FT                   residue 32"
FT   gene            complement(452813..453214)
FT                   /locus_tag="Pnuc_0462"
FT   CDS_pept        complement(452813..453214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0462"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A3561 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33682"
FT                   /db_xref="GOA:A4SW18"
FT                   /db_xref="InterPro:IPR018687"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW18"
FT                   /protein_id="ABP33682.1"
FT                   /translation="MLKYIGIYLSFLISLVTIDLVWLLGIAKALYRDEMGDLMATEPKL
FT                   IAGLGFYLFYALGACIFVIAPALAKQSWIQAMQYGALFGFFCYMTYDLTNLAIIRDFPT
FT                   RLAFIDIAWGSLVTAVGAGIAYWVGERLS"
FT   gene            453310..453750
FT                   /locus_tag="Pnuc_0463"
FT   CDS_pept        453310..453750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0463"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: xcb:XC_4113
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33683"
FT                   /db_xref="GOA:A4SW19"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW19"
FT                   /protein_id="ABP33683.1"
FT                   /translation="MFKHLLVPVDGSDVSKKSLKKVAELAKADGAAVTLVYVSDPMPPM
FT                   VYSDSTMGYGISAKEHKSACEAYAKDVFKKANTALGVAIKAKALHIGNANLAEGILDGA
FT                   KKAKADVIVMASHKRTGLKGILLGSETHEVIVHSKLPVLVLG"
FT   gene            complement(453814..455268)
FT                   /locus_tag="Pnuc_0464"
FT   CDS_pept        complement(453814..455268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0464"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: peptidase M23B; KEGG: net:Neut_1544 peptidase
FT                   M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33684"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW20"
FT                   /protein_id="ABP33684.1"
FT                   /translation="MLAILDNCGVNKKATSRSPLTTRLLIALGCALLSLSLGLASSAQA
FT                   QSSQKRKKVFIQNTKSVGFKDKSAAGSAKASSSMSLNPELFQRKNPNELILDSEANLDY
FT                   RVVQGCLRRSFNEDNLPASIGIDNRQFAEFFKNQTKGFFDHMRGDCIPYAAAFTTRNRF
FT                   DSLSIMNGPFQDSKTEVWTFTPSAFGGFLVQQDFLKNESKNLTEIRVPLREVLYDPRKL
FT                   GDKLPVELVWELNSIIKQIYPEDNNSLENPNSVVRLIVDFGDRERWAQIWSAEIIDPSS
FT                   KEVFASAFWVERADLPGGFFTASGESLERTFWTNPLSYRRISRGVGMVKASSGKRSKSN
FT                   APVAQAAPNKQRYRAHMGIDYAAPIGTPVFSVANGKVVHMGFSGAFGNLIVLEHPGNYH
FT                   TYYAHLSNYNPELELGNEVRRGLEIGYVGTTGRSTGPHLHFELRKDGIYVDPYGSRTQL
FT                   DLWSMRDNESGQLTREILLLGSPINR"
FT   sig_peptide     complement(455131..455268)
FT                   /locus_tag="Pnuc_0464"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 46"
FT   gene            complement(455301..456233)
FT                   /locus_tag="Pnuc_0465"
FT   CDS_pept        complement(455301..456233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0465"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase, NAD-binding;
FT                   KEGG: bbr:BB2438 probable 3-hydroxybutyryl-CoA
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33685"
FT                   /db_xref="GOA:A4SW21"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW21"
FT                   /protein_id="ABP33685.1"
FT                   /translation="MSKVVVIGTGTMGIGIAAGFLAYGANTILLGRNPAKTTSCIEAIE
FT                   NCAASINPAWPQLGGALSTGSIADWSDWTNTDLVIESVSENLGLKRLIFSDLDQRLPSH
FT                   IPIGSNTSGFPISDITASLPTAHRMFNTHYFMPAHIVPLVEVVLGKTSDPELAKTVCQL
FT                   FQAHHKKPVLVKKDIPGFLANRIQHALMREVLSLVDEGIATPDDIDTAVRYSFGFRYAA
FT                   VGPMTQKEISGWEGMALAAELIYPSLSNITAPPACVTNLVKSGKTGIAKGEGFKQWSPE
FT                   EAAILKSNYEERLKAAFEVLKVAPDKEDH"
FT   sig_peptide     complement(456159..456233)
FT                   /locus_tag="Pnuc_0465"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.905) with cleavage site probability 0.888 at
FT                   residue 25"
FT   gene            456342..457475
FT                   /locus_tag="Pnuc_0466"
FT   CDS_pept        456342..457475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0466"
FT                   /product="Mandelate racemase/muconate lactonizing enzyme,
FT                   C-terminal domain protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   enzyme, N-terminal domain protein; Mandelate
FT                   racemase/muconate lactonizing enzyme, C-terminal domain
FT                   protein; KEGG: bbr:BB2683 putative racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33686"
FT                   /db_xref="GOA:A4SW22"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW22"
FT                   /protein_id="ABP33686.1"
FT                   /translation="MPIIESVQVASVAVPLDKVTSFSTRTVSERHYCLVKVRAKDGNEG
FT                   IGFCYVGSAGGDIAKIAVEQLLAPKLISQNSHRSEGLWMEMYNESILQGRTGAVMRGIS
FT                   ILDTALWDLNARSAKLPLHHYLGAVVDDRVPAYASGGYYLEGKTPAKLGKEMESYVKQG
FT                   FKAVKMKVGRLSPSEEEARVKAARKAIGEDILLTLDANNAWKDLPTALEYVRRFEAYNP
FT                   YWIEEPFSPDAIDLHAALARQTTINVATGEMEAGRWRFRELIDAGGVAILQSDAAVCGG
FT                   ITEWRRISAYADAKGITVCPHWMHDLHAPLVAATPNARFVEFFLDDQVLNFRRLINKQL
FT                   TFKKGDLILHQTPGLGFEFDEAAIKQYAGKAAWTKIS"
FT   gene            complement(457558..459570)
FT                   /locus_tag="Pnuc_0467"
FT   CDS_pept        complement(457558..459570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0467"
FT                   /product="TRAP transporter, 4TM/12TM fusion protein"
FT                   /note="TIGRFAM: TRAP transporter, 4TM/12TM fusion protein;
FT                   PFAM: TRAP C4-dicarboxylate transport system permease DctM
FT                   subunit; KEGG: bld:BLi02556 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33687"
FT                   /db_xref="GOA:A4SW23"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="InterPro:IPR011853"
FT                   /db_xref="InterPro:IPR021814"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW23"
FT                   /protein_id="ABP33687.1"
FT                   /translation="MNQNVIDNETQEKLEAFIKQEEGDSNDYKGLLAKFITLVAVGMSL
FT                   FHLYAAYSIVPTQELRVIHVALVLFLVFLSFPIAARFKNRLMWWDVIFALISVYVAYYI
FT                   LSGGDDFMDRNTAPNSTDVVIGIGLILLILEGVRRTNGLILVSVTVLFLLYALFGNYLP
FT                   APWTHKGYDLDRLVGYMYMTLEGIYGTAVDVSATLIILFTIFGAFLQFTGAGKFFIDFS
FT                   FAAMGGKSSGVGRTIVMSSFLLGGPSGSGVATTVTVGSVAAPMLDKVGYEKNAAGGLLA
FT                   AGGLGAIISPPVLGAAAFLIADFLKISYLDVLLMATIPTILFYLGLFVMVEIDVRKYGM
FT                   KNIHFESTESAWQLTKKYWFHFFSLISIVVFMLMGFSPVMSVFWATVVSALSSMLREDT
FT                   AIIPWTWFKGKEPILSGLYNSNLTKSLAAGSTGVLAIAATCAGAGLIVGTVTLTGLGLK
FT                   FSSIVIQYAGGSLLLTTIFTALVVWVVGLAVPVTASYIICAVIAAPALINLGVPAFAAH
FT                   MFIFYYAVLSEVSPPTALSPFAAAAICKGNPYKTTLQTWKYVAPAILVPFMFVLDKSGV
FT                   SLLLMGSTEALEQADWMQIAWISFTAVVGIICLAGGLQGWFIEKTKIFERIIMVASGVA
FT                   LAYPSTEADLVGFVGFALVLVTQTITHFKLNPRSS"
FT   gene            complement(459660..460610)
FT                   /locus_tag="Pnuc_0468"
FT   CDS_pept        complement(459660..460610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0468"
FT                   /product="TRAP transporter solute receptor, TAXI family"
FT                   /note="TIGRFAM: TRAP transporter solute receptor, TAXI
FT                   family; KEGG: afu:AF0635 immunogenic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33688"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW24"
FT                   /protein_id="ABP33688.1"
FT                   /translation="MKLLKIIALSLSLLWISAHAQNISIATGGTGGVYYPMGGGLASVL
FT                   SSKVPGMSATAEVTGGSVDNLNLIGTGKPYVGFSMADAAKDAQIGEGKFVNKKVDLRTL
FT                   VVLYPNLMHVVTVDSTGIKSMKDLKGKRVSTGAPGSATEVMAFRLLEAAGMDKDKDVKR
FT                   ERLSVAESVNAIKDRKIDAFFWVGGLPTAAVTDLANTPGTKIVMIDTNEEVTAMNKKYG
FT                   NLYFTANIPKATYSGMAKDNKVAAVANILVVNANMPDDQAYKIVKAIFDNKLELVRTHQ
FT                   EFMSVNLDNQKQKATPIDFHPGALKFFKEKNAKVN"
FT   sig_peptide     complement(460548..460610)
FT                   /locus_tag="Pnuc_0468"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.981 at
FT                   residue 21"
FT   gene            complement(460638..461564)
FT                   /locus_tag="Pnuc_0469"
FT   CDS_pept        complement(460638..461564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0469"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   pol:Bpro_3814 dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33689"
FT                   /db_xref="GOA:A4SW25"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW25"
FT                   /protein_id="ABP33689.1"
FT                   /translation="MTISLHPSTLPAVLSPVLTPFTADGSPDAEKLLKQCKWLEANGVG
FT                   QAIFGTNSEANSISAPQKMAALTKLIEGGLNPGHLMPGTGATSIDATVNMTRHALNHQC
FT                   AGVLMLPPFYYKDVTDDGLFAYFSEVIQKVGSAALQIYIYNIPPVTKINLSLSLLERLA
FT                   KEYPKTVVGMKDSSGDWAYTESVIKLLAPSGFRVYAGSEVFLMRALRAGGVGCISATAN
FT                   VNPKAIADLAAHWRESNADQRQAALDQVRGVFSKYQMIAGMKTAVAHFSKDPEWLRVRP
FT                   PLMQLSADQQAQLLSELAAIHFSMPGL"
FT   sig_peptide     complement(461487..461564)
FT                   /locus_tag="Pnuc_0469"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.740) with cleavage site probability 0.696 at
FT                   residue 26"
FT   gene            complement(461577..462506)
FT                   /locus_tag="Pnuc_0470"
FT   CDS_pept        complement(461577..462506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0470"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase, NAD-binding; KEGG: pol:Bpro_3811 D-isomer
FT                   specific 2-hydroxyacid dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33690"
FT                   /db_xref="GOA:A4SW26"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW26"
FT                   /protein_id="ABP33690.1"
FT                   /translation="MIPVNSVLQVGHFPEIMQAEIDRRLSPVRHLNLDAPIPSGNFEAI
FT                   LIRSNTKLPQSLIQQIPSIRLVATCGVGYDNLPLPYLKANNIKASNTPGVLNDAVCELA
FT                   IGMMLSLMRRIPESQEYVKSSAWSKAPFKLTTTLAGKRVGIAGMGRIGQDLAQRLEPFK
FT                   VKIAYTGPSPKKVPYTYYQSIQELAKASDVLFLACPATSKTEKLVNAKVLDALGPSGYL
FT                   INIARGSVVDEVALLDALQHNQIAGAALDVFDNEPNPNSAFFSLNNVLLTPHIGSATSE
FT                   TRIAMTNLAVDNLEAFFTQQPLPSEVNN"
FT   gene            462592..463533
FT                   /locus_tag="Pnuc_0471"
FT   CDS_pept        462592..463533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0471"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase, NAD-binding;
FT                   KEGG: reh:H16_B1652 3-hydroxyacyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33691"
FT                   /db_xref="GOA:A4SW27"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW27"
FT                   /protein_id="ABP33691.1"
FT                   /translation="MLFTPAETKVVIVGGGTMGADVAAVCARGGCAVQVVEPTTERRAL
FT                   LPDYFVNTMTDLGYEHRIHLLTVAGSLEEVDWADVDLVIECVPERLDIKQELFAKLEKY
FT                   AKPEAVLASNSTSFPISEIASGLKTAARMIGLHFFMPAHLVPCVEVVYGEKTSPMVGDS
FT                   LSRLMTACGMVPVTVKKDLPGFLANRLQHALSREAFAMVDAGICTPEDIDKAVRFGFGF
FT                   RYIAAGPAMQRDHAGLEVHAAGGAKIYPSLNNSPTIAKCLSDRVESGKFGMKTGEGFFP
FT                   WTAETIKAERERYQDALRAGLKIIQKDLPEIK"
FT   gene            complement(463554..464759)
FT                   /locus_tag="Pnuc_0472"
FT   CDS_pept        complement(463554..464759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0472"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: protein of unknown function DUF894, DitE;
FT                   major facilitator superfamily MFS_1; KEGG: mfa:Mfla_2622
FT                   major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33692"
FT                   /db_xref="GOA:A4SW28"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW28"
FT                   /protein_id="ABP33692.1"
FT                   /translation="MNPSKAFRTLLLYRIGATLSYQITMVAVGWHLYEITNSVVSLGLV
FT                   GLAELVPYFLLALYAGHAVDHYSRKLIAAFACLIHIAVALFLTGIALGWLTPPVPLIYT
FT                   AIAFIGAGRALLRPSYTAIFGQIIPRAQLPRYTAYASSAFQICVVAGPGLGGLLIGFAG
FT                   LEWTYLMAAFCGALGLYGITFIHAPPEKISQLGGHFFKSFLEGFHYVRKHELILGIMAL
FT                   DMFAVLFGGAVSILPAFVKEILDAGPEVLGILRAAPAAGAVITGIYLARRPLLTDSGKH
FT                   LFLSVAGFGLAIIAFGISNHLWICAFFLFISGCCDSVSVVIRGSIMQLTTPDHMRGRIS
FT                   AINGIFIGSSNELGALESGIAASLMGLVPSIVFGGVATIAIVLITYKLAPHLSKLHLKD
FT                   IS"
FT   gene            464803..465483
FT                   /locus_tag="Pnuc_0473"
FT   CDS_pept        464803..465483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0473"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: azo:azo0089 conserved
FT                   hypothetical hydrogenase cytochrome b-type subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33693"
FT                   /db_xref="GOA:A4SW29"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW29"
FT                   /protein_id="ABP33693.1"
FT                   /translation="MKKMIRIWDLPLRLFHWLLVACIVGSLICVNIGGNAIEYHAYFGY
FT                   SILTLLIFRLVWGFVGSTHARFTSFFPSPAKIIHYLQGSSPRVLGHNPIGALSVFALLF
FT                   VLCVQAFTGLFVDDEIAFQGPLAKFASGSVVSFLSEIHEGNQVVIYTLITIHIAAIWYY
FT                   NKFKGENLIKPMITGDKEIDPSEEAKYLPTDLGRASKDGGLQRAFALVLLSVIAVVVGY
FT                   FITQ"
FT   gene            complement(465484..465936)
FT                   /locus_tag="Pnuc_0474"
FT   CDS_pept        complement(465484..465936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0474"
FT                   /product="cytochrome c, class II"
FT                   /note="PFAM: cytochrome c, class II; KEGG: pna:Pnap_0216
FT                   cytochrome c, class II"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33694"
FT                   /db_xref="GOA:A4SW30"
FT                   /db_xref="InterPro:IPR002321"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="InterPro:IPR012127"
FT                   /db_xref="InterPro:IPR015984"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW30"
FT                   /protein_id="ABP33694.1"
FT                   /translation="MTIRKIILAGAAIALTISASTTFAQFQNADKAVEYRESVMTVIGT
FT                   HFGRIGAVVKGDVPYNKDEVAKNAAIVAMMSTLPWQAFGPGTEGGKAKPEVWSDNAKFK
FT                   AAAEKMQLAAANLNTAAQSGDLDNIKKAFGATGQACKGCHDDFKKK"
FT   sig_peptide     complement(465862..465936)
FT                   /locus_tag="Pnuc_0474"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.960 at
FT                   residue 25"
FT   gene            complement(466007..466726)
FT                   /locus_tag="Pnuc_0475"
FT   CDS_pept        complement(466007..466726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0475"
FT                   /product="peptidase M50"
FT                   /note="PFAM: peptidase M50; KEGG: aav:Aave_3710 peptidase
FT                   M50"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33695"
FT                   /db_xref="GOA:A4SW31"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW31"
FT                   /protein_id="ABP33695.1"
FT                   /translation="MNRVSFLQSLLRSYGYHIAMITDYSIQAVAINAIPLIFAITIHEA
FT                   AHGYAARKFGDNTAYMLGRVSLNPAKHIDPVGTILIPLVLILTGSPFLVGYAKPVPVNF
FT                   GRLRNPRIDSIWVALAGPGSNFIQAILWAIFWVVVQGIGLQEPFFISMAKAGIMWNVGL
FT                   LVFNLFPLPPLDGGRILGSLLPARQSIALGRLEPWGFFIVLGLVFTGIIGSLWMEPLSN
FT                   FFLGIINLLITPLRMLF"
FT   gene            467058..467837
FT                   /locus_tag="Pnuc_0476"
FT   CDS_pept        467058..467837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0476"
FT                   /product="Extradiol ring-cleavage dioxygenase, class III
FT                   enzyme, subunit B"
FT                   /note="PFAM: Extradiol ring-cleavage dioxygenase, class III
FT                   enzyme, subunit B; KEGG: eca:ECA0327 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33696"
FT                   /db_xref="GOA:A4SW32"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR014436"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW32"
FT                   /protein_id="ABP33696.1"
FT                   /translation="MTSHRQPAVFAGHGSPMYAIEPNRYTQAWANLGKNLKRPDAILVI
FT                   SAHWVTRGTWVTAMAKPKTIHDFGGFPQTLFDIQYPAPGSPALADRVQELLDIPIVLEE
FT                   NEWGIDHGAWSVLKYLYPNADVPVVQLSLDGSMSAREHYELAKQLRPLRDENILILASG
FT                   NVVHNLRTIHWQDDAQPYPWAKDFNDFFSSEIRANHHDPLIDWERYGDAAHLSIPTAEH
FT                   YWPALYILALQQDDEIAKVFIDGIEMSSISMLSFSVQ"
FT   gene            467849..468226
FT                   /locus_tag="Pnuc_0477"
FT   CDS_pept        467849..468226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0477"
FT                   /product="camphor resistance protein CrcB"
FT                   /note="TIGRFAM: CrcB protein; PFAM: Camphor resistance CrcB
FT                   protein; KEGG: bte:BTH_I1520 CrcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33697"
FT                   /db_xref="GOA:A4SW33"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SW33"
FT                   /protein_id="ABP33697.1"
FT                   /translation="MWLSILAIFCGAGLGALLRTGFNLLSVGVASVIPLGTLISNMVGG
FT                   YLIGIALAFFGNNPHLSPEWKLLIITGFLGGLTTFSSFSAEVVTMIQRGEFTWALGTAL
FT                   LHLVGSLVLTLLGIWTYQAIK"
FT   gene            complement(468249..469226)
FT                   /locus_tag="Pnuc_0478"
FT   CDS_pept        complement(468249..469226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0478"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   bpa:BPP4256 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33698"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW34"
FT                   /protein_id="ABP33698.1"
FT                   /translation="MNFFKLIFISIAAIASLSSSGAFAQANYPNKPINFIVPYGAGGGA
FT                   DSRSRQIAQKMSIILKQPIIVDNKPGAGGNIGTEYISRAAPDGYTIGMGNFAPMAVNKT
FT                   LFGNLRYDPEADLTPIVLIEKGPLVLVVNPNSPYKTVQDIVAAAKAKPGVLTFSSGGIG
FT                   GSHQLSAELFKQSAGIDMIHVPYKSGSAGLTDLMAGNVTMMFDQMYSALPSIKADKLRP
FT                   IAITSKKRSPLLPSIPTFAEAGYPKVEVLNWQGLIAPKGTPKAIIDKLNAAANEALKDP
FT                   QLRELMLSQGNEIGGGSPAEFAALIKAESAKWSSVVKTANIKPE"
FT   sig_peptide     complement(469152..469226)
FT                   /locus_tag="Pnuc_0478"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 25"
FT   gene            complement(469242..469784)
FT                   /locus_tag="Pnuc_0479"
FT   CDS_pept        complement(469242..469784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0479"
FT                   /product="Chromate transporter"
FT                   /note="PFAM: Chromate transporter; KEGG: dar:Daro_3385
FT                   chromate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33699"
FT                   /db_xref="GOA:A4SW35"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW35"
FT                   /protein_id="ABP33699.1"
FT                   /translation="MEESEEMISTLASLFLKLSVFSLFAFGGINALLPTLYDLAVNQEQ
FT                   WINGQTFADYFAIAQAAPGPNLMTVTLIGWNVGGIFGAAIATLAIAWPSSIMIYFLQRS
FT                   INNMQDKDKQKSIQFAAGALAVGLVLSASWQIALQINQSTAAYLLTIGTIAITFFTRWH
FT                   PLYLIVIGALLGVMGFI"
FT   gene            complement(469763..470299)
FT                   /locus_tag="Pnuc_0480"
FT   CDS_pept        complement(469763..470299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0480"
FT                   /product="Chromate transporter"
FT                   /note="PFAM: Chromate transporter; KEGG: dar:Daro_3386
FT                   chromate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33700"
FT                   /db_xref="GOA:A4SW36"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW36"
FT                   /protein_id="ABP33700.1"
FT                   /translation="MKTLTPKQLFIGFSKIGMSGFGGVLPWARRTIVEEEHWLTSEEFS
FT                   AMLGICQIVPGPNIVNLGVCVGSRFAGIPGAIAAVMGLLLGPVALVIVLGILYGHYSYM
FT                   PLVQGMLRGVSAVGVGLIASTGFKMMRSELQYPPMLAVIILTVLAATYFHLGLGWVVLI
FT                   SSPLALLLAWKKVKR"
FT   gene            complement(470317..471294)
FT                   /locus_tag="Pnuc_0481"
FT   CDS_pept        complement(470317..471294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0481"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase, NAD-binding; KEGG: pol:Bpro_1268 D-isomer
FT                   specific 2-hydroxyacid dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33701"
FT                   /db_xref="GOA:A4SW37"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW37"
FT                   /protein_id="ABP33701.1"
FT                   /translation="MASVPNIVVLGDYEHALRRFPNWEKLETQANLKIYHEPLRDEALY
FT                   QVIKDADAIAIVRDRAPMNEAMIARLHHLKFLMFTGERNGTLDAKALMARNITVACSPG
FT                   GPSKETTAELTWALILGASKRLIEENKLIASGGWRDELSLLPMLAGERLGIMGLGAIGS
FT                   RVARVGAAFGMEVVAWSPRMTPERAALENAKSVSLEELLKTSKVVSMHLVAGPGTKGII
FT                   STEQLALMRPDSILVNTSRAALINMGDLQKALVAGRPGQAAVDVFDVEPLPKDDPLRNT
FT                   ANLLVTPHLGFIAEPIFAAFSKGIIEALEAWLENKPAPHPFNPQ"
FT   gene            complement(471317..472690)
FT                   /locus_tag="Pnuc_0482"
FT   CDS_pept        complement(471317..472690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0482"
FT                   /product="MmgE/PrpD family protein"
FT                   /note="PFAM: MmgE/PrpD family protein; KEGG: pol:Bpro_1269
FT                   MmgE/PrpD"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33702"
FT                   /db_xref="GOA:A4SW38"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW38"
FT                   /protein_id="ABP33702.1"
FT                   /translation="MSHAIAAAADLNAPPVTKILAEFVTSHPSQGWTPEVDHEAHRTFL
FT                   NWLGCAIGAANHESVESSLAAIREFQPAPQASILGRKDKVDMGGAALINGISSHTFDFD
FT                   DTHLKTVIHPAGPVASAILALGEHINSNGRQIIDSLVLGIDVACRVGNAMYPDHYHRGW
FT                   HITGSTGMLGSAAACSRLMGLDLQKTTMALGIAASQPVGMREQFGTMTKPFHPGGAARA
FT                   GQLSALLAKHGFTSSPKALEAGRGYMQTVSTKCDWSEIDRALGKSFEISLNTYKPFACG
FT                   IVIHPAIDACAQLRAQGVKAEDVESIELRVHPLVLELTGKKTPKDGLEGKFSVYHGCAV
FT                   GLIFGQAGEGEYADDIVNRPDVVALRAKVNATTDTSISEASVDVKAFLKDGKEVHIFVK
FT                   NAIGSVENPMSDTHLEQKFTSLAEPVIGKEKTRQLISALWKLGQASDLKQILSLCTPE"
FT   gene            complement(472738..473742)
FT                   /locus_tag="Pnuc_0483"
FT   CDS_pept        complement(472738..473742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0483"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   pol:Bpro_1270 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33703"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW39"
FT                   /protein_id="ABP33703.1"
FT                   /translation="MTKTSNRRAPIFLSYALLAFTALTGSLSAYAQAAGPTYPVKPIKL
FT                   IAPVAAGGGLDNIARAVAEKLSRSIGQPVIVENMGGGGGSIASQATAKAPADGYTLMIA
FT                   YVGTHGTNPAVRRLPYDAIKDFTPIGMIGATPNVLIINPELPIKNFSEFVAYAKKNPAK
FT                   LSYGSAGPGTLTHLGMEQLKLAAGIFMVHVPYRGVGPAYTDLLAGQTQAMFPTLFAALP
FT                   YITTNRVRGLAVTGAKRSPAAPTIPTFKELGYNGFDGQQWYGVVGPANLPPAIVSKLNT
FT                   ELNKVLATPEFSEKMTSEAMTLMPMTPTQFATYIKEDIARWAKVAKDRNIELE"
FT   sig_peptide     complement(473641..473742)
FT                   /locus_tag="Pnuc_0483"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.776 at
FT                   residue 34"
FT   gene            complement(473825..474607)
FT                   /locus_tag="Pnuc_0484"
FT   CDS_pept        complement(473825..474607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0484"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: reh:H16_A0899
FT                   predicted sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33704"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW40"
FT                   /protein_id="ABP33704.1"
FT                   /translation="MREKMKSILNIAAYLFVSLDALTDLRAKMLDECNARNLKGTILLT
FT                   GEGINMFLAGGENEMRGFLEWLRSDPRFQTMQAKESWSDTQPFKKMLIKLKNEIIRMNH
FT                   PSIRPEEGRANFIAPKKLQEWLDRGTDDLGRPVVMVDTRNAFEVEYGTFENALHFNIEK
FT                   FTEFPAAISAQKEALAGKTLVSFCTGGIRCEKSGLYMREIGMDHSYQLEGGILKYFEEV
FT                   GAAHYKGSCFVFDEREALEPNLETIPIEQSIRKKLKTE"
FT   gene            474684..475685
FT                   /locus_tag="Pnuc_0485"
FT   CDS_pept        474684..475685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0485"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   pol:Bpro_1056 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33705"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW41"
FT                   /protein_id="ABP33705.1"
FT                   /translation="MLNSVKIAKRALFVGLMALGLSSLSWAQSGGVGTWPAQKPIRLIA
FT                   VFPPGGSVDQVARILAPALQSELKQNVIVENVGGASGVIGTSAMTRSDPDGYTFAVVFD
FT                   THGVNPSLKDKLPYDTIKDIAPVILVGTSPMVLVASKNSGITSFKQLVEQSKAGKKFSY
FT                   GSIGIGSLGHLAMARLAKQAGFDWNHIPYRGGGPLMQDVLGGQVELAIGSEFLVKPHIE
FT                   SGGVIPLVITTAKRSPSLPNVPTIAESGFPGFSAPAWWAVLAPGKTPPAIVNAMNQAIN
FT                   KALKNPAVAAKFKAQGIEIVGGSPETLREFIGKQIAVWGKFVIENNIKETGQ"
FT   sig_peptide     474684..474767
FT                   /locus_tag="Pnuc_0485"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 28"
FT   gene            475695..476246
FT                   /locus_tag="Pnuc_0486"
FT   CDS_pept        475695..476246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0486"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   bxe:Bxe_C0965 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33706"
FT                   /db_xref="GOA:A4SW42"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW42"
FT                   /protein_id="ABP33706.1"
FT                   /translation="MSERLIPYQPMDLAEPAELVAAIRKRRGGQFINLDRMLLHSVPIA
FT                   EGWNHFIGEIRNNLSLDPKLRELAMCGVAVLNGAEYEFFHHAPPFKKAGGTEEQVQGLR
FT                   LIGQATFPRQLFSQVENDAADLTFQMTRNIKVDGTLMKRLQQELGSTDTVELVTVIAAY
FT                   NMVSRFLIALDVNPEDHPPA"
FT   gene            476254..477108
FT                   /locus_tag="Pnuc_0487"
FT   CDS_pept        476254..477108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0487"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein domain protein; Pirin
FT                   domain protein; KEGG: maq:Maqu_3553 pirin domain protein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33707"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW43"
FT                   /protein_id="ABP33707.1"
FT                   /translation="MIRNIQTIIPGIATSDGAGVKLRRSLGGQEQLRLDPFLMLDEFSS
FT                   NDPNDYVAGFPAHPHRGFETVTYMLEGHMLHEDHLGNQGHLKTGGVQWMTTGRGIIHSE
FT                   MPQQVSGAMRGFQLWINLPAQEKMKPAGYQDIQVEEIPRVELEHGGSIKVIAGSYEGAD
FT                   GAIQGPIQGITTAPLFLDVNLPPHIEFEHRIAKEFNAFLYLYKGELEVGGPMRPAPTQA
FT                   AIVLGDGDRLKVKSGEAGAQFIVLAALPLHEPIVQYGPFVMNTRAEIEQAIDDYQNNRF
FT                   VIS"
FT   gene            477109..478278
FT                   /locus_tag="Pnuc_0488"
FT   CDS_pept        477109..478278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0488"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; KEGG: bte:BTH_I2943
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33708"
FT                   /db_xref="GOA:A4SW44"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW44"
FT                   /protein_id="ABP33708.1"
FT                   /translation="MNIQWNQGELSHSAKWHSENGIRPHQKVIAADDTLTADVAYRLAC
FT                   EGTAMLWTGDFQNAKQLLQALIRRVDKPSKKSQRIDRLEKEKSKSPVDIFNLHRLSQSQ
FT                   RARILGMVLIPINADHSISLRRAPELTQACMEAYGAQQEAYVVSLRELLGVISAHEWRK
FT                   KGVPILVRDDEEIRIHPHYGVFSPIRGEYIELLLKAPLPKAIQKSSIAFDIGVGTGVLS
FT                   VVLAVREVKKIIATDQDDRAIACAQENIERLGLESQIVVLKTNLFPDDKAALIVCNPPW
FT                   LPARPSSTLEYAVYDPESQMLKGFLQGLKDHLLPGGEGWLILSDLAEHLGLRTREELRD
FT                   WIDQAGLQVLDRMNTKPSHRKAFDPTDALYKARSAELTSLWRLAPKTSL"
FT   gene            478310..480166
FT                   /locus_tag="Pnuc_0489"
FT   CDS_pept        478310..480166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0489"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: cph:Cpha266_1841
FT                   TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33709"
FT                   /db_xref="GOA:A4SW45"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029489"
FT                   /db_xref="InterPro:IPR037919"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW45"
FT                   /protein_id="ABP33709.1"
FT                   /translation="MFQEVFQALQNNQFLEAESLLQEMLLASPENPDVLHLLGIVCGMQ
FT                   NRPDDALRFFEQALQLTPDNSALHFNTAKALSTLQRDMDALEHHRKALAIDPDNPEIWL
FT                   NYGRSLDNLRKREEALTCYEKAVVLQPQMAEGWFNKGKILGELRRYAEALQSYINAYQL
FT                   RPTEPFLLGIILHYKMLICDWADLDGIYLKIQQDLHAHQLVVEPFGFQGISTSEQDLLE
FT                   SAKIFAKQRFPARKKAVIQSAPKSKNEKIRIAYLCGEFRDQATSVLMTGVYESHDPEYF
FT                   EIYALDNGWDDGGVLRPRMKKAFKEIIDISQMTDPAVVSLIEDLQIDILVNLNGYFGEG
FT                   RQNIFASHPAPIQVNYLGFPGTLGAEYMDYLIADPIVIPADSRQYYVEKIAYMPNSYQA
FT                   NDSKRVISAREFTRAELGLPESGFVYCCFNNNYKITPETFDSWMRILKAVEGSVLWLIQ
FT                   DNVPAEENLKAEALKRGISSDRIIFAQRLPLPEHLARHKIADLFLDTLPYNAHTTASDA
FT                   LWAGVPVLTLLGNTFPGRVAASLLNAVGLAELVTHTPQAYEQRAIELARDPLALRAIQD
FT                   RLVENRLTKPLFDTVLFTQDLEVLYKKMVERYRANLAPENIS"
FT   gene            complement(480244..480599)
FT                   /locus_tag="Pnuc_R0014"
FT   tmRNA           complement(480244..480599)
FT                   /locus_tag="Pnuc_R0014"
FT                   /note="tmRNA as predicted by Rfam (RF00023), score 148.58"
FT   gene            complement(480665..481339)
FT                   /locus_tag="Pnuc_0490"
FT   CDS_pept        complement(480665..481339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0490"
FT                   /product="phosphoglycolate phosphatase"
FT                   /EC_number="3.1.3.18"
FT                   /note="KEGG: reh:H16_A0786 predicted phosphatase; TIGRFAM:
FT                   phosphoglycolate phosphatase ; HAD-superfamily hydrolase,
FT                   subfamily IA, variant 3; HAD-superfamily hydrolase,
FT                   subfamily IA, variant 1; PFAM: Haloacid dehalogenase domain
FT                   protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33710"
FT                   /db_xref="GOA:A4SW46"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW46"
FT                   /protein_id="ABP33710.1"
FT                   /translation="MKQSPYHGIFFDLDGTLADTAPDLVAATNQLLIARNLAPKPYEFL
FT                   RPYASAGARGLLEGAFGISTDHPDFAVLRDEFFANYENALHVESKLFEDMDSLLDQMDQ
FT                   ANLPWGIVTNKSERFTNPLVELMGLHKRSVSTVSGDTTAHAKPHPEPILHAARLANVDP
FT                   SKSLYIGDDIRDVVAGKAAGMKTVAAAYGYCGCKEPPEAWGADYIVNSPLELLQIIFPN
FT                   KV"
FT   gene            complement(481336..482025)
FT                   /locus_tag="Pnuc_0491"
FT   CDS_pept        complement(481336..482025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0491"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase"
FT                   /EC_number="2.1.1.64"
FT                   /note="KEGG: bbr:BB3475 3-demethylubiquinone-9
FT                   3-methyltransferase; TIGRFAM: ubiquinone biosynthesis
FT                   O-methyltransferase; PFAM:
FT                   Cyclopropane-fatty-acyl-phospholipid synthase; UbiE/COQ5
FT                   methyltransferase; Methyltransferase type 11;
FT                   Methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33711"
FT                   /db_xref="GOA:A4SW47"
FT                   /db_xref="InterPro:IPR010233"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW47"
FT                   /protein_id="ABP33711.1"
FT                   /translation="MNVDQSEIAKFSALAHRWWDPNSEFKPLHAINPLRLNWIKTFIDL
FT                   DGKKVLDVGCGGGILAESISQSGADTTGIDLSDKALKVAELHALEVGANLTYRSISAEA
FT                   LAEEQPEQYDVVTCMEMLEHVPDPASVVRACATLCKPGGTLFFSTLNRSPKSYLFAIIG
FT                   AEYILKLLPKGTHEYTKFIKPSELVAFTRHAGLELLGMKGLSYNPITQVYSLNNDLDVN
FT                   YMIAVRK"
FT   gene            complement(482120..482683)
FT                   /locus_tag="Pnuc_0492"
FT   CDS_pept        complement(482120..482683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0492"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: ajs:Ajs_2463
FT                   OmpA/MotB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33712"
FT                   /db_xref="GOA:A4SW48"
FT                   /db_xref="InterPro:IPR002368"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW48"
FT                   /protein_id="ABP33712.1"
FT                   /translation="MNKTLKVLLASVITVSATAAMASDNWQNGDGTLNWKNGDGTLCWR
FT                   DNNWTPATAAKGCDGALTAAAAGVSQSKITLQADTLYDFNKSDLKPEGKATLDKIAADL
FT                   SKIKLEVIIAVGNTDSVGTDAYNMALGQRRAQSVKTYLVSKGVDASRIYTESKGKSNPV
FT                   ASNATAEGRAKNRRTDIEVVGTAK"
FT   sig_peptide     complement(482615..482683)
FT                   /locus_tag="Pnuc_0492"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            482843..485545
FT                   /locus_tag="Pnuc_0493"
FT   CDS_pept        482843..485545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0493"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="TIGRFAM: DNA gyrase, A subunit; PFAM: DNA
FT                   gyrase/topoisomerase IV, subunit A; DNA gyrase C-terminal
FT                   repeat, beta-propeller; KEGG: reh:H16_A0789 DNA gyrase
FT                   subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33713"
FT                   /db_xref="GOA:A4SW49"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW49"
FT                   /protein_id="ABP33713.1"
FT                   /translation="MEQAAKETLPISLEDEMRRSYLDYAMSVIVGRALPDVRDGLKPVH
FT                   RRVLFAMYELNNDWNRAYKKSARIVGDVIGKYHPHGDSAVYDTIVRMAQDFSLRYMLVD
FT                   GQGNFGSVDGDNAAAMRYTEIRLRKIAHDLLADLDKETVDFGPNYDGSEKEPLILPAKV
FT                   PNLLINGSSGIAVGMATNIPPHNLDEVISACLHVLHNPECTIDELIEIIPAPDFPTAGI
FT                   IYGVQGVREGYRTGRGRVVMRAKTHFEDLDKGARQAIIVDELPYQVNKKNLLERIAELV
FT                   NEKKVEGISDLRDESDKSGMRVVIELKRGEVPEVVLNNLYKSTQLQDNFGMNMVALVDN
FT                   QPRLLNLKQMLEYFLQHRREVVTRRTIFELRKARDRGHVLEGLAVALANIDEFIAIIKA
FT                   AANPVVAKQELMGKAWDSSMVREMLARAETDTPGGRNAYRPEGLLPEYGMQTTGLYRLS
FT                   DSQAQEILQMRLQRLTGLEQDKIVNEYKEVMSEISDLLDLLAKPERVTQVIETELKEVQ
FT                   AEFGVAGGDTGRRSFIEMNATELFTEDLITPQDMVVTLSNTGYMKSQPLSEYRAQKRGG
FT                   RGKQAAATKNEDWIDTLFVANTHDIILCFSDRGRMYWLKVWEVPQGSRTSRGKPIVNMF
FT                   PLIEGEKITVILPIKGYQDDHYVFMATSLGTVKKTRLSDFSNPRKAGIIAVDLNENDFL
FT                   VGAAITDGQHDVMLFSDAGKAVRFDENDVRPMGRTARGVRGMNLGDGHQVIAMLVAPAE
FT                   AAEGAEAAVVDANGAAIPSSVLTATENGYGKRTPIAEYTRHGRGTKGMIAIQTTERNGK
FT                   VVAAALVSPEDQIMLITTGGILVRTRVSEIREMGRATQGVTLINVDEGTRLSGLQRIAE
FT                   SDSDDETDEEGDASAEPADDTNSDVAGDA"
FT   gene            485572..486669
FT                   /locus_tag="Pnuc_0494"
FT   CDS_pept        485572..486669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0494"
FT                   /product="phosphoserine aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.52"
FT                   /note="KEGG: bam:Bamb_0918 phosphoserine aminotransferase;
FT                   TIGRFAM: phosphoserine aminotransferase; PFAM:
FT                   aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33714"
FT                   /db_xref="GOA:A4SW50"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW50"
FT                   /protein_id="ABP33714.1"
FT                   /translation="MTFDRRIFNFAAGPATLPEEVLKQAADEMLNWRGLGTSVMEISHR
FT                   SKEFMEVYEEVIHDLRTLMNIPDAYEILLLQGGGLGQNAAIPMNLMPLAKNGPKADYIV
FT                   TGIWSEKSFKEAQKYGVANLVASSAAEKFNTIPAKSSWQLSNDAAYVLYCANETIGGVE
FT                   FPDVPDVGNTPLVADISSNILSKEMDVTKCAVWFGGAQKNIGPSGVTIVIVRKDFIGHS
FT                   MGITPTIWDWSVQANTQSMINTPPTFSIYMAGLGFKWLLKQGGVKVIEKRNQEKADLLY
FT                   SFLDQSSLYENRVTKEYRSRMNVTFFLKDENLNTEFLAQSNAAGLVALRGHKAAGGMRA
FT                   SIYNAMPIEGVKALIEFMRDFERRA"
FT   gene            486669..487748
FT                   /locus_tag="Pnuc_0495"
FT   CDS_pept        486669..487748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0495"
FT                   /product="chorismate mutase"
FT                   /EC_number="5.4.99.5"
FT                   /note="TIGRFAM: chorismate mutase; PFAM: prephenate
FT                   dehydratase; Chorismate mutase; amino acid-binding ACT
FT                   domain protein; KEGG: bxe:Bxe_A0977 bifunctional,
FT                   chorismate mutase/prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33715"
FT                   /db_xref="GOA:A4SW51"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR010957"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW51"
FT                   /protein_id="ABP33715.1"
FT                   /translation="MSTEEQRLAPLREKIDALDAQILDLLTQRAKAAQEVGHVKGGFSS
FT                   PVFRPERERQVVARLQEINNGPLLPDGIAAIWREVMSACRALEARQTIAYLGPVGTFSE
FT                   QAAQTYFGHSIAGLPCASLDEVFKAVEKGAAQFGVVPVENSSEGAISRTLDLLLDSSMQ
FT                   ISGEVVLPIRHHLLTKSGNLDGVTTVCAHAQALAQCQQWLSIHAPQLKRQAVSSNAEAA
FT                   RLAAADPTLAAIAGDPAQEAYGLQAVAAQIQDDPHNRTRFVVVGKYACQSTGKDQTSLV
FT                   LSVDNQPGAVHRLLAPLAKHGVSMNRFESRPARKGTWEYHFYIDIAGHADDDKVVKALE
FT                   ELKGVAAFYKNLGSYPHSA"
FT   gene            487798..488922
FT                   /locus_tag="Pnuc_0496"
FT   CDS_pept        487798..488922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0496"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="TIGRFAM: histidinol-phosphate aminotransferase;
FT                   PFAM: aminotransferase, class I and II; KEGG: reh:H16_A0793
FT                   histidinol-phosphate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33716"
FT                   /db_xref="GOA:A4SW52"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW52"
FT                   /protein_id="ABP33716.1"
FT                   /translation="MTSKIGLKHIHAIAPYVGGRPISEVAREYGLDETKIVKLASNENP
FT                   LGMPKSAQEAMLKAASDLGRYPDSNGFELKNVLASRLGVPTDWITLGNGSNDILELAAR
FT                   AVAQAGDEVIFSKHAFAVYPLATQAVGAKAVEVDATAMYGHNLPAMLTAIKAAGDKAKL
FT                   VFVANPNNPTGSYLTAKEIEDFLMAVPSNVVVVLDEAYNEYLNLEQRYDAIAWVKRFAN
FT                   MILSRSFSKAYGLAGLRIGYGVAQPHLTDLLNRIRQPFNVNSLAQAAAIAAFQDQAFLQ
FT                   QGFELNLAGYGQLTTAFDELGLRYLPSAGNFVLVKVGEDDQAGARINLALLKRGIIVRP
FT                   VGNYGLPQWLRISIGLPEENAAFIGALKAILAPQ"
FT   gene            488942..489823
FT                   /locus_tag="Pnuc_0497"
FT   CDS_pept        488942..489823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0497"
FT                   /product="prephenate dehydrogenase"
FT                   /EC_number="1.3.1.12"
FT                   /note="PFAM: Prephenate dehydrogenase; NADP oxidoreductase,
FT                   coenzyme F420-dependent; 6-phosphogluconate dehydrogenase,
FT                   NAD-binding; NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase domain protein; Ketopantoate reductase
FT                   ApbA/PanE, N-terminal domain protein; KEGG: reu:Reut_A2573
FT                   prephenate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33717"
FT                   /db_xref="GOA:A4SW53"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW53"
FT                   /protein_id="ABP33717.1"
FT                   /translation="MTIINPASNYGTVTIVGVGLIGASLGLALKQAGVVTKVLGVGRSK
FT                   ENLDQAQKMGAIDGVVDLVEAAKQSDVIVLCVPVAQMRTAFEIIEPHLEPRTMITDAGS
FT                   TKGDVILAAKEVLGKKACQFVPAHPIAGGAQHGAAAAKADLFQGKQTIICPLQENSPED
FT                   TALIAGLWESVGSEVKKIGNVQHDAIYAAVSHLPHILSYALMASVVNSEDADQKLSHVG
FT                   AGFKDFTRIAASSPEMWRDICLGNRTAILKEVDQYLLIVNHMRKLIAENDGAGLEKLFN
FT                   KASKARQDLDVL"
FT   gene            489823..491151
FT                   /locus_tag="Pnuc_0498"
FT   CDS_pept        489823..491151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0498"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /note="KEGG: rme:Rmet_0719 3-phosphoshikimate
FT                   1-carboxyvinyltransferase; TIGRFAM: 3-phosphoshikimate
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33718"
FT                   /db_xref="GOA:A4SW54"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW54"
FT                   /protein_id="ABP33718.1"
FT                   /translation="MSGIPEITIGPFTRAQGSIVLPGSKSISNRALLLAALASGTTTLK
FT                   NLLDADDTQVMRNALRQLGLSVIDQANHVCVVKGCGGQFPVREADLFMGNAGTAIRPLT
FT                   AALAMQGGNYRLSGVARMHERPIRDLVDGLRQVGAKIDYELQEGYPPIKILAADIQIKD
FT                   VVKVRGDVSSQFLTALLMALPLVAQEAVRIEVIGELISRPYIDITLKLMARFGVNVACP
FT                   DAQSFVIPAKTSDAVYKSPGNLSVEGDASSASYFLALGALGAGPVRVLGVGKDSIQGDV
FT                   AFADALALMGAKITAGEDWIEVSGVKNAGGKLNGITLDCTEIPDAAMTLAVAALFAEGQ
FT                   TRLNNIASWRVKETDRIAAMAKELKKIGAIVEEGADYIVVQAPAALGDWKSPSEGIDTY
FT                   DDHRMAMCFSLATLGPNTLKINDPNCVAKTFPTYFAEFAKIVS"
FT   gene            491156..491818
FT                   /locus_tag="Pnuc_0499"
FT   CDS_pept        491156..491818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0499"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /note="KEGG: mfa:Mfla_1072 cytidylate kinase; TIGRFAM:
FT                   cytidylate kinase; PFAM: cytidylate kinase region"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33719"
FT                   /db_xref="GOA:A4SW55"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SW55"
FT                   /protein_id="ABP33719.1"
FT                   /translation="MSAIPVIAIDGPTASGKGTVASLVAEKLGFHYLDSGALYRLVALA
FT                   SEKHGIDVKNGPELGLLVPKLLISFKNSQIFLDDDEVTDAIRTESIGLRASALAVHPEV
FT                   RSALVGLQRSFRQFPGLVADGRDMASVIFPDAVLKVFLTATAAARAERRYKQLIAKGIS
FT                   AKLSDLLQDLQERDARDSSRGTAPLLVADGAKVLETSDLSIDQAVKTVLDWYQSAIA"
FT   gene            491964..493637
FT                   /locus_tag="Pnuc_0500"
FT   CDS_pept        491964..493637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0500"
FT                   /product="SSU ribosomal protein S1P"
FT                   /note="TIGRFAM: ribosomal protein S1; PFAM: RNA binding S1
FT                   domain protein; KEGG: rme:Rmet_0722 ribosomal protein S1"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33720"
FT                   /db_xref="GOA:A4SW56"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW56"
FT                   /protein_id="ABP33720.1"
FT                   /translation="MSESFAELFEESLTRSNMKTGQVISAEVLRIDHNFVVVNAGLKSE
FT                   AFIPVEEFHNDAGEIEVAPGDFVSVAIDALENGYGDTILSRDKAKRLASWLNLEKALEQ
FT                   AEIVTGTVTGKVKGGLTVMVNGIRAFLPGSLVDTRPIKDTSPYEGKTMEFKVIKLDRKR
FT                   NNVVLSRRAVVEASQGEERAKLMSNLKEGAVVTGLVKNITDYGAFVDLGGIDGLLHITD
FT                   LAWRRVRHPSEMLTVGQEVTAKILKFDQEKNRVSLGVKQLGDDPWVGIARRYPPNTRLF
FT                   GKVTNLTDYGAFVEIESGIEGLVHVSEMDWTNKNVAPSKATALGTEVEVMVLDIDEDKR
FT                   RISLGIKQCKANPWEEFARSQQKGDKLSGAIKSITDFGVFIGLPGGIDGLVHLSDLSWN
FT                   EPGEEAVKKYKKGDEVEATVLAIDVEKERISLGIKQLSGDPFNNYTSVSDKGSLVTGTV
FT                   KAVDAKGATIHLADEVEAYLRASEISTDRVEDARNVLKEGDSVTAMIINIDRKSRVINL
FT                   SIKAKDSSDQQDAMSKLQGDAQSGTTNLGALLKAKLDNQG"
FT   gene            493690..494034
FT                   /locus_tag="Pnuc_0501"
FT   CDS_pept        493690..494034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0501"
FT                   /product="integration host factor, beta subunit"
FT                   /note="TIGRFAM: integration host factor, beta subunit;
FT                   PFAM: histone family protein DNA-binding protein; KEGG:
FT                   rme:Rmet_0723 integration host factor, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33721"
FT                   /db_xref="GOA:A4SW57"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005685"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW57"
FT                   /protein_id="ABP33721.1"
FT                   /translation="MTDQEQQAITRSELVESLAEQFPQLLPRDVELAVKTLLDTMTQAL
FT                   AEGKRIELRGVGSFVLHHRPARTGRNPKSGEKVLIPEKRVPHFKPGKELRERVDYKPLK
FT                   QAGPKEGSGA"
FT   gene            494095..495306
FT                   /locus_tag="Pnuc_0502"
FT   CDS_pept        494095..495306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0502"
FT                   /product="Tetratricopeptide domain protein"
FT                   /note="SMART: Tetratricopeptide domain protein; KEGG:
FT                   bam:Bamb_0926 tetratricopeptide domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33722"
FT                   /db_xref="GOA:A4SW58"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR030865"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW58"
FT                   /protein_id="ABP33722.1"
FT                   /translation="MIQIATSWLLLLPIMFGIGWLASRWDLRLENRMDERERMRQQRST
FT                   FKGLSLLLNEQPDQAIETLVKIAQLDPETIELHFSLGNLFRRRGETERAIRVHQHLANR
FT                   DDLKLRDRDHAAYELGRDFLRAGLLDRAEASLNRVGDGKYAVPAKESLLEMYQVERDWK
FT                   KAIIAATELESLQGKSHHTEIAQFHCELGQDALRRKDLVEVEQSIQRALQAVPNHARAL
FT                   ILQGDYFMATERPAQAIEAWSVIASLHPAYMHLLADRWMLAHTALSKENEGLDRLVELL
FT                   KTQASGELLDIVHKQLTVIRGPQAANAMLSEVMQHSPSLSALSKMAETRLALEQGSASP
FT                   ERILELQSILNLLRQRTTSLARYTCGNCGFRARRFYWQCPGCNHWEAYSPRRSEGVAPS
FT                   GPSM"
FT   gene            495341..496705
FT                   /locus_tag="Pnuc_0503"
FT   CDS_pept        495341..496705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0503"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="PFAM: UDP-glucose/GDP-mannose dehydrogenase; KEGG:
FT                   reu:Reut_A2565 UDP-glucose 6-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33723"
FT                   /db_xref="GOA:A4SW59"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW59"
FT                   /protein_id="ABP33723.1"
FT                   /translation="MKVTIVGSGYVGLVTGACLAEQGNNVFCLDLDPKKIEILNSGGVP
FT                   IYEPGLKEMIERNRAAGRLQFSTDIAASVAHGDIQFIAVGTPPDEDGSADLQYVVAAAR
FT                   NIGRHMTTPKVIVDKSTVPVGTADKVSEAISEELEKRGLSTELCSVVSNPEFLKEGAAV
FT                   EDFMRPDRIVIGTESTPAGLRAKEQMRRLYAPFNRHHERTYYMDVKSAELTKYAANAML
FT                   ATRISFMNELANLADLVGADIEAVRQGIGADSRIGFGFLYPGTGYGGSCFPKDVSALSK
FT                   TAKEHGRELKILDAVEAVNEIQKYILVEKIEKRFGKDLLGMKFALWGLAFKPNTDDMRE
FT                   APSRVIIQELVKRGATIVAYDPVAMPEAKHCFDLDFQGNSEGLKKVSMVADPMAALDGC
FT                   DALVIATEWKVFHTPDFDQVMQKLTRPIIFDGRNLYEPTAMKELGIEYHGIGRHN"
FT   sig_peptide     495341..495403
FT                   /locus_tag="Pnuc_0503"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.902) with cleavage site probability 0.895 at
FT                   residue 21"
FT   gene            496683..497645
FT                   /locus_tag="Pnuc_0504"
FT   CDS_pept        496683..497645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0504"
FT                   /product="D-alpha,beta-D-heptose 7-phosphate 1-kinase"
FT                   /EC_number="2.7.1.-"
FT                   /note="TIGRFAM: rfaE bifunctional protein; PFAM: PfkB
FT                   domain protein; KEGG: reu:Reut_A2564 RfaE bifunctional
FT                   protein, domain I"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33724"
FT                   /db_xref="GOA:A4SW60"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW60"
FT                   /protein_id="ABP33724.1"
FT                   /translation="MALGDIIKSIQMEKANREQFSKTRLLVVGDVMLDRYWFGDTSRIS
FT                   PEAPVPVVQVGKIDERLGGAANVARNVAALGAQTTILGVVGNDEPGKRVAELLKSGGVD
FT                   SQLEIDADVPTIVKLRVIARQQQLIRLDFEETPSEKALAHKLERFEKLVGTADVVILSD
FT                   YGKGALGQVAHMIEQARAQNKIILVDPKGEDYEKYRGATVLTPNRSELRQVVGQWSSEE
FT                   DLTNKAQALRKSLNLEALLLTRSEEGMSLYTEAGVSHVKAQAREVFDVSGAGDTVIATL
FT                   AVAVAAKWPLEKAMALANRAGGIVVGKLGTATITSEELQ"
FT   gene            497642..498670
FT                   /locus_tag="Pnuc_0505"
FT   CDS_pept        497642..498670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0505"
FT                   /product="ADP-glyceromanno-heptose 6-epimerase precursor"
FT                   /EC_number="5.1.3.20"
FT                   /note="TIGRFAM: ADP-L-glycero-D-manno-heptose-6-epimerase;
FT                   PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; KEGG: reh:H16_A0804
FT                   ADP-D-beta-D-heptose 6-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33725"
FT                   /db_xref="GOA:A4SW61"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011912"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW61"
FT                   /protein_id="ABP33725.1"
FT                   /translation="MTIIVTGAAGFIGANIVQALNARGEKNIIAVDDLRPADKYRNLAD
FT                   LDIIDYLDKDEFLEAFRSGKLGKIKAVFHEGACSDTMETDGIFMMANNYRYTMDLLDIC
FT                   TEQKVQLLYASSAATYGGSDVFIESREHEKPLNIYGYSKFLFDQVMRKRFAENANTAQV
FT                   VGFRYFNVYGPRESHKGRMASVAFHQYHQYKANGHVKLFGEYGGYGPGEQSRDFVSVED
FT                   VVKVNLFFLDHPEISGIFNLGSGRAQPFNDVAHAVANGMRKLDKATPATLQELVKEKAI
FT                   EYIPFPDALRGKYQCFTQADLTKLRAAGYKEPFLNVEQGVGRYIEWLEANAGFLANPLD
FT                   SK"
FT   sig_peptide     497642..497701
FT                   /locus_tag="Pnuc_0505"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.665) with cleavage site probability 0.613 at
FT                   residue 20"
FT   gene            498679..499419
FT                   /locus_tag="Pnuc_0506"
FT   CDS_pept        498679..499419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0506"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dar:Daro_4102 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33726"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW62"
FT                   /protein_id="ABP33726.1"
FT                   /translation="MTKALLAFVIWIVSGAVTAQVFDIPHGEEAPTRTLLVSTAKPRAL
FT                   VLLFPGGGGVAGIFDNSSAKSRHTFVRSINLWGQYGIDAVLVDSPYDLGDLRRGNLRGR
FT                   QDHLTRVNEAVSFYKTKLHLPVWIFGHSMGTSTATYYANNLPVGQEQIAGIIIAGTIHT
FT                   ASLNKEVSLPVLGIHHASDGCAGTPLSATADIIQNRPTKYISQLDVIEGGITEGNVCDS
FT                   FAYHGFNQTEPELIKRAAQFILSH"
FT   sig_peptide     498679..498738
FT                   /locus_tag="Pnuc_0506"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 20"
FT   gene            499549..499977
FT                   /locus_tag="Pnuc_0507"
FT   CDS_pept        499549..499977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0507"
FT                   /product="helix-hairpin-helix motif protein"
FT                   /note="PFAM: helix-hairpin-helix motif; KEGG: bam:Bamb_1783
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33727"
FT                   /db_xref="InterPro:IPR004509"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW63"
FT                   /protein_id="ABP33727.1"
FT                   /translation="MLMNINLSHAKSLVGTFIVAGGLALASLGFAIAAPINVNTATQTE
FT                   LESIKGIGPSKAKTIIAERLDGGHFQDANDLQKRVRGIGMKSVEKMVDNGLTIEAPSSF
FT                   REPNGRTKKEGGSAGRRNSRNQAGTRSQPERTGATRRN"
FT   sig_peptide     499549..499650
FT                   /locus_tag="Pnuc_0507"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.886 at
FT                   residue 34"
FT   gene            500019..500930
FT                   /locus_tag="Pnuc_0508"
FT   CDS_pept        500019..500930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0508"
FT                   /product="cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /note="TIGRFAM: cysteine synthase; cysteine synthase B;
FT                   PFAM: Pyridoxal-5'-phosphate-dependent enzyme, beta
FT                   subunit; KEGG: reh:H16_A0807 cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33728"
FT                   /db_xref="GOA:A4SW64"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005858"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW64"
FT                   /protein_id="ABP33728.1"
FT                   /translation="MSKPDYLTISQTVGNTPLVRLQRIPGVENEQRNNVILGKLEGNNP
FT                   AGSVKDRPALSMIMRAQERGEIRPGDTLIEATSGNTGIALAMTAAMLGYKMVLVMPENQ
FT                   SIERRQSMAAYGAELILTAASGGMEFARDYALQLQREGRGRLLDQFANPDNPRAHLETT
FT                   GPEIWRDTDGQITHFVSAMGTTGTITGVSTYLKSMNPAIQIIGAQPEEGSQIPGIRKWA
FT                   PEYLPKIYQGDRVDRIEYVTQADAEDMARRLAVEEGIFCGISAGGALVVALRIARQVEN
FT                   ATIVFIVCDRGDRYLSTGVFPA"
FT   gene            complement(500933..502201)
FT                   /locus_tag="Pnuc_0509"
FT   CDS_pept        complement(500933..502201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0509"
FT                   /product="lytic murein transglycosylase B"
FT                   /note="TIGRFAM: lytic murein transglycosylase B; KEGG:
FT                   rme:Rmet_0732 lytic murein transglycosylase B"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33729"
FT                   /db_xref="InterPro:IPR011757"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW65"
FT                   /protein_id="ABP33729.1"
FT                   /translation="MLFRTYSLLIALALGACTSAPTQQSAPQQPIVNQADDALTEARYS
FT                   QNLNVLLTQVSETQEIPLSTLQTGFLDAKTIPSIRKLVLPPSGTFKKNWLVYRKRFIEP
FT                   IRLKAGKAFWEENQAYLTQVEQESGVPAEVIVAIIGIETIYGRQTGNFRVKDVLSTLAF
FT                   SYPDTPNKVAREQLFKDQLKELILLCWKEAGGSLPGKNSNQGVNSARFSACLNQNSSYA
FT                   GAIGLPQFMPSSIRSFAVDGDGDGRIDLKQSPKDAIASVANFMKMHGWQAGMPIYFPVQ
FT                   ENAIPAARQLADGEPQLKYTVAELIEKGILSKQQGDLQRGGVEPQSKAMIVDLPYPDKD
FT                   GADQVQYFVGLNNFLTIVQYNRSYFYAQSVAEFAEALGYKNRSVVPIEASPKATNSKAS
FT                   HETVPAKKSSGKKKSKSASKTTG"
FT   sig_peptide     complement(502124..502201)
FT                   /locus_tag="Pnuc_0509"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.850 at
FT                   residue 26"
FT   gene            502286..503206
FT                   /locus_tag="Pnuc_0510"
FT   CDS_pept        502286..503206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0510"
FT                   /product="histone deacetylase superfamily"
FT                   /note="PFAM: histone deacetylase superfamily; KEGG:
FT                   rme:Rmet_0733 histone deacetylase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33730"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW66"
FT                   /protein_id="ABP33730.1"
FT                   /translation="MTTGYITHPDFLKHEMGSHHPECPERIQAINDQLIRSGIDVFLHH
FT                   LDAPLASEEQLELVHSPDHIAFVKEQAPESGYAMLDGDTIMNPFTWTAALRASGAAIAG
FT                   VDAVMKGEVENVFCAIRPPGHHAEPTRSMGFCLFDNVAIAARYAMEAYGIDRVAIIDFD
FT                   VHHGNGTEAAFFNDPNVLMCSFFQHPFYPYSGLDHANNMVNVPLPAATRGDVVRSIVDE
FT                   RWMPALRNFEPQLIIISAGFDAHREDDLGQMGLVEEDYAWITRRLKEIANEYAQGRIVS
FT                   CLEGGYNLSALGRSVVAHVKALADI"
FT   gene            503250..504905
FT                   /locus_tag="Pnuc_0511"
FT   CDS_pept        503250..504905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0511"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   ajs:Ajs_3136 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33731"
FT                   /db_xref="GOA:A4SW67"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW67"
FT                   /protein_id="ABP33731.1"
FT                   /translation="MMANIYEQGLERNPANYTPITPILFLERSAEIYPNKTAIIHGKLR
FT                   QTWQQTYERCRRLASALQKRGIGLGDTVAVMLPNTPPMVEAHFGIPMAGAVLNALNTRL
FT                   DAESVAFMLNHGEAKVVIVDPEFSGVMKKALEIVKKDSGREILVIDVEEKEFDVPGECL
FT                   GTVTYDQLLSEGDPEFPLIVPEDEWQAICLNYTSGTTGNPKGVVYHHRGAAINAVSNVL
FT                   DWDINKHPIYLWTLPMFHCNGWCFPWTIAARAGVNVCLRRVDAQHIFAAIKEHGVTHYC
FT                   AAPIVHNLLVNAPDELKVGVPSGVKGLIAGAAPPASIIEGMEKLGFDLTHVYGLTEVYG
FT                   PAAVCVKQDEWNDVDIGERARLNARQGVRYHMQQAIDVIDPETMQPVPADGETMGEIMF
FT                   KGNIAMKGYLKNEKATKEAFEGGWFHSGDLAVKNPDGYVKMKDRSKDIIISGGENISSV
FT                   EVEDVLYRHPAVNAAAVVAKPDPKWGETPCTFLEIKPGAEVTVEEMIAHCKQHLAGFKV
FT                   PRAIVFCELPKTSTGKIQKFELRKQAGSAGAIDV"
FT   gene            504987..505736
FT                   /locus_tag="Pnuc_0512"
FT   CDS_pept        504987..505736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0512"
FT                   /product="electron transfer flavoprotein beta-subunit"
FT                   /note="PFAM: electron transfer flavoprotein beta-subunit;
FT                   KEGG: reh:H16_A0814 electron transfer flavoprotein
FT                   beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33732"
FT                   /db_xref="GOA:A4SW68"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW68"
FT                   /protein_id="ABP33732.1"
FT                   /translation="MKILVAVKRVVDYNVKIRVKSDNSGVDIANVKMSMNPFDEIAVEE
FT                   AVRLKEAGIATEVVVVTAGVTQCQETLRTALAIGADRGILVETDLDLQPLAVAKILKAL
FT                   SEKEQAQIIILGKQAIDDDSNQTGQMLASLLDIPQATFASKVVVADGKATVTREVDGGL
FT                   ETIALTLPAVITTDLRLNEPRYVTLPNIMKAKKKTIDIVKPEELGVDTAPRLKTLKVEE
FT                   PPKRSAGVMVADVAALVEKLKNEAKVI"
FT   gene            505737..506672
FT                   /locus_tag="Pnuc_0513"
FT   CDS_pept        505737..506672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0513"
FT                   /product="electron transfer flavoprotein, alpha subunit"
FT                   /note="PFAM: electron transfer flavoprotein beta-subunit;
FT                   electron transfer flavoprotein, alpha subunit; KEGG:
FT                   ajs:Ajs_2809 electron transfer flavoprotein, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33733"
FT                   /db_xref="GOA:A4SW69"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW69"
FT                   /protein_id="ABP33733.1"
FT                   /translation="MAALVIAEHDNISLKAATLNAVAAALQCAPEVDVLVAGNQSDAAA
FT                   QAAAQIAGVRKVIQIDAAYLADQLAEPLAAQILALAGSYSHILAPATANGKNVLPRVAA
FT                   KLDVAQLSDITKVITADTFERPIYAGNAIATVQTGDPVKVITVRTTGFDPVAATGGSAA
FT                   VEKVAASDSAGKSSFVGRELTKSDRPELTAAKIIVSGGRGLGSGEKYQELIAPLADKLG
FT                   AALGASRAAVDAGYVPNDYQVGQTGKIVAPQLYIAVGISGAIQHLAGMKDSKVIVAINK
FT                   DPEAPIFGVADYGLVADLNTAVPELTKALG"
FT   gene            506733..508520
FT                   /locus_tag="Pnuc_0514"
FT   CDS_pept        506733..508520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0514"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   pna:Pnap_3285 acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33734"
FT                   /db_xref="GOA:A4SW70"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW70"
FT                   /protein_id="ABP33734.1"
FT                   /translation="MPYVAPVKDMLFAMNELAGLSEVVAYPTYAEAGADVDLAPAILEE
FT                   AAKFNQDVVAPLNWPGDQNPSSFKEGVVTTAPGFKEAFEQFGSAGWQGVVHPAEFGGQG
FT                   LPKLIATACFEMVHSASLSFALCPMLTDGAIEALLTAASPELLERFVPNMISGEWTGSM
FT                   CLTEPQAGSDLSMVRARAVPEGNGAYKIFGTKIYITYGEHDMAKNIVHLVLARTPDAPE
FT                   GVKGISLFVVPKFLVNADGSLGDRNDVHCVSIEHKLGIKASPTAVLQFGDHGGAIGYLV
FT                   GEENRGLEYMFVMMNAARFAVGMQGIAVAERAYQKAVQYAKDRVQSRDLAGSPGPVAII
FT                   HQPDVKRMLMTMRAYTEASRALAYYAAAAYDAQHADPDEAVKKANQAIYEFLVPIVKGF
FT                   STEMSIEVASLGVQVHGGMGFIEETGAAQHYRDARILTIYEGTTAIQANDLVGRKTVRD
FT                   GGATAKVLSQKIAETEKELAASSSADAQAVLKQLTLARAAFEEAVAYILANAKSDVKAV
FT                   YAGSFAYLRLAGLVLGGWQMARGLLAAERLRETDPSFYSAKIATARFFAENLMPQTQAL
FT                   ATSIVESGYSTNALEVEQF"
FT   gene            complement(508564..509010)
FT                   /locus_tag="Pnuc_0515"
FT   CDS_pept        complement(508564..509010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0515"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RSc0929 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33735"
FT                   /db_xref="GOA:A4SW71"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW71"
FT                   /protein_id="ABP33735.1"
FT                   /translation="MKKSKLIFCALGLFFPGSGLNCFYLQGLKSFWAWSQLLALVGGIL
FT                   GWSLLKDAHFHSAPGWVLLTFGFIAIEASWLSTIAFGLRPDEKWDAQFNPNIAEHQRSQ
FT                   SGWLVVLTVIFSLVLGAGVMMTFLAISFEQFFISQIYEAKKLSQ"
FT   sig_peptide     complement(508945..509010)
FT                   /locus_tag="Pnuc_0515"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.906) with cleavage site probability 0.707 at
FT                   residue 22"
FT   gene            complement(509023..509553)
FT                   /locus_tag="Pnuc_0516"
FT   CDS_pept        complement(509023..509553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0516"
FT                   /product="protein of unknown function DUF306, Meta and
FT                   HslJ"
FT                   /note="PFAM: protein of unknown function DUF306, Meta and
FT                   HslJ; KEGG: rme:Rmet_2713 protein of unknown function
FT                   DUF306, MetA and HslJ"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33736"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW72"
FT                   /protein_id="ABP33736.1"
FT                   /translation="MFAKTALRRPFKNYLNTGLRGVFCLSASLLVACANVIPPCGAKVS
FT                   PPSSELKNTKWELTRWNLAPNSNGEVRTRQIPQGESNNPIQIIFDANGQRVSGSTGCNR
FT                   FTAQLDEDGRGFSLKQIASTKMSCSPQRMELENDFLYELNDYRSIVRNGDQLLMIGTDR
FT                   EVLSFTQRPNSIK"
FT   sig_peptide     complement(509449..509553)
FT                   /locus_tag="Pnuc_0516"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.453 at
FT                   residue 35"
FT   gene            509778..510023
FT                   /locus_tag="Pnuc_0517"
FT   CDS_pept        509778..510023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0517"
FT                   /product="SSU ribosomal protein S16P"
FT                   /note="PFAM: ribosomal protein S16; KEGG: reh:H16_A0894 SSU
FT                   ribosomal protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33737"
FT                   /db_xref="GOA:A4SW73"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SW73"
FT                   /protein_id="ABP33737.1"
FT                   /translation="MVVIRLARGGSKKRPFYSIVATDKRNRRDSNFIERIGYFNPQAAA
FT                   TEQAMRIAQDRLTYWTGVGAQISPTVVRLIKNNPAV"
FT   gene            510115..510681
FT                   /locus_tag="Pnuc_0518"
FT   CDS_pept        510115..510681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0518"
FT                   /product="16S rRNA processing protein RimM"
FT                   /note="TIGRFAM: 16S rRNA processing protein RimM; PFAM:
FT                   RimM protein; PRC-barrel domain protein; KEGG:
FT                   reu:Reut_A2539 16S rRNA processing protein RimM"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33738"
FT                   /db_xref="GOA:A4SW74"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SW74"
FT                   /protein_id="ABP33738.1"
FT                   /translation="MSTPSLDNLIELGAISEAQGLQGQVKVRPHSPDPVALLSSKVVWL
FT                   SLLPRRSAGALSSTEEATLTQYKVKSAKMHSGNVVLTLDGVSDRDQALALKGARILLDR
FT                   DAFPKAESDSYYWVDLIGCKAKNLQDEILGDVIDVTENGAHGVIAIGDISTKTIQYLVP
FT                   FVKEVVRNVDLPNKLLTLDWQSDWV"
FT   gene            510699..511445
FT                   /locus_tag="Pnuc_0519"
FT   CDS_pept        510699..511445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0519"
FT                   /product="tRNA (Guanine37-N(1)-) methyltransferase"
FT                   /note="KEGG: reh:H16_A0896 tRNA
FT                   (guanine-N1-)-methyltransferase; TIGRFAM: tRNA
FT                   (guanine-N1)-methyltransferase; PFAM: tRNA
FT                   (guanine-N1-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33739"
FT                   /db_xref="GOA:A4SW75"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SW75"
FT                   /protein_id="ABP33739.1"
FT                   /translation="MRFDVVTLFPEMFSALTQWGITGRACQQSLASVHLWNPRDFCPDP
FT                   RKTVDDRAYGGGPGMVMMAKPLEDTVAGIQASHQAAGIKSGPICLLAPQGERFSQKIAT
FT                   DILDYGNLSFICGRYEAVDQRFIDRNVDIQLSIGDFVLSGGEIPAMTIMDAVIRLVPGA
FT                   LGDGESATQDSFMNGLLDYPHYTRPEIYENLLVPDVLLGGHHAKIADWRRQKSLELTLR
FT                   LRPDLIESARANGLLTREDEQFLRSL"
FT   gene            511572..511961
FT                   /locus_tag="Pnuc_0520"
FT   CDS_pept        511572..511961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0520"
FT                   /product="LSU ribosomal protein L19P"
FT                   /note="PFAM: ribosomal protein L19; KEGG: reh:H16_A0897 LSU
FT                   ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33740"
FT                   /db_xref="GOA:A4SW76"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SW76"
FT                   /protein_id="ABP33740.1"
FT                   /translation="MNLIEKIEQEEIARLSANKTLPSFAPGDTVVVGVNVVEGARKRTQ
FT                   AFEGVVIAKRNRGLNSSFIVRKISSGEGVERTFQTYSPLIASIEVKRRGDVRRAKLYYL
FT                   RDRSGKSARIKEKLPARKVAATPAA"
FT   gene            512025..512762
FT                   /locus_tag="Pnuc_0521"
FT   CDS_pept        512025..512762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0521"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: rme:Rmet_0752 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33741"
FT                   /db_xref="GOA:A4SW77"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW77"
FT                   /protein_id="ABP33741.1"
FT                   /translation="MTKISKPEEDAINVAAPPGFDAQSIPIHEVCGNQQKVSLNFLRPA
FT                   GLRERFQAPPQWEPEITDENRHVIAADIIAKRQAVGKVTKAAVLIPLVLKEDGLWVLLT
FT                   QRTNHLRDHAGQISFPGGRMDPEDAGPEETALRESKEEIGLDPSRVEIIGHLPEYLTVS
FT                   GYSVTPVVGLVQAQAEYVLDPFEVADVFEVPLEFLLDPANHQVRLWQSEQGGRRFYSMP
FT                   YENRFIWGATAGMLRNLYHLLKV"
FT   gene            512759..513718
FT                   /locus_tag="Pnuc_0522"
FT   CDS_pept        512759..513718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0522"
FT                   /product="cobalamin biosynthesis protein CbiB"
FT                   /note="PFAM: cobalamin biosynthesis protein CbiB; KEGG:
FT                   rme:Rmet_2578 cobalamin biosynthesis protein CbiB"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33742"
FT                   /db_xref="GOA:A4SW78"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="InterPro:IPR031347"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW78"
FT                   /protein_id="ABP33742.1"
FT                   /translation="MTFFSILFALIAEQYRPVTSSHWIARICARWLDWVAGEFGGKTEE
FT                   GASPVGARIACMVAFILPTFLVFIVYVTCMVTYPILGFLWNVLIAYLFFGFRQFSHSFT
FT                   AVHEAIEAHDLPAARTALGEWYGPELDTSNLSETEVISLALERAIIGSHHHVFGVLFWF
FT                   MMPMGPAGVVLYRLADIASQRWSERGDFNLSEASRHFFYVLDWIPARITAMGFAIVGNF
FT                   EGALYGWRYLTQKWSDSLSAVILAAGSGALGVRLGEPLSEPDSDEALRMAEAGEPVVYE
FT                   VGLEPTERSMRSAVGLVWRLVIAWMALLLMLTIALWLG"
FT   gene            complement(513663..514676)
FT                   /locus_tag="Pnuc_0523"
FT   CDS_pept        complement(513663..514676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0523"
FT                   /product="ribosome small subunit-dependent GTPase A"
FT                   /note="TIGRFAM: ribosome small subunit-dependent GTPase A;
FT                   PFAM: GTPase EngC; KEGG: reu:Reut_A0905 GTPase EngC"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33743"
FT                   /db_xref="GOA:A4SW79"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW79"
FT                   /protein_id="ABP33743.1"
FT                   /translation="MEQFRALLTASYGRHYLAQRLIADAAGNESPSGPLIQVSTPAKQH
FT                   IGAVGDRMLLEMTSVDQARIIEIEPRENLLYRSDAFKSKLIASNVDQILIVLATQPAFS
FT                   PDLLGRAVVAAETNQIGLHILLNKCDLPDNIEHARKIIAPYARMGYPVSEVSAKFDPAS
FT                   IDALQSALKGKVSVFVGQSGMGKSSLLNAWVPNAAALTQEYSVRLDTGKHTTTACRYFE
FT                   LPESWGRDASGKLGALIDSPGFQEFGLAHMSVSELQHAFREFKDLLGKCRFHNCAHQSE
FT                   PDCAVRAAVDRNEIAPERLALFRQLRSDSKTADTQIQGISQAKERWSALATKPSKR"
FT   gene            complement(514679..515932)
FT                   /locus_tag="Pnuc_0524"
FT   CDS_pept        complement(514679..515932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0524"
FT                   /product="Ste24 endopeptidase"
FT                   /EC_number="3.4.24.84"
FT                   /note="PFAM: peptidase M48, Ste24p; KEGG: bps:BPSL2482
FT                   subfamily M48A unassigned peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33744"
FT                   /db_xref="GOA:A4SW80"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR027057"
FT                   /db_xref="InterPro:IPR032456"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW80"
FT                   /protein_id="ABP33744.1"
FT                   /translation="MTFTIVFLIAFIASFGLRHWLSQRQIRYVAQHRDQVPAEFSEKIT
FT                   LAEHQKAADYTIAKLRLGILENGVSAIILIGFTLLGGLEVLNITLLQLLGEGITQQIAL
FT                   LASIAIISGLLDLPFSWYKQFHLEERFGFNRMGKKLFFADMLKGLLVGAAIGIPLLWVI
FT                   LTLMAKSGDLWWLWAWAVITVFSLLMQWIFPTFIAPLFNKFQALEEGALKTQIEALLKR
FT                   CDFASQGLFVMDGSKRSAHGNAFFAGMGKAKRIVFFDILIEKLNPGEVEAVLAHELGHF
FT                   KCKHIRKRLLVSFALSFAMFALLGWISTQVWFYTDLGVMPNLNGYNGGLALALFMLVSP
FT                   VFSFFFTPLSSLASRKHEYEADGFAAEKSSAKDLISALVKLYQDNASTLTPDPIYTAFY
FT                   SSHPPAPLRIANLQRFSS"
FT   gene            515948..516535
FT                   /locus_tag="Pnuc_0525"
FT   CDS_pept        515948..516535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0525"
FT                   /product="Exonuclease, RNase T and DNA polymerase III"
FT                   /note="PFAM: Exonuclease, RNase T and DNA polymerase III;
FT                   SMART: Exonuclease; KEGG: reh:H16_A2709 oligoribonuclease
FT                   (3'->5' exoribonuclease)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33745"
FT                   /db_xref="GOA:A4SW81"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW81"
FT                   /protein_id="ABP33745.1"
FT                   /translation="MSEQINTATAKTASPSEHLIWVDMEMSGLNPETERILEIAIIVTD
FT                   AHLNTIATAPVWVVHQDDAILDAMDAWNKGTHGRSGLIDKVKTSTLDEAAVEAECIAFL
FT                   KQYIKAGIAPMCGNTIGQDRRFMAKYMPKLEAYFHYRNVDVSTLKELCKRWHPELVKGF
FT                   TKNQAHTALADIEESIEELKYYREKFIVPLPQ"
FT   gene            complement(516591..517214)
FT                   /locus_tag="Pnuc_0526"
FT   CDS_pept        complement(516591..517214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0526"
FT                   /product="molybdopterin adenylyltransferase"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain; PFAM:
FT                   molybdopterin binding domain; KEGG: bur:Bcep18194_A4193
FT                   molybdopterin binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33746"
FT                   /db_xref="GOA:A4SW82"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW82"
FT                   /protein_id="ABP33746.1"
FT                   /translation="MKHNQAWERSTPSELKIGLISISDRASKGVYQDEGIPTLQTWLIK
FT                   AIKNSCALHERLIADESEIITETIIELVDEFCCDLVLTTGGTGPSRRDVTPEATLEAGT
FT                   RELPGFGEQMRQISLKFVPTAILSRQTAVLREIEGHAALIINLPGQPKAIAETLEGLKD
FT                   ENGKSIVPGIFAAVPYCIDLIGGPYIETNEEVVKAFRPKNAIKK"
FT   gene            517241..518587
FT                   /locus_tag="Pnuc_0527"
FT   CDS_pept        517241..518587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0527"
FT                   /product="microcin-processing peptidase 1, Unknown type
FT                   peptidase, MEROPS family U62"
FT                   /note="PFAM: peptidase U62, modulator of DNA gyrase; KEGG:
FT                   rso:RSc0945 putative pmba protein (tldE protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33747"
FT                   /db_xref="GOA:A4SW83"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW83"
FT                   /protein_id="ABP33747.1"
FT                   /translation="MFTYSSSQFQEIINFMLKEAKRRGASDAVAEISEGQGLSVTVRKG
FT                   EVETIEQSLDKQVGVTVFLGHHRGNASTSDFSKESLKATVDAAYHIAQHTAEDACAGPA
FT                   EAELLEKNPMDLDLFHPWNIDAAGAVEIARIAEGAAFSVSKQIQNSDGASVSAHHAHFM
FT                   MGTSHGFMGGYPFSRHYISCAPIASVGGKNAHMQRDDWYSSSRLPQELADPAAIGKYAA
FT                   QRALSRLKARSITTRRCPVIFEAPLAAGLLGGLVQAVSGGALYRRSSFLLDSLGKQVLP
FT                   KHVSLFENPHLKAMTGSAPFDEEGVKTTARTVVDKGILEGYFLSTYSARKLGMKTTGNA
FT                   GGSHHLTLQSKKTPKGGLTALLKEMGTGLLVTELMGQGVNYVTGDYSRGAFGYWVENGE
FT                   IQYPVEEVTIAGNLRDMLLDIEMIGSDTLIRGTKETGSILIGSMTVGGK"
FT   gene            518644..519726
FT                   /locus_tag="Pnuc_0528"
FT   CDS_pept        518644..519726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0528"
FT                   /product="TRAP dicarboxylate transporter-DctP subunit"
FT                   /note="PFAM: TRAP dicarboxylate transporter- DctP subunit;
FT                   KEGG: rme:Rmet_3543 twin-arginine translocation pathway
FT                   signal"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33748"
FT                   /db_xref="GOA:A4SW84"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR026289"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW84"
FT                   /protein_id="ABP33748.1"
FT                   /translation="MQRRSFLKKATIGAGVAAIGAPAIAQSLPTLNWRLVSSFPKSLDT
FT                   LYGTPEVFANALRKATDGKFNVKVFAAGEVVPALQVLDAVQNGTVECGHTASYYYLGKN
FT                   SAFIFDTAAPFGMTARQQSAWMLHGNGMKLMRELYATYNIVNFLGGQTGTQMGGWFRKE
FT                   IKSPEDLKGLKFRIAGFAGQVLAKLGVVPQQLPAGEIYSALEKGTIDAAEFVGPYDDEK
FT                   LGLAKVAKNYYYPAFWEGAAALSFLVNKKQWESLPPAYQAAWEAACFEAHTDMCAKYDA
FT                   LNPPALQRLIQNGAVLRKFNTSVMDACFKASQETYAEESAKNPQFKKIFDDYRVFRNME
FT                   AQWFGLAEQAFAQYSFAKKL"
FT   sig_peptide     518644..518721
FT                   /locus_tag="Pnuc_0528"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.982 at
FT                   residue 26"
FT   gene            519840..521111
FT                   /locus_tag="Pnuc_0529"
FT   CDS_pept        519840..521111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0529"
FT                   /product="putative manganese transport protein"
FT                   /note="KEGG: sme:SMa1115 putative manganese transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33749"
FT                   /db_xref="GOA:A4SW85"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW85"
FT                   /protein_id="ABP33749.1"
FT                   /translation="MNFSAIWARIKQHPLSRVGPGLVTGVADDDPSGIVTYSQAGAQFG
FT                   LNMLWTMPFAYPLMSTIQVLCARIGRVTGRGLSANMKLAFPPAVLIALVSILLIANVLN
FT                   IAADIAAMGEVAQLVTGINWHIMTGVFVLLTLILQILIPYRHYVFFLKWLSLSLLAYGA
FT                   VLFTVHVPWGEVVWKTFFPTITFNAASAAVVVGIFGTTISPYLFFWQASQEVEDMNLRH
FT                   ENSLLLGNAKEIHSELRRIQWDTWSGMLYSNVAAYCIILATAVTLHVVGIRDINTAAEA
FT                   ASALRPLAGEFAFMLFALGILGVGLMGVPVLAGSAAYALSEVFGWRSSLEDNAAQAGKF
FT                   YAIIAISVLGALAIQYSPISPMKALFWSAVLNGVVAVPLMVAIMILSSRSSVMGPHVAT
FT                   LSMKILGWLATGFMAVAAVYMFVA"
FT   gene            521137..521922
FT                   /locus_tag="Pnuc_0530"
FT   CDS_pept        521137..521922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0530"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   pol:Bpro_1234 protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33750"
FT                   /db_xref="GOA:A4SW86"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW86"
FT                   /protein_id="ABP33750.1"
FT                   /translation="MFNSLVAPLSQSFHAHTLAFFVCAVISVLIVGISKSGFGAGLGIL
FT                   SLPLMASQSSINEALAILLPLLIAIDLVGLRRFIRNANWRILKLILPPAIVGLALGMFF
FT                   FTAITPKVLTLSIGIFTLLFLMQNLAMTYFDSREAKPYPWLGRAMGLTSGFTSFVAHIG
FT                   GPPITVFMLRENLLPMVYTSTLGVFFTFINFGKLGPYAYLELLNFQQLATSLLLLPCVP
FT                   FGVYFGFYLAKRISMKWYYHIVRFFLLVASIKLISDGLL"
FT   gene            complement(521919..522584)
FT                   /locus_tag="Pnuc_0531"
FT   CDS_pept        complement(521919..522584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0531"
FT                   /product="phospholipase/Carboxylesterase"
FT                   /note="PFAM: phospholipase/Carboxylesterase; KEGG:
FT                   rfr:Rfer_1674 carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33751"
FT                   /db_xref="GOA:A4SW87"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW87"
FT                   /protein_id="ABP33751.1"
FT                   /translation="MLPCIEIETAPNPSAAVIWLHGLGADGNDFVPIVPELNLEGCPAI
FT                   RFIFPSAPNMPVTVNGGYVMPAWYDIIGRDLVAQEDASGIARSATAIKEIIINEASHGI
FT                   AYENIVLAGFSQGCAMALQIGLRFPHQLAGIMALSGYLPLATTLSLEKHPSNQSTPIFM
FT                   AHGLYDPVVIPARAEASCALLEKLGYQVSWNEYPMEHSVNHEELQDISRFLRSVLIKG"
FT   gene            522799..523026
FT                   /locus_tag="Pnuc_0532"
FT   CDS_pept        522799..523026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33752"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW88"
FT                   /protein_id="ABP33752.1"
FT                   /translation="MKPFFIDYPQEKIAEHQHAYRCAYCKIPTTVIFGLIENHDEACQY
FT                   RQQQSKWVQLEAKLKPHHAHFDEPHADEVD"
FT   gene            523027..523401
FT                   /locus_tag="Pnuc_0533"
FT   CDS_pept        523027..523401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0533"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33753"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW89"
FT                   /protein_id="ABP33753.1"
FT                   /translation="MKTYPIAIELTVWFDLGLSQYEIALDETPTISVKKTDDVLHTKGL
FT                   SLAEVDLLIEAIETLKVPVAEETEANVTDKSSSSYELIVESAHFSLEYNWETADLENSS
FT                   VFASVEKLAALIEVLGVTSE"
FT   gene            523906..524214
FT                   /locus_tag="Pnuc_0534"
FT   CDS_pept        523906..524214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0534"
FT                   /product="protein of unknown function DUF485"
FT                   /note="PFAM: protein of unknown function DUF485; KEGG:
FT                   pna:Pnap_0484 protein of unknown function DUF485"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33754"
FT                   /db_xref="GOA:A4SW90"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW90"
FT                   /protein_id="ABP33754.1"
FT                   /translation="MSDAVVARIEANPKYQELKRKRSSFGWALCILMFIVYYGYIALIA
FT                   FDKPFLAQPIGDGVITLGIPIGMGVIIFTILITGIYVRRANNEYDTLTAEILKDAVK"
FT   gene            524211..525938
FT                   /locus_tag="Pnuc_0535"
FT   CDS_pept        524211..525938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0535"
FT                   /product="SSS sodium solute transporter superfamily"
FT                   /note="TIGRFAM: SSS sodium solute transporter superfamily;
FT                   PFAM: Na+/solute symporter; KEGG: bur:Bcep18194_B1980
FT                   Na+/solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33755"
FT                   /db_xref="GOA:A4SW91"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW91"
FT                   /protein_id="ABP33755.1"
FT                   /translation="MNRIEKLLCALALLVLPVLAIAAGADMGQIEKQETNWVAIGMFAA
FT                   FVAGTLFITKWAATKTKSAADFYTGGGGITGFQNGLAIAGDYMSAASFLGISAAVMANG
FT                   YDGLIYSIGFLVGWPVITFLMAERLRNLGKFTFADVAGYRFQQGPIRAFAASGTLVVVA
FT                   FYLIAQMVGAGQLIKLLFGLEYWMAVVIVGCLMMIYVLFGGMTATTWVQIIKACLLLAG
FT                   VTFMAFMVLAEYGFSPAALFAKAVEVKTAIAANAGKTPEEAAKAGLSIMGPGGFIKDPI
FT                   SAISFGMALMFGTAGLPHILMRFFTVPDAKEARKSVLWATTWIGYFYVLIFIIGFGAIT
FT                   LVLTNPEMANVAKGVINGGAGTANMAAVLVAKVVGGNIFFGFISAVAFATILAVVAGLT
FT                   LSGASAVSHDLYATVIKKGNADSAAELKVSRLTTLTLGVIAVVLGIVFEKQNIAFMVSL
FT                   AFAIAASANFPVLFMSVLWKNCTTKGAVIGGFLGLVSSVALTVVSPSVWEAVLGNPKGS
FT                   ALFPYSSPALFSITIGFLGVWLFSILDNSENAKKERAAFAAQQVRSETGFGASGASGH"
FT   sig_peptide     524211..524279
FT                   /locus_tag="Pnuc_0535"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.929 at
FT                   residue 23"
FT   gene            complement(526008..526664)
FT                   /locus_tag="Pnuc_0536"
FT   CDS_pept        complement(526008..526664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0536"
FT                   /product="Exonuclease, RNase T and DNA polymerase III"
FT                   /note="PFAM: Exonuclease, RNase T and DNA polymerase III;
FT                   SMART: Exonuclease; KEGG: pna:Pnap_0481 exonuclease, RNase
FT                   T and DNA polymerase III"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33756"
FT                   /db_xref="GOA:A4SW92"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW92"
FT                   /protein_id="ABP33756.1"
FT                   /translation="MNRLVPSPLRKFYHAIWREWLIYHLADERYKFMFNPPPPNEWVVI
FT                   DCETTGLNVAQDQIISIGAVKIVGNQLITSERLELLVKPDKEVSAESVKIHRLRELDIA
FT                   NGLDPEVAVAKLMQFIGSRPIVGYYLEFDMAMLHKIIWRMLGQGLPQPKIEVSAMYYEY
FT                   KNAQLPINLRGQMIDLRFDTLMKDLNLPVRDAHDALNDAVMTGMAFIKLRQLLKP"
FT   gene            complement(526661..528490)
FT                   /locus_tag="Pnuc_0537"
FT   CDS_pept        complement(526661..528490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0537"
FT                   /product="putative CBS domain and cyclic
FT                   nucleotide-regulated nucleotidyltransferase"
FT                   /note="PFAM: cyclic nucleotide-binding; CBS domain
FT                   containing protein; protein of unknown function DUF294,
FT                   nucleotidyltransferase putative; KEGG: pna:Pnap_0480 cyclic
FT                   nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33757"
FT                   /db_xref="GOA:A4SW93"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005105"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR018821"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW93"
FT                   /protein_id="ABP33757.1"
FT                   /translation="MPNAFNFSASPFDCLNSQEQKLVRDSVDIAYFKEGEIILDVGSAP
FT                   THLFILIKGFVRQFENSEEVALYGPDDCFDGRGLMAGKVSSQFIASEEVVAYQLAKAAV
FT                   KELISDNATFGALLFADLSKKLNALAERRSQYEINSLSLAQVSQAFLREIHFVDANTNL
FT                   FEVVRIFSENRTNNVLVRDDSKGEKRLGIFTITNLQRAILAKIPLESTPVGPLSNYKLI
FT                   CVQASDHLYEALAVMIRHSVHRVIVMDKGNAIGTLEQVDLLSFIANSSSLVVQKIFQAK
FT                   TLDDLKVPAEQITNLISLLHRNGTKVGMIARLVQELNSKLFERAWSLIASPDLQKNSCL
FT                   FVMGSEGRGEQILKTDQDNGLILSNNYQNLEEAASACDRFSAALLEFGFPECPGKIMVN
FT                   NPEWRMSEADFISTTKQWLLEPTPDSLMNLAIFLDSHPITGNADLLFAIKKALFNLVTD
FT                   NQFLLARFASAIESFSSEIGWWNRLLTLGGEGHENRINLKKAGIFSIVHGVRALALENH
FT                   IWANSTAERINELVRLNKFPKDLFEDVNESLHLLMELRLMSGISELETDKEVSGEIDIS
FT                   RLSTLERDLLKDSLSVVKRFKQFLRQHFHLEFA"
FT   gene            complement(528595..529392)
FT                   /locus_tag="Pnuc_0538"
FT   CDS_pept        complement(528595..529392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0538"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: chu:CHU_0221 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33758"
FT                   /db_xref="GOA:A4SW94"
FT                   /db_xref="InterPro:IPR025333"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW94"
FT                   /protein_id="ABP33758.1"
FT                   /translation="MDFPLLRFALSYPGIDLRITLVLFVLLLCFSAYWFFQKLFPHLLF
FT                   GEDAPYAGYIYNAMGVVFSLVFAFVTVLVWQNYNGVSDAVAKEASTLNNVYRVFSAFPP
FT                   EIDKTGKAQVRAYVKTVINEEWPLLSKNEFSLKAYKELTTLEDLAVQIKPKNMGESNAH
FT                   QQLLHLTLQATELRRSRIFNAKFALAPAAWVGLGSSLMVFLIFSCLFQMKSRKIHMILI
FT                   AFLSLTVVGILYFLILFIHPFLGPLAITPEPFTALLNTSWVYQ"
FT   gene            complement(529470..530348)
FT                   /locus_tag="Pnuc_0539"
FT   CDS_pept        complement(529470..530348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0539"
FT                   /product="Citryl-CoA lyase"
FT                   /EC_number="4.1.3.34"
FT                   /note="PFAM: HpcH/HpaI aldolase; KEGG: ade:Adeh_0181
FT                   citryl-CoA lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33759"
FT                   /db_xref="GOA:A4SW95"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW95"
FT                   /protein_id="ABP33759.1"
FT                   /translation="MININRPRRSVLYMPGVNTRALEKAKTLPADSLILDLEDAVAPDS
FT                   KSIARENIRTALESGFGHREAVVRINGLNTPWGLDDLKAFANTKADAIVLPKVESAKKI
FT                   QEVAKLLSELNAPKDLTIWAMIETPKAIFKLEEIAGAHPRLEALVLGTSDLVKDLHARH
FT                   TLDRTETLTALSLSVLAARAYGLCVLDGVHLILDDEAGLKQSCVQGRDMGFDGKTLIHP
FT                   SQIALANELFGPSAQEIEEAQQKIAAYESAISTGAGIAVLNGKLIEELHIQDAKRLLAL
FT                   AAAIQSFGTNN"
FT   gene            complement(530493..533180)
FT                   /locus_tag="Pnuc_0540"
FT   CDS_pept        complement(530493..533180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0540"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   pna:Pnap_0056 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33760"
FT                   /db_xref="GOA:A4SW96"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW96"
FT                   /protein_id="ABP33760.1"
FT                   /translation="MEKHYLNSLLDPSSISIFVNQKASKSDYSYQNTFLKLFEEGQYTS
FT                   EVEWIDTSLSFEINKNELKKKGLAIIALPHHELVAALELAGRLKHQSAVLISTGIDKST
FT                   SDELKDLAKHYGIQLLGPNTMGFQRPYLHLNASVMGDLASPGPLALIAQSGALTSAMLD
FT                   WAKTNGVGFSFVASVGQNASVDIAELLDFLGNDAKTQSIVLYLEGITSSRKFMSALRAA
FT                   ANIKPVIVLKSGHKPAGNEAAKTHCGSIVGTDAVFDAAIRRAGAVRVKSFVDLFSAAKC
FT                   LASSYRPVGNRLAIITNGGGPGVLAADRVSENNLLLAKLSDESIERLRPTLSALASLEN
FT                   LVDLSEEATPEQYCAAIEAANSDRAVDGILVIYSPKPTVDSLEIANAIAELKKQINKPL
FT                   LSCWIGDSSVVESRLNLSNANIPTFRTPEAAVGAFENISSFYTNQKLLQQTPPPLSKTS
FT                   SPDLDGAKLIIENVLASRRTVLTEMESKALLSAFHIPITQTILAKSANEAIMIANQIGY
FT                   PVVLKIDSPDVSHKSDVNGVALDVMNAVSVRDVYAHMTQTVTHLVPDAIINGITVQKMV
FT                   RNKRGREIYIGLVNEEPFGPVIAFGAGGTMIELLNDQSMELPPLNQYLAQQLISRSRIA
FT                   QTLKEWRGAPAVNEEAIEHILLRVSEMACELPQLVEMDINPIIVDEFGAVAVDARIVIS
FT                   NSHHLNNSQMGLYNHLAILPYPHQYEQSYPLKDGGEYQIRPIHPDDADMLKAFYKTMSP
FT                   ESRYFRFISNAPELPHSMAAKFTLIDYDREMALVALVRNSELASDGTRVETEKIIGVSR
FT                   YSTNPDKASCEFSLAVGDDFGGQGIGSRLMLNIMEVARDKGLSEIDGLVLSKNPGMLKL
FT                   MRNLGFSVENLVDDSDFKIVRKKL"
FT   gene            533585..534193
FT                   /locus_tag="Pnuc_0541"
FT   CDS_pept        533585..534193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0541"
FT                   /product="Glutathione S-transferase, N-terminal domain
FT                   protein"
FT                   /note="PFAM: glutaredoxin; Glutathione S-transferase,
FT                   N-terminal domain; KEGG: mfa:Mfla_0507 glutathione
FT                   S-transferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33761"
FT                   /db_xref="GOA:A4SW97"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW97"
FT                   /protein_id="ABP33761.1"
FT                   /translation="MPPILYSYRRCPYAMRARMALKYAGIEVEHREIQLRSKPQSMLRL
FT                   SPKGTVPVLCVGDQILEQSLDIIDWALDQADPDGWRSADESISQAWIDKNDGPFKKLLD
FT                   QYKYLERHPELNQEEVLAQAMDLMLVPMETVLKSTQYLMGEKKSWVDVAIFPFIRQFAM
FT                   ADLEKFNDLSLPALKRWLNHYLESELFLSVMHKYPAWTD"
FT   gene            534279..534749
FT                   /locus_tag="Pnuc_0542"
FT   CDS_pept        534279..534749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0542"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cps:CPS_2500 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33762"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW98"
FT                   /protein_id="ABP33762.1"
FT                   /translation="MRLDKTTFVGLLAKIILLSFLFSETAHSQLIFAARHVIGRINQMS
FT                   QEDSNNNTASQFATVIIDAPANKVYATAVNVASQNTAVTIVSQDSRNMKMNVTEGGNKA
FT                   SISVVPLGNASSEIMISATVTAQNPNLGTSAAVNSIMKICNQLNKVCKPGAN"
FT   sig_peptide     534279..534365
FT                   /locus_tag="Pnuc_0542"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.743) with cleavage site probability 0.610 at
FT                   residue 29"
FT   gene            534811..535731
FT                   /locus_tag="Pnuc_0543"
FT   CDS_pept        534811..535731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0543"
FT                   /product="protein tyrosine/serine phosphatase"
FT                   /note="KEGG: rha:RHA1_ro06278 possible protein-tyrosine
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33763"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:A4SW99"
FT                   /protein_id="ABP33763.1"
FT                   /translation="MKQLISKVFIASFILAGSWLPVQAQVPSVGLTPGQSLGAFLDIPS
FT                   LPNLRDIGGYQNNEGLYVVRGKTYRSNAFNPMNAQELAKLGQLDLKNDYDLRTNAEIAA
FT                   VPDIISSGVHYTQFNVMADDADVAIPPDQLSILFQDPKRTAEKFGGAQGVVNMFTKSYR
FT                   GFVSMPSAKKNYRSLFLSLQNPTSSPNVFHCTNGKDRTGWAAASLYALLGVSKEKIYED
FT                   YLLSNSYLLPFHQKEIDAFTAKGGDPEILISFFGVKPAYLDAAFDEMNKRYGSIEQYFS
FT                   KGLGIDAATQKKIRAMYLTSAVSIK"
FT   sig_peptide     534811..534885
FT                   /locus_tag="Pnuc_0543"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.997 at
FT                   residue 25"
FT   gene            535807..536184
FT                   /locus_tag="Pnuc_0544"
FT   CDS_pept        535807..536184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33764"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWA0"
FT                   /protein_id="ABP33764.1"
FT                   /translation="MAANQNDIEVEAELLERQSVQYIQEQNWDALEAMLDPACQFIAKS
FT                   GSYDRTSAMKLMKEMNLGPVEFKDFKVTQAGDNLIVSFCIAAIEYRDGTQLSPQFSPRL
FT                   SVWKTQNGQRKCIAYADLIAS"
FT   gene            536303..537730
FT                   /locus_tag="Pnuc_0545"
FT   CDS_pept        536303..537730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0545"
FT                   /product="putative cytochrome c1 signal peptide protein"
FT                   /note="KEGG: rfr:Rfer_0914 putative cytochrome c1 signal
FT                   peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33765"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWA1"
FT                   /protein_id="ABP33765.1"
FT                   /translation="MKKFLFTFLIGFILLCLNLGSAQALPLFSRQTGQNCVACHAGGQY
FT                   PELTPYGRYFKLTGYTIGERTTIPVSVQFVGGAATSTNGNNGTGQVHQSGKLEPNYLFL
FT                   DVGGKIFDNFGAFSQWYYASDEQVSGKGSVPNQNSFAADVQDWRYADHYVGNSADPVKD
FT                   IIWGASLNNYAGVTDVWNSSPMWMYPYMGSTRNSSTYGLPFSTRLSAYSIHNPGYGVYA
FT                   YINKNFYAEADLYQSGGSGAFSWLTYPASNSNPNNSPVYLQGVNPYVRLAYQSDEHAGH
FT                   NWMIGLLGANINQYSSCNTVSASASYRGAALTCNGPVNSPALSAGTVKFQDRAIDGQYQ
FT                   YLVDPHTVTAQARYTKENISDPTGILYSNPNNTTNSFMSKVSYVYDATYGAAVAFQNIT
FT                   GTSDTYYGTNAVSGAALNPNSTAWIPSIWYQPLQNLRLTYQYTAFTKFNGGTINYNGLG
FT                   TNASANNASWLYLWLAM"
FT   sig_peptide     536303..536377
FT                   /locus_tag="Pnuc_0545"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.930 at
FT                   residue 25"
FT   gene            537748..538497
FT                   /locus_tag="Pnuc_0546"
FT   CDS_pept        537748..538497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0546"
FT                   /product="cytochrome c, class I"
FT                   /note="PFAM: cytochrome c, class I; KEGG: rfr:Rfer_0913
FT                   cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33766"
FT                   /db_xref="GOA:A4SWA2"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWA2"
FT                   /protein_id="ABP33766.1"
FT                   /translation="MIGRSQVASSLVIAFSFSVAALAGCTYFNNIPPVTTLENPTRSRT
FT                   LGDYEVAGNVLAVQVCAACHGVNGQSHSPMVPNLAGQQKDYLVNQLQDYRDHSRSNFYG
FT                   VRYMWGMAGPLKDKQIQELADYFSKQAPMKIANTGLEDPQLVRGKEIFEKGIPEQGVIQ
FT                   CNSCHGPNGEGMATFPRIAGQHAFYLTQQLKVWQHPDQKRFMEVGGNTWAPRTITFARP
FT                   RGVLMQNNVKNLSDADAEAVAAYLNTL"
FT   sig_peptide     537748..537819
FT                   /locus_tag="Pnuc_0546"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.811 at
FT                   residue 24"
FT   gene            complement(538550..539269)
FT                   /locus_tag="Pnuc_0547"
FT   CDS_pept        complement(538550..539269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0547"
FT                   /product="phytochelatin synthase, putative"
FT                   /note="KEGG: bte:BTH_I2045 phytochelatin synthase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33767"
FT                   /db_xref="GOA:A4SWA3"
FT                   /db_xref="InterPro:IPR007719"
FT                   /db_xref="InterPro:IPR038156"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR040409"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWA3"
FT                   /protein_id="ABP33767.1"
FT                   /translation="MTYTRQLKFLIATICIFGGLLTNAFPADLVYINTTAGSERLLHST
FT                   HNRQYFALASYVDTQERVTFCGISSMSATLNSLPTVVRPITPELAPHPYFTEDSIFNEA
FT                   TTKIKSRDDVLKSGLTLEQIGLYLTALKANPKVYYGSDLTVAELRKVIQSSLANPYQRV
FT                   MVDFDRQALHQLGNGHFSPIGAYDSKSDSVLILDVAKYKYPPFWVTTSDLLASLKTIDP
FT                   DSGRSRGIVQITVNPKN"
FT   sig_peptide     complement(539195..539269)
FT                   /locus_tag="Pnuc_0547"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.962) with cleavage site probability 0.953 at
FT                   residue 25"
FT   gene            539411..539968
FT                   /locus_tag="Pnuc_0548"
FT   CDS_pept        539411..539968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0548"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mlo:mll4938 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33768"
FT                   /db_xref="GOA:A4SWA4"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWA4"
FT                   /protein_id="ABP33768.1"
FT                   /translation="MHSFQWIQAALGIIVGLGMTRVIISVVQICVARRQVKLDWVPFIW
FT                   ALNIFFLLLQFSWNFVELDSLISRWNFGLFLLLMSFVITLFIAAALILPLSEAQAGSDL
FT                   SSWFRSDGRWALPFLAFYAFLAYPFNWYLAALTPGSNPASAILIVMSMTAFYTTSRKVL
FT                   TTVTVLNLLLTLAIVAEMVMSS"
FT   gene            540045..540578
FT                   /locus_tag="Pnuc_0549"
FT   CDS_pept        540045..540578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0549"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbb:BCG_3103 putative hydroxylaminobenzene
FT                   mutase hab"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33769"
FT                   /db_xref="GOA:A4SWA5"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWA5"
FT                   /protein_id="ABP33769.1"
FT                   /translation="MNFQFDKKFLISGLIMFLLGLLAPIYSPYAIAKIGLLQAHLIGAV
FT                   QALVFFAFAWMWPHLSLPKFTKAIATASLYISLWANWIGTLFVGIFGAGREQYIVHQDL
FT                   VPGATGFWNVATLLLINLSQLAVLSVVLAIIGFLGWAWTAKREKSINFISGLLFVALVI
FT                   MSLFQTFNPEFSNG"
FT   sig_peptide     540045..540143
FT                   /locus_tag="Pnuc_0549"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.995 at
FT                   residue 33"
FT   gene            540684..541982
FT                   /locus_tag="Pnuc_0550"
FT   CDS_pept        540684..541982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0550"
FT                   /product="secretory lipase"
FT                   /note="PFAM: secretory lipase; KEGG: mes:Meso_1425
FT                   secretory lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33770"
FT                   /db_xref="GOA:A4SWA6"
FT                   /db_xref="InterPro:IPR005152"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWA6"
FT                   /protein_id="ABP33770.1"
FT                   /translation="MKNYFSVFLASIFLGILSTAVFADPPVSDFYQSVSKLEINGKLGQ
FT                   IIKQERIQTSVKGAQAWKIAYISSDVAGRKTIVTGLIVAPIGQPPQEGRPILAWAHGTT
FT                   GSAQNCGPSQIINPASPLNEYFLMSGNSWTDYGIPNVEEFIKEGYVVVATDYQGQGGGG
FT                   RHQYAIAGTNGRDAINSARAASSMREAGAGKKTIIYGWSQGGGATIAAASMIDYQAQQG
FT                   TAADNLQYLGFVGLAPDDIAIVLPKPPADEASANKLLNEFTQANVPNVFLFAHYVMALW
FT                   GSEAAFPNLKLTDILTDEGAKVVDQLAGNKCVHVMADSFNYAYGDQYKSLIKPQPRNSL
FT                   AWLNAFIDGSVKPVKPVAPVVIYWGTKDTAVPPIQHELYQKQMCSRGANVQRIQLPGEQ
FT                   THFTTPGVSAPMYLSWVKERVAGKPLANGCPQN"
FT   sig_peptide     540684..540755
FT                   /locus_tag="Pnuc_0550"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            complement(542060..542494)
FT                   /locus_tag="Pnuc_0551"
FT   CDS_pept        complement(542060..542494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0551"
FT                   /product="protein of unknown function DUF336"
FT                   /note="PFAM: protein of unknown function DUF336; KEGG:
FT                   ppu:PP_3193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33771"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWA7"
FT                   /protein_id="ABP33771.1"
FT                   /translation="MTLLSLAQANLIADKALEKAESLDFQPQTVAVLDAGGHIKVIKRS
FT                   DGASLLRPEIAFGKAWGVLGMGFGGRDLAKRAEQAPAFFTALNAISNGRMVPVAGGVLI
FT                   KDAQNEIIGSVGVSGDTSDNDEICAVAGVVAAGLVADTGA"
FT   gene            542685..543998
FT                   /locus_tag="Pnuc_0552"
FT   CDS_pept        542685..543998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0552"
FT                   /product="Cl-channel, voltage-gated family protein"
FT                   /note="PFAM: Cl- channel, voltage-gated family protein;
FT                   KEGG: mkm:Mkms_4266 Cl-channel, voltage-gated family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33772"
FT                   /db_xref="GOA:A4SWA8"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWA8"
FT                   /protein_id="ABP33772.1"
FT                   /translation="MNSIQKEDLADSPYDIFRVLLVAVFAGILVGIVGGAFRTSLNFLA
FT                   IQFHAFIVYLHAVDSGWLIPGFLVTALITSVCVGISRMLVKLEPTTIGSGIQHVEAVMH
FT                   GDAKPSKFRALPIKFFGGLLSIGSGMALGREGPTVQMAAVIGSQCGKLFRLKAVEQSLL
FT                   YTAVAGAGLSIAFNAPLSGIAFSFEEISKKIDIKRLIVSFAAVTSGMLVFRNHFGNSIE
FT                   FFVGDLLPDSGVTLCFYIVFSVLLSFIAAMYSRTIIGALNIADSFRSISPVVKASIIGF
FT                   GIGSLAYFYPNLVGGGDLQVQSLLSGDYFLFPLILIMALRFFLGPICYSSGVPGGIFSP
FT                   ILLMGSGVGVLFVLLLNPLLTYAGITQLDPISFALVGMAAFFTVVVRAPLTGILLVTEM
FT                   SGKVSLMIPLLIASVICTFIPVLLKQEPIYDALRDRGT"
FT   gene            544093..545823
FT                   /locus_tag="Pnuc_0553"
FT   CDS_pept        544093..545823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0553"
FT                   /product="pyruvate dehydrogenase (cytochrome)"
FT                   /note="PFAM: thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding; thiamine pyrophosphate enzyme, central region;
FT                   thiamine pyrophosphate enzyme TPP binding domain protein;
FT                   KEGG: pae:PA5297 pyruvate dehydrogenase (cytochrome)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33773"
FT                   /db_xref="GOA:A4SWA9"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWA9"
FT                   /protein_id="ABP33773.1"
FT                   /translation="MAKTAAEVIVEVFESAGVKHFYGVIGDTLNYVSDAISKSSIEWIH
FT                   VRHEEVGAFAAGADSYLTGTLAGCAGSCGPGSLHLINGVYEAHRSRIPLLVIASQIDTM
FT                   SLGTDMPQEIDFLKVYSDCSVFCEQLYNAEQARHLAVRAVQAAISRQGPAVIVLPVDLS
FT                   KALVKDEIAYSVHIPNPIRRPNDAELKEAAKIISEGKKIGIYAGAGCNGAHDLLIEVAK
FT                   KLKAPIAHTSRAKDFVEYANPYNVGMTGLLGVHSGFHMMNECDTLLLLGADFAWGQFYP
FT                   KHAKIVQIDRDGSRVGKRHPVTLGLEGDVIPSLEALLPLLTEHSNDDFLKECLEERKKT
FT                   EASLAGEESPGDGCVIHPQYLTHLINQYADEDAILTGDVGSAMVWVLRHFDTNGKRRSL
FT                   ISLRNGSMANAMPMALGAKKAFPNRQVISLSGDGGLAMLMGDLLTIDQENLPIKIVVLN
FT                   NSSLNFVELEMKTEGLLNSFTDLKNPNFSKIAEAVGIKGFEATKTADLEQTVKEFLAYP
FT                   GAALLDVHTNRYELIMPPDITEKNVAGMVTYGMKALISGRIKDVEGLMVDPVHTLKKLV
FT                   "
FT   gene            546274..546594
FT                   /locus_tag="Pnuc_0554"
FT   CDS_pept        546274..546594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33774"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWB0"
FT                   /protein_id="ABP33774.1"
FT                   /translation="MFFIGASIATGSVLAQSPPTATGVLRDDPHRPVDSISRNLGVTPE
FT                   QFRACFSNVNPAPRGSLPGSDEKHANKAVLLGCLQKANPAITNDGLDRVMDRYRPGGRA
FT                   AQ"
FT   sig_peptide     546274..546321
FT                   /locus_tag="Pnuc_0554"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.923) with cleavage site probability 0.759 at
FT                   residue 16"
FT   gene            complement(546612..547835)
FT                   /locus_tag="Pnuc_0555"
FT   CDS_pept        complement(546612..547835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0555"
FT                   /product="cytochrome c, class I"
FT                   /note="PFAM: cytochrome c, class I; KEGG: bam:Bamb_2722
FT                   cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33775"
FT                   /db_xref="GOA:A4SWB1"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014353"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWB1"
FT                   /protein_id="ABP33775.1"
FT                   /translation="MFCTLSTSANRLKSLFFCATVAFAPFYAFADDAVKDGAYLATAGD
FT                   CTSCHTAPGGKPFAGGLKMANQFGYLLTPNITPDIETGIGSYSKDDFFRVLHNGVNKKD
FT                   QDLYPFMPYGAYTKVTREDSDKIYDYLRTIQPVSNSIEVNHLDFPFNIRSSMIVWRELF
FT                   FKPGTYKSDPTQSAAWNRGAYLVEGLGHCSSCHSPRNLMGAIENSKAYTGSVIDGWYAL
FT                   NITSNPLTGLGKWSAQDIARFLKTGSYESKTTALGPMEEVVHNSTGKMTDSDLLAMGTY
FT                   LKTLPANSSLSEDQKKVDANTLVGTRLYIDNCSGCHQSSGRGITGVIPPLAGNPAVIAA
FT                   RPNNIIKVIIRGFTARNGYIPMPSFASRLNDQEIVEITNYIRSNWGNTANPDATKGLVE
FT                   DIRKHPGI"
FT   sig_peptide     complement(547743..547835)
FT                   /locus_tag="Pnuc_0555"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 31"
FT   gene            547934..548371
FT                   /locus_tag="Pnuc_0556"
FT   CDS_pept        547934..548371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0556"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: pen:PSEEN2275
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33776"
FT                   /db_xref="GOA:A4SWB2"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWB2"
FT                   /protein_id="ABP33776.1"
FT                   /translation="MENYTASSDLILLIARCLVSPIMLVYGLSKLLDIRDDFEDNPATQ
FT                   RFMKVFDHGATPPLWFAYANALFQFGMGLAILLGFETRIAAALVALWLIPVTYFGHPFW
FT                   AGIDPAVNKENFIKNLGIIAAYLMLFCFGAGKYSLDAVLFG"
FT   gene            548422..548826
FT                   /locus_tag="Pnuc_0557"
FT   CDS_pept        548422..548826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33777"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWB3"
FT                   /protein_id="ABP33777.1"
FT                   /translation="MKYFLTALLTLATAFISLKAYADPNLFQCQVISDAYIGDSGTLDV
FT                   LRDGPRMGQKFTVIKNTGELLGDVMDALKNPRVVSLGSGKNAYKVIWEQESADKKGAFV
FT                   DYLSINASAKGKKKPFGFFSGSLLMTGFCE"
FT   sig_peptide     548422..548490
FT                   /locus_tag="Pnuc_0557"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(549480..549914)
FT                   /locus_tag="Pnuc_0558"
FT   CDS_pept        complement(549480..549914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33778"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWB4"
FT                   /protein_id="ABP33778.1"
FT                   /translation="MKKYLIGALLSTFSFGAFAACQGTDQPLIIAGENICGAISAPSTK
FT                   GEIAIRMPAGPGSELYLLHQNKLNKLSPGIFKSYVDSLKKDEIPSGVSHAIRAIEFAPT
FT                   SLPQYANKTFSCATPHIIEAPKGNIDKAVLLIPNCVAATQ"
FT   sig_peptide     complement(549855..549914)
FT                   /locus_tag="Pnuc_0558"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.936 at
FT                   residue 20"
FT   gene            550161..550904
FT                   /locus_tag="Pnuc_0559"
FT   CDS_pept        550161..550904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0559"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rle:pRL110227 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33779"
FT                   /db_xref="GOA:A4SWB5"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWB5"
FT                   /protein_id="ABP33779.1"
FT                   /translation="MQNLTSIISTVTAAFLGSFVEVVEAFTIVLAVGITNTWRSAFIGT
FT                   AAGLLVLVALVLVFGPLLQLIPIGILQFIVGVLLGLFGMRWLRKAILRASGYIALHDES
FT                   KTYAEEVSALNAQKRSKRADYLAAIASFKAVLLEGIEVVFIVIAVGTREGLMLYAGIGA
FT                   LLACLIVLLVGLVLHRPLTQIPENLLKLSVGVMLTAFSAFWIGEAMGVEWPGSDLVLLP
FT                   LIALIGVFTFLLIRILSADHKHLKA"
FT   sig_peptide     550161..550238
FT                   /locus_tag="Pnuc_0559"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.735) with cleavage site probability 0.431 at
FT                   residue 26"
FT   gene            550908..551120
FT                   /locus_tag="Pnuc_0560"
FT   CDS_pept        550908..551120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33780"
FT                   /db_xref="GOA:A4SWB6"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWB6"
FT                   /protein_id="ABP33780.1"
FT                   /translation="MEFLRTTLKELRDLFIDDGNLVFLLLSLIAIISIAVKWLGLQPIL
FT                   GGILLLIGYLTLLTESVMRYRRKNR"
FT   gene            complement(551164..551541)
FT                   /locus_tag="Pnuc_0561"
FT   CDS_pept        complement(551164..551541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33781"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWB7"
FT                   /protein_id="ABP33781.1"
FT                   /translation="MKILLVLTLATVLLACSKKDADLVLSCNGSNVVTSEDSSIVTDET
FT                   RKYIFENKKLENYNCDWSSKTIVCYATNDGPENRSRSHLVYDIRTGSFTELNSTRASAT
FT                   NRLINRTVFVGHCESPIFHYM"
FT   sig_peptide     complement(551494..551541)
FT                   /locus_tag="Pnuc_0561"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.752) with cleavage site probability 0.335 at
FT                   residue 16"
FT   gene            complement(552152..552859)
FT                   /locus_tag="Pnuc_0562"
FT   CDS_pept        complement(552152..552859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33782"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWB8"
FT                   /protein_id="ABP33782.1"
FT                   /translation="MKSLKYSYMPAILALLISANVYADAQSNPWVGAYGQIGVGYESYI
FT                   PKNANGTTTTASGYSFPNVASANHANGPAGNIGVGYNFGAGDSFVIGLGAALYPGHSKS
FT                   ASSTLVTTVGNTPVVGTGTYDVSNVFSFSLIPGYVIDKTHLIYAKVGYAGSTINANSAG
FT                   NYPQQTNRVNGTVYGLGYKQFLPESSIYFFGEGNYAVNRAKSVSLITDSGSTIASTANA
FT                   TGYDILIGLGYHF"
FT   sig_peptide     complement(552788..552859)
FT                   /locus_tag="Pnuc_0562"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.872 at
FT                   residue 24"
FT   gene            complement(552863..554638)
FT                   /locus_tag="Pnuc_0563"
FT   CDS_pept        complement(552863..554638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0563"
FT                   /product="integral membrane sensor hybrid histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region, ATPase domain protein domain protein; histidine
FT                   kinase A domain protein domain protein; KEGG: pna:Pnap_2688
FT                   integral membrane sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33783"
FT                   /db_xref="GOA:A4SWB9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWB9"
FT                   /protein_id="ABP33783.1"
FT                   /translation="MDTYSIHQPEELLLSEKYQFLETASKTNTAGTIIGPILTGALIFQ
FT                   EAAILNLLIWLSVMAICVAFRAYMVFVKNKDRRLPIHKKIVNLNVGVFSVTASWGLGWL
FT                   IVAPTLPFNLQCLYLLMSSTAVFVGLYGYSINRSTFLCFALPIFIGQFIASLIPPLMFP
FT                   WPILLGEFAFSLYAIKMASYFSNSWVKTVSLQIQNQTLNKALELERNTAISANIAKSKF
FT                   IATASHDLRQPLHAVNIYLDLFEPNKLNQKERINFLQIKKSIQTLNSMFKSLLDLSKLD
FT                   AGTSDNLKKPFELIELVGYLSNTYTPIATNKNLALQFEFMNMGINGDKLLLQQLLGNLI
FT                   SNAIQYTASGSILVKLDKNNDCLHIKIEDTGCGIEPALQDKIFDEFFRVDSTRNMHDGL
FT                   GLGLSIVKRLCKISGADILISSVLGVGTTFKIQTTYSTQSLNDEEAPAVQKVLHENVNP
FT                   QEFLLEAKTIAVFEDDHTIFDAYKQALTQNGFSVLSLSENSQDLMNQLANINQIDCILS
FT                   DYRLETTTGDLIIQQLRDSFSVDIPAIIITADTSPQHIQLFKELNIEVLYKPIGYSEIV
FT                   EAIRLLLKTNLNNHR"
FT   gene            complement(554642..555235)
FT                   /locus_tag="Pnuc_0564"
FT   CDS_pept        complement(554642..555235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0564"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR; response regulator
FT                   receiver; KEGG: pat:Patl_0522 two component transcriptional
FT                   regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33784"
FT                   /db_xref="GOA:A4SWC0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWC0"
FT                   /protein_id="ABP33784.1"
FT                   /translation="MHSVSLLIVDDHPVYRDALHQFLTRKFFSSGNEVYSANSIKEGLK
FT                   IVQGKESKWIILLDLLIPDSETQLCGIKEFKKLEEVVAIAAISGLEKETLEQECIEAGC
FT                   SIFIPKSSDTSYIYQSLCDLMGLNPDEAELTQLTDRQKEILAHISNGDSNKMIAYSLNI
FT                   SEQTVKVHLGEIFKKIKVFNRTQAVIKAKENGWV"
FT   gene            555476..555850
FT                   /locus_tag="Pnuc_0565"
FT   CDS_pept        555476..555850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33785"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWC1"
FT                   /protein_id="ABP33785.1"
FT                   /translation="MGMFLRSIQFNFWRSTMSLTSLCGRHPLVTVLVASGFVFGSVAVA
FT                   GPNIQFGMNQQVQTNPNNPHHLPADMDPKSQTLSDEISAIQVEVHEEVAEASETIHSIA
FT                   FQDHHGSSQQILDYTTGTSN"
FT   sig_peptide     555476..555613
FT                   /locus_tag="Pnuc_0565"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.901 at
FT                   residue 46"
FT   gene            555893..556234
FT                   /locus_tag="Pnuc_0566"
FT   CDS_pept        555893..556234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0566"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rso:RSp1129 putative arsenical resistance
FT                   operon repressor transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33786"
FT                   /db_xref="GOA:A4SWC2"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWC2"
FT                   /protein_id="ABP33786.1"
FT                   /translation="MKTSIYLPIFEALAHETRFRVFGFIYRSGKVGVRPKDVIEEFGVD
FT                   SGTLDFHLKKLMSVGLVVLKTGGRRGVYCPNDNIPHELTRLFDSIQVSPDALTGDVNIS
FT                   ALSHLGMFH"
FT   gene            complement(556249..556599)
FT                   /locus_tag="Pnuc_0567"
FT   CDS_pept        complement(556249..556599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0567"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eba:ebB231 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33787"
FT                   /db_xref="GOA:A4SWC3"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWC3"
FT                   /protein_id="ABP33787.1"
FT                   /translation="MAWIITKYLLTAAMVVFISEVAKRSDRLGGFIAALPLMTLLTLIW
FT                   LYVENQPEEKIANHAYYTFWYVIPTLPMFLLFPYLLPRIGFWLTVGASIVVTIACFGLF
FT                   ALLMKHFGVELL"
FT   gene            complement(556608..558014)
FT                   /locus_tag="Pnuc_0568"
FT   CDS_pept        complement(556608..558014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0568"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO6331 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33788"
FT                   /db_xref="InterPro:IPR018721"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWC4"
FT                   /protein_id="ABP33788.1"
FT                   /translation="MPSELYKSFLKRNPSPQQRFESGKSVRKKVPRSSIGQYTVEANRQ
FT                   SPIDILLSQAKTRIPEYVPIRHARMAVDPFAFFRGGAAIMAKDLATTPSPPITVQLCGD
FT                   MHVSNFGFFSTTEHQLVFGINDFDETLPGNFDWDLKRLTASAMIASQQLGQDKAYGEMI
FT                   VRNIAQAYRLYLHRYSALPFIDLKRTYIDEQALTNRAKNYANEPSQKYLKKLLDKARKN
FT                   NSLGLIGKLTETTPDGIRLIDNPPFIEHLDLSVHGNDISILNDEGMNSYIQSLPADRKH
FT                   LLLNYKWIDWARKVVGVGSVGTSCWVMYFEGRDINDPLFLQSKQAQESVLASFFPKTQF
FT                   GSEGERVVHGQCLIQGAPDLFLGYGKSSELDFYIRQLRDMKGGISIGGDGINKKVFPDF
FT                   AKLFGWALANAHSRSGDPAVLAGYCGKGEAMDDALVSFATIYAKQNETDYDMFMKAIKS
FT                   GQVSCAKKGF"
FT   gene            complement(558101..559102)
FT                   /locus_tag="Pnuc_0569"
FT   CDS_pept        complement(558101..559102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0569"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   rpe:RPE_3904 putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33789"
FT                   /db_xref="GOA:A4SWC5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWC5"
FT                   /protein_id="ABP33789.1"
FT                   /translation="MMNQENQFQFNYLQIEDIPKLIECVRRCYGESYPFKQIYSPSALE
FT                   ELVLNQLMHSVVCKDANQNVLGHGALTFSGEENSSPELGKLFVDPDHRGHHIADLLASE
FT                   LVNLSSNLSLPGFWSECVTNHPYSQDVVIAAGGVEVGLLLGDLPATLKMQGENNFSDSR
FT                   MSLLTYYVPSANAKPSNIFIPESQANHIKSLASHANQARHISTELFSGSGQTKLSSNID
FT                   LATLDACIQITSIGSDFSSMIQSEIDTLEKQQLASIYIDLPIGDKAAATAYLTLEKLGF
FT                   FFGSWLPHFWKNQDVLRMQKIYTQINESEIICARGQGARMKDYVITEMKRVS"
FT   gene            559406..560302
FT                   /locus_tag="Pnuc_0570"
FT   CDS_pept        559406..560302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0570"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   rfr:Rfer_0496 cation diffusion facilitator family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33790"
FT                   /db_xref="GOA:A4SWC6"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWC6"
FT                   /protein_id="ABP33790.1"
FT                   /translation="MDKEIEDHEPQTPAKQAAAKKSTLVSVVVNIGLTVSQVFAGIVSG
FT                   SQGLIADGIHSATDLVADFVVLFANHHSAKDADEDHRYGHQRYETAASLFLGISLLAVG
FT                   VGMLFKAGEKIVNPIQVGQIQILALYVALASLVAKEILFRYMLAVAKRVRSSMLVANAW
FT                   HARSDAASSLVVSIGIVGALLGHPIFDAIGALVVGLMVAKMGWKFGWDALHDLMDRAVS
FT                   EEEHRHIEEIIKSTEGVRGFHDLRTRKMGDMILVDVHIDVDANATVQVGHDIALRAGNQ
FT                   IKKELPVLNVMTHIDPV"
FT   gene            complement(560317..561189)
FT                   /locus_tag="Pnuc_0571"
FT   CDS_pept        complement(560317..561189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0571"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   reh:H16_A1980 hydroxyacylglutathione hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33791"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWC7"
FT                   /protein_id="ABP33791.1"
FT                   /translation="MESYSAPVVKTFFDASTWTFTHVVYEKPGSECAIIDSVLNYDPKS
FT                   GRTSTESADEVIEFIKQQKLRVVWILETHAHADHLTAATYLKKHLGGKLAIGEHIKEVQ
FT                   ATFKNIFNLEDSFETNGSQFDYLITENEELPLGNLKIKALFTPGHTAACMAYVVGDAIF
FT                   VGDTMFMPDVGTARCDFPGGNANVLYQSVKSILSFPNETRLYMCHDYPPNEREVAYITT
FT                   VLDERKHNIHINDGISEKDFISMRAARDATLDMPALILPAVQINIRAGEFPPKETNDVS
FT                   YLKIPLNLL"
FT   gene            complement(561331..561963)
FT                   /locus_tag="Pnuc_0572"
FT   CDS_pept        complement(561331..561963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0572"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: mca:MCA0486 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33792"
FT                   /db_xref="GOA:A4SWC8"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWC8"
FT                   /protein_id="ABP33792.1"
FT                   /translation="MSTPLNHLDKSRLISQKNIAHYDQNAVSYDEGTQGHDVSQNINAL
FT                   LRAIKTEPPFTILDFGCGPGRDLQTFSKLGHIATGLEGSQQAAQIARTKSGCNVLVQDF
FT                   FNLDLPEGYCDGIFANASLFHIPNNILPKVLGNLWACLKPNGILFSSNPRGNNEESWYG
FT                   DRFGSYHNLEGWRSFMTNANFTEVEHYYRPSGLPFEQQHWLASVWRK"
FT   gene            562389..563072
FT                   /locus_tag="Pnuc_0573"
FT   CDS_pept        562389..563072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0573"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   proteins; KEGG: sus:Acid_4064 multiple antibiotic
FT                   resistance (MarC)-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33793"
FT                   /db_xref="GOA:A4SWC9"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWC9"
FT                   /protein_id="ABP33793.1"
FT                   /translation="MLSIALASFVTVFAALFPVINPLGDGPIFLNMVQGCSEGVRNKLA
FT                   RSVSVNCFFMLLASMLIGPQLLLFFGISLPALKLAGGAVVIAMGWNLLNQKSASDKGAN
FT                   ESTGITDETSDGSAFFPLTMPLTVGPGSIATAIALVAAYQESSSFSIANELPAVIGTVA
FT                   ALFALSLTIYFIYRESSGIQRIFGVNGTNVLMRLFAFILLAIGVQIFLGGINGYLELIK
FT                   LLPVH"
FT   gene            563110..564173
FT                   /pseudo
FT                   /locus_tag="Pnuc_0574"
FT   gene            564209..565303
FT                   /locus_tag="Pnuc_0575"
FT   CDS_pept        564209..565303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0575"
FT                   /product="Choloylglycine hydrolase"
FT                   /note="PFAM: Choloylglycine hydrolase; KEGG: stt:t1459
FT                   putative secreted hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33794"
FT                   /db_xref="GOA:A4SWD0"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029132"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWD0"
FT                   /protein_id="ABP33794.1"
FT                   /translation="MCTVFMYQDANGVTYQARSIEDPIFFAESVTYYPAGSSIESMTQA
FT                   GKPGKTFNTKYAFLAVTLAGMLPLNVKPKQESVLEGSNDQGLCFTGNNLFGTTSIEVSS
FT                   SDDKVLVSTDLGHWALGNFQNVAQVKQALANKEVDIWVPALAAFGNLPSPVHYALFDKT
FT                   GGAIVIEFTNGQVQVYDNPVGVMTNGPEFPWHLVNLNNYAQLTNVDTNSSKFNKLKVSP
FT                   VDSGNALANLPSDQTSVGRFVKAAFYSNYAKKASTPKEAVLTLAHVVNNFDRPRNISID
FT                   LPDPSTANVENNATDKTQASSEVTLISFVNDLAQNQWYIRTINAMNFTKFDIPKLASLK
FT                   QLKVITLDSIDELDGGDGTHLFLN"
FT   gene            565656..566438
FT                   /locus_tag="Pnuc_0576"
FT   CDS_pept        565656..566438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0576"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gbe:GbCGDNIH1_1333 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33795"
FT                   /db_xref="GOA:A4SWD1"
FT                   /db_xref="InterPro:IPR025333"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWD1"
FT                   /protein_id="ABP33795.1"
FT                   /translation="MTSFIYRFSNLTIMLFFIVLITAAMDGFPILLQLLPFLSPNDEST
FT                   KSGLSLFGPIASSLGLLIGFLLNQAQTNFREVEGIVSTEAARINNLDRLLLRFGSEKAL
FT                   EARIQLRAYIESIIFIEWPKLAEENGSKETHMLWRNISQNIFKLDPTTPKQVALYSDII
FT                   KKSEEVAESRETRIDKSDKCLPTLFWVVIFICLGALICLNAMFLRTGHYIFGLSILSIA
FT                   YGGLISLLVITDQPFKGQNAIAPSALIKILASIKTRIE"
FT   gene            566439..566576
FT                   /pseudo
FT                   /locus_tag="Pnuc_0577"
FT   gene            complement(566657..568294)
FT                   /locus_tag="Pnuc_0578"
FT   CDS_pept        complement(566657..568294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0578"
FT                   /product="Amidohydrolase 3"
FT                   /note="PFAM: Amidohydrolase 3; KEGG: mul:MUL_0894
FT                   metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33796"
FT                   /db_xref="GOA:A4SWD2"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWD2"
FT                   /protein_id="ABP33796.1"
FT                   /translation="MTSNQTLYFNGNILTMAGDQPEYVEAVLVTDGKITFTGNKKQAST
FT                   LAGQDAKLHDLQGHTLTPGFIDTWGHFGLFAQQTLSLNVGYFADNPPRSRSELITQLKQ
FT                   SGKLLNGWLIAAEYMDGLMKDGPLTMADLDTAFPDTPVLVQNISTLAGLFNTAGLKKLG
FT                   ITADAKVESGTIVVDPNTHQMTGIIIGLPYLKAVAEAYGKFSQDLTFKTYQSAEKIYAS
FT                   YGTTTAQHYQASPDDIQLMRLAADSGAVSIDLVALPMSDTVDALLKDNPDFSFGVYSKG
FT                   DHGFKVAGMLMSTDGGPQLKLAYLSEPYSNTTGFPDDWRGMAYYTQEQVDHYTKLAYEK
FT                   NIPYFCYSNGDAGIDMALAAIKKAIAETGITEDRRTTISHSFFAREDQLNDYKTNHIIA
FT                   ITLSNHMWLYGDIYLDIVGQERADNFCPMVTAHNKGIVVGIHNDVPSSGPDCLFTIWSA
FT                   VNRKTMSGKTLGAKEKMNPYLALQAFTSNAAYVYREENTKGKIMPGMLADLVELDQNPL
FT                   TVDPDTIKDIKVVNTIKNGKVIYSRSAN"
FT   gene            complement(568314..569150)
FT                   /locus_tag="Pnuc_0579"
FT   CDS_pept        complement(568314..569150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0579"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rle:pRL110217 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33797"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWD3"
FT                   /protein_id="ABP33797.1"
FT                   /translation="MHQFKALLTILILCNFKLVLAQDTNSFFEALTPGEERLISSERQL
FT                   QAQDNVASVPIYFNFDQKVGLGHQGSTQYTQIEPWLPYRINSDYSYVVHPQITYQSFNN
FT                   FDGYSSSGFKPVIIESFFTESNESRLRNSFGIGPMVQIGTNMPAMYGSSQNAAGYSMGA
FT                   IHRSEDWIMGAYAYQSFGLGAMPLNGPSANNVSFEPFITYITKRYGNITLDCESITNID
FT                   TGAHSYPINLMGSKLIEVGDLPLLFTIGARYYTVNTNQGGAQGWGGRIGITYAFSH"
FT   sig_peptide     complement(569085..569150)
FT                   /locus_tag="Pnuc_0579"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.960 at
FT                   residue 22"
FT   gene            569312..569791
FT                   /locus_tag="Pnuc_0580"
FT   CDS_pept        569312..569791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33798"
FT                   /db_xref="GOA:A4SWD4"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWD4"
FT                   /protein_id="ABP33798.1"
FT                   /translation="MLKELPIVAIYLSLWFCAITFYNQAAVHMPEKGIESYGFAVIQAL
FT                   VMSKIMLTAEMIVPVGVIFNPNVKYTIYLAILVRTTLASIVALMLRYSAAGTEGFFKHQ
FT                   GFVESMRNFCDGDIAHILALTCLYWLIILPYIAYRFILHLAGNEGLESYLLAKRS"
FT   gene            complement(570029..570331)
FT                   /locus_tag="Pnuc_0581"
FT   CDS_pept        complement(570029..570331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33799"
FT                   /db_xref="GOA:A4SWD5"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWD5"
FT                   /protein_id="ABP33799.1"
FT                   /translation="MRNPNNLSGHILPTSGAMLGVCMTVISIVKLTQTNRGVAYWVDDL
FT                   LALDALIFLASSIFSYLSIRSNSKKVYFEDIADKFFMLALLCMGAAVLLLTYEIV"
FT   gene            complement(570332..571000)
FT                   /locus_tag="Pnuc_0582"
FT   CDS_pept        complement(570332..571000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0582"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dar:Daro_1872 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33800"
FT                   /db_xref="GOA:A4SWD6"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWD6"
FT                   /protein_id="ABP33800.1"
FT                   /translation="MNRAIMPLRSIILSFLVLVAILPIKESFAQWGGSQGSGIPGMPGM
FT                   RRGAGRNASNPDYSSISANTHISMPAPGSQLLTYEQIETGLSRLEESLKLTPEQSKAWG
FT                   NFAIKVRLYASDVAKERAKLNNDSSDTIDGLKFLSQSTEDAKNRYTSLKEVDETAKPLY
FT                   KLLTSEQKASFDSKVPTFINASQKRLPPSQPNYNLPELGGSPSSNQNPGSGILPGYSHQ
FT                   "
FT   sig_peptide     complement(570911..571000)
FT                   /locus_tag="Pnuc_0582"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.827) with cleavage site probability 0.683 at
FT                   residue 30"
FT   gene            571145..571585
FT                   /locus_tag="Pnuc_0583"
FT   CDS_pept        571145..571585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0583"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: azo:azo0274 conserved hypothetical secreted
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33801"
FT                   /db_xref="InterPro:IPR021455"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWD7"
FT                   /protein_id="ABP33801.1"
FT                   /translation="MKRAMQGLMMASILMVGAIGIASAALPDPQDPQVVANMTFEQRLQ
FT                   MSKDLREQFKQATPEERREYRQKLHAKFKALSPEERKALREKMHAQWQALTPEQKKELR
FT                   DNRKAMIAAMTPEERLEMKKEREEWMKAHPNEKEHWNKPMSN"
FT   sig_peptide     571145..571219
FT                   /locus_tag="Pnuc_0583"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 25"
FT   gene            571594..572166
FT                   /locus_tag="Pnuc_0584"
FT   CDS_pept        571594..572166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0584"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70, region 4 type 2; KEGG:
FT                   azo:azo0273 putative ECF-family RNA polymerase sigma
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33802"
FT                   /db_xref="GOA:A4SWD8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWD8"
FT                   /protein_id="ABP33802.1"
FT                   /translation="MTLFPSKQHRIEQALLKRAVAGDSKASKEVIRLLSSPAYSLAWKM
FT                   LGNKEDAEDVVQEAFIRLWKSADSFAGKSGLFTYFYAIVSNLCLDRIKSINKGFFEEFD
FT                   EVEHQPIKEIEWSIAEGVSPESIKKAMDVLSSKQRMAILMWAYQDMTAEEVGLAMGMNK
FT                   NSVDQLLYRAKLKLKMELERGESHASE"
FT   gene            572144..572458
FT                   /locus_tag="Pnuc_0585"
FT   CDS_pept        572144..572458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33803"
FT                   /db_xref="GOA:A4SWD9"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWD9"
FT                   /protein_id="ABP33803.1"
FT                   /translation="MNLMRANDKKHLKKVLDQIEVQELSNHFEKRIYQDWQRAVSKGDQ
FT                   PTDRISEVLVLARLHPRLIALIAIAIITASMLLGQHLLTSPEEELYRIDALSELSLSTI
FT                   "
FT   gene            573052..573255
FT                   /locus_tag="Pnuc_0586"
FT   CDS_pept        573052..573255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0586"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /note="PFAM: Cold-shock protein, DNA-binding; SMART: Cold
FT                   shock protein; KEGG: dar:Daro_1388 cold-shock protein,
FT                   DNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33804"
FT                   /db_xref="GOA:A4SWE0"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWE0"
FT                   /protein_id="ABP33804.1"
FT                   /translation="MANGIVKWFNDAKGFGFITPELGGEDLFAHFSAINSNGFKSLAEG
FT                   QKVTFDITTGPKGKLASNIQPV"
FT   gene            573341..573601
FT                   /locus_tag="Pnuc_0587"
FT   CDS_pept        573341..573601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0587"
FT                   /product="bacterial translation initiation factor 1
FT                   (bIF-1)"
FT                   /note="TIGRFAM: translation initiation factor IF-1; PFAM:
FT                   S1, IF1 family protein; KEGG: pna:Pnap_0981 translation
FT                   initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33805"
FT                   /db_xref="GOA:A4SWE1"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4SWE1"
FT                   /protein_id="ABP33805.1"
FT                   /translation="MAKEELLEMEGLVDEILPDSRYRITLDNGHKLIAYTAGRVKKNHI
FT                   RILAGDKVSLEVSPYDLSKGRITFRHIDKKQSFAGAPYRRH"
FT   gene            574169..574906
FT                   /locus_tag="Pnuc_0588"
FT   CDS_pept        574169..574906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33806"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWE2"
FT                   /protein_id="ABP33806.1"
FT                   /translation="MERFIRIFFLLILALFISSASGQTSNDVNSTGASATNTSVGGGQS
FT                   NLLGSNIGTQQNSTNVTGGYGNVNSNNPGTTTAKVYSVPTMYAPGLTAAGSDVCLGSVS
FT                   ASGSILGLGLAGGGTYVDDNCVLLKNSQRMAALGFGNAAVVMMLQNKDIEKAIRTSSPT
FT                   VYLQVSKDRLANLQAEFDDAKEMGESTVDLEEKLIKANKEVRIMARRVQTSPGMPEKVV
FT                   EIAPTTSGGKAKTANDPREILNP"
FT   sig_peptide     574169..574237
FT                   /locus_tag="Pnuc_0588"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.968 at
FT                   residue 23"
FT   gene            574917..575669
FT                   /locus_tag="Pnuc_0589"
FT   CDS_pept        574917..575669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33807"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWE3"
FT                   /protein_id="ABP33807.1"
FT                   /translation="MKKILVASLLTISALAFAAPPTAFTFVAPASVAVAPALTNLLGVV
FT                   NAFKAVGTAFALADPVATGLLDQAAINLTLSVDIKNIDTLAINSPVYSSTTGQITWVNN
FT                   FATSVASSNAWVQTDIAGYDTAAKAFRDAGGAYAVTAIMTGGSGVNKLLSAIDGTTRTV
FT                   NGASYIPDSSFNTLVTSFNTDLTVTQKIADLGTAATALTAIQTQGSAMDIAGAVAVTTL
FT                   NTLVLPAAGKNSASYSTLNSLLLYNALQ"
FT   sig_peptide     574917..574973
FT                   /locus_tag="Pnuc_0589"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.861 at
FT                   residue 19"
FT   gene            complement(575942..576139)
FT                   /locus_tag="Pnuc_0590"
FT   CDS_pept        complement(575942..576139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33808"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWE4"
FT                   /protein_id="ABP33808.1"
FT                   /translation="MIIPTPDILNSPDPDISGSYFAIKRARKAAIDLAIQTNTAIVTTI
FT                   NGKIVRIPAAELIKQRQLTA"
FT   gene            complement(576142..576660)
FT                   /locus_tag="Pnuc_0591"
FT   CDS_pept        complement(576142..576660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0591"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eba:ebA2161 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33809"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWE5"
FT                   /protein_id="ABP33809.1"
FT                   /translation="MMSGINKKIIIIAGPNGAGKTTFAKNFLPQEAHTFRFINADLIAA
FT                   GLAPFNPESVAFKAARLMLNELDEYTKAGESFAFETTLSGTHYLQRIQEWKDLGYTIKL
FT                   WFIALSSPELAISRVAERVAQGGHNIPEEVIRRRYRAGLENLPKYQKAVNSWVLLDGDL
FT                   TELEKIAQG"
FT   gene            complement(577031..578011)
FT                   /locus_tag="Pnuc_0592"
FT   CDS_pept        complement(577031..578011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0592"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase, NAD-binding; KEGG: mta:Moth_1954 D-isomer
FT                   specific 2-hydroxyacid dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33810"
FT                   /db_xref="GOA:A4SWE6"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWE6"
FT                   /protein_id="ABP33810.1"
FT                   /translation="MSKPNVYITRSIPEQTIAELRKTCDVEVNPHDRALTREELMNAVK
FT                   GRDAVITLLTDNVDAEILDAAGPQCKIIANYAVGFNNFNLDAATKRGVIMTNTPGVLDK
FT                   ATATHAWALLLATAKRISESERYVREGKWKGWSPMTFIGQDVDGKTLGIAGLGRIGTMF
FT                   ARKAAAFDMKVIYTNEQRNFDFEKDHGATFVDKETLLKESDFLSIHLPLTPETKYYIGA
FT                   KELSQMKPSAILINAARGPLVNEKELVEALRNKVIWGAGLDVFEDEPKLAEGLDQLDNV
FT                   VIVPHIASATLDTRLAMGKIVTDNVLAVLNGKAPITCINPEVLKK"
FT   gene            complement(578094..579035)
FT                   /locus_tag="Pnuc_0593"
FT   CDS_pept        complement(578094..579035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0593"
FT                   /product="2-keto-3-deoxygluconate permease"
FT                   /note="PFAM: 2-keto-3-deoxygluconate permease; KEGG:
FT                   sec:SC0161 2-keto-3-deoxygluconate permease; TC 2.A.10.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33811"
FT                   /db_xref="GOA:A4SWE7"
FT                   /db_xref="InterPro:IPR004684"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWE7"
FT                   /protein_id="ABP33811.1"
FT                   /translation="MKIYQAINKVPGGIMVVPLFIGMLLNTFAPNALKIGGFTQALTNQ
FT                   GYPTFLAMYLFTVGTKMTLNAAPTMLKRGFGIMFAKVGIAIAVALGIAHFFNGDVLGLT
FT                   TLAVLAAMNDTNGGMFLALTSTFGNKEDAGTYVPQSIETGPFLTMLVLVGAGLAVIPWM
FT                   TMFSVIAPILAGALLGNLDKDLRDFFGAHEPIIVPFMAFTLGQGINLSAVLTAGLPGIL
FT                   LGITVLVLTGIVCILADRLLGGSGVAGAAASSTAGNATGTPQAVALADPTFAAIAPIAT
FT                   VQVAASVIVTAVLTPLLTAFIYNKNKRKNGGN"
FT   gene            579331..580230
FT                   /locus_tag="Pnuc_0594"
FT   CDS_pept        579331..580230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0594"
FT                   /product="2-hydroxy-3-oxopropionate reductase"
FT                   /EC_number="1.1.1.60"
FT                   /note="KEGG: pol:Bpro_4563 2-hydroxy-3-oxopropionate
FT                   reductase; TIGRFAM: 2-hydroxy-3-oxopropionate reductase;
FT                   PFAM: NADP oxidoreductase, coenzyme F420-dependent;
FT                   6-phosphogluconate dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33812"
FT                   /db_xref="GOA:A4SWE8"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006398"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWE8"
FT                   /protein_id="ABP33812.1"
FT                   /translation="MSKLKLGFIGLGIMGAPMASHLMAAGHALFINTRSKVPEELANSA
FT                   AVVCATPAEVAKMADIIFTMVPDTPDVEKVLFGEHGVAHGLSKGKIVVDMSSISPIATK
FT                   DFAKKINALGCEYLDAPVSGGQVGAKGGTLTIMVGGKESVFQTVKPMFDLMGKNITLVG
FT                   DNGAGQVTKVANQIIVALNIEAVAEALLFASKAGADPARVREALMGGFASSKILEVHAE
FT                   RMIKRTFDPGFRIELHQKDLNLALNSARALGVSLPNTANAQELFNSCLAYGGKAWDHSA
FT                   MVKALEKLANFEVGQKAT"
FT   sig_peptide     579331..579405
FT                   /locus_tag="Pnuc_0594"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.945 at
FT                   residue 25"
FT   gene            complement(580448..580523)
FT                   /locus_tag="Pnuc_R0015"
FT                   /note="tRNA-Lys1"
FT   tRNA            complement(580448..580523)
FT                   /locus_tag="Pnuc_R0015"
FT                   /product="tRNA-Lys"
FT   gene            complement(580610..581956)
FT                   /locus_tag="Pnuc_0595"
FT   CDS_pept        complement(580610..581956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0595"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /note="PFAM: cell wall hydrolase/autolysin; KEGG:
FT                   reh:H16_A0597 N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33813"
FT                   /db_xref="GOA:A4SWE9"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWE9"
FT                   /protein_id="ABP33813.1"
FT                   /translation="MSSKKVNLSKRLTLKTSAQFLSFALLLTEFDIAWGAKILGVRVWP
FT                   SEDYTRVTLETDKALPITQQILTNPDRLVVDVQGLELNPTLKDLVAKVKPNDPYISQVR
FT                   VGQFQPGVVRLVFDLKEPIKPQLFTLDPIGEYNYRMVFDLYPTTPPDPLMELVKSSAKK
FT                   ESALEKSNEEVDLIAQFATNKDKELAKTPAAPVAQAIPETKAPPAAAKYKRLITIAIDP
FT                   GHGGEDPGAIGAAGSREKNVVLSIAKRLKDKIEGEAYMRPYLTRDGDYFVPLHVRVQKA
FT                   RRVEADLFVSIHADAFIESNAKGASVFALSQMGASSTMARWMANKENASDLIGGINIKT
FT                   QDRQVANLLLDMSTTAQIKDSLQVGNSILKQIGGFAPLHKGKVEQASFAVLKAPDIPSI
FT                   LVETAFISNPQEEARLNDDGYQDRIAEAILKGIKEYFSKNPPVARRINS"
FT   gene            complement(581960..582490)
FT                   /locus_tag="Pnuc_0596"
FT   CDS_pept        complement(581960..582490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0596"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="PFAM: protein of unknown function UPF0079; KEGG:
FT                   cvi:CV3821 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33814"
FT                   /db_xref="GOA:A4SWF0"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWF0"
FT                   /protein_id="ABP33814.1"
FT                   /translation="MAQKQELLKASLQQHCRQEADTAALAKFLAATLWHYLVQSPQKHL
FT                   NISLKGDLGAGKTTFARYLIQAMGYEGKVKSPTYTLCEPYQIELKQQEITIHHFDLYRM
FT                   RDPLEWQEAGFEEHFDIPGICLIEWPEKAEGTLPAFDLQIQLTAGADENERFININALS
FT                   QSGASILKEGASK"
FT   gene            582533..583627
FT                   /locus_tag="Pnuc_0597"
FT   CDS_pept        582533..583627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0597"
FT                   /product="putative iron-sulfur cluster binding protein"
FT                   /note="TIGRFAM: putative iron-sulfur cluster binding
FT                   protein; PFAM: 4Fe-4S ferredoxin, iron-sulfur binding
FT                   domain protein; domain of unknown function DUF1730; KEGG:
FT                   rme:Rmet_0524 4Fe-4S cluster binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33815"
FT                   /db_xref="GOA:A4SWF1"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWF1"
FT                   /protein_id="ABP33815.1"
FT                   /translation="MPLSANLTSLDEAKLRNWLGGQSHELGFDALRITDTHLGPASDRL
FT                   QTWLSEGRHGHMEYMQRHADLRSDPQLLVPGTLRVICVSMNYLPPETSFEREWERMADP
FT                   SQAVVSLYARGRDYHKVLRNRLQEFAKRIEEKIGAFGYRVFTDSAPLMEVELARKAGLG
FT                   WRGKHTLLLNRESGSTFFLGEILVDIPLPIDTEVEEHCGTCTSCIDICPTQAITAPYQL
FT                   DARRCISYLTIENPEAIPIEFRRAMGNRVYGCDDCQLICPWNKFAKRSQMPDFVQRHGL
FT                   GQATLLQLWSWTEAEFEQRHEGSAIRRIGYLRWRRNLAVAMGNALSNSTVPASQKDDIR
FT                   LALQHSLEGADPLLVEHINWALST"
FT   gene            583670..584455
FT                   /locus_tag="Pnuc_0598"
FT   CDS_pept        583670..584455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0598"
FT                   /product="AzlC family protein"
FT                   /note="PFAM: AzlC family protein; KEGG: pub:SAR11_1356
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33816"
FT                   /db_xref="GOA:A4SWF2"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWF2"
FT                   /protein_id="ABP33816.1"
FT                   /translation="MSSADQPYIDPSEIALEESAAERFSSRNDAFWSGIRDAAGAPAVV
FT                   LFAGMVGFGAMGKTNGFDIWFTSATSLFMFALPGQVVLLEMAITGSSAIAIALAVTLTA
FT                   TRFITMTVTLFPQFHHKDRNRGLYASVHLLAMTAWAISMREFHSIETKHRLSYFTGLGL
FT                   LCWLISVPGTILGYFLAGMVPTPVTLGLVFINPLFFLLTFTEVKPWINRIAILLGCVFG
FT                   PIFFYIDRDTSLLTAGLVSGTIAYLIDRKFLRKKPGVMG"
FT   gene            584455..584805
FT                   /locus_tag="Pnuc_0599"
FT   CDS_pept        584455..584805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnuc_0599"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: atc:AGR_C_2526 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnuc_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABP33817"
FT                   /db_xref="GOA:A4SWF3"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:A4SWF3"
FT                   /protein_id="