(data stored in ACNUC7421 zone)

EMBL: CP000656

ID   CP000656; SV 1; circular; genomic DNA; STD; PRO; 5619607 BP.
XX
AC   CP000656; AAPA01000000-AAPA01000045;
XX
PR   Project:PRJNA15760;
XX
DT   19-APR-2007 (Rel. 91, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Mycobacterium gilvum PYR-GCK, complete genome.
XX
KW   .
XX
OS   Mycolicibacterium gilvum PYR-GCK
OC   Bacteria; Actinobacteria; Corynebacteriales; Mycobacteriaceae;
OC   Mycolicibacterium.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-5619607
RX   PUBMED; 23469141.
RA   Badejo A.C., Badejo A.O., Shin K.H., Chai Y.G.;
RT   "A Gene Expression Study of the Activities of Aromatic Ring-Cleavage
RT   Dioxygenases in Mycobacterium gilvum PYR-GCK to Changes in Salinity and pH
RT   during Pyrene Degradation";
RL   PLoS One 8(2):E58066-E58066(2013).
XX
RN   [2]
RP   1-5619607
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Chain P., Malfatti S., Shin M., Vergez L., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Mikhailova N., Miller C., Richardson P.;
RT   ;
RL   Submitted (09-APR-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 52d9e29ac672f6229810b50375db0ec2.
DR   BioSample; SAMN02598346.
DR   EnsemblGenomes-Gn; EBG00001148502.
DR   EnsemblGenomes-Gn; EBG00001148503.
DR   EnsemblGenomes-Gn; EBG00001148504.
DR   EnsemblGenomes-Gn; EBG00001148505.
DR   EnsemblGenomes-Gn; EBG00001148506.
DR   EnsemblGenomes-Gn; EBG00001148507.
DR   EnsemblGenomes-Gn; EBG00001148508.
DR   EnsemblGenomes-Gn; EBG00001148509.
DR   EnsemblGenomes-Gn; EBG00001148510.
DR   EnsemblGenomes-Gn; EBG00001148511.
DR   EnsemblGenomes-Gn; EBG00001148512.
DR   EnsemblGenomes-Gn; EBG00001148513.
DR   EnsemblGenomes-Gn; EBG00001148514.
DR   EnsemblGenomes-Gn; EBG00001148515.
DR   EnsemblGenomes-Gn; EBG00001148516.
DR   EnsemblGenomes-Gn; EBG00001148517.
DR   EnsemblGenomes-Gn; EBG00001148518.
DR   EnsemblGenomes-Gn; EBG00001148519.
DR   EnsemblGenomes-Gn; EBG00001148520.
DR   EnsemblGenomes-Gn; EBG00001148521.
DR   EnsemblGenomes-Gn; EBG00001148522.
DR   EnsemblGenomes-Gn; EBG00001148523.
DR   EnsemblGenomes-Gn; EBG00001148524.
DR   EnsemblGenomes-Gn; EBG00001148525.
DR   EnsemblGenomes-Gn; EBG00001148526.
DR   EnsemblGenomes-Gn; EBG00001148527.
DR   EnsemblGenomes-Gn; EBG00001148528.
DR   EnsemblGenomes-Gn; EBG00001148529.
DR   EnsemblGenomes-Gn; EBG00001148530.
DR   EnsemblGenomes-Gn; EBG00001148531.
DR   EnsemblGenomes-Gn; EBG00001148532.
DR   EnsemblGenomes-Gn; EBG00001148533.
DR   EnsemblGenomes-Gn; EBG00001148534.
DR   EnsemblGenomes-Gn; EBG00001148535.
DR   EnsemblGenomes-Gn; EBG00001148536.
DR   EnsemblGenomes-Gn; EBG00001148537.
DR   EnsemblGenomes-Gn; EBG00001148538.
DR   EnsemblGenomes-Gn; EBG00001148539.
DR   EnsemblGenomes-Gn; EBG00001148540.
DR   EnsemblGenomes-Gn; EBG00001148541.
DR   EnsemblGenomes-Gn; EBG00001148542.
DR   EnsemblGenomes-Gn; EBG00001148543.
DR   EnsemblGenomes-Gn; EBG00001148544.
DR   EnsemblGenomes-Gn; EBG00001148545.
DR   EnsemblGenomes-Gn; EBG00001148546.
DR   EnsemblGenomes-Gn; EBG00001148547.
DR   EnsemblGenomes-Gn; EBG00001148548.
DR   EnsemblGenomes-Gn; EBG00001148549.
DR   EnsemblGenomes-Gn; EBG00001148550.
DR   EnsemblGenomes-Gn; EBG00001148551.
DR   EnsemblGenomes-Gn; EBG00001148552.
DR   EnsemblGenomes-Gn; EBG00001148553.
DR   EnsemblGenomes-Gn; EBG00001148554.
DR   EnsemblGenomes-Gn; EBG00001148555.
DR   EnsemblGenomes-Gn; EBG00001148556.
DR   EnsemblGenomes-Gn; EBG00001148557.
DR   EnsemblGenomes-Gn; EBG00001148558.
DR   EnsemblGenomes-Gn; EBG00001148559.
DR   EnsemblGenomes-Gn; EBG00001148560.
DR   EnsemblGenomes-Gn; EBG00001148561.
DR   EnsemblGenomes-Gn; EBG00001148562.
DR   EnsemblGenomes-Gn; EBG00001148563.
DR   EnsemblGenomes-Gn; EBG00001148564.
DR   EnsemblGenomes-Gn; EBG00001148565.
DR   EnsemblGenomes-Gn; EBG00001148566.
DR   EnsemblGenomes-Gn; EBG00001148567.
DR   EnsemblGenomes-Gn; EBG00001148568.
DR   EnsemblGenomes-Gn; EBG00001148569.
DR   EnsemblGenomes-Gn; Mflv_R0001.
DR   EnsemblGenomes-Gn; Mflv_R0002.
DR   EnsemblGenomes-Gn; Mflv_R0003.
DR   EnsemblGenomes-Gn; Mflv_R0004.
DR   EnsemblGenomes-Gn; Mflv_R0005.
DR   EnsemblGenomes-Gn; Mflv_R0006.
DR   EnsemblGenomes-Gn; Mflv_R0007.
DR   EnsemblGenomes-Gn; Mflv_R0008.
DR   EnsemblGenomes-Gn; Mflv_R0009.
DR   EnsemblGenomes-Gn; Mflv_R0011.
DR   EnsemblGenomes-Gn; Mflv_R0012.
DR   EnsemblGenomes-Gn; Mflv_R0013.
DR   EnsemblGenomes-Gn; Mflv_R0014.
DR   EnsemblGenomes-Gn; Mflv_R0015.
DR   EnsemblGenomes-Gn; Mflv_R0016.
DR   EnsemblGenomes-Gn; Mflv_R0017.
DR   EnsemblGenomes-Gn; Mflv_R0018.
DR   EnsemblGenomes-Gn; Mflv_R0019.
DR   EnsemblGenomes-Gn; Mflv_R0020.
DR   EnsemblGenomes-Gn; Mflv_R0021.
DR   EnsemblGenomes-Gn; Mflv_R0022.
DR   EnsemblGenomes-Gn; Mflv_R0023.
DR   EnsemblGenomes-Gn; Mflv_R0024.
DR   EnsemblGenomes-Gn; Mflv_R0025.
DR   EnsemblGenomes-Gn; Mflv_R0026.
DR   EnsemblGenomes-Gn; Mflv_R0027.
DR   EnsemblGenomes-Gn; Mflv_R0028.
DR   EnsemblGenomes-Gn; Mflv_R0029.
DR   EnsemblGenomes-Gn; Mflv_R0030.
DR   EnsemblGenomes-Gn; Mflv_R0031.
DR   EnsemblGenomes-Gn; Mflv_R0032.
DR   EnsemblGenomes-Gn; Mflv_R0033.
DR   EnsemblGenomes-Gn; Mflv_R0034.
DR   EnsemblGenomes-Gn; Mflv_R0036.
DR   EnsemblGenomes-Gn; Mflv_R0037.
DR   EnsemblGenomes-Gn; Mflv_R0038.
DR   EnsemblGenomes-Gn; Mflv_R0039.
DR   EnsemblGenomes-Gn; Mflv_R0040.
DR   EnsemblGenomes-Gn; Mflv_R0041.
DR   EnsemblGenomes-Gn; Mflv_R0042.
DR   EnsemblGenomes-Gn; Mflv_R0043.
DR   EnsemblGenomes-Gn; Mflv_R0044.
DR   EnsemblGenomes-Gn; Mflv_R0045.
DR   EnsemblGenomes-Gn; Mflv_R0046.
DR   EnsemblGenomes-Gn; Mflv_R0047.
DR   EnsemblGenomes-Gn; Mflv_R0048.
DR   EnsemblGenomes-Gn; Mflv_R0049.
DR   EnsemblGenomes-Gn; Mflv_R0050.
DR   EnsemblGenomes-Gn; Mflv_R0051.
DR   EnsemblGenomes-Gn; Mflv_R0052.
DR   EnsemblGenomes-Gn; Mflv_R0053.
DR   EnsemblGenomes-Gn; Mflv_R0054.
DR   EnsemblGenomes-Gn; Mflv_R0055.
DR   EnsemblGenomes-Tr; EBT00001565216.
DR   EnsemblGenomes-Tr; EBT00001565218.
DR   EnsemblGenomes-Tr; EBT00001565219.
DR   EnsemblGenomes-Tr; EBT00001565221.
DR   EnsemblGenomes-Tr; EBT00001565223.
DR   EnsemblGenomes-Tr; EBT00001565226.
DR   EnsemblGenomes-Tr; EBT00001565228.
DR   EnsemblGenomes-Tr; EBT00001565229.
DR   EnsemblGenomes-Tr; EBT00001565232.
DR   EnsemblGenomes-Tr; EBT00001565234.
DR   EnsemblGenomes-Tr; EBT00001565236.
DR   EnsemblGenomes-Tr; EBT00001565238.
DR   EnsemblGenomes-Tr; EBT00001565240.
DR   EnsemblGenomes-Tr; EBT00001565242.
DR   EnsemblGenomes-Tr; EBT00001565244.
DR   EnsemblGenomes-Tr; EBT00001565246.
DR   EnsemblGenomes-Tr; EBT00001565247.
DR   EnsemblGenomes-Tr; EBT00001565249.
DR   EnsemblGenomes-Tr; EBT00001565251.
DR   EnsemblGenomes-Tr; EBT00001565253.
DR   EnsemblGenomes-Tr; EBT00001565254.
DR   EnsemblGenomes-Tr; EBT00001565255.
DR   EnsemblGenomes-Tr; EBT00001565257.
DR   EnsemblGenomes-Tr; EBT00001565259.
DR   EnsemblGenomes-Tr; EBT00001565260.
DR   EnsemblGenomes-Tr; EBT00001565261.
DR   EnsemblGenomes-Tr; EBT00001565264.
DR   EnsemblGenomes-Tr; EBT00001565265.
DR   EnsemblGenomes-Tr; EBT00001565267.
DR   EnsemblGenomes-Tr; EBT00001565269.
DR   EnsemblGenomes-Tr; EBT00001565272.
DR   EnsemblGenomes-Tr; EBT00001565273.
DR   EnsemblGenomes-Tr; EBT00001565274.
DR   EnsemblGenomes-Tr; EBT00001565275.
DR   EnsemblGenomes-Tr; EBT00001565276.
DR   EnsemblGenomes-Tr; EBT00001565277.
DR   EnsemblGenomes-Tr; EBT00001565278.
DR   EnsemblGenomes-Tr; EBT00001565279.
DR   EnsemblGenomes-Tr; EBT00001565280.
DR   EnsemblGenomes-Tr; EBT00001565281.
DR   EnsemblGenomes-Tr; EBT00001565282.
DR   EnsemblGenomes-Tr; EBT00001565283.
DR   EnsemblGenomes-Tr; EBT00001565284.
DR   EnsemblGenomes-Tr; EBT00001565285.
DR   EnsemblGenomes-Tr; EBT00001565286.
DR   EnsemblGenomes-Tr; EBT00001565287.
DR   EnsemblGenomes-Tr; EBT00001565288.
DR   EnsemblGenomes-Tr; EBT00001565289.
DR   EnsemblGenomes-Tr; EBT00001565290.
DR   EnsemblGenomes-Tr; EBT00001565291.
DR   EnsemblGenomes-Tr; EBT00001565292.
DR   EnsemblGenomes-Tr; EBT00001565293.
DR   EnsemblGenomes-Tr; EBT00001565294.
DR   EnsemblGenomes-Tr; EBT00001565295.
DR   EnsemblGenomes-Tr; EBT00001565296.
DR   EnsemblGenomes-Tr; EBT00001565297.
DR   EnsemblGenomes-Tr; EBT00001565298.
DR   EnsemblGenomes-Tr; EBT00001565299.
DR   EnsemblGenomes-Tr; EBT00001565300.
DR   EnsemblGenomes-Tr; EBT00001565301.
DR   EnsemblGenomes-Tr; EBT00001565302.
DR   EnsemblGenomes-Tr; EBT00001565303.
DR   EnsemblGenomes-Tr; EBT00001565304.
DR   EnsemblGenomes-Tr; EBT00001565305.
DR   EnsemblGenomes-Tr; EBT00001565306.
DR   EnsemblGenomes-Tr; EBT00001565307.
DR   EnsemblGenomes-Tr; EBT00001565308.
DR   EnsemblGenomes-Tr; EBT00001565309.
DR   EnsemblGenomes-Tr; Mflv_R0001-1.
DR   EnsemblGenomes-Tr; Mflv_R0002-1.
DR   EnsemblGenomes-Tr; Mflv_R0003-1.
DR   EnsemblGenomes-Tr; Mflv_R0004-1.
DR   EnsemblGenomes-Tr; Mflv_R0005-1.
DR   EnsemblGenomes-Tr; Mflv_R0006-1.
DR   EnsemblGenomes-Tr; Mflv_R0007-1.
DR   EnsemblGenomes-Tr; Mflv_R0008-1.
DR   EnsemblGenomes-Tr; Mflv_R0009-1.
DR   EnsemblGenomes-Tr; Mflv_R0011-1.
DR   EnsemblGenomes-Tr; Mflv_R0012-1.
DR   EnsemblGenomes-Tr; Mflv_R0013-1.
DR   EnsemblGenomes-Tr; Mflv_R0014-1.
DR   EnsemblGenomes-Tr; Mflv_R0015-1.
DR   EnsemblGenomes-Tr; Mflv_R0016-1.
DR   EnsemblGenomes-Tr; Mflv_R0017-1.
DR   EnsemblGenomes-Tr; Mflv_R0018-1.
DR   EnsemblGenomes-Tr; Mflv_R0019-1.
DR   EnsemblGenomes-Tr; Mflv_R0020-1.
DR   EnsemblGenomes-Tr; Mflv_R0021-1.
DR   EnsemblGenomes-Tr; Mflv_R0022-1.
DR   EnsemblGenomes-Tr; Mflv_R0023-1.
DR   EnsemblGenomes-Tr; Mflv_R0024-1.
DR   EnsemblGenomes-Tr; Mflv_R0025-1.
DR   EnsemblGenomes-Tr; Mflv_R0026-1.
DR   EnsemblGenomes-Tr; Mflv_R0027-1.
DR   EnsemblGenomes-Tr; Mflv_R0028-1.
DR   EnsemblGenomes-Tr; Mflv_R0029-1.
DR   EnsemblGenomes-Tr; Mflv_R0030-1.
DR   EnsemblGenomes-Tr; Mflv_R0031-1.
DR   EnsemblGenomes-Tr; Mflv_R0032-1.
DR   EnsemblGenomes-Tr; Mflv_R0033-1.
DR   EnsemblGenomes-Tr; Mflv_R0034-1.
DR   EnsemblGenomes-Tr; Mflv_R0036-1.
DR   EnsemblGenomes-Tr; Mflv_R0037-1.
DR   EnsemblGenomes-Tr; Mflv_R0038-1.
DR   EnsemblGenomes-Tr; Mflv_R0039-1.
DR   EnsemblGenomes-Tr; Mflv_R0040-1.
DR   EnsemblGenomes-Tr; Mflv_R0041-1.
DR   EnsemblGenomes-Tr; Mflv_R0042-1.
DR   EnsemblGenomes-Tr; Mflv_R0043-1.
DR   EnsemblGenomes-Tr; Mflv_R0044-1.
DR   EnsemblGenomes-Tr; Mflv_R0045-1.
DR   EnsemblGenomes-Tr; Mflv_R0046-1.
DR   EnsemblGenomes-Tr; Mflv_R0047-1.
DR   EnsemblGenomes-Tr; Mflv_R0048-1.
DR   EnsemblGenomes-Tr; Mflv_R0049-1.
DR   EnsemblGenomes-Tr; Mflv_R0050-1.
DR   EnsemblGenomes-Tr; Mflv_R0051-1.
DR   EnsemblGenomes-Tr; Mflv_R0052-1.
DR   EnsemblGenomes-Tr; Mflv_R0053-1.
DR   EnsemblGenomes-Tr; Mflv_R0054-1.
DR   EnsemblGenomes-Tr; Mflv_R0055-1.
DR   EuropePMC; PMC2765153; 19700556.
DR   EuropePMC; PMC2937484; 20656856.
DR   EuropePMC; PMC3271072; 22319448.
DR   EuropePMC; PMC3585252; 23469141.
DR   EuropePMC; PMC4057218; 24927157.
DR   EuropePMC; PMC4219376; 24299240.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01066; 6C.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01763; ykkC-III.
DR   RFAM; RF01781; ASdes.
DR   RFAM; RF01791; F6.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000656.
DR   SILVA-SSU; CP000656.
DR   StrainInfo; 581072; 0.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4000377
CC   Source DNA and bacteria available from Charles Miller
CC   (cdmiller@biology.usu.edu)
CC   Contacts: Charles Miller (cdmiller@biology.usu.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5619607
FT                   /organism="Mycolicibacterium gilvum PYR-GCK"
FT                   /strain="PYR-GCK"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:350054"
FT   gene            292..1350
FT                   /locus_tag="Mflv_0001"
FT   CDS_pept        292..1350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0001"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase, IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: mpa:MAP3286
FT                   IS1547_2 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42497"
FT                   /db_xref="GOA:A4T3A5"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3A5"
FT                   /protein_id="ABP42497.1"
FT                   /translation="MVIVGTDVHKRTHTFVAVDEVGRKLGEKVVPATTAGTAVAWAREQ
FT                   FGDELLWGIEDCRNLSARLEIDLLGMAQSAVRVAPKLMSQSRACARTRGKSDPIDALAV
FT                   AHAVLRHPDLPVAAHDEVSRELKLLTDRREDLVAQRTSTINRLRQRVHELDPAAEPNPG
FT                   SLHRPTPCATLAAWLNTQTGILSELARDELADIVRLSEAINAVAARIGERVREVAPTLL
FT                   ALPGCGELTAAKILGETATVSRFRSEAAFARHTGTAPIPVWSGNTAGRVRLSRSGNRQL
FT                   NAALHRIAITQIRLTDSAGQRYYRKRLAEGKATKEALRCLKRQLARIVYRHLHTDENTR
FT                   KTKPHNNAQTAA"
FT   gene            complement(1382..1987)
FT                   /locus_tag="Mflv_0002"
FT   CDS_pept        complement(1382..1987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0002"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0967 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42498"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3A6"
FT                   /protein_id="ABP42498.1"
FT                   /translation="MMRRIALLLVGIVVPGIVVCAVPATATAQPDSDAVPPTLPVFTPY
FT                   PSAWMPDYSLFPYNLWQNRVTPEQITAQRESCQWFNAQYDTLMAQAFGFQRFLGDRRDD
FT                   WSDPGVQQAGATVAANLDQSAAFLAPRADTLFIVNYPDQSEYSPLFHGDSIYRLWYQFT
FT                   QISDKIKKQVPAGQINANNATANVYGTAIRDSGVCTGA"
FT   sig_peptide     complement(1901..1987)
FT                   /locus_tag="Mflv_0002"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.959 at
FT                   residue 29"
FT   gene            complement(1984..2793)
FT                   /locus_tag="Mflv_0003"
FT   CDS_pept        complement(1984..2793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0003"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0966 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42499"
FT                   /db_xref="InterPro:IPR021729"
FT                   /db_xref="InterPro:IPR021992"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3A7"
FT                   /protein_id="ABP42499.1"
FT                   /translation="MVRRLTCSGVAAVLASVVMATASPASASAASFCDELGGQWDGQFC
FT                   TTSVVSERKATRDIRMALPGDLVENPVIRAYLTTLMNNWRNAATKMVQNSFGEQHFQIL
FT                   HRGEAMTAVFHEMYSGTVGTDALAHPNAPIVSDAYRTFTFVGGRQVQLADLFKPGVDHL
FT                   AEIPRLGAPFIVAALDAAPPPHQPGTYPFTPDRWTPDKVYSGGYKAWAISGDELILYMP
FT                   DYPVGRDTPTNFTPGLMQWSMDGGTVQARIPLAALAPVLRPEFGGSP"
FT   sig_peptide     complement(2704..2793)
FT                   /locus_tag="Mflv_0003"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.524 at
FT                   residue 30"
FT   gene            complement(2793..3440)
FT                   /locus_tag="Mflv_0004"
FT   CDS_pept        complement(2793..3440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0004"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0965 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42500"
FT                   /db_xref="GOA:A4T3A8"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3A8"
FT                   /protein_id="ABP42500.1"
FT                   /translation="MTVTTQSTRDDEPDTSADDEQTPEGAGPGDADVADAHTETEPADD
FT                   DSDPDEPMTARGWRRRVLLGVVALVFAALLAVSGVLGWMTWKQHQLTQAGEQARQAAVT
FT                   YAQVLTSIDSAKVDENFNQVLDGATGEFKDMYSESSMQLRQLLIDNKAASRGVVVESAI
FT                   QSVEEGRVVVLLFVDQSVTNSAVPDPRIDRSRIKMTMEYVDGRWRAAKVELA"
FT   gene            complement(3460..4710)
FT                   /locus_tag="Mflv_0005"
FT   CDS_pept        complement(3460..4710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0005"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mva:Mvan_0964 mammalian cell entry related domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42501"
FT                   /db_xref="GOA:A4T399"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A4T399"
FT                   /protein_id="ABP42501.1"
FT                   /translation="MINALADSVVRVVRTVHRGRAWLSAGALVFILVVAAAYLFVGALQ
FT                   VNPLAKSYRVTVQLPESAGLLPNQNVTLRGVPIGRVERLDITPAGVDAVVSMDSSVAVP
FT                   MSSAVRVSGLSPAGEQYIDFVADSDAGPYLENGSVIAQDNTTVPVSLADLLANADGALS
FT                   QVDPGKLEVIKHELSMTEAGPQKLADIIDGGTFLLTTLDSVLPETSSMLRTSRVVFTLA
FT                   ADKNAGIEVASDNLAQTFDGVNRMRDGFRRLTDRAPGTLNSVDNLFADNSDTMVQLLGN
FT                   LTTTSQLLYLRVPALHALFPDYRTSVLDAIGSAMHDNGLWATGEIYPRYTCDYGTPRRP
FT                   PSSADFPEPFMYNYCRDDHPGVLVRGAKNAPRPAGDDTAGPPPGADLGRQTDPTPRGRY
FT                   TIPTPYGGPTLPIEPPR"
FT   gene            complement(4710..5951)
FT                   /locus_tag="Mflv_0006"
FT   CDS_pept        complement(4710..5951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0006"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: mva:Mvan_0963 mammalian cell entry related domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42502"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3A0"
FT                   /protein_id="ABP42502.1"
FT                   /translation="MMTRRAATALAVAMTTCLSVTSCATEGLSSLPLPAPGGGSGGYTL
FT                   TAVFSNALNLPAMAKVKLAGADIGQLESMQARDYTAVTTLRIREGVLLPVGSTAELRSA
FT                   TPLGDVFVSIKPPPSAGQGTPLLTDGDTIGLESTTAAATVESVLSSAAILVNGGAVRNF
FT                   TNIINGLGKATGDQGQAFGELIRKTNHTLGTLNGRSEEIKTALTETSQLAAQLEAKNQS
FT                   LAEVMDAAAPATSTLAAQTNGIADLVLTVGATTEQLRKFPSIAGTDTSGRSVIADASRI
FT                   AGAWNDVVLAPGADLYSLNRLMPPFIKSTTSNAIAVRASIDRLVLGSIPDIGFAGDPGL
FT                   HGPKRYNWHQLVGSLRYTLLRLQERVVGKGPGVPQMPVIPSPTEPGQWAPAPPPGPVPP
FT                   GPAPAVAPPAPGVP"
FT   sig_peptide     complement(5823..5951)
FT                   /locus_tag="Mflv_0006"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.245 at
FT                   residue 43"
FT   gene            complement(5948..7066)
FT                   /locus_tag="Mflv_0007"
FT   CDS_pept        complement(5948..7066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0007"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mva:Mvan_0962 virulence factor Mce family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42503"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3A1"
FT                   /protein_id="ABP42503.1"
FT                   /translation="MSGRAKVTALVVAGLVAVVAVAAIGWSFLSDRLDAITVTAQFDSA
FT                   AGLYEGNTVAVLGMPVGKVVRIEPKGGYVEVEFTVDGDVAVPADVQAVTISNSILTDRQ
FT                   IELTPPYRGDGPTLRDHDTIGLNRTRTPVEFARVLDVLDKLSTSLRGDGRGGGPVADVV
FT                   NASAAIADGNGQQMKDALGELSTALRLSADHGQVTRDQLTTIIRNVSTLSQAAADNDAT
FT                   LREFGSSVRQLSQVLADENFGTGTTGKKLNEVIVQFGEVLDTHREAIRQIVTNGNTAVT
FT                   TTVDHQRDLAEFLDVTPMTLDNIYNAIDRTNGAVRVHVLTDKVLFDTQTVKEMCNMMGL
FT                   RQLGCSTGTLQDFGPDFGLSYVLDGLTAMGQK"
FT   sig_peptide     complement(6959..7066)
FT                   /locus_tag="Mflv_0007"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.999) with cleavage site probability 0.480 at
FT                   residue 36"
FT   gene            complement(7063..8100)
FT                   /locus_tag="Mflv_0008"
FT   CDS_pept        complement(7063..8100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0008"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mva:Mvan_0961 virulence factor Mce family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42504"
FT                   /db_xref="GOA:A4T3A2"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3A2"
FT                   /protein_id="ABP42504.1"
FT                   /translation="MAEQTKRRRRRLESYHKAWLGTVAVVVVAVLVGALLLIKAADVGY
FT                   RTFTAQFLQAAALQPGNPVSVAGIPVGEVTDMKLAGDHVEARFTVRNDVDLGEDSRAVI
FT                   KVTTILGSRYLSLEPEGTGALPDRHFDLSHTEVPYDLQEALTDVTTTFEQVDSDKFAET
FT                   LSILGRQLQGMPEILPQALENTHTLSTIIADRRDQLGSLLETTEVVSNTLRRQQANIGS
FT                   LVRQGNDLVGEFVLRRASFQAMMNAITNLVQTLGDIVIEDRPELEALLVNVRELSDMLG
FT                   QHDDLLRSILQSGPPALRGLANATGMGNAVEFNAANGLLVDSWMCAISGRAKQFGMIQY
FT                   FQDCK"
FT   sig_peptide     complement(7978..8100)
FT                   /locus_tag="Mflv_0008"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.999 at
FT                   residue 41"
FT   gene            complement(8093..9148)
FT                   /locus_tag="Mflv_0009"
FT   CDS_pept        complement(8093..9148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0009"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mva:Mvan_0960 virulence factor Mce family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42505"
FT                   /db_xref="GOA:A4T3A3"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3A3"
FT                   /protein_id="ABP42505.1"
FT                   /translation="MKYRGPLIGLSLFMIVAITLTWLVYVTLRRDVAGEKVPYSAMFTD
FT                   VFGLREGDDVRMAGVRVGRVEKIELDGKLAKVSFVVQGDQQVLGTTVASVTYQNIVGQR
FT                   YLGLTLGSQGEPVPLPAGSVLPLERSDPSFDVTTLLNGYEPLFSLLDPQAADDLTQGVI
FT                   QSLQGDEASLVALVDQTSQLTESFAGHDEELGAVITDLNTVMSNLAKHNDSMDQVLTET
FT                   QAAVSIFDAQRQELVDSTGSISRVVSRLSTVSDDVYPSLNELIEREPGFAQHLVSIEPQ
FT                   LAFTGANLPLLLKGFARITSEGAYANAYACDLNATGFFPGLNDVTPIIVDAATPGNDAQ
FT                   YSPKCRNMANG"
FT   gene            complement(9148..10785)
FT                   /locus_tag="Mflv_0010"
FT   CDS_pept        complement(9148..10785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0010"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: mva:Mvan_0959 mammalian cell entry related domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42506"
FT                   /db_xref="GOA:A4T3A4"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3A4"
FT                   /protein_id="ABP42506.1"
FT                   /translation="MANSFEFDGRGPSDRQLLVCGVAVLAIVSIVTAVLLVKSTGRLDP
FT                   RVRVVAAMVNVGDGLPQRSDVKYHGVLVGAVDDVTPAENGEPNFVHIDLKPEYAKSIPA
FT                   NVTARVVPSNVFAVSSVQLVGSGGPPIQPGAEIPEDTELPTVLFQTTISKLRDILAATG
FT                   RGREDDTVGILAAVHAATEDRRTELLTSGAQLNRMVDELDRIVATEPGPTTVSALVDAT
FT                   RGLQQTAPELVDALHQAVQPMQTLVEQSAQLTSLVNGGIRTSETTRTAFDNHADRLVRI
FT                   TTELTPVVGSLADTSRHWVPAFVKLNELSRKFFDEVWIHEHDIGNMRINLSFTPTYSYT
FT                   RADCPQYAGLKGPSCYTAPLVPTRAALPDVLLPQNYQPPKDLQPPPGTEIGPSGNLIAV
FT                   GPPLVNPNPSLADPNPPLPPWMPPSPPVPLTANPALVPPPQLPAPLSPPAPVAPKPGDP
FT                   PPRPAAPAPAAPAPAPAAPAPAPAAPGPGSAEAPFAPASFGGNVGPVGSQQEQRQLSLI
FT                   TGRHATPATQLLLGPLARGTTVSIDGEP"
FT   gene            complement(10786..11643)
FT                   /locus_tag="Mflv_0011"
FT   CDS_pept        complement(10786..11643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0011"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   mva:Mvan_0958 protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42507"
FT                   /db_xref="GOA:A4T392"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A4T392"
FT                   /protein_id="ABP42507.1"
FT                   /translation="MSASTFSPAVVRPAKKAYRMLATPIIRLGHMLVFFVRALLGIPVA
FT                   ISHYRKEFVRLLSDIAWGNGSLVVGGGTAGVAIVLGITVGALVGIEGYNFLDMLGLGPA
FT                   TGIISSLVNTRELAPIAASLAFATQAGCRFTAQLGSMRIAEEIDALESLGIRPIPYLVT
FT                   TRLMASVIAVIPLYVVCLAVSYLTTQAVVMVISGGSTGSYMHYFTLMLSGQDILYSVLK
FT                   TVIFVWIASTVQCYYGFYASGGPVGVGVAAGHAMRASITVVIMVNMLLTMALWSVDAGA
FT                   RFGG"
FT   gene            complement(11644..12582)
FT                   /locus_tag="Mflv_0012"
FT   CDS_pept        complement(11644..12582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0012"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   mva:Mvan_0957 protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42508"
FT                   /db_xref="GOA:A4T393"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A4T393"
FT                   /protein_id="ABP42508.1"
FT                   /translation="MRLPGPRTRCGRRHRRSECTAAERTSGMTTADQPVRRDDSVHAVQ
FT                   DWVGGYVRRHPLASLATVGDQFVLGVRTLQWFFVDLFTGRFQFQEFVRQGAFMAGTAVL
FT                   PTVLVALPIGVTLSIQFALLAGQVGATSLAGAASGLAVIRQAASLTAAILMAAAVGSAI
FT                   TADLGSRKMREETDAMEVMGVSVIRRLVVPRFAAAIMIGVALTGVVCFVGFLASYLFNV
FT                   YFQNGAPGSFVATFASFATTGDMIVALVKAVIFGAIVAIVSCQKGLSTQGGPTGVANSV
FT                   NAAVVESILVLMVVNVAISQLYILMFPRVGL"
FT   gene            complement(12770..14044)
FT                   /locus_tag="Mflv_0013"
FT   CDS_pept        complement(12770..14044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0013"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mpa:MAP0116
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42509"
FT                   /db_xref="GOA:A4T394"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A4T394"
FT                   /protein_id="ABP42509.1"
FT                   /translation="MAVRKKPTRARGAGRSVRVCRMAASVGVRDARRRPKDRKQQIARA
FT                   SAEAFSELGYHAVSMEDIASRVGVTAASLYRHYSGKYDLFRAAVLNLGEQLVSATAFAD
FT                   DESGDSPEELWERIVAALADAAIKTRASGGLYRWEARFLQESDQAISNEQIRLVNRRLQ
FT                   RPLSALRPELDSRQRWTVTASVLSAIGSICDHRAKLPVNDMRRLLVSLARRLRDADLPP
FT                   VSAREKPGRRAAPSVGPAGEYEAILAAALRLFHEHGFRETGMDDIASAIGLPASTIYRY
FT                   FSGKSAVLSTIYRRAADRVSGDMGAILAMAPDERTAVGQLIDAYVWRTFAEPELAYVYY
FT                   AEQLNVPAEDRAALHNIQRSIVEGWARQVVAARPDLSVREARFAVHAGLGLVVDIGRLE
FT                   RFADTESSRRLIGRLLRVLLLPEHA"
FT   gene            14231..14578
FT                   /locus_tag="Mflv_0014"
FT   CDS_pept        14231..14578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0014"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0956 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42510"
FT                   /db_xref="GOA:A4T395"
FT                   /db_xref="UniProtKB/TrEMBL:A4T395"
FT                   /protein_id="ABP42510.1"
FT                   /translation="MCHHRLMATRDGRAHPPTGPDDEPEGRGRRFLRPYRKDDGAASFV
FT                   DRALLVALAYTAIGVVYLGFNVPVLDRLEALFSAQFTVFADLVAVVAAVVLWPLLLISS
FT                   WACGTVGCGVL"
FT   gene            14637..16280
FT                   /locus_tag="Mflv_0015"
FT   CDS_pept        14637..16280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0015"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mva:Mvan_0953 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42511"
FT                   /db_xref="GOA:A4T396"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A4T396"
FT                   /protein_id="ABP42511.1"
FT                   /translation="MTAVDVSSRERSSDPQLRPFLHSGHLTVGALKRHKDRPVLFLGDT
FT                   TLTGGELADRISQYIQAFEALGAGTGAAVGLLSLNRPEVLMIIGAGQTQGYRRTALHPL
FT                   GSLDDHAYVLTDAEVTSLIIDPNPMFVERALGLVEKVPTLTQVLTIGPVPEEFAKAGVK
FT                   AVDLSAEAAKYSPRPLTAAALPPDHIGGLTYTGGTTGKPKGVIGTTQSITTMTTVQLAE
FT                   WEWPENPRFLMCTPLSHAGAAFFTPVIVKGGELIVLTKFDPAEVLRVIEEQKITATMLV
FT                   PSMIYALMDHPDSHTRDLSSLETVYYGASAMNPVRLKEAIRRFGPIFAQYYGQSEAPMV
FT                   ITYLSKKEHDDKRLTSCGRPTLFAKVALLGEDGQPVPQGEVGEICVSGPLLSGGYWNLP
FT                   EATAETFRDGWMHTGDLAREDEDGFYFIVDRTKDMIVTGGFNVFPREVEDVVAEHPSIA
FT                   QVCVIGTPDEKWGEAVTAVVVLRPDAASDAAAVEVMISEIQASVKERKGSVHVPKQVVV
FT                   TDSVPITALGKPDKKAVRAQFWESAGRAVG"
FT   gene            complement(16371..17072)
FT                   /locus_tag="Mflv_0016"
FT   CDS_pept        complement(16371..17072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0016"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: mva:Mvan_0952 GntR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42512"
FT                   /db_xref="GOA:A4T397"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4T397"
FT                   /protein_id="ABP42512.1"
FT                   /translation="MIGRKDIRVPLSTARRSGLVEQVIDQLRHAVAGQEWRIGDRIPNE
FT                   TVLVEKFGVGRNTVREAVRALAHAGILEVRQGDGTYVRATSEVSGALRRLCGEELREVL
FT                   EVRRALEVEAARLAASRRTPADVAEMRGLLARRDERDSAGDVEAFARIDTEFHLAVVRC
FT                   ARNNTLIELYRGLLEAVTASVAHTRHVPVDVCDHGVLLDHIAAGDPDLAARTAGEFLDR
FT                   IINGLGSADSS"
FT   gene            17096..18316
FT                   /locus_tag="Mflv_0017"
FT   CDS_pept        17096..18316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0017"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mva:Mvan_0951 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42513"
FT                   /db_xref="GOA:A4T398"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4T398"
FT                   /protein_id="ABP42513.1"
FT                   /translation="MRSERQPMIVDPRATPDSVPPVAGGALLAVAVVLAALNLRPAVTS
FT                   IATLLHDIRGDLAVSATWAGLVTTLPALCFAGAGLAAPWVASRIGLSRAISVALLALTA
FT                   GLALRGVGGEYVVIGATLIACAGIALANVLIPVVIKTSFPARIGMMTGIYTAALQGGGA
FT                   LGSAVTPGLADPLGGWRTALMVWAAVSLLALTLWIPATARHRSAWAVHTRPSAARRSLL
FT                   RSPLAWTVTVFFGSQAFLAYIMMGWLPQVFIDNGIDKVQAGLLVAVASLVGVPLSLVIT
FT                   PLAARSASQSGWIVGVGSFGFLGTVGLMVAPTAQPLLWSVLLGTGLSGFSLALALLGLR
FT                   ARTPEDTAALSGMAQGFGYLLAGTGPFLFGLLHDVTHGWTAPWVLFLAVFCVQTVTGAL
FT                   AGRNRYV"
FT   gene            18339..19589
FT                   /locus_tag="Mflv_0018"
FT   CDS_pept        18339..19589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0018"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0950 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42514"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A4T386"
FT                   /protein_id="ABP42514.1"
FT                   /translation="MRTFPGDHLGLEFPADAASLGQAGPRFLTAAFRRSGVLPDQGTVV
FT                   SVDELREFGGGSTGRKAVLSLTYGGADTLPRELFVKFSRDFDDPARDLGRTQMAHEVRF
FT                   ALLTRAPGFPIDVPRCLYADYHGESGSGILITERIAFGRNGIEPQYEKCADYAMPDQLG
FT                   HYRALFSALGRLAGAHSAGAVAAGSDFAVDIRSLSVGERAPYTADQLRRRVDRLAQLAE
FT                   RQPGLLPADLGSPEFVSRLRRDVAVIADRVDALWDSLGADPEYVALCHWNANVDNAWFW
FT                   RDGDLLRCGLMDWGCVGQMNLAMAIWGAMCSAESALWETHFIVLLQHFADEYAGAGGPS
FT                   LDIAVLRDHVLAYVAIMGTAWLLDVPGYLLNLLPEPVADRFDPRIAGSEQARSRLLMMT
FT                   NFLHLWRTSDTTAVLGG"
FT   gene            complement(19599..20222)
FT                   /locus_tag="Mflv_0019"
FT   CDS_pept        complement(19599..20222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0019"
FT                   /product="NodS family protein"
FT                   /note="PFAM: NodS family protein; Methyltransferase type
FT                   12; KEGG: rha:RHA1_ro00128 probable methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42515"
FT                   /db_xref="GOA:A4T387"
FT                   /db_xref="InterPro:IPR008715"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4T387"
FT                   /protein_id="ABP42515.1"
FT                   /translation="MTPRLPDGFFDRMYAHAADPWQLESRWYEKRKYDITMALLPYPRY
FT                   RHAFEPGCSIGVLTERLVARCDHVTSSDVAVAALDAAHRRLSDRRIRHRVTLLRGSLDD
FT                   PWPTTPFDLVVLSEVCYYLQPATLRAVLDREVPRLGHPTTVVAAHWRHDVEEYPMNGDH
FT                   ANDVIGATEGLHHLGGYRDADVVIDVFDNAGGASVAARTGVPGS"
FT   gene            complement(20219..20986)
FT                   /locus_tag="Mflv_0020"
FT   CDS_pept        complement(20219..20986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0020"
FT                   /product="LmbE family protein"
FT                   /note="PFAM: LmbE family protein; KEGG: mpa:MAP3239
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42516"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:A4T388"
FT                   /protein_id="ABP42516.1"
FT                   /translation="MTASQTGNSDRFAVHPLPAGGTPEKVWARPGLRLPPLDLAGCREI
FT                   VIVGAHPDDETLGFGSAAAMLAESGVRVQIVSASDGGAAFPNVSLLQRYRIEALRRSEL
FT                   WAAADTLGLPTPISLGLPDGDIARHEQRLTDLLIEILTDTPAGTWCAATWRGDGHPDHE
FT                   AVGRAAAVAAECTGTVLLEYPVWMWHWARPGDPAVPWERARAVDATPAAVTRKMKAAAL
FT                   FRSQFEPTEYGDEPVLPPYFLPRLLTVGEVVFR"
FT   gene            complement(20983..21924)
FT                   /locus_tag="Mflv_0021"
FT   CDS_pept        complement(20983..21924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0021"
FT                   /product="dehydrogenase"
FT                   /note="KEGG: mav:MAV_4073 dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42517"
FT                   /db_xref="GOA:A4T389"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="UniProtKB/TrEMBL:A4T389"
FT                   /protein_id="ABP42517.1"
FT                   /translation="MTAGLVRSWLESGRLDLPLPGRGDTALRWERLAELTEIDVVAGRL
FT                   AEAHADAAAILAELGGRAPAPGQWWGVWAAESGDEVVTAHDDGARVLLDGTKVWCSGAG
FT                   LCTHALATARLSTGERGLFAVDLAADGVLPLPSGWHTTGMAESDTRSVAFAMTPAVAVG
FT                   APGEYLTRPGFWHGAVGVAACWLGGARAVAAALYARVAAGNADAHTAAHLGAVDASLTA
FT                   AHATLAAVAADIDADPQNCGGRAELRARRARAVVETAVEETLSRTARALGPLPLAMDSD
FT                   HARRVADLSIYVRQSHAERDLERLGVLAAEPS"
FT   gene            complement(21921..22625)
FT                   /locus_tag="Mflv_0022"
FT   CDS_pept        complement(21921..22625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0022"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   msm:MSMEG_1097 glycosyl transferase, group 2 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42518"
FT                   /db_xref="GOA:A4T390"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4T390"
FT                   /protein_id="ABP42518.1"
FT                   /translation="MSRAVVVVPAHNEKDHLPDCLRALTTAALCVPIPVGIVVVLDSCD
FT                   DGSDALAGQFGADVHFVSVDAGNVGATRAAGFEYARTLSGDDEIGRTWYATTDADSTVD
FT                   ADWLVRMLGAGADMVLGVVRVSNWRHFSPAVARRYLRGYRSRGTGHRHIHGANMGFRAE
FT                   SYWRVGGFRALKSSEDVDLVRRFEDAGMFIHRDRRLSVATSDRREGRAPGGFAQHLRNL
FT                   SRSDDPGKADVA"
FT   gene            22686..23372
FT                   /locus_tag="Mflv_0023"
FT   CDS_pept        22686..23372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0023"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   2 (HAD-like)"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 2 (HAD-like); HAD-superfamily hydrolase, subfamily
FT                   IA, variant 3; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: mva:Mvan_0949 HAD-superfamily hydrolase,
FT                   subfamily IA, variant 3"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42519"
FT                   /db_xref="GOA:A4T391"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A4T391"
FT                   /protein_id="ABP42519.1"
FT                   /translation="MTDLDAVLFDFSGTLFRLEEDESWFDGMTLDSAGNRDVDEHVQAE
FT                   LMRRLTAPTGRSVSMTPEALEAWMKRDLAPHLHREAYLHVLRESGLACEHAESLYSRVI
FT                   DPACWTPYPDTATVLTGLRRRGIRTAVVSNIAFDLRPAFDGVGTVDEFVLSFEVGAVKP
FT                   DPSIFQTALDRLGVPAERALMVGDSDEADGGARALGCAFALVDPLPTRERSDGLLGALR
FT                   AHGIRL"
FT   gene            23440..23832
FT                   /locus_tag="Mflv_0024"
FT   CDS_pept        23440..23832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0024"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0948 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42520"
FT                   /db_xref="GOA:A4T381"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A4T381"
FT                   /protein_id="ABP42520.1"
FT                   /translation="MIAINRTGLLKNGPVVLTVTGRRTGKPRSTPITPFEVDGRRYVVG
FT                   GLPGSDWVRNLQANPDAVLTRGRTRERVRMVELPVEEARPLLRQFPVLVPTGVDFMKNA
FT                   GLVTGPHPEEFEALAGRCPVFRFDTV"
FT   gene            23836..24747
FT                   /locus_tag="Mflv_0025"
FT   CDS_pept        23836..24747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0025"
FT                   /product="1,4-Dihydroxy-2-naphthoate synthase"
FT                   /EC_number="4.1.3.36"
FT                   /note="TIGRFAM: naphthoate synthase; PFAM: Enoyl-CoA
FT                   hydratase/isomerase; KEGG: mva:Mvan_0947 naphthoate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42521"
FT                   /db_xref="GOA:A4T382"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR010198"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A4T382"
FT                   /protein_id="ABP42521.1"
FT                   /translation="MSTPGSNPFDPSLWEPVSGFDDLTDITYHRAVDQPTVRIAFDRPE
FT                   VRNAFRPHTVDELYRVLDHARMSSNVGVVLLTGNGPSPKDGGWAFCSGGDQRIRGRSGY
FT                   QYASGDTAETVDPARAGRLHILEVQRLIRFMPKPVICLVNGWAAGGGHSLHVVCDLTLA
FT                   SREHARFKQTDADVGSFDGGYGSAYLARQAGQKFAREIFFLGRPYTAEQMHAMGAVNEV
FT                   VDHAELENVALQWASEINGKSPQAVRMLKYAFNLLDDGLVGQQLFAGEATRLAYMTDEA
FT                   VEGRDAFLEKRDPDWSPFPRYF"
FT   gene            24763..25722
FT                   /locus_tag="Mflv_0026"
FT   CDS_pept        24763..25722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0026"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR; KEGG:
FT                   mva:Mvan_0944 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42522"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4T383"
FT                   /protein_id="ABP42522.1"
FT                   /translation="MRSSRKSASEVLLECEFGAGNRLRGVTSRNPLRRLADQVVLTSMR
FT                   PPILPALLNRPTRETIELRGKRVLLTGASSGIGEAAAEKLARRGATVVAVARRQDLLDE
FT                   LVTRIADAGGDARAHACDLSDLDAVDELVATVEKDLGGIDILVNNAGRSIRRPLEESLE
FT                   RWHDVERTMTLNYYGPLRLIRGLAPGMLARGDGHIINVSTWGVKTESPPLFGVYNASKA
FT                   ALSSVSRIIETEWSGRGVHATTLYYPLVKTPMIAPTRAYDGLPGLSADEAAGWIVTAAR
FT                   HRPVSIAPRIAVTAHAINSVAPGAVDTIMKRQRMQPRD"
FT   gene            25729..27258
FT                   /locus_tag="Mflv_0027"
FT   CDS_pept        25729..27258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0027"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mva:Mvan_0943 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42523"
FT                   /db_xref="GOA:A4T384"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020459"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A4T384"
FT                   /protein_id="ABP42523.1"
FT                   /translation="MFHNLADIVRSHGRNRPDAPALIVGDRTVSYRELDERSNRTAQAF
FT                   SRTGVGPGDRVAFVERNGIEFFDVAFGSAKLGAVAVPVNWRLTAPEMRHVIADCGASVV
FT                   VVGQEFTGRIEAIADDLDVEVVVIGKHRHWPTFDDLLAAAPAVDPGVVTGPDDLVFLMY
FT                   TSGTTGAPKGVMLSNANVVCKTAGVGGPWKFDADSVSLAVMPLFHMAGFGWALAGLWEG
FT                   AVTVVLRDVDPGAILDAVARHRVTNMLLVPAVIQFLLDTTGLDDTDLSRLRIVVYGASP
FT                   ITDDVLMRGIDRFGGIFAQVYGMTESTGSVTQLDGDEHLPQLLRSCGRPYPWVQIRVVD
FT                   PTGRDVAPGTVGEVWTRSDQNMLGYWNNPEATAATLTPDGWLRTGDAGYLDRDGYLYLH
FT                   DRIKDMIVSGAENVYPAEVENVLMTHPAVTDVAVIGIPDTRWGEAVKAVVVAGAPVTEA
FT                   ELIAFAREQLAGFKLPKSVDFVDALPRNPSGKLLKRQLREPYWTDEDRHIG"
FT   gene            27282..27665
FT                   /locus_tag="Mflv_0028"
FT   CDS_pept        27282..27665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0028"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: mva:Mvan_0942
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42524"
FT                   /db_xref="GOA:A4T385"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A4T385"
FT                   /protein_id="ABP42524.1"
FT                   /translation="MEILASRVLFRPKDCARTVAFYRDSLGLAIAREYSGGTVFYAGQT
FT                   LIEIAGHGAPPDGAPPFPGALWLQVRDLAATQEQLTQRGVTIAREARQEPWGLHEMHVA
FT                   DPDGISLIFVQVPDDHPLRRDTR"
FT   gene            complement(27662..27961)
FT                   /locus_tag="Mflv_0029"
FT   CDS_pept        complement(27662..27961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0029"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0941 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42525"
FT                   /db_xref="InterPro:IPR021784"
FT                   /db_xref="UniProtKB/TrEMBL:A4T376"
FT                   /protein_id="ABP42525.1"
FT                   /translation="MRENVFDNVLGWLRHGYPHGIPTTDYFPLLALLSRTLTEDEVVGV
FT                   AQTVLRGTDSDTVTPQEIRAAIHLVTDKEPNPEEMHQVAARLASVGWPLAAPAG"
FT   gene            complement(27972..28259)
FT                   /locus_tag="Mflv_0030"
FT   CDS_pept        complement(27972..28259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0030"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0940 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42526"
FT                   /db_xref="GOA:A4T377"
FT                   /db_xref="UniProtKB/TrEMBL:A4T377"
FT                   /protein_id="ABP42526.1"
FT                   /translation="MTYFESIFKVLGIGLLLGAGLPAVFALGLVAFSRGAGSDGSDGGA
FT                   VAAPNPAMKILGVSMFVFVGWVILTAVLWITRGTVIHYTGIDMFPFLPAK"
FT   sig_peptide     complement(28143..28259)
FT                   /locus_tag="Mflv_0030"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.997) with cleavage site probability 0.304 at
FT                   residue 39"
FT   gene            complement(28276..29601)
FT                   /locus_tag="Mflv_0031"
FT   CDS_pept        complement(28276..29601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0031"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: mva:Mvan_0939
FT                   phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42527"
FT                   /db_xref="GOA:A4T378"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:A4T378"
FT                   /protein_id="ABP42527.1"
FT                   /translation="MGSISHPPTPAKIRKTGAEGRRINSMSAELVVLVLLIITALAFDF
FT                   TNGFHDTGNAMATSIATGALKPKTAVLLAGILNLVGAFLSVEVAVTVTTSVLKVQDSTS
FT                   GELLSGIDASTGLTIIFAGLIGGILWNLLTWLFGIPSSSSHALFGGLIGAGLAALGLAG
FT                   VNWSGVTQKVLIPALAAPMIACLVAGCGTWLVYRLTRRVAEKRRREGFRWGQIATASLV
FT                   ALSHGTNDAQKTMGVIALALITTGHLTGDVKEEGLPFWIIFSCAVAIGLGTYLGGWRVI
FT                   RTLGKGLVEIQSPQGFAAEASSAAIILSSSAAGMALSTTHVATGSILGSGVGKPGAEVR
FT                   WAVAGRMAVAWLITLPAAGLVGALTYWLSSGVTSATGSDLAGDGLIFVILVGLSAFMWW
FT                   RAQQQKVDHKNVNADWDDTTNSVVPAELRVTTTPDPKPVATV"
FT   gene            29760..30077
FT                   /locus_tag="Mflv_0032"
FT   CDS_pept        29760..30077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0032"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0938 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42528"
FT                   /db_xref="InterPro:IPR021784"
FT                   /db_xref="UniProtKB/TrEMBL:A4T379"
FT                   /protein_id="ABP42528.1"
FT                   /translation="MTKFLARIVAWIVEGYPEGVPGPDRVPLLALLRRRLTDDEVRAVV
FT                   TELRTRAELTDTPGIDTVDIGVLITEITDGLPSPDDIERVRARLAAQGWPLDDSRDEED
FT                   T"
FT   gene            30134..31219
FT                   /locus_tag="Mflv_0033"
FT   CDS_pept        30134..31219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0033"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mva:Mvan_0937 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42529"
FT                   /db_xref="GOA:A4T380"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A4T380"
FT                   /protein_id="ABP42529.1"
FT                   /translation="MIADVLDGRAAVLPVPADDPHQSAALATALRAGEDIDDAVGAVLS
FT                   TSGTTGTPKGALLTAAALRAGAEATHERLGGPGQWLLALPAHHVAGFQVLVRSVVAGTR
FT                   PVAVPASFEPEALTSAIAGMEPGRRYASLVAVQLDKALGDVAATRALASLDAVLIGGGP
FT                   MPAGVAEKASAAGISVIRTYGMSETAGGCVYDGVPLRGVEVRIAEDGRIELGGPTVAVG
FT                   YRNPVTPDPFAEPGWFRTDDIGVLDAGVLRVLGRADDAISTGGLTVLPGMVEAALATHP
FT                   AVAECAVFGVADARLGQRVAAAVVTTPESSVTLAQLRSHVTETLPSSAAPRQLHLVDEL
FT                   PRLGIGKIDRRELVRRFGESD"
FT   gene            31263..31877
FT                   /locus_tag="Mflv_0034"
FT   CDS_pept        31263..31877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0034"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding; KEGG: mva:Mvan_0936 pyridoxamine 5'-phosphate
FT                   oxidase-related, FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42530"
FT                   /db_xref="GOA:A4T370"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024029"
FT                   /db_xref="UniProtKB/TrEMBL:A4T370"
FT                   /protein_id="ABP42530.1"
FT                   /translation="MSRHVTTVEELRAIVGHPHAVVAGKVRDRLLPAMRDWLAHSPLGF
FT                   VATTDADGRVDVSPKGDPAGFVHIIDDHTIAIPERPGNKRVDGYLNVLERPRVGTLFVI
FT                   PGRGDTLRINGSARVMADADYFDAMSVEGRRPILALEIAVEEVFFHCAKAFLRSDAWDP
FT                   QSWDPAAVPSAAHLAKQMYADADLDDMRRALDEDMMRQALY"
FT   gene            31941..32651
FT                   /locus_tag="Mflv_0035"
FT   CDS_pept        31941..32651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0035"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: mkm:Mkms_0723 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42531"
FT                   /db_xref="GOA:A4T371"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A4T371"
FT                   /protein_id="ABP42531.1"
FT                   /translation="MVTRVLIADDDGVVRDVVRRYLERDGLEVSTAHDGNEALRLLSSQ
FT                   RIDVAVLDVMMPGPDGMALCRRLRQNGHYSVPVILLTALGEEDDRIAGLEAGADDYLTK
FT                   PFSPRELALRVRSVLRRSPASIAAHPVDITSGDLTVSTASRSATVGGRTVSLTNREFDL
FT                   LLFFLTHAGTVYTREDLLKEVWHWDFGDLSTVTVHVKRLRSKLGDRHRVQTVWGRGYMW
FT                   APDEASPGQPDAAG"
FT   gene            32638..33660
FT                   /locus_tag="Mflv_0036"
FT   CDS_pept        32638..33660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0036"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: mva:Mvan_0884
FT                   integral membrane sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42532"
FT                   /db_xref="GOA:A4T372"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4T372"
FT                   /protein_id="ABP42532.1"
FT                   /translation="MLPAEYWEIIGWALACSVPVVLVGAAVVRLARAWSLAVSMVALVL
FT                   IPVLATLAGVLGASGFMISGTFERTAVVLVIVSIVTIPAAVMLARYQARRMVWEAEIRD
FT                   SEAAAEHSRRRLVAFVSHDLRTPLAGIRAVAEAIADGVVPDEEVRVHAKHIENESIRLS
FT                   EMVDDLFEMSKINAGALTPTFDMVALDEVVDDVIAAHRMPAERAGVRLRASLPEQPVQV
FT                   VGSDRALVRVLSNLVANAIAHTPPGGTVELALGADEISAWARVDDTGVGIDEADLPRVF
FT                   DVAYRGSNSRVPRSDSSLPSGSGLGLAIAAGLVQAHRGTLTAHNLPTGARFEVRLPLAE
FT                   "
FT   gene            complement(33741..34877)
FT                   /locus_tag="Mflv_0037"
FT   CDS_pept        complement(33741..34877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0037"
FT                   /product="2-nitropropane dioxygenase, NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase, NPD; KEGG:
FT                   mva:Mvan_0883 2-nitropropane dioxygenase, NPD"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42533"
FT                   /db_xref="GOA:A4T373"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A4T373"
FT                   /protein_id="ABP42533.1"
FT                   /translation="MSMTSTALCEQFGIDFPLFAFSHCRDVVAAVTNAGGFGVLGATAY
FT                   SPDQLDQELAWIDEAVGGRPYGVDLIVPAKFEGKGEKLSSSDLAARIPQTYKDLVDELL
FT                   RKHDIEPEPERRIGKPMLSGNTGRELLDVALTHPVKLIANALGVPPDYMIEAGKERGIP
FT                   VAALVGAKEHAVKQAAAGVDLIVAQGTEAGGHCGEVSTLVVVPEVLEGLAALGVSTPVL
FT                   AAGGIVTGRQMAGMVAMGASGAWTGSVWLTTEEAETAPHTVAKMLAATSRDTVRSAGRT
FT                   GKPSRQLVSDWTKAWAPSKDGEQPLGLPLQSMLCEPVIRRIDVLASQGHEGAQALATYF
FT                   VGQGVGLMNKVKPAREVVREFIEDYLAAAERLSSSLPG"
FT   gene            35209..36078
FT                   /locus_tag="Mflv_0038"
FT   CDS_pept        35209..36078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0038"
FT                   /product="1,4-dihydroxy-2-naphtoate prenyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="TIGRFAM: 1,4-dihydroxy-2-naphthoate
FT                   octaprenyltransferase; PFAM: UbiA prenyltransferase; KEGG:
FT                   mva:Mvan_0880 1,4-dihydroxy-2-naphthoate
FT                   octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42534"
FT                   /db_xref="GOA:A4T374"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR004657"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:A4T374"
FT                   /protein_id="ABP42534.1"
FT                   /translation="MASLAQWIEGARPRTLPNAVAPVIAGTGAAAWLDGASWWKALLAL
FT                   VVAVALIIGVNYANDYSDGIRGTDDVRSGPLRLVGSKLAAPKSVLTAAVVSLAVGALAG
FT                   LVLAWFSAPWLIAVGAVCIAGAWLYTGGSKPYGYLGLGEVAVFVFFGLVAVLGTQYTQA
FT                   LRVDWVGLTLAVAIGCLSSAVLVANNLRDIPTDAESGKITLAVRLGGAKTRVLFTVLTA
FT                   IPFVLTLVLIAATPWCAAGLLALPLALRAAGPVRGGQGGKDLIPVLKNTGLTMLVWAVV
FT                   VAAALILG"
FT   gene            36123..37124
FT                   /locus_tag="Mflv_0039"
FT   CDS_pept        36123..37124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0039"
FT                   /product="ATPase associated with various cellular
FT                   activities, AAA_3"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities, AAA_3; ATPase associated with various cellular
FT                   activities, AAA_5; KEGG: mva:Mvan_0879 ATPase associated
FT                   with various cellular activities, AAA_3"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42535"
FT                   /db_xref="GOA:A4T375"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:A4T375"
FT                   /protein_id="ABP42535.1"
FT                   /translation="MTAAPMPRESDDAREAQRVVAALSEAFSAKVVGQEHLRETLLIGL
FT                   LTGGHILLESVPGLAKTTAARVIAESIDGEFRRIQCTPDLLPSDIIGTQVYDATTTAFV
FT                   TQLGPVHANVVLLDEINRSSAKTQSAMLEAMEERQTTIAGTVYPIPEPFLVIATQNPVD
FT                   QEGTYALSEAQTDRFLLKEIVRYPSPEQEVDMMSRRDAGLYDKDHRSSPVVGLDDVRRL
FT                   QRITRDVYMSRDLMLYASRLVGVTREPGNHLPSQLARMVEYGASPRATIALCTAARALA
FT                   VLSGRDHVIPSDIADLAHRVLQHRLILGFEAASAGVTPNRVIDAVLHAVRVP"
FT   gene            37138..37998
FT                   /locus_tag="Mflv_0040"
FT   CDS_pept        37138..37998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0040"
FT                   /product="protein of unknown function DUF58"
FT                   /note="PFAM: protein of unknown function DUF58; KEGG:
FT                   mva:Mvan_0878 protein of unknown function DUF58"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42536"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:A4T367"
FT                   /protein_id="ABP42536.1"
FT                   /translation="MGTHLNRARAHFGTDTRGMLEGGRHALLHTRSLEFDELRPYVPGD
FT                   DVRDIDWKASARSGSVLIKRFVSEKHHKVLLVADTGRNMAALAADGERKSDVALHVLGA
FT                   VGLITLGRSDQIGMVYGDARGSLRVRQSRGENHIESMLAGYHDHAGRHGPSDIVCQLTY
FT                   VATHYRHPMLIVVVSDEPDTDSRLEDAVARLTSRHDVMWAMVTDMPAAGVKDGAYDVAT
FT                   GRPVLGSAATDPRVVAAYERAELRRAERLSQLLVARGVPRATITGSGQIRRAVGEMTRA
FT                   WSRAG"
FT   gene            37988..38461
FT                   /locus_tag="Mflv_0041"
FT   CDS_pept        37988..38461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0041"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0877 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42537"
FT                   /db_xref="GOA:A4T368"
FT                   /db_xref="UniProtKB/TrEMBL:A4T368"
FT                   /protein_id="ABP42537.1"
FT                   /translation="MPDDLLEFVSGPPGYSAIWLWLGIALLGAVILWYTAVFVATMPSD
FT                   RLRRIPGVEDAHARMLRRRFAGTARDITDRHRSGEITAEQAGADLSRTLRSFLHQATGV
FT                   RAQYMQVRAIAASDLAAAAPLLESLGSAQFDRASTVDVGSLGDATEELIRSWT"
FT   gene            38452..39408
FT                   /locus_tag="Mflv_0042"
FT   CDS_pept        38452..39408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0042"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0876 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42538"
FT                   /db_xref="GOA:A4T369"
FT                   /db_xref="UniProtKB/TrEMBL:A4T369"
FT                   /protein_id="ABP42538.1"
FT                   /translation="MDLTWWPVAALGAGAVVLVIAVAILLPVTGNQDRRLPLANTDRLT
FT                   RLPEYRAVLRRQTRAAVVTLTLLILLCGTTALVSARPSEPRRDEAGAVARQDIMLCAGS
FT                   PVDEPATSDFLRYFARQAPTYGAERIGLTSSNRRLIPLTRDHQFAAGRLGDFARNSPAA
FT                   PTFASSVTYADYSPTVADVLALCLTGFPDFENESTTRRSLIYVGPGSLRAPGDTRPSLY
FT                   TDAETVEMARRAGVQISAIATPGRDTGALSAAVGETGGQFFRFDPARVDGQLDAIRAAA
FT                   AAPPEGIDVREDSPVVALIVALALSALLAVSLLAVRR"
FT   gene            39405..40319
FT                   /locus_tag="Mflv_0043"
FT   CDS_pept        39405..40319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0043"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0875 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42539"
FT                   /db_xref="GOA:A4T362"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A4T362"
FT                   /protein_id="ABP42539.1"
FT                   /translation="MTFDPVMPGIVLAVAAATLLALRAVALLPAARAGRTSVARWAVTT
FT                   VALLLLVLAAARPVTGSAAGEQNAQRPQAGANIYFLVDRSSDSAIPDFGDAPRITAMRS
FT                   DIEEVIRAHPDARFAIIGFAARPSIDWPLSADTWSLQPAVDALTPYPGIDSAEVNAAAA
FT                   ANILRYQLISAGQQFPQAENLVYYLGSGAGESTVPQGVFDTPRIDDGAVLGYGTGPGEA
FT                   RLREIAAQLGLPYVPRRDGAELPSDRAPESGTATATDPATAPQPTELYWVLTMLATALL
FT                   LVEIYLTTRDLRRTRAVRRQAPS"
FT   sig_peptide     39405..39509
FT                   /locus_tag="Mflv_0043"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.970) with cleavage site probability 0.474 at
FT                   residue 35"
FT   gene            40316..41026
FT                   /locus_tag="Mflv_0044"
FT   CDS_pept        40316..41026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0044"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0874 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42540"
FT                   /db_xref="UniProtKB/TrEMBL:A4T363"
FT                   /protein_id="ABP42540.1"
FT                   /translation="MTRPPARIRLRRRLLLFSAVPAVLVTLLAVKLISVVVVGGAAQQH
FT                   YATGDIGALSDDVSLLQFANMIEPANAAVAAGGLAVLHDRLDVADMQFTAALETTDDSR
FT                   SCPVRINLELVRERRGDIDAWEARLDDARQRYEAALTVIADAPPACFAGNDDPDPQRRA
FT                   VRADAAARVQAKIDALGTVAPLAPPSPPPPAAPVAPTAPPPAGADQPRPDERRLDIGED
FT                   PLAALRQLLRDAAG"
FT   sig_peptide     40316..40441
FT                   /locus_tag="Mflv_0044"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.488 at
FT                   residue 42"
FT   gene            complement(41023..41433)
FT                   /locus_tag="Mflv_0045"
FT   CDS_pept        complement(41023..41433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0045"
FT                   /product="protein of unknown function DUF1486"
FT                   /note="PFAM: protein of unknown function DUF1486; KEGG:
FT                   mva:Mvan_0873 protein of unknown function DUF1486"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42541"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A4T364"
FT                   /protein_id="ABP42541.1"
FT                   /translation="MTDPQVMNRPRGLTDHRALSSLGAGAHRLYRRWIHELWSGRRVAE
FT                   QLVSPDFVGHLPNREVRGPAGLQAEIDRTHLTLKELSFVVDVGPIVDGDMVAARWIATG
FT                   AGRNGPVRYTGNDLLRIANGKVVEYWSGTSRA"
FT   gene            complement(41498..41839)
FT                   /locus_tag="Mflv_0046"
FT   CDS_pept        complement(41498..41839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0046"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0872 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42542"
FT                   /db_xref="GOA:A4T365"
FT                   /db_xref="InterPro:IPR025323"
FT                   /db_xref="UniProtKB/TrEMBL:A4T365"
FT                   /protein_id="ABP42542.1"
FT                   /translation="MSDDPRPGSRLYLDVLAYVAARLALVAAVAAAVLGIGHLIGIRDF
FT                   PVVVALLFAIVVALPLGIWLFSPLRRRANASIAVIDERRRRDREQLQERLRGGAGKPAP
FT                   KSDPKRRDG"
FT   gene            41889..42053
FT                   /locus_tag="Mflv_0047"
FT   CDS_pept        41889..42053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0047"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0871 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42543"
FT                   /db_xref="UniProtKB/TrEMBL:A4T366"
FT                   /protein_id="ABP42543.1"
FT                   /translation="MAYLLLVLVLAGLVYVGWRVIRMNANRPRTRTIGPDDDPEFLRRI
FT                   NPRDDQPRS"
FT   gene            complement(42079..43173)
FT                   /locus_tag="Mflv_0048"
FT   CDS_pept        complement(42079..43173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0048"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0870 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42544"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4T359"
FT                   /protein_id="ABP42544.1"
FT                   /translation="MSFRAQQRFSDPMAPVPAEWTAPTPPEGVVPVVAAATPSTELVPY
FT                   RELSTVALLGALPKAPSAGWRKWVYRASGRLINPGESPKVIRHDDLLARVQQPLQGCYR
FT                   VAMLSQKGGVGKTTITATLGATFAGARGDRVIAVDANPDRGTLSQKVPVETPATVRHLL
FT                   RDAEGVSAYSDVRRYTSQGPSRLEVLASESDPAVSEAFSATDYVRALNILERFYSMVLT
FT                   DCGTGMLHSAMSAVIDKADVLVVISSGSADGARSASATLDWLDAHGHDDMVRNSIAVIN
FT                   AVRPRGRRGTSRGTAKVDLDKIVDHFTRRCRAVCQVPFDAHLEEGAEISLDRLRPQTRE
FT                   SLLELAAAVADGFPGARNRSDPAD"
FT   gene            complement(43177..44151)
FT                   /locus_tag="Mflv_0049"
FT   CDS_pept        complement(43177..44151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0049"
FT                   /product="cytochrome c assembly protein"
FT                   /note="PFAM: cytochrome c assembly protein; KEGG:
FT                   mva:Mvan_0869 cytochrome c assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42545"
FT                   /db_xref="GOA:A4T360"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR017562"
FT                   /db_xref="UniProtKB/TrEMBL:A4T360"
FT                   /protein_id="ABP42545.1"
FT                   /translation="MSTTIDLDLARYSDWAFTSSVLVLVAALLLFAVELAYSRSRKVED
FT                   RELVGAASGRVSGDSSAPGVVVDAPRRSMDERLGAAGMSLTYVGIALLLACIVLRGLST
FT                   SRVPWGNMYEFINLTCFCGLVAAAWVLRKPQYRSLWVFVLVPVLILLTVSGKWLYSHAA
FT                   PVMPALQSYWLPIHVSVVSLGSGVFLVAGVASILFLVKMSRLADRDDAIGRIVAKLPDG
FT                   QTLDRIAYRTTIFAFPVFGFGVIFGAIWAEEAWGRYWGWDPKETVSFIAWVVYAAYLHA
FT                   RSTAGWRDRKAAWINIAGFVAMVFNLFFINLVTVGLHSYAGVG"
FT   gene            complement(44148..45797)
FT                   /locus_tag="Mflv_0050"
FT   CDS_pept        complement(44148..45797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0050"
FT                   /product="ResB family protein"
FT                   /note="PFAM: ResB family protein; KEGG: mva:Mvan_0868 ResB
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42546"
FT                   /db_xref="GOA:A4T361"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="UniProtKB/TrEMBL:A4T361"
FT                   /protein_id="ABP42546.1"
FT                   /translation="MVTTTPREDTNSRNTPPTRPITRLLALVRNTWRTLTSMGTALVLL
FT                   FLLALAAIPGALLPQRSLNESKVAEYIAEHPTLGPWLDRVQAFDVFSSFWFTSIYVLLF
FT                   VSLVGCLTPRLFEHFRSLRATPVPAPRNLSRLPKHHSADVPCADVDAAATAVDGQLRGW
FT                   RRTTRRDGEATEISAEKGYLREFGNIVFHFSLLGLLVAIAAGKLFSYEGNVIVIANGGP
FT                   GFCTASPAAFDSFRAGNTVDGTSLYPMCIQVDDFDATYLDNGQAVGFQANIRYQADDDL
FT                   TTGTWQPYLLKVNEPLRVGGDRVYLQGHGYAPTFTVTFPDGQTRTQTLQWRPDDQFTFL
FT                   SSGAMRFDPPAGTYPDEDERRDNQIAIQGLFAPTALLHGALLSSRFPEMQDPAVAIDIY
FT                   KGDTGLDTGRPQSVFSLDERMIGQGRLEKMARVNLKVGEDTRLADGTVVRFDGAEQFVN
FT                   LQVSHDPAQIWVLVFSMTMMGGLLVSLIVRRRRVWVRLTPGPAGTVNVELGGLARTDNS
FT                   GWGDEFERLTERLLTAVESATPAEKAKKADHS"
FT   sig_peptide     complement(45642..45797)
FT                   /locus_tag="Mflv_0050"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.798) with cleavage site probability 0.685 at
FT                   residue 52"
FT   gene            complement(45797..46582)
FT                   /locus_tag="Mflv_0051"
FT   CDS_pept        complement(45797..46582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0051"
FT                   /product="cytochrome c biogenesis protein, transmembrane
FT                   region"
FT                   /note="PFAM: cytochrome c biogenesis protein, transmembrane
FT                   region; KEGG: mva:Mvan_0867 cytochrome c biogenesis
FT                   protein, transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42547"
FT                   /db_xref="GOA:A4T355"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:A4T355"
FT                   /protein_id="ABP42547.1"
FT                   /translation="MNVDQIDQLTASGPLLLAMGLAALAGLVSFASPCVVPLVPGYLSY
FT                   LAAVVGVDDGPAGSGAVAVKGARLRVAGAAALFVAGFTVVFLLGTVAVLGMTTTLITNQ
FT                   LLLQRIGGVITILMGLVFIGLVPVLQRDTRFTPRRISTVGGAPLLGAVFALGWTPCLGP
FT                   TLTGVIAVASATEGSNVARGVVLVIAYCLGLGIPFVLLAFGSARAVAGLGWLRRNTRTI
FT                   QILGGVLMILVGAALVTGLWNEFVSWVRDAFVSDVRLPI"
FT   sig_peptide     complement(46487..46582)
FT                   /locus_tag="Mflv_0051"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.963) with cleavage site probability 0.961 at
FT                   residue 32"
FT   gene            complement(46579..47181)
FT                   /locus_tag="Mflv_0052"
FT   CDS_pept        complement(46579..47181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0052"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   mva:Mvan_0866 redoxin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42548"
FT                   /db_xref="GOA:A4T356"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4T356"
FT                   /protein_id="ABP42548.1"
FT                   /translation="MNRVVAFGRTLMAACAATAVFAGCATGSDAVAQGGTFEFVAPGGQ
FT                   TDIFYDPPQERGTPGPLSGPDLMDTDRTISLDDFAGKVVVINVWGQWCGPCRTEITELQ
FT                   KVYDATRDRGVAFLGIDVRDNNIDAPRDFIIDRAITFPSIYDPPMRTMIAFGGRYPTTV
FT                   IPSTVVLDREHRVAAVFLRELLAQDLQPVVERLAAEQ"
FT   sig_peptide     complement(47083..47181)
FT                   /locus_tag="Mflv_0052"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.952 at
FT                   residue 33"
FT   gene            complement(47178..47813)
FT                   /locus_tag="Mflv_0053"
FT   CDS_pept        complement(47178..47813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0053"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: mva:Mvan_0865
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42549"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A4T357"
FT                   /protein_id="ABP42549.1"
FT                   /translation="MTDQTPGAGGANQTIVHVMRHGEVHNPEKILYGRLPDYHLSDRGQ
FT                   AQARRVAEWLGSRDITHVVASPLERAQETAAPIAAAHGLAVSTDDELIESENIFQGQRV
FT                   SPGDGALRDPRNWWHLRNPRTPSWGEPYSHIAARMKRAVLRAREAAHGHEAVCVSHQLP
FT                   VETLRRAMTDRPLHHFPTRRMCNLASVTSFYFHDGVCVGWGYSELAGQ"
FT   gene            complement(47810..49108)
FT                   /locus_tag="Mflv_0054"
FT   CDS_pept        complement(47810..49108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0054"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /EC_number="5.4.3.8"
FT                   /note="TIGRFAM: glutamate-1-semialdehyde-2,1-aminomutase;
FT                   PFAM: aminotransferase, class I and II; aminotransferase
FT                   class-III; KEGG: mva:Mvan_0864
FT                   glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42550"
FT                   /db_xref="GOA:A4T358"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4T358"
FT                   /protein_id="ABP42550.1"
FT                   /translation="MSTTEESAKLFADASSVIPGGVNSPVRAFNSVGGTPRFITSAKGC
FT                   RLTDVDGNQYVDLVCSWGPMILGHAHPAVVEAVQRVAAHGLSFGAPTPSESELAREIID
FT                   RVAPVERVRLVNSGTEATMSAIRLARGFTGRAKIVKFSGCYHGHSDALLADAGSGVATL
FT                   GLPSSPGVTGAAAADTLVLPYNNVAAVEEIFAQFGDEIACVITEASPGNMGTVPPLPGF
FT                   NAALRRITAAHGALLIVDEVMTGFRVSRSGWYGLDPVDADLFTFGKVMSGGLPAAAFGG
FT                   TAEVMGRLAPLGPVYQAGTLSGNPVAMAAGLATLRAADDAAYAKLDANADRLVGLIGDA
FT                   LTEAGVTHQIPRAGNMFSVFFGGDPVTDFASAKATETWRFPAFFHALLDAGIYPPPSAY
FT                   EAWFVSTALDDEAFDRIADALPGAARAAAQAAA"
FT   gene            complement(49195..50580)
FT                   /locus_tag="Mflv_0055"
FT   CDS_pept        complement(49195..50580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0055"
FT                   /product="permease for cytosine/purines, uracil, thiamine,
FT                   allantoin"
FT                   /note="PFAM: permease for cytosine/purines, uracil,
FT                   thiamine, allantoin; KEGG: mva:Mvan_0862 permease for
FT                   cytosine/purines, uracil, thiamine, allantoin"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42551"
FT                   /db_xref="GOA:A4T351"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR026030"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:A4T351"
FT                   /protein_id="ABP42551.1"
FT                   /translation="MHDLEAELTVIPESAKTTDLRGQFWIWAGANIAPINWILGALGVT
FT                   MGLGLFETIAVLVVGNAIGMSLFGTFVVIGQKTGVTGMVLSRMVFGRRGAYVPAAVQAA
FT                   LCIGWCAVNTWIVLDLVMALLGRIGLVDPELSNHAARIVVAGIIMTTQVVIAWFGYRLI
FT                   AAFERWTVPPTVAVLVAMTAVAWFGLDVDWGYTGDAALTGAEHFTAITAVMTAIGIGWG
FT                   ITWLGYAGDYSRFVSSSVPARKLFAASALGQFIPVVWLGALGATLATLSASSDPGEIIV
FT                   DAYGVLAIPVLLLVVHGPLATNILNIYTCAVSTQALDIHVNRRVLNIVIGVVAMAWVVY
FT                   FVLNGDFAATIDAWLVGIVGWLAPWAAVMLVHWFGVARRQVDPATLLTPPNESTLPAVR
FT                   PSALISLAVGIVFTWLFMYGMVPMMQGPIAVALGGVDLSWLAGGLAAGSLYAALEIPKA
FT                   RRA"
FT   gene            complement(50785..52146)
FT                   /locus_tag="Mflv_0056"
FT   CDS_pept        complement(50785..52146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0056"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: msm:MSMEG_0968
FT                   cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42552"
FT                   /db_xref="GOA:A4T352"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A4T352"
FT                   /protein_id="ABP42552.1"
FT                   /translation="MVAGTEPGVGHLPLAPKNPLPYRRLLTLVRALDTGQLQVRAAGGP
FT                   ITRVQVAPRWLFPPFVAVFSPRGVRDVLGRNDAFSERCIVHEEVRDMAGDSLFVLPNEP
FT                   WRPRKRALQPVFTPQNVRRFGGHMSRAAEVFVDAWRDGGDVDLDLECRRITMQSLGRSV
FT                   LGVDLNESADVIAEHMHVASSYTADRALRPVRAPRWLPTPARRRAAHAVAEMRQVAADM
FT                   LQVCRDDPDRDAPLVRALMDARDPETGMALSDDDICNDLLIFMLAGHDTTATALTYALW
FT                   VLGHHPDVQDRVAAEAAALGRRELEPGDVPHLKYTTQVLLEALRLCPPAAGVGRMAVRD
FT                   IDVDGHRVQAGTLVAVGIYALHRDPEIWPDPDRFDPDRFSPEQTAQRDRWHFLPFAGGA
FT                   RSCIGEHFARLETTLALATIVRSMRVTSSDNDFPVDVPFTTVAHGPIPAHLTPR"
FT   gene            complement(52130..52648)
FT                   /locus_tag="Mflv_0057"
FT   CDS_pept        complement(52130..52648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0057"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0857 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42553"
FT                   /db_xref="GOA:A4T353"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A4T353"
FT                   /protein_id="ABP42553.1"
FT                   /translation="MPSLRAVTALESIAPAFVDMAHSIVWASIATVDAVGRPRTRILHP
FT                   IWEWDGTDLFGWIATVPTPLKRAHLAAHPDVSVSYWTTTQDTCSAECLVEWYTDDDTCA
FT                   QVWDKFATGPAPVGYDPRIIPMWKDGPTSHEFAVLRLAPYRLRVMPGAVMMRGEGAPLM
FT                   WSDHSGRRD"
FT   gene            complement(52680..53015)
FT                   /locus_tag="Mflv_0058"
FT   CDS_pept        complement(52680..53015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0058"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0856 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42554"
FT                   /db_xref="UniProtKB/TrEMBL:A4T354"
FT                   /protein_id="ABP42554.1"
FT                   /translation="MTTDDQTQQRQSGDKPDVQLDHVTDTPDPDTENCTEKPEITDEHR
FT                   DKAKEMAKAYSDDLQTTTLPGSSGTVSGTSVTDWVDDADKGKIETSADEGNVEYRNTEE
FT                   FKKKLEG"
FT   gene            complement(53058..53651)
FT                   /locus_tag="Mflv_0059"
FT   CDS_pept        complement(53058..53651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0059"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, LacI; regulatory protein,
FT                   TetR; KEGG: mva:Mvan_0855 transcriptional regulator, TetR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42555"
FT                   /db_xref="GOA:A4T345"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A4T345"
FT                   /protein_id="ABP42555.1"
FT                   /translation="MSGPDPASEQILDAAVVEFERHGFRRVALEDVARRAGVSRTTIYR
FT                   RFANKDQLVGAVIERENVALFSDIATELKQAGPQSNYYVEAFTLSILKFRGHRVLHRMI
FT                   TEEPGLVLELASLYYRAAIERMAEALRVIFPPGFAERIGADAVDELADTILRYATMVLL
FT                   LPSAQPLETADDIRAFARHHFLPSLPEALRSVPA"
FT   gene            complement(53638..54546)
FT                   /locus_tag="Mflv_0060"
FT   CDS_pept        complement(53638..54546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0060"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0854 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42556"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:A4T346"
FT                   /protein_id="ABP42556.1"
FT                   /translation="MTELADKNGHLDGADTDALPLGPQSLVWRYFGDNRMYLIGPRPAV
FT                   LQNMLAELGQGVYDHSTFFADTAERLKRTIPPILNTVYGSDEENAGLQVRDFHHHVKGV
FT                   MPGPDGEEAGRYHALDPETYFWAHATFVEQVYYFADTFVKRLTDAEREQIWLESKTWYR
FT                   RYGVSDRVMPATYAEFVQYWDRMMDQVVVAHPTAKYGVGYVTKGFPKPKAVHPLVWRLV
FT                   APVFNPLAAFLTTGGLPPRARMLLGLPWSDKQERRYQRFAAFWRSRPVNWVWDRLPMTV
FT                   RYSGYAVKGFTRSDMRSDVRA"
FT   gene            complement(54660..54914)
FT                   /locus_tag="Mflv_0061"
FT   CDS_pept        complement(54660..54914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0061"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: mkm:Mkms_0696 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42557"
FT                   /db_xref="GOA:A4T347"
FT                   /db_xref="UniProtKB/TrEMBL:A4T347"
FT                   /protein_id="ABP42557.1"
FT                   /translation="MSRRRALAEVLLGALAAVGCVAAWLGAATPVTVAPVLPGEPSTSS
FT                   YTYYAPMLTLSLLLATLAGVLVVLGIARLRRTSAKPAPR"
FT   sig_peptide     complement(54810..54914)
FT                   /locus_tag="Mflv_0061"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.273 at
FT                   residue 35"
FT   gene            complement(54911..55399)
FT                   /locus_tag="Mflv_0062"
FT   CDS_pept        complement(54911..55399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0062"
FT                   /product="putative conserved transmembrane protein"
FT                   /note="KEGG: mva:Mvan_0850 putative conserved transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42558"
FT                   /db_xref="GOA:A4T348"
FT                   /db_xref="UniProtKB/TrEMBL:A4T348"
FT                   /protein_id="ABP42558.1"
FT                   /translation="MTGPRSPEVLFSEQGASWLWVLAGPAAGVAMALIQYSGGYGIQWV
FT                   VPVLFLVLVSGFLAIQVKAARIHTSVELTTESLRQGTELIRTEEIVRIYPEASGSETPK
FT                   WQYARALGELTGVPRGRTGIGVRLTNDRTAQAWARKHHQLRAALTNLVEERIPPEPAQ"
FT   gene            complement(55396..55866)
FT                   /locus_tag="Mflv_0063"
FT   CDS_pept        complement(55396..55866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0063"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0849 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42559"
FT                   /db_xref="GOA:A4T349"
FT                   /db_xref="UniProtKB/TrEMBL:A4T349"
FT                   /protein_id="ABP42559.1"
FT                   /translation="MIGYADPTMSAPTSSGRPRIVDLGFWCFMAGAVIMIVGGLMAVTA
FT                   TFEAARAAIPDTVSDDQVRSYLTIYRGTGFGAVLGAGALAFLAGRARRGDARFRLATLA
FT                   LTFAAVVVIGLLALGIGVAQPLILLGLLPAVIGALLFVQPSAREWFQRDGGS"
FT   gene            complement(56297..57277)
FT                   /locus_tag="Mflv_0064"
FT   CDS_pept        complement(56297..57277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0064"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="PFAM: delta-aminolevulinic acid dehydratase; KEGG:
FT                   mva:Mvan_0847 porphobilinogen synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42560"
FT                   /db_xref="GOA:A4T350"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A4T350"
FT                   /protein_id="ABP42560.1"
FT                   /translation="MGFPRHRPRRLRTTPAMRRLVSETSLEPRHLVLPMFVADGLDEPR
FT                   DIASMPGVVQHTRESLRRAAAEAVEAGVGGLMLFGVPRDEDKDATGSIGVDPDGILNRA
FT                   LRDLTRDLGDDTVLMADTCLDEFTDHGHCGVVDPTGRVDNDLTNRRYVELAVAQANSGA
FT                   QVVSPSGMMDGQVAAIRDGLDVAGYTHTAILAYSAKFASGFYGPFREAVGSSLEGDRRT
FT                   YQQDPGNGREALHEVRLDIEEGADIVMVKPAMSYLDVVRATAEICPLPLAAYQVSGEYS
FT                   MIAAAAEKGWIDLPTVVLESLVGIRRAGADIVLSYWAVDVARWLT"
FT   gene            complement(57366..59075)
FT                   /locus_tag="Mflv_0065"
FT   CDS_pept        complement(57366..59075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0065"
FT                   /product="uroporphyrinogen-III synthase /
FT                   uroporphyrinogen-III C-methyltransferase"
FT                   /EC_number="4.2.1.75"
FT                   /EC_number="2.1.1.107"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; Uroporphyrinogen III
FT                   synthase HEM4; KEGG: mva:Mvan_0846 uroporphyrinogen III
FT                   synthase HEM4"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42561"
FT                   /db_xref="GOA:A4T339"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/TrEMBL:A4T339"
FT                   /protein_id="ABP42561.1"
FT                   /translation="MSLRGRKNKPGRITFVGSGPGDPGLLTSRARAVLANAALVFTDPD
FT                   VPEAVRALVGSELPPPSGPLPPVADAAPKTAAAGADQPASQDAAPADAAKTAKAAEDAV
FT                   IPGGPDVRPALGDPAEVAKTLAHEARTGVDVVRLVAGDPLSNDSVITEVNALAKTQLSF
FT                   EIVPGLPGTSAVPTYAGLPLGSSHTVADVRGDVDWAALAAAPGPLILHATPSHLPEAAR
FT                   TLIEYGLAESTPAVVTANGTTCQQRSVETTLAGLLDKAALAGTEPAGPLTGTLVVTIGR
FT                   TVANRAKLNWWESRALYGWTVLVPRTKDQAGEMSDRLVGHGALPIEVPTIAVEPPRSPA
FT                   QMERAVKGLVDGRFQWVVFTSTNAVRAVWEKFNEFGLDARAFSGVKIACVGQATAEKVR
FT                   AFGINPELVPTGEQSSLGLLDEFPPYDDIFDPVNRVLLPRADIATETLAEGLRELGWEI
FT                   EDVTAYRTVRAAPPPAHTREMIKTGGFDAVCFTSSSTVRNLVGIAGKPHARTIVACIGP
FT                   KTAETAAEFGLRVDVQPEVAAVGPLVEALAEHAARLRAEGALPPPRKKSRRR"
FT   gene            complement(59072..60010)
FT                   /locus_tag="Mflv_0066"
FT   CDS_pept        complement(59072..60010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0066"
FT                   /product="hydroxymethylbilane synthase"
FT                   /EC_number="2.5.1.61"
FT                   /note="KEGG: mva:Mvan_0845 porphobilinogen deaminase;
FT                   TIGRFAM: porphobilinogen deaminase; PFAM: Porphobilinogen
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42562"
FT                   /db_xref="GOA:A4T340"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4T340"
FT                   /protein_id="ABP42562.1"
FT                   /translation="MIRIGTRGSLLATTQAGTIRDALIAAGHDAELVIISTEGDRRADE
FT                   PIADIGVGVFTAALREAIADNVVDAAVHSYKDLPTAVDPRFMIAATPVREDARDALVAR
FT                   DGMVLGELPAGSVIGTSSPRRVAQLKALGLGLEIRPLRGNLDTRLNRVSSGELDAIVVA
FT                   KAGLSRIGRLEVVTETLEPVQMLPAPAQGALAIECRAGDTALAQLLAELDDADTRAAVT
FT                   AERTLLAELEAGCSAPVGAIAEVVESIDEDGRVFEELSLRGCVATLDGSDVIRASGIGS
FT                   PDRARELGLSVAAELFDLGARDLLDERGRDT"
FT   gene            complement(60036..61403)
FT                   /locus_tag="Mflv_0067"
FT   CDS_pept        complement(60036..61403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0067"
FT                   /product="glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.70"
FT                   /note="PFAM: glutamyl-tRNA reductase; UBA/THIF-type NAD/FAD
FT                   binding protein; Shikimate/quinate 5-dehydrogenase; KEGG:
FT                   mva:Mvan_0844 shikimate/quinate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42563"
FT                   /db_xref="GOA:A4T341"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4T341"
FT                   /protein_id="ABP42563.1"
FT                   /translation="MSVLLFGVSHRSAPVSVLEQLSTDESDQAKIIAEVLRSSLVTEAM
FT                   VLSTCNRVEIYAVVEAFHGGLSVIGQVLSDHSGMSLQDLTKYAYVRYAEAAVEHLFAVA
FT                   SGLDSAVVGEQQVLGQVRRAYASAESNHTVGRTLHELSQRALAVGKRVHSETGIDRAGA
FT                   SVVSVALDVAEKKVGPLAGRSAVVVGAGSMGALAATQLARAGIERIHVVNRSLPRGKRL
FT                   AENIRGYGIAAEAYPFDHLPPLLTDADIVVSCTGAVRPVVSLADVHRGLAHVREPKDLV
FT                   ICDLGMPRDVDAAVAGLPGVFVIDMDRILREPTAKTATSDADAARSIVATEVANYLAGQ
FT                   RVAEVTPTVTALRQRAADVVEAELLRLDNRLPGLDSSHRDEVANTVRRVVDKLLHAPTV
FT                   RVKQLASAPGGDSYAEALRELFELDQHAVDAVAGSELGAVSGDELAAPAIDLDLTE"
FT   gene            complement(61548..61802)
FT                   /locus_tag="Mflv_0068"
FT   CDS_pept        complement(61548..61802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0068"
FT                   /product="glutaredoxin 2"
FT                   /note="PFAM: glutaredoxin 2; KEGG: mkm:Mkms_0688
FT                   glutaredoxin 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42564"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4T342"
FT                   /protein_id="ABP42564.1"
FT                   /translation="MDRQVELLTREGCPMCAAAAAQLDALAGELGFTVVVTDVDAAAAA
FT                   GDAALRAEYGDRLPVVLLDGVEHSYWEVDEARLRADLSG"
FT   gene            61842..62729
FT                   /locus_tag="Mflv_0069"
FT   CDS_pept        61842..62729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0069"
FT                   /product="HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IB
FT                   (PSPase-like); HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: mva:Mvan_0843 HAD-superfamily subfamily IB
FT                   hydrolase, TIGR01490"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42565"
FT                   /db_xref="GOA:A4T343"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4T343"
FT                   /protein_id="ABP42565.1"
FT                   /translation="MSDIGGRAQQLAGEASAEAAVEGLTEPLGPAAPPPPPPPPDLTAA
FT                   AFFDVDNTLVHGSSLVHFARGLAAREYFTYQDLARFAYAQAKFQLTGRENSDDVAAGRR
FT                   KALSFIEGRSTAELVALGEDIYDEIIADKIWPGTRRLAQMHLDAGQQVWLVTATPYELA
FT                   ETIARRLGLTGALGTVAESIDGVFTGRLVGDILHGTGKAHAVRSLAIREGLNLRRCTAY
FT                   SDSFNDVPMLSLVGTAVAINPDAALRDLARQRGWEVRDFRTARKAARIGVPSALALGAV
FT                   GGALAAAVSHRDKK"
FT   gene            62780..63328
FT                   /locus_tag="Mflv_0070"
FT   CDS_pept        62780..63328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0070"
FT                   /product="MaoC-like dehydratase"
FT                   /note="KEGG: mva:Mvan_0842 MaoC-like dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42566"
FT                   /db_xref="InterPro:IPR016709"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:A4T344"
FT                   /protein_id="ABP42566.1"
FT                   /translation="MATSIAADIIGTHYRYPDYFQVDREKIREFARAVKDEHPAHHDED
FT                   AARECGHDALIASLTFLAVAGRRVQQEIFNQFDLPINMERVLHRDQKLVFHRPILAGDK
FT                   LWFDSYLDSVTESHGAVLTEIRGEITDDEGNPIITSIVTVMGEAAHETEADELTAQIAA
FT                   KRDADALAKFVAGQKGQID"
FT   gene            complement(63358..64428)
FT                   /locus_tag="Mflv_0071"
FT   CDS_pept        complement(63358..64428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0071"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   mva:Mvan_0841 phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42567"
FT                   /db_xref="GOA:A4T335"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR016676"
FT                   /db_xref="UniProtKB/TrEMBL:A4T335"
FT                   /protein_id="ABP42567.1"
FT                   /translation="MAGEPKAKVIPLHANSGRGAAARRSASQRADSASRHPSVLSDPKG
FT                   RASAEQIASVVREIDQRRGPSSGTGFDAPPPNELAQRIAAIAEFVRKRMTGEYTVDEFG
FT                   FDPHLNDAIFLPLLRVLFNSWFRVEVSGIENLPETGAALVVANHAGVLPFDGLMTQVAV
FT                   RDEHPAHRDLRLLAADIVFDMPMVGQAARKAGHTMACTDDAHRLLAAGELTAVFPEGYK
FT                   GLGKHFKDRYKLQRFGRGGFVSAALRTKAPIVPCSIVGSEEIYPMIADVKLLARLLGLP
FT                   YFPVTPLFPAAGPLGVVPLPSKWYIQFGEPIDTTDYDESAAEDPMVTFDLTDQVRETIQ
FT                   QTLYQLLANRRNTFFG"
FT   gene            complement(64479..65579)
FT                   /locus_tag="Mflv_0072"
FT   CDS_pept        complement(64479..65579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0072"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   C-terminal domain; KEGG: mva:Mvan_0840 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42568"
FT                   /db_xref="GOA:A4T336"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4T336"
FT                   /protein_id="ABP42568.1"
FT                   /translation="MDSEGRSGTGPEGSDAREGLDYPKVVLVTGACRFLGGYLTARLAQ
FT                   NPLINHVIAVDAVAPSKDLLRRMGRAEFVRADIRNPFIAKVIRNGEVDTVVHAAAASYA
FT                   PRAGGRATLKEINVMGAIQLFAACQKAPSVRRVILKSTSEVYGSSSRDPVLFSESSSRR
FT                   RPPGEGFARDSIDIEGYARGMGRRRPDIAVTILRLANMIGPATDTALSRYLAGPVVPTV
FT                   IGHDPRLQLLHEQDALGALERATMAGRSGAFNIGASGIITMSQAIRRAGRLALPVPRSA
FT                   LVAVDSLWRATRNTELDREQLDYLSYGRVMDTSRMRNELGYSPKWTTAEAFDDYVRGRG
FT                   LTPIIDPRWIHAVENRAVAAAQRWGR"
FT   gene            complement(65611..65712)
FT                   /locus_tag="Mflv_0073"
FT   CDS_pept        complement(65611..65712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0073"
FT                   /product="Protein of unknown function DUF1713"
FT                   /note="PFAM: Protein of unknown function DUF1713; KEGG:
FT                   rha:RHA1_ro02059 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42569"
FT                   /db_xref="InterPro:IPR013177"
FT                   /db_xref="UniProtKB/TrEMBL:A4T337"
FT                   /protein_id="ABP42569.1"
FT                   /translation="MGSVIKKRRKRMSKKKHRKLLRRTRVQRRKLGK"
FT   gene            complement(65861..66133)
FT                   /locus_tag="Mflv_0074"
FT   CDS_pept        complement(65861..66133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0074"
FT                   /product="DNA binding domain, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain, excisionase family;
FT                   KEGG: mva:Mvan_0838 DNA binding domain, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42570"
FT                   /db_xref="GOA:A4T338"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A4T338"
FT                   /protein_id="ABP42570.1"
FT                   /translation="MTSMNGPSSRDSAGGKAARDAGQGSAGDAQSPRAQFLTVAEVASL
FT                   MRVSKMTVYRLVHNGELPAVRVGRSFRVHAKAVHDMLESSYFDAG"
FT   gene            complement(66271..67152)
FT                   /locus_tag="Mflv_0075"
FT   CDS_pept        complement(66271..67152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0075"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="KEGG: mva:Mvan_0837 transcriptional regulator, fis
FT                   family; TIGRFAM: pyrroline-5-carboxylate reductase; PFAM:
FT                   NADP oxidoreductase, coenzyme F420-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42571"
FT                   /db_xref="GOA:A4T331"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4T331"
FT                   /protein_id="ABP42571.1"
FT                   /translation="MLARMARIAIIGGGSIGEALLAGLLRAGRQVKDLVVAEKSPDRGK
FT                   YLAEKYSVLVTTVADAVDAATYVIVAVKPADVQHVIGDIADTAARADSDAAEQVFVSVA
FT                   AGVSTSFYESKLPAGSPVIRVMPNAPMLVGGGVSALAPGRFASPEQLKEVSLLFDAVGG
FT                   VLTVAESQIDAVTAVSGSGPAYFFLMVEALVDAGVDAGLPRAVATDLAVQTMAGSAAML
FT                   LERLDQNAAGSASAGPSMDTSAAQLRATVTSPGGTTAAGLRELERGGLRAAVANAVEAA
FT                   KKRSEQLGITTE"
FT   gene            complement(67186..67998)
FT                   /locus_tag="Mflv_0076"
FT   CDS_pept        complement(67186..67998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0076"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0836 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42572"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:A4T332"
FT                   /protein_id="ABP42572.1"
FT                   /translation="MTSSTLFTDAMALTPAGDGVYHGVLNEHWTIGPKVHGGAMLALCA
FT                   NAARSEFGEDGVEPIAVSGSFLWAPDPGAMQVVTTVRKRGRRVSLLDVELQQGDRVALR
FT                   AAITMGTPEHHVPPLLSVNPVVPLMTPEPPPGLEPIGPGHSMADIVHLAHGCDIRPSLT
FT                   TFDPRQDGGMPVIEYWVRPKGVAPDLLFALLCGDVSAPVTFGVNRFGWAPTVQLTAYLR
FT                   ALPADGWLRVMCTATQIGEDWFDEDHIVVDCEGRIIVQTRQLAMVPSR"
FT   gene            complement(68023..68868)
FT                   /locus_tag="Mflv_0077"
FT   CDS_pept        complement(68023..68868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0077"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: mva:Mvan_0835 xylose isomerase domain protein TIM
FT                   barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42573"
FT                   /db_xref="GOA:A4T333"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A4T333"
FT                   /protein_id="ABP42573.1"
FT                   /translation="MRPAIKVGLSTASVYPLKTEAAFEYAANLGYDGVELMVWAEAVSQ
FT                   DIDAIAAMSKRYGVPVLSVHAPCLLITQRVWGANPITKLARSVRAAEQLGAQTVVVHPP
FT                   FRWQRRYAEGFSDQVAELESGSDVLVAVENMFPFRADRFFGAGPTSIERMRKRGGTPGP
FT                   GISAFAPSYDPLDGGHAHYTLDLSHTATAGTDALDMAARMGEGLAHLHLCDGSGASYDE
FT                   HLVPGRGTQPTAEVCEMLAASDFAGHVILEVTTSGARSGAEREALLTESLQFARTHLLR
FT                   "
FT   gene            complement(68896..70197)
FT                   /locus_tag="Mflv_0078"
FT   CDS_pept        complement(68896..70197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0078"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0834 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42574"
FT                   /db_xref="GOA:A4T334"
FT                   /db_xref="UniProtKB/TrEMBL:A4T334"
FT                   /protein_id="ABP42574.1"
FT                   /translation="MTGTEDSNSSTRPISVAELLAKNGTIGAPPVGGRRRRRRGNSDAV
FT                   TVAELTGEIPIIRPDDPPPAPVTAPETVAEPIEEAPAEAEVEVEAEAEVEAESEVEAEV
FT                   EADTAADVEAEDTDVEDATDVEVEATDDVEAPDVEAEAPADVVDTDVQAEATDVDVEAE
FT                   TVEQVAPVAPPAAEPSRSRRFGFLRLGRRSAPAAVTPVAETSVAEVPADQVDTVDDAPV
FT                   AEETAEIEKTESGETAEDAIAEEPSDTITEDAHDEDLHAEDLEPAFDDEDLDDRDSDEL
FT                   PSYLRSSEEPLFGGQSVVDELARQGDRSSRADTVEDRDAAVETVDADETDDDLVDEPDD
FT                   HDAPRTMSPLVSALWIIGQSVIAVVFGAGLFVAFDQLWKWNNIIALVLSVLVILGLVVG
FT                   VRLVRKTEDIGSTLIAVAVGALVTLGPLALLQSG"
FT   gene            complement(70238..71269)
FT                   /locus_tag="Mflv_0079"
FT   CDS_pept        complement(70238..71269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0079"
FT                   /product="Ppx/GppA phosphatase"
FT                   /note="PFAM: Ppx/GppA phosphatase; KEGG: mva:Mvan_0833
FT                   Ppx/GppA phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42575"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:A4T327"
FT                   /protein_id="ABP42575.1"
FT                   /translation="MRLGVLDVGSNTVHLLVVDARRGGHPTPMSSTKASLRLAEAIDDS
FT                   GKLTRRGADKLIGTLDEFARIATSSGCAELMAFATSAVRDARNSEEVLARVKAETGVEL
FT                   KVLSGVDESRLTFLAVRRWYGWSAGRIVNIDIGGGSLELSSGVDEEPDVALSLPLGAGR
FT                   MTREWLPDDPPGRRRVAMLRDWLTNELSDAAAAVTEAGTPDLAVASSKTFRSLARLTGA
FT                   APSGAGPRVKRTLTATGLRQLINFISRMTAADRAELEGVSADRAPQIVAGALVAEASMN
FT                   ALNIESVDICPWALREGLILRKLDSEADGSDFVGGSFNQVSGRGKAAKTGARESARTAD
FT                   ART"
FT   gene            71294..72085
FT                   /locus_tag="Mflv_0080"
FT   CDS_pept        71294..72085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0080"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0832 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42576"
FT                   /db_xref="UniProtKB/TrEMBL:A4T328"
FT                   /protein_id="ABP42576.1"
FT                   /translation="MKTVSASASHPGEVELDFAREWVEFYDPDNPEHLIAADMTWLLSR
FT                   WTCVFGTPACKGTVVDRPDDGCCSHGAFLSDDDDRAQLDDAVTLLTAEDWQYRDKGLGK
FT                   KGYLEMDEYDGKPNWRTRKYKGACIFLNRPGWPKGIGCALHSKALEIGVEPLTLKPEVC
FT                   WQLPIRRTQEWITRPDDTEILKTTITEYDRRGWGEGGADLHWYCTGDPAAHVGAKPVWQ
FT                   SYAPELTELLGEKAYAELAAMCKRRSGLGLIAIHPATRAAE"
FT   gene            72082..72390
FT                   /locus_tag="Mflv_0081"
FT   CDS_pept        72082..72390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0081"
FT                   /product="YCII-related protein"
FT                   /note="PFAM: YCII-related; KEGG: mkm:Mkms_0675
FT                   YCII-related"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42577"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A4T329"
FT                   /protein_id="ABP42577.1"
FT                   /translation="MSTERSQLFLFRLIPPRADFAQTMTDIEEHTMHLHMTYWQELLAA
FT                   GRVVVYGPVADPEGMWGLGVLRVADRAEALAIAEADPSIIAGVNTFEVLEILGGTTG"
FT   gene            complement(72472..73158)
FT                   /locus_tag="Mflv_0082"
FT   CDS_pept        complement(72472..73158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0082"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: mva:Mvan_0831 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42578"
FT                   /db_xref="GOA:A4T330"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A4T330"
FT                   /protein_id="ABP42578.1"
FT                   /translation="MTSVLIVEDEESLADPLAFLLRKEGFETTVVTDGPSALAEFERAG
FT                   ADIVLLDLMLPGMSGTDVCKQLRSRSSVPVIMVTARDSEIDKVVGLELGADDYVTKPYS
FT                   ARELIARIRAVLRRGADADDLGVADGVLEAGPVRMDVERHVVSVNGAPITLPLKEFDLL
FT                   EYLMRNSGRVLTRGQLIDRVWGADYVGDTKTLDVHVKRLRSKIESDPANPVHLVTVRGL
FT                   GYKLEG"
FT   gene            complement(73166..74374)
FT                   /locus_tag="Mflv_0083"
FT   CDS_pept        complement(73166..74374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0083"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: mva:Mvan_0830
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42579"
FT                   /db_xref="GOA:A4T321"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4T321"
FT                   /protein_id="ABP42579.1"
FT                   /translation="MSVVSALLLAAIVALLALAIGVAIGVRAVPRLRERRQRRSAEQSG
FT                   ITVSQMLERIVSFSPIGIAVVDNFRDVVYKNDRAQELGLLGDRLLDDRAWVAAQRTLTT
FT                   GEPHGFDLSPRKGSRTGRSGLSVRGYCRLLAEEDRRFAVVYVDDQSEHARMEATRRDFV
FT                   ANVSHELKTPVGALGVLAEAVLASVEDPDTVRHFAEKMVTEADRLANMVGELIELSRLQ
FT                   GGEPLPDLEAVDVDVVVSEALSRHKVAADNADIAITTDAPTGFQVLGDQTLLVAAVANL
FT                   VSNAIAYSPNGSAVSISRRRNGDNIQIAVTDRGIGIAPADQERVFERFFRVDKARSRAT
FT                   GGTGLGLAIVKHVAANHNGSIRLWSQPGTGSTFTLSIPAAPPGEQRSGDAAGGAADLAQ
FT                   RED"
FT   sig_peptide     complement(74288..74374)
FT                   /locus_tag="Mflv_0083"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.979 at
FT                   residue 29"
FT   gene            complement(74514..75266)
FT                   /locus_tag="Mflv_0084"
FT   CDS_pept        complement(74514..75266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0084"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /note="KEGG: mva:Mvan_0829 phosphoglycerate mutase 1
FT                   family; TIGRFAM: phosphoglycerate mutase 1 family; PFAM:
FT                   Phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42580"
FT                   /db_xref="GOA:A4T322"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A4T322"
FT                   /protein_id="ABP42580.1"
FT                   /translation="MADTATLILLRHGESEWNALNLFTGWVDVDLTDKGRAEATRAGEL
FT                   IGEQDKLPDVLYTSLLRRAITTANIALDKADRHWIPVHRDWRLNERHYGALQGLNKAET
FT                   KAKYGDEQFMAWRRSYDTPPPQIEAGSEFSQDRDPRYADIDGGAPLTECLKDVVERFVP
FT                   YFTEVIVPDLKAGKTVLIAAHGNSLRALVKYLDGMSDDDVVGLNIPTGIPLRYDLDESL
FT                   KPLVAGGSYLDPDAAAAGAAAVAAQGAK"
FT   gene            complement(75291..75800)
FT                   /locus_tag="Mflv_0085"
FT   CDS_pept        complement(75291..75800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0085"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0828 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42581"
FT                   /db_xref="InterPro:IPR019660"
FT                   /db_xref="UniProtKB/TrEMBL:A4T323"
FT                   /protein_id="ABP42581.1"
FT                   /translation="MSTTDDVSDLIERTLKDNDLEYVRHEGAAGGLPGLVVALPGERRL
FT                   KTNTILSVGEHSVRVEAFVCRRPDENHEGVYRFLLKRNRRLYGVAYTLDNVGDIYLVGR
FT                   MALASVTPDEVDRVLGQVLEAVDADFNTLLELGFRTSIQKEWEWRVSRGESLKNLRAFE
FT                   HLISDD"
FT   gene            complement(75797..77125)
FT                   /locus_tag="Mflv_0086"
FT   CDS_pept        complement(75797..77125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0086"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   mva:Mvan_0827 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42582"
FT                   /db_xref="GOA:A4T324"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR017814"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4T324"
FT                   /protein_id="ABP42582.1"
FT                   /translation="MRLATDPAGSSSGLPQPRRVAVLSVHTSPLAQPGTGDAGGMNVYV
FT                   LQTSLELARRGVEVEIFTRATSSADQPIVSVAPGVVVRNVVAGPFEGLDKNDLPTQLCA
FT                   FTAGVLRAEATHEPGYYDILHSHYWLSGQVGWLAADRWAVPLVHTAHTLAAVKNASLAA
FT                   GDTPEPPMRAIGEQQVVDEADRLIVNTEHEAQQLVSLHHADPGRIDVVHPGVDLATFTP
FT                   GDRAAARAALGLDPAARIVAFVGRIQPLKAPDVLLRAAALLPDVHVVIAGGPSGSGMAT
FT                   PDNLVHLAGELGIAERVTFLPPQSRDHLVRVYRAADIVAVPSHNESFGLVAVEAQACGT
FT                   PVVAAAVGGLPVAVRDGVSGALVHSHEPDAWATTLGEVFAADPSTFGRAAVDHAATFSW
FT                   AHTVDALLTGYGRAIADHRADNTLQVAARRSGRRFSMRRGVRA"
FT   gene            complement(77136..78458)
FT                   /locus_tag="Mflv_0087"
FT   CDS_pept        complement(77136..78458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0087"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: mva:Mvan_0826 ROK
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42583"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4T325"
FT                   /protein_id="ABP42583.1"
FT                   /translation="MSTTTLAPRTRTTSAENAAAKRPAAGGRYPQALLHQIVAPSLCLP
FT                   EAAAASVFAAARQRGPIARDVIAQVTGLSIATVNRQVTALLDAGLLRERADLAVSGAIG
FT                   RPRVPVEVNHEPFLTLGIHIGARTTSIVAADLFGRTLDVVETPTPRGPQAVALTAIAGS
FT                   ASRYLSRWHRRRPLWVGVATGGVVDSATGYLDHPRLGWADAPVGPVLAETLGLPVSVAS
FT                   HVDAMAGAELLLGVRRRPGKAATGLYVYARETVGYALSIGGRVHSPTSGPGTIASLPVR
FT                   SELLGGTGQLESTVSDEAVLTAARRAGVVPADGPASTVTAVLRAARQGDEHAVALIAER
FT                   ARVLGEAVALLRDMLNPDDLVVGGQAFTEYPEGMSIVEEAFNERSALGHRDIRLTAFGN
FT                   RVQEAGAGIVSLGGLYADPIAAMRRALARNERLGSASPAAV"
FT   gene            78682..79440
FT                   /locus_tag="Mflv_0088"
FT   CDS_pept        78682..79440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0088"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mva:Mvan_0825 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42584"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4T326"
FT                   /protein_id="ABP42584.1"
FT                   /translation="MTTPSDARRVAVVTGASAGIGEAIARTLAAQGFHVICVARREGPI
FT                   KALAAEIDGTAIVADVTDPTAVAALAGRLDRVDVLVNNAGGARGLESISDADVENWRWM
FT                   WEANVMGTLHVTRALLPKLIDSGDGLIVTITSIAAVEIYDNGGGYTSAKHAQGVLHRTL
FT                   RSELLGKPVRLTEVAPGMVKTDFSLNRFDGDAERAEKVYEGVTPLVAEDIAEVVGFVAS
FT                   RPSHVDLDLIVVRPRDQVSGASGSRFHRQS"
FT   gene            complement(79537..80835)
FT                   /locus_tag="Mflv_0089"
FT   CDS_pept        complement(79537..80835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0089"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   mva:Mvan_0824 ErfK/YbiS/YcfS/YnhG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42585"
FT                   /db_xref="GOA:A4T317"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="InterPro:IPR041280"
FT                   /db_xref="UniProtKB/TrEMBL:A4T317"
FT                   /protein_id="ABP42585.1"
FT                   /translation="MSPADPLPSITRRRALAAFAVGIVAPATLAACMSDGGGTGAENAD
FT                   EAPQAPTVSYEPADGSSDVAPKGAVGVTVENGWFQKVSLVNANTGKVVAGTLDKDRTTF
FT                   TVTESLGYGADYEWSGSVVGEDGKAVPLSGSFTTVAPTTEVNGRFQLADGQTVGVAAPI
FT                   ILQFDAAIADADRAEVEKAVTVTTTPPVEGSWAWLPDEAGGSRMHWRTREYYPAGATVH
FT                   VDADLYGVPFGDGAYGAADSTLDFTVGRFQVVKAEASSHRIQVITDAGVIMDFPCSYGE
FT                   GDLDRNVTRSGIHVVTEKYEDFYMTNPAAGYANVRERFAVRISNNGEFIHANPASLGSQ
FT                   GNSNVTNGCINLSESDAQQYFNTAIYGDPVEVTGTRIQLSYADGDIWDWAVPWDEWTSM
FT                   SALSSADRTDDIPSSAPVTPSGAPQPAGARPGG"
FT   sig_peptide     complement(80701..80835)
FT                   /locus_tag="Mflv_0089"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.992) with cleavage site probability 0.508 at
FT                   residue 45"
FT   gene            complement(80851..81900)
FT                   /locus_tag="Mflv_0090"
FT   CDS_pept        complement(80851..81900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0090"
FT                   /product="UDP-N-acetylmuramate dehydrogenase"
FT                   /EC_number="1.3.1.98"
FT                   /note="KEGG: mva:Mvan_0823
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; TIGRFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; PFAM: FAD
FT                   linked oxidase domain protein;
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42586"
FT                   /db_xref="GOA:A4T318"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4T318"
FT                   /protein_id="ABP42586.1"
FT                   /translation="MGTSLLGGVPVAENVPLAPLTTLRVGPVARRLVTCVTTDQIVDAV
FT                   MAAGPEALILAGGSNVVLAGDAADLTVVRLANTRISVDGDVVRAEAGAGWDDVVAASLA
FT                   HGLGGLECLSGIPGSAGATPVQNVGAYGAEVADTIRRVRLLERGTGSVRWVSPEFLRFG
FT                   YRTSVLKHSSQWVVLEVEFGLDAAGHSAPVRYRELATELAVEQGERTDPQRVRAAVLEL
FT                   RARKGMVLDAADHDTWSVGSFFTNPVVSRAEFERIAATVGSAVPNYPAEDGVKLAAGWL
FT                   VEQAGFGKGYPGADAPARLSTKHALALTNRGTATTADVLALARTVRDGVKAAFGIELTP
FT                   EPVLVGCSL"
FT   gene            81926..82447
FT                   /locus_tag="Mflv_0091"
FT   CDS_pept        81926..82447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0091"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0822 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42587"
FT                   /db_xref="InterPro:IPR019639"
FT                   /db_xref="UniProtKB/TrEMBL:A4T319"
FT                   /protein_id="ABP42587.1"
FT                   /translation="MPRSFDMATEYGGTVEDVHRAFSDEDYWQIRLDDSGADYATLDEL
FT                   TVDDAGGLRIRTTQTLRADRLPGIVSQFHRGDLSLVREEIWTPISNRRSTARVTGSIPG
FT                   APASLTGDAVLSSVADSAGAIASRLAFTATVEVRVPLVGGKIENFIGSQLVELLIAEQR
FT                   FTTVWITENS"
FT   gene            82469..83263
FT                   /locus_tag="Mflv_0092"
FT   CDS_pept        82469..83263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0092"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0821 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42588"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4T320"
FT                   /protein_id="ABP42588.1"
FT                   /translation="MAPLGQVTRGTTGHNRLRRSDRWLVHSSRVRTALQAAADPLVVDL
FT                   GYGAKPVTTLELAIRLREVRRDVRVVGLEIEPERVRAGQSAVRHGAHPGVEFALGGFEL
FT                   ADHRPILVRAFNVLRQYPVEDVEGAWAAMRDRLATGGLIVDGTCDELGRLCCWVLLDAT
FT                   RPVSLTLACDPFAIERPSQLAERLPKVLIHHNVEGQPIHTLLRAADRAWASVAGHGVFG
FT                   PRIRWRAMLDLLVAEGFPIEVPRRSLRDGVLTVPWDAVAPVS"
FT   gene            complement(83256..84773)
FT                   /locus_tag="Mflv_0093"
FT   CDS_pept        complement(83256..84773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0093"
FT                   /product="Na+/solute symporter"
FT                   /note="PFAM: Na+/solute symporter; KEGG: mva:Mvan_0815
FT                   Na+/solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42589"
FT                   /db_xref="GOA:A4T313"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A4T313"
FT                   /protein_id="ABP42589.1"
FT                   /translation="MILLGVAISIAVVVAVGFFVSTRIKGDSSNFLVGGRMLPFWLVGG
FT                   ALMGAAVDTNATLGNTDLAYEFGFWAGACLPLGLALCLLITGIFFAKPMNRMGLTSFPD
FT                   YYRLRFGRSVEIGASILLAVAFCMLVAGNLVAGGLLFNYFLGMPHWLGVVLIAAIAVAY
FT                   TGTGGLIADAYTAIIQMGLILAGAIGLFFWMTTTHGLDIADGTGPFALGQLSDPAQGAV
FT                   INWATLIALGIGDIVAIDFMARVFSAKSPEAARRACFTAAAGTAAICVPFGLVVLAAHS
FT                   FLPAELDGPVLFVLLDQYAPAGLTVLVLCGLMGASMSTANGAILAISNVCVRNLGGVRR
FT                   VHEPGRKDPLLRAARVAMAPMTLFSILFAIYVQQTGILLTLAFDLMLACLIVPFILGLV
FT                   WRRGTTTAALAAIAVGFTVRIGLFVLTPTMFGVENTILYIPNDLVSASFDGWPTFIAFA
FT                   AGLATYVAVALATKPAHMRGLDIQVARDLDDILDDADRFEKEPEPVS"
FT   sig_peptide     complement(84693..84773)
FT                   /locus_tag="Mflv_0093"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.996) with cleavage site probability 0.995 at
FT                   residue 27"
FT   gene            85120..86268
FT                   /locus_tag="Mflv_0094"
FT   CDS_pept        85120..86268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0094"
FT                   /product="agmatinase"
FT                   /EC_number="3.5.3.11"
FT                   /note="PFAM: Arginase/agmatinase/formiminoglutamase; KEGG:
FT                   mva:Mvan_0814 arginase/agmatinase/formiminoglutamase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42590"
FT                   /db_xref="GOA:A4T314"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:A4T314"
FT                   /protein_id="ABP42590.1"
FT                   /translation="MSDYPDPSLPNAEGAWAQQVEANLGDRRLREEIDRGLTYGLEAAP
FT                   TINDRTISTFVRGEKPHFAGERGTFLKCPFIEDVNEVDDAEVAIFGVPLDAGATYRPGT
FT                   RFGPQGIRRSTNLFGTYNYESGVDLREQLNMVDIGDVFTIPGNLEKSFDQISTAMAHVA
FT                   SKGVMPIVLGGDHSIGFPTIRGLAPHMDGNIGIIHFDRHVDTQETDLDERMHTTPWFHA
FT                   TNIKNAPATNLVQIGIGGWQSPREGVKVGRERKSTVITVGDVERVGIEKIAETALEIAW
FT                   KGAKAVYLSFDIDVIDAGFVPGTGWPEPGGLLPREALNLVKMISEPGLAGIEVVECSPP
FT                   YDWAEQTALMSSRVILDSLAAQVRSGKLGKKAAKADRPAWGP"
FT   gene            86282..87121
FT                   /locus_tag="Mflv_0095"
FT   CDS_pept        86282..87121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0095"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: mva:Mvan_0813 nitrilase/cyanide
FT                   hydratase and apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42591"
FT                   /db_xref="GOA:A4T315"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A4T315"
FT                   /protein_id="ABP42591.1"
FT                   /translation="MRSGMRIALAQIQSSTDPAANLTLVEEYTRRAVDAGASLVLFPEA
FT                   TMVRFGVPLGGVAEPFDGPWANAVRDIAARAGIVVVAGMFVPSDDGRSFNTLLATGPGV
FT                   EARYDKIHLYDAFGFLESKTVAPGREPVVISVDTESGPVTVGLTLCYDIRFPELYVELA
FT                   DRGAEIITAHASWGTGPGKLEQWTLLARARAIDTSSVVAAVGQAYPGDEIAALGPTGVG
FT                   GSLVASALGEVLASAGDDPELLVCDVDLEAARKARQTVAVMQNRSGFAHRGKAESRG"
FT   gene            87118..87975
FT                   /locus_tag="Mflv_0096"
FT   CDS_pept        87118..87975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0096"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0812 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42592"
FT                   /db_xref="GOA:A4T316"
FT                   /db_xref="InterPro:IPR021373"
FT                   /db_xref="UniProtKB/TrEMBL:A4T316"
FT                   /protein_id="ABP42592.1"
FT                   /translation="MTDPWARPPQQPGTAPGPFPQDPSQPSAPAPQDDSSLPAKLKRIF
FT                   SDPVSVVLVVVIVLALVFAGLLGTELYARNRADTVVAGTIECVVQDDATASFGVMPPFL
FT                   LQHLSGHYDNIRIETAGNQVRDAKGMKLNIDINDVRLEDSATSSGSIGSLVANISWSTE
FT                   GIRETIQGAIPLVGSFVNAVTTDAGAGTIELEGALGSITAKPVVVNGGLSLQVQQVTGL
FT                   GFTLPREAVQPALDAFTERLTQDYPMDIRADSVEVTDSGVVSQFSTSNASIPKSQQDPC
FT                   FAGL"
FT   gene            complement(87972..88649)
FT                   /locus_tag="Mflv_0097"
FT   CDS_pept        complement(87972..88649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0097"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /note="KEGG: mva:Mvan_0811 deoxyribose-phosphate aldolase;
FT                   TIGRFAM: deoxyribose-phosphate aldolase; PFAM:
FT                   deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42593"
FT                   /db_xref="GOA:A4T309"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/TrEMBL:A4T309"
FT                   /protein_id="ABP42593.1"
FT                   /translation="MGSYTRAQVAALVDHTLLKPEATEADIEAVVAEALALEVKAICVS
FT                   PTFVAAVASLAPAATVASVVGFPSGKHLSSVKAAEAHAAAAAGAAEIDMVIDVGAALAG
FT                   QLDAVRADIAAVRAAAPETVLKVIVESAALLEFGGQPILLDVCRIAEDAGAEFVKTSTG
FT                   FHPSGGASPRAVELMAGAVGGRLGVKASGGIRTAAAATEMLDAGATRLGLSGTRAVLDG
FT                   LRA"
FT   gene            complement(88649..89059)
FT                   /locus_tag="Mflv_0098"
FT   CDS_pept        complement(88649..89059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0098"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0810 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42594"
FT                   /db_xref="InterPro:IPR019719"
FT                   /db_xref="UniProtKB/TrEMBL:A4T310"
FT                   /protein_id="ABP42594.1"
FT                   /translation="MRWMPAALAAVTLPVLLAPAATATPAAPAPPYIDHVTWAKWGDLS
FT                   SLRVYPTPGARRASGHAGTQPLADAAWNEILALAPDAAIPGMRDQFLCHWNLAEFVEPG
FT                   KTSWNLEPWRPEVSYEQMVAKRCNPGGTEEPF"
FT   sig_peptide     complement(88979..89059)
FT                   /locus_tag="Mflv_0098"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.550 at
FT                   residue 27"
FT   gene            complement(89059..89385)
FT                   /locus_tag="Mflv_0099"
FT   CDS_pept        complement(89059..89385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0099"
FT                   /product="conserved membrane protein"
FT                   /note="KEGG: mva:Mvan_0809 conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42595"
FT                   /db_xref="GOA:A4T311"
FT                   /db_xref="InterPro:IPR019662"
FT                   /db_xref="UniProtKB/TrEMBL:A4T311"
FT                   /protein_id="ABP42595.1"
FT                   /translation="MGEGRTGDVTRRLWSVQLQGLVGYVLFALQVAVLVASVYSFVHAA
FT                   MQRPDAYTAADKLTKPVWLVILGVGVLLALVLGITGVAIAAVAAGVYIVDVRPKILEVQ
FT                   GKSR"
FT   gene            complement(89403..90065)
FT                   /locus_tag="Mflv_0100"
FT   CDS_pept        complement(89403..90065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0100"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0808 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42596"
FT                   /db_xref="InterPro:IPR020340"
FT                   /db_xref="UniProtKB/TrEMBL:A4T312"
FT                   /protein_id="ABP42596.1"
FT                   /translation="MAEAKNQLDVDDLKAPLLAAVGAADLALERVNEIVATLRERAGDA
FT                   RTDAETRVEESRARVAKLQEDLPNQFGDLRDRLTSDELRKFAEGYAEAAQTTYTKLIER
FT                   GEAALERLRSQPALEGAASRVEEYTDQAVELTQEALGNVASQTRAVGERAAKLVGVELP
FT                   KKAESAAEPVKKAAEKAPAKKAPAKKATPAAAAKANPTVPAKKAPAKKAPAKKVTQK"
FT   gene            complement(90058..90606)
FT                   /locus_tag="Mflv_0101"
FT   CDS_pept        complement(90058..90606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0101"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   mva:Mvan_0807 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42597"
FT                   /db_xref="GOA:A4T304"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A4T304"
FT                   /protein_id="ABP42597.1"
FT                   /translation="MPPPPQDENLAAVVSNAAQDIGSFIRSQREAAQVSVRQLAEKAGV
FT                   SNPYLSQIERGLRKPSADVLNQIAKALRVSAEVLYIQAGILEPGDTNEVRDAIITDMAI
FT                   NERQKQVLLDIYTSFCQQNEAALAEAAAADEMAKASADSVSDADEEPTTEQGTSALEIS
FT                   RTPQSIAELNLQKEGLHHG"
FT   gene            complement(90700..91986)
FT                   /locus_tag="Mflv_0102"
FT   CDS_pept        complement(90700..91986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0102"
FT                   /product="protein of unknown function DUF445"
FT                   /note="PFAM: protein of unknown function DUF445; KEGG:
FT                   mkm:Mkms_0654 protein of unknown function DUF445"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42598"
FT                   /db_xref="GOA:A4T305"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:A4T305"
FT                   /protein_id="ABP42598.1"
FT                   /translation="MRRSFAEKLAGADSAADAERRRGLRRMKAVALSFLLGATVVFLVC
FT                   SWWQSAGAPGWVGYVRAAAEAGMIGALADWFAVTALFKHPLGIPIPHTAIIKRKKDQLG
FT                   EGLGSFVRENFLSPENVETKLRDADVAGRAGKWLAEPVNAERVAAEASTVLRVLVEMLR
FT                   DEDVQQVLDRMIIKRIAEPQWGPPIGRVLNSLLDEGRQEALLQLLADRAFQWSLDSEEI
FT                   IERVIERDSPQWSPRWVDHLVGDRIHRELVDFTDKVRRNPDHELRRSATRFLFEFAGDL
FT                   QNDAVTIQKAENVKEQIMARDEVARAAETAWSAAKRIILESVDDPSSTLRARIADTVVR
FT                   FGESLRDDVEMRDKVDNWIVRGANHLVSEYGAEITTIITDTIERWDAEEASRRIELHVG
FT                   RDLQFIRINGTVVGSLAGLVIYTVAQLLF"
FT   gene            92134..92838
FT                   /locus_tag="Mflv_0103"
FT   CDS_pept        92134..92838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0103"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mkm:Mkms_0653
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42599"
FT                   /db_xref="GOA:A4T306"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A4T306"
FT                   /protein_id="ABP42599.1"
FT                   /translation="MAQHTSPVAVKTDGRKRRWHQHKVERRNELVDGTLDAIRRLGSNV
FT                   SMDEIAAEIGVSKTVLYRYFVDKNDLTTAVMMRFAQTTLIPNMAAALTSNLDGYELTRE
FT                   VIRVYVETVANEPEPYQFVMANNSASKSKAVADSEAIIARMLAVMLRRRMAAAGMDASG
FT                   AEPWAFHTVGGVQLATHSWMSNPRMTSDDLIDYLTMLSWSALCGIVEVNGSLETFRQNP
FT                   HPSPVLPSSLLD"
FT   gene            92843..93709
FT                   /locus_tag="Mflv_0104"
FT   CDS_pept        92843..93709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0104"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344; KEGG:
FT                   mva:Mvan_0804 protein of unknown function DUF344"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42600"
FT                   /db_xref="GOA:A4T307"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022300"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4T307"
FT                   /protein_id="ABP42600.1"
FT                   /translation="MTEPDDLPSLWSHEPHVELRFRPGDRVADIDADATPGFRGDKSDA
FT                   PTLQAERNVRFAELQEMLYANSRSGDTRSVLLVLQGMDTAGKGGIVKHVVGGCNPQGVQ
FT                   YRSFGKPTAEELAHHYLWRIRKALPSAGHIGVFDRSHYEDVLIVRVHNLVPPEVWEPRY
FT                   DEINAFERELVDGGTTLVKVAMFVSLDEQKKRLAERLERPDKYWKYNPGDIDERLKWPA
FT                   YQEAYQAMLDRTSTDHAPWHIVPCNRKWYSRLAITELMIEALKGLNMAWPPPDFDVAAE
FT                   KKRLASA"
FT   gene            complement(93765..94639)
FT                   /pseudo
FT                   /locus_tag="Mflv_0105"
FT   gene            complement(94703..95557)
FT                   /locus_tag="Mflv_0106"
FT   CDS_pept        complement(94703..95557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0106"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase, NAD-binding;
FT                   KEGG: mva:Mvan_0802 3-hydroxybutyryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42601"
FT                   /db_xref="GOA:A4T308"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4T308"
FT                   /protein_id="ABP42601.1"
FT                   /translation="MSIERVGVVGAGQMGSGIAEVAAKAGANVVVYEPSDALVNAGRER
FT                   ITASLERAKAKGKLAADDFEITLARLTFTTDLADLADRQLVIEAIIEDEAVKAKVFAQL
FT                   DEVVTDPDAVLASNTSSIPIMKIAAATKNPSRVLGLHFFNPVPVLPLVEVINTLVTSEE
FT                   AVARVEQFASEVLGKKVVRCGDRSGFIVNALLVPYLLSAIRMAEAGVATVEDIDTAVVA
FT                   GLSHPMGPLRLSDLIGLDTMKLIADSMYDEYKDPNFAPPPLLQRMVEAGQLGKKSGKGF
FT                   YSY"
FT   gene            complement(95705..96991)
FT                   /locus_tag="Mflv_0107"
FT   CDS_pept        complement(95705..96991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0107"
FT                   /product="isocitrate lyase"
FT                   /EC_number="4.1.3.1"
FT                   /note="TIGRFAM: isocitrate lyase; PFAM: isocitrate lyase
FT                   and phosphorylmutase; KEGG: mva:Mvan_0801 isocitrate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42602"
FT                   /db_xref="GOA:A4T2Z9"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2Z9"
FT                   /protein_id="ABP42602.1"
FT                   /translation="MSTVGMPKSPEQIQHDWDHNPRWKGITRTYTPADVVALQGHVVEE
FT                   HTLARRGAEVLWEQLHDMDFVNSLGALTGNMAVQQVRAGLKAIYLSGWQVAGDANLSGH
FT                   TYPDQSLYPANSVPQVIRRINNALLRADEIAKVEGDTSVENWLAPIVADGEAGFGGALN
FT                   VYELQKAMIAAGVAGSHWEDQLASEKKCGHLGGKVLIPTQQHIRTLTSARLAADVAGVP
FT                   TVVIARTDAEAATLITSDVDERDQPFITGDRTAEGFYRVKNGLEPCIARAKAYAPYSDL
FT                   IWMETGTPDLELAKKFAEGVKSEFPDQMLAYNCSPSFNWKQHLDDATIAKFQKELGAMG
FT                   FKFQFITLAGFHALNYSMFDLAYGYARNQMSAYVELQEREFAAEERGYTATKHQREVGA
FT                   GYFDRIATTVDPTSSTTALAGSTEEGQFH"
FT   gene            complement(97272..98126)
FT                   /locus_tag="Mflv_0108"
FT   CDS_pept        complement(97272..98126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0108"
FT                   /product="acyl-ACP thioesterase"
FT                   /note="PFAM: acyl-ACP thioesterase; KEGG: mva:Mvan_0800
FT                   acyl-ACP thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42603"
FT                   /db_xref="GOA:A4T300"
FT                   /db_xref="InterPro:IPR002864"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A4T300"
FT                   /protein_id="ABP42603.1"
FT                   /translation="MGTSQRVAGSGSVSTAGDGKQGLAKTLMPVPDPHPDVFDTQWPLR
FT                   VADVDREGRLKFDAATRHIQDIGTDQLREMGYEETHPLWIVRRTMIDMVEPIVFKDILR
FT                   LRRWCSGTSNRWCEMRVRIEGRRGGLVESEAFWININRETQGPARISDDFIEGLRRTTD
FT                   ENRLRWKPYLKGGSREDAASVHRYPVRVSDIDIFDHMNNSVYWGVIEEYLNTRPDLMTA
FT                   PLRVTIEHDLPVALGDDLEIIRHEYPAGSTDKFGAELADRGVTTLTYVVGDETKAVAAI
FT                   FPL"
FT   gene            98178..99626
FT                   /locus_tag="Mflv_0109"
FT   CDS_pept        98178..99626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0109"
FT                   /product="protein of unknown function DUF955"
FT                   /note="PFAM: helix-turn-helix domain protein; protein of
FT                   unknown function DUF955; KEGG: mva:Mvan_0799 protein of
FT                   unknown function DUF955"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42604"
FT                   /db_xref="GOA:A4T301"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR018653"
FT                   /db_xref="InterPro:IPR026281"
FT                   /db_xref="UniProtKB/TrEMBL:A4T301"
FT                   /protein_id="ABP42604.1"
FT                   /translation="MAKTFVGARVRQLRSERGFSQAALAQMLEISPSYLNQIEHDVRPL
FT                   TVAVLLRITEVFGVDATFFASQDDTRLIAELREVTMDRDLDVEVDPAEIAEVVASHPSL
FT                   ARAMVNLHRRYQLTTTQLAAATEDRFNTAGLSSAGGGSGSGAISMPHEEVRDYFYQRQN
FT                   YLHELDLAAENLTADMRVHRGELAGDLADRLRFVHGVTIIRRIDLGEVVMHRYDPDTRR
FT                   LEMSAQLSAGQRVFRMAAELAYLECGDLIEKLVAEGHFTSEESRKLARMGLANYFAAAT
FT                   VLPYGQFHEVAEKFRYDVERLSAYYSVSYETICHRLSTLQRPSMRGVPFSFVRVDRAGN
FT                   MSKRQSATGFHFSSSGGTCPLWNVYETFANPGKIGVQIAEMPDGRAYMWVARTVERRAA
FT                   RYGQPGKTFAIGLGCELRHAQRLVYSEGLDLSGDPSVRATPIGAGCRVCERDNCPQRAF
FT                   PALGRALDIDEHRSTVSPYLVRQP"
FT   gene            99623..100162
FT                   /locus_tag="Mflv_0110"
FT   CDS_pept        99623..100162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0110"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   mva:Mvan_0798 carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42605"
FT                   /db_xref="GOA:A4T302"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A4T302"
FT                   /protein_id="ABP42605.1"
FT                   /translation="MSTARIPPGGFKELGPLNWVIAKAGARGIRRPRFSLMNVLGQHRL
FT                   LFLAWLPLSGFLLYAGKLSRRDAEVVILRVGHLRGSEYELQQHRRLARSRGLDKETQAR
FT                   IFAGPDAEGLTDRERVLITATDEFVVTRGISPETWQMLAAHFTKPQLIEFCLLAAQYDG
FT                   LAATISTLQVPLDFPD"
FT   gene            100218..101183
FT                   /locus_tag="Mflv_0111"
FT   CDS_pept        100218..101183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0111"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mva:Mvan_0797
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42606"
FT                   /db_xref="GOA:A4T303"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4T303"
FT                   /protein_id="ABP42606.1"
FT                   /translation="MISNPWRHPPGVPRCEAPRAEGTFFLPDGRRLGYAEFGDPTGDVV
FT                   LWFHGTPGGRRQLPIVGRRAAERLGLRVVLVERAGAGLSSAHRYDRIGDWADDMAHVAD
FT                   ALGADKLGVAGLSGGGPYALACAGMPALRDRVAAVAVLGGVTPSVGPDATASGAITLAR
FT                   QLSAVTSALRRPFAAVTAGLLTPVIPLAHLAYSGLAAVMPDGDKRVFANPEIEAMFIDD
FT                   IVQVANGRFQALLDDARLFGVDWGFRLADVAVPVRWWHGDADSIISLADAQAAAEHLPD
FT                   VDLLLMPDESHLGGFAKADDVLAFLAPHLRHDDEQHRRKV"
FT   gene            complement(101190..102275)
FT                   /locus_tag="Mflv_0112"
FT   CDS_pept        complement(101190..102275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0112"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: mva:Mvan_0796 diguanylate
FT                   cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42607"
FT                   /db_xref="GOA:A4T2Z4"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2Z4"
FT                   /protein_id="ABP42607.1"
FT                   /translation="MVDGTVRTLLRQWWNQRDDYQWRIDFLRTRGLLPVLRYIIAGIGG
FT                   SLGVLSVYNAFVPPGADGVLIRTGWAILAVGSLGWAARWALGSWPTVRESAALVVFVDV
FT                   MMTVSALLFGDPTLAMSGIPILLCAGGYVVFFHGPRLHLVHIAWCTASVVGIAIWLAVS
FT                   DPVFGPQLAVSRAIIALAVTVCVLPALQFGFWLLQDSSMQSLTDPLTELTNRRGLAVSV
FT                   KRLNTDARADATLCALLIDVDRFKSVNDTFGHAVGDDVLIRTARRIRASVPEDAVVVRW
FT                   GGEEFLVVDRIPGNQAETVAERIRAAVAEPAEPTVTVSIGLATCERADIDLIDVISAAD
FT                   AAMYEAKADGGNKVVITAEAA"
FT   gene            complement(102291..102533)
FT                   /locus_tag="Mflv_0113"
FT   CDS_pept        complement(102291..102533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0113"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0795 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42608"
FT                   /db_xref="GOA:A4T2Z5"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2Z5"
FT                   /protein_id="ABP42608.1"
FT                   /translation="MVGHVLWLAGISFAISSTDISTWVLVVAAVSFVVGVSAALLGRRL
FT                   WQRKDEKSEARAAFLWGLSISPVLLSLIVLGVTYL"
FT   gene            complement(102570..103973)
FT                   /locus_tag="Mflv_0114"
FT   CDS_pept        complement(102570..103973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0114"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="TIGRFAM: dihydrolipoamide dehydrogenase; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; glucose-inhibited division protein A;
FT                   pyridine nucleotide-disulphide oxidoreductase dimerisation
FT                   region; HI0933 family protein; KEGG: mva:Mvan_0794
FT                   dihydrolipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42609"
FT                   /db_xref="GOA:A4T2Z6"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2Z6"
FT                   /protein_id="ABP42609.1"
FT                   /translation="MTHYDVVVLGAGPGGYVAAIRAAQLGLSTAIVEPKYWGGVCLNVG
FT                   CIPSKALLRNAELAHVFHKDAKTFGISGDVSFDYGAAFDRSRKVADGRVAGVHFLMKKN
FT                   KITEVHGYGRFTGPNSIEVEPTGDGEEGPVKLEFDNAIIATGSSTRLVPGTSLSENVVT
FT                   YEKQILTRELPGSIIIAGAGAIGMEFAYVLKNYGVDVTIVEFLPRALPNEDAEVSKEIE
FT                   KQYKKLGVKILTGTKVEKIEDDGKQVTVTVSKNDKTEELKADKVMQAIGFAPNVEGFGL
FT                   DKAGVELTDRKAIGIDDYMRTNVPHIYAIGDVTAKLQLAHVAEAMGVVAAETIAGADTL
FT                   PFEDYRMMPRATFCQPQVASFGLTEQQAKDEGYDVVVAKFPFTANGKAHGLGDPTGFVK
FT                   LIADKKHLELLGGHLIGPDVAELLPELTLAQKWDLTANELARNVHTHPTLSEAMQECFH
FT                   GLVGHMINF"
FT   gene            complement(103980..104606)
FT                   /locus_tag="Mflv_0115"
FT   CDS_pept        complement(103980..104606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0115"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cdi:DIP2125 putative ABC transport system,
FT                   ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42610"
FT                   /db_xref="GOA:A4T2Z7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2Z7"
FT                   /protein_id="ABP42610.1"
FT                   /translation="MTGLQATGVGLALGGRTVLHAVDLSAPAGDVTGVTGTSGSGKTTL
FT                   LRVLAGLHQPDTGEIRYDGEPVAPKGSIALLAQHPRLVCNPRWTLGQIIAEPALIRGDR
FT                   FGPDDLHSTAGDVGLDPALLDRYPGQVSDGQLQRACIARVLIQRARFVLCDEPTAMLDP
FT                   ISTASVVTLLRGLASGGAAVVLVSHDAVLVETLTAATLALPSPLG"
FT   gene            complement(104603..105370)
FT                   /locus_tag="Mflv_0116"
FT   CDS_pept        complement(104603..105370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0116"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cdi:DIP2126 putative binding-protein-dependent
FT                   integral membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42611"
FT                   /db_xref="GOA:A4T2Z8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2Z8"
FT                   /protein_id="ABP42611.1"
FT                   /translation="MVSAARLTGLTVGIDLRRGRASAVVDVLDDVHLDIPAGRVTALVG
FT                   ESGCGKSLVAAALSGLLPPGSRVHGTVHVGGRQVRCDDERAWRALRGRHVGSVPQSAAT
FT                   SFTPVRTVGSQLAEICARLRSDRTPEHLCAAMALPAGVVDRYPHELSGGMAQRVAIAAA
FT                   LAGRPGLLIADEPTSALDPDNAAVIWRLLGDAASDGAGVLVITHDMPSLLRAQVCDEVA
FT                   VMARGTVLSQAPLSDALGSPDPYTQALLGTVLV"
FT   gene            complement(105364..106209)
FT                   /locus_tag="Mflv_0117"
FT   CDS_pept        complement(105364..106209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0117"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: cdi:DIP2126 putative
FT                   binding-protein-dependent integral membrane transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42612"
FT                   /db_xref="GOA:A4T2Z0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2Z0"
FT                   /protein_id="ABP42612.1"
FT                   /translation="MSELASESSAMSVLARTSRWPWLVLGAIAVAAVGIPLIAGEQVAD
FT                   FSAALRPPSVEHLVGTDHSGYDLLVRTAEGLRVSLVIAVVCAVAATCLGLAVGVAAALV
FT                   GGWFDAVVMRLVDGFNALPHLVVGIVIAAMWRGAPLAIIASIALTHWPAVARVVRAELL
FT                   AVADAGWVESARLAGASRWFVARTHLVPAVTGQALVAMIVLLPHAVWHESTLSFLGVGL
FT                   SPDRASLGTLLSEARGDVLTGAWWTLAVPAAALIATALAFAAAGTLMRNRHRPPTGQLW
FT                   "
FT   gene            complement(106206..107210)
FT                   /locus_tag="Mflv_0118"
FT   CDS_pept        complement(106206..107210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0118"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: cdi:DIP2127 putative
FT                   binding-protein-dependent integral membrane transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42613"
FT                   /db_xref="GOA:A4T2Z1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2Z1"
FT                   /protein_id="ABP42613.1"
FT                   /translation="MESRGVDTLTPARAAARLLAVRTAVAAPLTVGISAAIFAVASLSP
FT                   FDPLAAYLGGNYQFATQSQRDAMREAYHTDMPWYQAWWQWIGGVARGELGWSSTQSQPV
FT                   TTVLVERMPFTLALSGAALLTATLVAILLGCLAGMHRGGLIDRLCTGFSVTFAAVPPFV
FT                   VSLALVVVVAVGLRWLPASGAAAPGADYTIEGVLRHGILPWIALTVSMIPWLLLTTRAA
FT                   VVESVDSDAVRAARSRGVHGWALLRGHIAPVSVLPTLALLGTRLPELIAGAAIVETVFG
FT                   WPGMAAVLVDSAAALDFPLLAALTVAAAAAVLAGSALSDAAAVAIDPRVRMSA"
FT   gene            complement(107183..108781)
FT                   /locus_tag="Mflv_0119"
FT   CDS_pept        complement(107183..108781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0119"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   5; KEGG: cdi:DIP2128 putative substrate-binding transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42614"
FT                   /db_xref="GOA:A4T2Z2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2Z2"
FT                   /protein_id="ABP42614.1"
FT                   /translation="MCSDRHMNFRVATVLASVLVAVTACSSSSPAEPRDQIVLAEGYEL
FT                   GGFNPVNGYAESGVSPIYDGLYRPSATTDAVIPELVPALAAQEPQPAGPNRWRVPLRPG
FT                   VVFSDGTTFDPVDVVATYDAVRDPRVASEISTSVAPIVSIEADGPDAVVVELDTAADPK
FT                   PYLLLGILPSERVEATPAADWAVNTAPVGTGPYRLDSLRPDQAVLVARDDYWGDAPQVR
FT                   RLVYTYAPDDNARAQSMVSGAVDGTNLPPRLIDSVKGSNDDVQTVAVRSADWRGIALPA
FT                   DNPFTADVTARLAMNVGIDRDALVRDVLVGYGSPAATPVADAYGDAYDPGAQYVFDLDR
FT                   ARNLLDDAGWRPGAGQIREKDGARASFELLYNAQDTLRRDLAVAYAAAMKPLGVDVRPR
FT                   GTSWDEIDTRFADSAVVLGGGATPYSIDSQVYDTLHTRVPDSSPYSNPGNFTAPGLDAL
FT                   LEQAAQSPSGPAKDALYREIQARYAAAPSHVFLVFLHHTYSYRDLGWQQSAPIMEPHSH
FT                   GVSWGPWWNLAAWTR"
FT   sig_peptide     complement(108686..108781)
FT                   /locus_tag="Mflv_0119"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.569 at
FT                   residue 32"
FT   gene            complement(108821..109207)
FT                   /locus_tag="Mflv_0120"
FT   CDS_pept        complement(108821..109207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0120"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0793 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42615"
FT                   /db_xref="GOA:A4T2Z3"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2Z3"
FT                   /protein_id="ABP42615.1"
FT                   /translation="MSEQTILEDPSPSNELPPPHAQPIVVPSAEQSVSRWRFVLVTAGM
FT                   WIAAAAAGAGLYYWWFHGADKSLPVFAVLVFVVACTVGSLLTAMVQERPGLAAMSLALM
FT                   SAPLAAALGAGGLYASYVFGWIST"
FT   gene            complement(109200..109751)
FT                   /locus_tag="Mflv_0121"
FT   CDS_pept        complement(109200..109751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0121"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0792 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42616"
FT                   /db_xref="GOA:A4T2Y4"
FT                   /db_xref="InterPro:IPR031614"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2Y4"
FT                   /protein_id="ABP42616.1"
FT                   /translation="MFLRPDCTLASPVMFSPASAPLIRLALSSESFRRRIEPWPRTGHA
FT                   VAENSRDNRLLAEFPHPLRDRVVTAPWPQARRAVPKVARSSVIVEPVIPLPRASVLAGV
FT                   MIIGVALGMMAALLAAVKVTATVRPDVVIGLVIGVPGVLGMLMILMSSRRWVTAVGAMI
FT                   LAIGPGWFGALTAIQVASGV"
FT   gene            complement(109790..110266)
FT                   /locus_tag="Mflv_0122"
FT   CDS_pept        complement(109790..110266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0122"
FT                   /product="protein of unknown function DUF779"
FT                   /note="PFAM: protein of unknown function DUF779; KEGG:
FT                   mva:Mvan_0791 protein of unknown function DUF779"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42617"
FT                   /db_xref="InterPro:IPR008497"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2Y5"
FT                   /protein_id="ABP42617.1"
FT                   /translation="MAVPHRALITAAAAELLLTLQERHGPLMFHQSGGCCDGSSPMCYP
FT                   AGDFIVGDRDVLLAVLDVGTGVPVWISGPQFDTWKHTQLVIDVVPGRGGGFSLESPEGK
FT                   RFLSRGRAFTEDENRALDDAPPVTGAAYERGERPSPTGSHLVADAVDACAIPQK"
FT   gene            complement(110268..111575)
FT                   /locus_tag="Mflv_0123"
FT   CDS_pept        complement(110268..111575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0123"
FT                   /product="putative GAF sensor protein"
FT                   /note="PFAM: transcriptional regulator domain protein; GAF
FT                   domain protein; KEGG: mva:Mvan_0790 putative GAF sensor
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42618"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2Y6"
FT                   /protein_id="ABP42618.1"
FT                   /translation="MPSNVGSPLVPEPAVAVGEDPRSYARLMSAVYDATMAGDRAPARP
FT                   REVIGDSWRRIMASGIEPDEHAEPVVETGALEMLRRSSGLMEVLDDISHGLGPLVADGE
FT                   NILVVADAKGRVLWRSGSPSVLMNADRLGFVEGANWGERAVGTNAIGTALVSQRAVQVF
FT                   SAEHFLRSHHSWTCAGAPIRDPRTGQVIGVVDVSGPAATVHPTTVALVDAVARLAESHL
FT                   RVEHDRTLNRLRALTAPILARMGSPALVVDTDGWVAAVDAMPLHHRILLPERLGPGRVR
FT                   LATLGMCAVEPLPGGWLVRPAGGEDGEDADEAQPSRATLDVSDPDRPSLVMVGRSGSWR
FT                   HDLSLRHAEILVALALSPQGRSAPQLAEDLYGDRSKVVTVRAEMSRLRKQFAGILATQP
FT                   YRFAGAIELSVRYPADRRMVLPPSNAPVIRAARENG"
FT   gene            complement(111599..112393)
FT                   /locus_tag="Mflv_0124"
FT   CDS_pept        complement(111599..112393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0124"
FT                   /product="acetoin reductase"
FT                   /note="TIGRFAM: acetoin reductases; PFAM: NAD-dependent
FT                   epimerase/dehydratase; short-chain dehydrogenase/reductase
FT                   SDR; KR; KEGG: mva:Mvan_0789 acetoin reductases"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42619"
FT                   /db_xref="GOA:A4T2Y7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014007"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2Y7"
FT                   /protein_id="ABP42619.1"
FT                   /translation="MAINGKVALVTGAARGIGRGIALRLARDGADVALVDVHQDGLDDV
FT                   AAEIAEIGSKTTTFVADVSDRDQVFAAVRHASSALGGFDIMVNNAGIALVGPISEVTPA
FT                   EIQKLWSINVDGVLWGIQAAVAQFTTLHNKEQGKISKIINASSIAGHDGFAMLGPYSAT
FT                   KFAVRALTQAAAKEHAADGITVNAYCPGVVGTDMWVEIDKRFAELTGAAEGETYDKFVG
FT                   GIALGRAETPDDVAGFVSYLAGPDSDYMTGQAGLIDGGLVYR"
FT   gene            complement(112396..113448)
FT                   /locus_tag="Mflv_0125"
FT   CDS_pept        complement(112396..113448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0125"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   mva:Mvan_0788 alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42620"
FT                   /db_xref="GOA:A4T2Y8"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2Y8"
FT                   /protein_id="ABP42620.1"
FT                   /translation="MRAAVYYGPNKLEVDDVPEPEARPGTVKLKVGFNGICGTDLHEYY
FT                   AGPIFVPTAPHPLTGAQLPLTMGHEFSGTITAVGDGVTGWQEGDRVAVEPIYKCDQCGP
FT                   CRAGNYNVCQQIGFHGLMSDGGMAEYTVVPTGMLHRLPDTVSLELGALVEPMSVAYHAA
FT                   TLGEVSAGDTAMVFGAGPIGIGLWFALRGKGLDDVFVVEPSPTRRTAIEALGARTLDPT
FT                   ADDVPAFIADHTGGDGADAVFDAAGVTPAVATALGCVGSRKPMISVAIYEKPLETPLLN
FT                   LVMNESRIQGSLCYTGADFESVIALMADGRYDTTGWVTRIPIDDVVDEGFEALHAGTKM
FT                   KVLVDPNGAQ"
FT   gene            113578..115281
FT                   /locus_tag="Mflv_0126"
FT   CDS_pept        113578..115281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0126"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0787 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42621"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2Y9"
FT                   /protein_id="ABP42621.1"
FT                   /translation="MTSTLDPQTTTELTPQQRVDGWLAAFESALAVRDIERITGMFAVD
FT                   SFWRDLVSFTWNIKTVEGRDQIADMLEARLAETEPSAFRTREPAVLDGTGEDAVVSAFI
FT                   EFQTAAGRGTGHLRLRADDGTDRAWTLLTALQELKGHEERRGPSRVLGAVHGDDPDPRS
FT                   WAEKKAAEDAELGRTIQPYVLVIGGGQGGIALGARLRQLGVPAIVVDKHERPGDQWRKR
FT                   YKSLCLHDPVWYDHLPYLPFPPNWPVFAPKDKIGDWLEFYTRVMEVPYWSKTTCLSATF
FT                   DEAADQWTVEVDRDGERLTLHPTQLVLATGMSGKPRVPTLPGQDVFRGDQHHSSAHPGP
FT                   DAYAGKKAVVIGSNNSAHDICKALCENGVDVTMVQRSSTHIVKSDTLMDIGLGDLYSER
FT                   ALASGMTTEKADLTFASLPYRIMHEFQIPLYDQMRERDKEFYDRLEAAGFELDWGADGS
FT                   GLFMKYLRRGSGYYIDVGACDMVADGRIKLAHGQVARLTEDSVVLADGTVLPADVVVYA
FT                   TGYGSMNGWAADLIGQDVADKVGKVWGLGSDTPKDPGPWEGEQRNMWKPT"
FT   gene            115503..117548
FT                   /locus_tag="Mflv_0127"
FT   CDS_pept        115503..117548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0127"
FT                   /product="Prolyl oligopeptidase"
FT                   /EC_number="3.4.21.26"
FT                   /note="PFAM: peptidase S9, prolyl oligopeptidase active
FT                   site domain protein; peptidase S9A, prolyl oligopeptidase
FT                   domain protein beta-propeller; KEGG: mva:Mvan_0785 prolyl
FT                   oligopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42622"
FT                   /db_xref="GOA:A4T2Y2"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2Y2"
FT                   /protein_id="ABP42622.1"
FT                   /translation="MGEVTDTRPEPTAHAPETDPYLWLEDVTGDDALAWVRAHNEPTVT
FT                   ELGGERFEQMRAEALEVLDTDARIPYVRRRGEYLYNFWRDAANPKGLWRRTTLESYRAE
FT                   NTDWDVIIDVDELARTDGENWVWAGADVLEPTHSVALISLSRGGADAAVVREFDMRTRT
FT                   FVDGGFELAEAKSQVSWEDENTLLIGTDFGAGSLTESGYPRLVKRWRRGQALTDAETLF
FT                   SGAESDVLVAGSRDHTPGFERTLIARAFDFFNEQVYELRGGELIRIDTPTDASISLHRE
FT                   WLLIELRTEWQHLGHTYPAGSLLAADYEEFLAGAAELQVVFTPDAHTCLHHYAWTRDRL
FT                   VVVTLADVASRVEVYTPGEWTSEPVHGLPENTNTVIVAADDLGDEIFLDSSGFDTPSRL
FT                   LYGTGGGELAEIKRAPSFFDAADLEVSQFFATSDDGTEIPYFVVGHRHRQGPGPTLLGG
FT                   YGGFEVSRTPGYDGVMGRLWLSRGGTYVLANIRGGGEYGPTWHTQAMREGRHLVYEDFA
FT                   AVAKDLVARGITTVEQLGAQGGSNGGLLMGVMLTRYPDLFGALVCSVPLLDMKRFHLLL
FT                   AGASWMAEYGNPDDPDDWAFISEYSPYQNISADRRYPPVLITTSTRDDRVHPGHARKMT
FT                   AALEAAGHPVSYYENIEGGHAGASDNPQVAFRSALVYEYLLRTLGG"
FT   gene            117568..118224
FT                   /locus_tag="Mflv_0128"
FT   CDS_pept        117568..118224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0128"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: msm:MSMEG_5514 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42623"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="InterPro:IPR019674"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2Y3"
FT                   /protein_id="ABP42623.1"
FT                   /translation="MQTSPRLRPQHLIVAAAAVLLTACTQDVTGTAVRATGAGPDATGG
FT                   DQNACVSVSAPLDDIPTEDDSEPLLRIPVPDGWERNTMMDNDVIRYSIVSDDLVANGFA
FT                   TNAVVTLESVRGSQDPAEVFDQNRANLETGLGAFDLETIDTTTCGLPAETTYYIAPQMG
FT                   SAPERPVVMHAVVAEDGGYTFLATLTIQTTEPDDPQYLDDAQEIVDGFQMVLPDS"
FT   sig_peptide     117568..117681
FT                   /locus_tag="Mflv_0128"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.997) with cleavage site probability 0.636 at
FT                   residue 38"
FT   gene            118221..118541
FT                   /locus_tag="Mflv_0129"
FT   CDS_pept        118221..118541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0129"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0784 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42624"
FT                   /db_xref="GOA:A4T2X8"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2X8"
FT                   /protein_id="ABP42624.1"
FT                   /translation="MSTLSWVLFGAGVLALILGAAVPGRDTATAPKRAVKRRIYWTGTV
FT                   AGVVLLFCSGLPDVQSAVASAAAAAILMTGSAYFRTPHIKIGDRIYSAYAPHRRPDPPP
FT                   AA"
FT   sig_peptide     118221..118304
FT                   /locus_tag="Mflv_0129"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.982) with cleavage site probability 0.372 at
FT                   residue 28"
FT   gene            complement(118552..119199)
FT                   /locus_tag="Mflv_0130"
FT   CDS_pept        complement(118552..119199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0130"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO2360 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42625"
FT                   /db_xref="GOA:A4T2X9"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2X9"
FT                   /protein_id="ABP42625.1"
FT                   /translation="MSTQGTADIGGLAGWTVDLMERLGGPGAGLAILLENVFPPLPSEV
FT                   ILPMAGFAAKLGRLSVVEAIVWTTVGSVVGAWIIYFLGAWLGHTRMRTLMTKMPLIDDE
FT                   DIDRSAQWFARHGTKGVFFGRMLPFFRSFISVPAGTERMNFVVFTVLTTLGSLIWNCVF
FT                   IGAGYGLGANWHLVEPYASTFQTVVMIGVIALVGWFIAGRVRRRKARAGQES"
FT   gene            complement(119225..120088)
FT                   /locus_tag="Mflv_0131"
FT   CDS_pept        complement(119225..120088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0131"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0773 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42626"
FT                   /db_xref="GOA:A4T2Y0"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2Y0"
FT                   /protein_id="ABP42626.1"
FT                   /translation="MRFLAALLLWLLTTMALAVAIPAVWTQWNVIGEDGYAGLAASAAR
FT                   DSRLQDAMAGELTTQVLALATDNGYSLNPGLAREVADAYTRNDGFPGQFAQANRIAHRW
FT                   MFTGAVPSGNSTDEWLIDVAPMLSDPSFAATLGTLDLQVPPTLTVPITVDTPELQPGKL
FT                   RWLATWGPWAAVGAAAITGVFALLTLAAARSRGKALTALGVSALLVGAAGWTGIEMGRR
FT                   FVEAGLNRTTGDIRTVAEVMVAHAESSMHLWLNYTLLAGVGLVVIGALGAVLGSVLRRP
FT                   SPSVGS"
FT   sig_peptide     complement(120008..120088)
FT                   /locus_tag="Mflv_0131"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.997) with cleavage site probability 0.447 at
FT                   residue 27"
FT   gene            complement(120103..121632)
FT                   /locus_tag="Mflv_0132"
FT   CDS_pept        complement(120103..121632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0132"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: mva:Mvan_0771
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42627"
FT                   /db_xref="GOA:A4T2Y1"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2Y1"
FT                   /protein_id="ABP42627.1"
FT                   /translation="MTATSDAHTANPFTGTGTITNPATGAVAGTVHWTDPADVAQVAAG
FT                   LRTAQREWEARGPKGRAKVLARYALWLGEHRAEIERLLIAETGKSAVDAAQEVPLILMI
FT                   TSYYVRTMEKALAPESRPAALPFLSIKKITVHYRPRPVVGIIAPWNYPVANALMDAIGA
FT                   LAAGCAVLLKPSERTPLTAELLLRGWLEAGGPDVLALAQGARAVSEAVIDNSDFIQFTG
FT                   SSATGAKVMERAARRLTPVSLELGGKDPMIVLEDADVDLAAHAAVWGAMFNAGQTCVSV
FT                   ERVYVLDQVYDQFVDAVVRDVAKLQVGAGEGNAFGALIDDDQVAVTERHVADALAKGAR
FT                   ALTGGTRGAGSGSFYEPTVLVDVDHAMLCMTEETFGPTLPIMRVSTVDEAVRLANDSPY
FT                   GLSAAVFSKDLERAEAVAVQLDCGGVNINDVISNLMCTTAPMGGWKTSGIGARFGGPEG
FT                   LRKYCRIETVVAPRTNVGAGGNYYNNSPRALKRMNTMMTKLALIRPRRVAK"
FT   gene            complement(121642..122205)
FT                   /locus_tag="Mflv_0133"
FT   CDS_pept        complement(121642..122205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0133"
FT                   /product="phosphoesterase, PA-phosphatase related protein"
FT                   /note="KEGG: mva:Mvan_0770 phosphoesterase, PA-phosphatase
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42628"
FT                   /db_xref="GOA:A4T2X4"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2X4"
FT                   /protein_id="ABP42628.1"
FT                   /translation="MRWWPFVGLAALVLLGLAVGKGSTPVDDWFQDLGATHPELGRLLI
FT                   FTDGVVTLTLCAVACGVAAVQRRWRLAVATVATPFLAVMAARLGKRSFGRLKDGEICYP
FT                   SGHTTLAVVVVAMAVIVAGVTVWAVAAAVTAMLLGVVGQAVSYHYFTDAIGALFLGSAF
FT                   VCLAVWLGKLDRCQPQGDSDHNPR"
FT   sig_peptide     complement(122137..122205)
FT                   /locus_tag="Mflv_0133"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.792) with cleavage site probability 0.633 at
FT                   residue 23"
FT   gene            complement(122214..122726)
FT                   /locus_tag="Mflv_0134"
FT   CDS_pept        complement(122214..122726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0134"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0769 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42629"
FT                   /db_xref="InterPro:IPR007061"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2X5"
FT                   /protein_id="ABP42629.1"
FT                   /translation="MADIEAARELLRDSFTRLAEHVDALTEDLTEDVAYFRPAPEANTI
FT                   VWLIWHTGRMQDAQVADIAGVEQVWFRDGWVDRFGLDLPRDAHGYGQTPEEVAKVRAPA
FT                   DLLAGYYRAVHKLSLEYVASVSADELARVVDEKWTPPVTASARLVSIVDDAAQHLGQAA
FT                   YIRGLVR"
FT   gene            complement(122737..123165)
FT                   /locus_tag="Mflv_0135"
FT   CDS_pept        complement(122737..123165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0135"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: mkm:Mkms_0623
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42630"
FT                   /db_xref="GOA:A4T2X6"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2X6"
FT                   /protein_id="ABP42630.1"
FT                   /translation="MYGGTVIDHFGINCADWERSKAFYDKVLGVLGYTRQMDFGVAIGY
FT                   GTDGHPDFWIADMSTGAAAGPNREVHIAFAAKDAESVQAFFRTALALGVEPLHEPRLWP
FT                   EYHENYYGAFVRDPDGNNVEAVFHGGGPSGGPPGPRPA"
FT   gene            123173..124897
FT                   /locus_tag="Mflv_0136"
FT   CDS_pept        123173..124897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0136"
FT                   /product="Amidohydrolase 3"
FT                   /note="PFAM: amidohydrolase; D-aminoacylase domain protein;
FT                   Amidohydrolase 3; KEGG: mva:Mvan_0767 amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42631"
FT                   /db_xref="GOA:A4T2X7"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2X7"
FT                   /protein_id="ABP42631.1"
FT                   /translation="MTYDLVIRGGTVVDGLGGEPFTADVAVTDGIIREVGAVGSAGARE
FT                   IDATGLLVTPGFVDLHTHYDGQAIWSDRLTPSSAHGVTTAVMGNCGVGFAPCRPADHDV
FT                   LVDVMAGVEDIPGVVMVDGLPWQWETFPEFLDAVASRQRDIDVAAFLPHSPLRVYVMGR
FT                   RGVDREPATDEDLEMMRKLAAEAVHAGALGFASSRFTLHKTESGQPIPSYNADYAEIEA
FT                   IARGVQDGGGGLIQFVPDLVAGDYEPVLQTVFDAAADVGLPVTFTLAVGNAGDPFFLDA
FT                   LTMVEKANANGGDITAQIFPRPIGLVLGLELSGNPFVMYPSYREIAALPLAERVAEMRK
FT                   PEVRERILNDTPASDGHPLMFAAQAWNYMFPLTDPPNYEPSPSDSIGARARARGVSPLE
FT                   EAYDRLLDDDGHAMLLVTLANFRDGTLDTVAELIRRDDVVLGLGDGGAHYGMICDASFP
FT                   TYMLTHWVRDRPSGRLTVPEAVRELTSVPARVAGLGDRGRIAVGYKADLNVIDADTLRL
FT                   HRPVIVKDLPGGGRRLDQTADGYVATIVSGEVIAENGEPTDARPGALIRGRRPAPVA"
FT   gene            124894..125451
FT                   /locus_tag="Mflv_0137"
FT   CDS_pept        124894..125451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0137"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   msm:MSMEG_6536 carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42632"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2W9"
FT                   /protein_id="ABP42632.1"
FT                   /translation="MSRVAPLAPPWSEEDADGIGSWGHPDRTYEPLLLVRCLQRHPALA
FT                   AKLRKLGEALYVDTLLPPRVRTIAILRICALLRCAYEWGGQAAFWGPLAGVSDEECDAL
FT                   VTGARADWSADELILIDAVDELERSGSWSEETWMSLGRSLSDEQRMELLIAVGWYRTIC
FT                   TLCNGLDLPVEGWMRPWPASAA"
FT   gene            complement(125440..126261)
FT                   /locus_tag="Mflv_0138"
FT   CDS_pept        complement(125440..126261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0138"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: rha:RHA1_ro01884 probable short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42633"
FT                   /db_xref="GOA:A4T2X0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2X0"
FT                   /protein_id="ABP42633.1"
FT                   /translation="MGLPTPSPTTTAVVTGASSGIGADLARELAARGHGVTLVARREDR
FT                   LRALADELSSSNVRVEVVACDVADADARAGLFPEIERRGLTVDVLVNNAGIGTIGPVVD
FT                   STPEAEIGQVRVNVEAVIDLTTRAVQQMVPRGRGAILNVGSTAGFQPFPGQSGYAATKA
FT                   FVRTYTDGLRGELAGTGVTVTALHPGPVRTEFLDTAGMDERTFASAFPKFLWIESREVA
FT                   EKGIDGLAADRGSVIPGLQNEIPARVFEFLPRRILLPLIRNQHPALRRSRS"
FT   gene            126291..126656
FT                   /locus_tag="Mflv_0139"
FT   CDS_pept        126291..126656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0139"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding; KEGG: mva:Mvan_0766 pyridoxamine 5'-phosphate
FT                   oxidase-related, FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42634"
FT                   /db_xref="GOA:A4T2X1"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR020145"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2X1"
FT                   /protein_id="ABP42634.1"
FT                   /translation="MSITVDLDKLAETLADFAYAYLVTVGDDYRAHTVAVTPVLSGREL
FT                   HIGSVGNSTRRNAAAHPTVTLLWPPREPGGYTLIVDGGAAVNDDGVSVRPTGAVLHRPA
FT                   TPGVPTASGCGDDCLPL"
FT   gene            126739..128058
FT                   /locus_tag="Mflv_0140"
FT   CDS_pept        126739..128058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0140"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: mkm:Mkms_4964 major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42635"
FT                   /db_xref="GOA:A4T2X2"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2X2"
FT                   /protein_id="ABP42635.1"
FT                   /translation="MTLTNAPDDASTRETVTPQARTALWASLVGTTIEWYDFFLYATAA
FT                   SLVFNQAFFPDQSTFVGTMLSFATFAVGFVVRPIGGFVFGHVGDRIGRKKTLALTMLLM
FT                   GGATALMGVLPTAAQIGILAPILLLLLRIVQGFALGGEWAGAVLLAVEHGPARRRGLFG
FT                   SIPQVGLALGLALGTGVFALLQIALPDEAFLTYGWRIAFLFSIVLVVFGVVVRLKASET
FT                   PSFEKVRDSDDRAAVPLREVFRPPVLKSTVLGMLSRWGEGAAFNTWGVFAIAYATGTLG
FT                   LAKVPVLLVVTAAALLMAALLPVSGLLADRYGPKRIYATGIALYAAAVFPVFALFGTED
FT                   IALYALGMILVFGIVHALFYGAQGTLYASLFPARIRYTGLSTVYQLSGVYASGLTPLIL
FT                   TALIGAAGGSPWIACGYLVATAVISVVATLALKPAPLHTL"
FT   gene            complement(128188..129813)
FT                   /locus_tag="Mflv_0141"
FT   CDS_pept        complement(128188..129813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0141"
FT                   /product="chaperonin GroEL"
FT                   /note="TIGRFAM: chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; KEGG: mva:Mvan_0764 chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42636"
FT                   /db_xref="GOA:A4T2X3"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4T2X3"
FT                   /protein_id="ABP42636.1"
FT                   /translation="MAKTIAYDEEARRGLERGLNSLADAVKVTLGPKGRNVVLEKKWGA
FT                   PTITNDGVSIAKEIELEDPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVREGLR
FT                   NVAAGANPLGLKRGIEKAVEAVTQGLLKSAKEVETKEQIAATAAISAGDVQIGELIAEA
FT                   MDKVGNEGVITVEESNTFGLQLELTEGMRFDKGYISGYFVTDAERQEAVLEDPYILLVS
FT                   SKVSTVKDLLPLLEKVIQAGKPLLIIAEDVEGEALSTLVVNKIRGTFKSVAVKAPGFGD
FT                   RRKAMLQDMAILTGGQVVSEEVGLSLETADVALLGTARKVVVTKDETTIVEGAGDSDAI
FT                   AGRVAQIRAEIENSDSDYDREKLQERLAKLAGGVAVIKAGAATEVELKERKHRIEDAVR
FT                   NAKAAVEEGIVAGGGVALLQSAPVLEDLGLSGDEATGANIVRVALSAPLKQIAFNGGLE
FT                   PGVVAEKVSNLPAGHGLNAATGEYEDLLKAGVADPVKVTRSALQNAASIAALFLTTEAV
FT                   VADKPEKAAAPAGDPTGGMGGMDF"
FT   gene            complement(129999..130553)
FT                   /locus_tag="Mflv_0142"
FT   CDS_pept        complement(129999..130553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0142"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mva:Mvan_0763
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42637"
FT                   /db_xref="GOA:A4T2W8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2W8"
FT                   /protein_id="ABP42637.1"
FT                   /translation="MTRPLRADAARNRARVLEVAYDTFAAEGLTVPIDEIARRAGVGAG
FT                   TVYRHFPTKEALVVAVAEDRVRRIAERARTLLAVEGPGQALFVFFRDMVRSAAVDHGLV
FT                   DALMNQGLDLEAVAPGVEAAFLSTLGDLLSAAQGAGTVRPDVDVAVVKALLVVCKVPQV
FT                   FDSEVTERVTRVIEDGLRPLR"
FT   gene            130654..131565
FT                   /locus_tag="Mflv_0143"
FT   CDS_pept        130654..131565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0143"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mva:Mvan_0762 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42638"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2W3"
FT                   /protein_id="ABP42638.1"
FT                   /translation="MTDWTNWNVADIPDQTGRTAVITGANTGLGFETAKALAEKGARVV
FT                   IAVRNTDKGAQAAARIRGDVDVQELDLTSLSSIRTAAEALKARFDKIDLLINNAGVMTT
FT                   PKGTTADGFELQFGTNHLGHFALTGLLFDNILDIPGSRIVTVSSNGHKMGGAIHWDDLQ
FT                   WERSYNRMGAYTQSKLANLLFTYELQRRLAPRGKTIAVAAHPGTSTTELARNLPRPVER
FT                   AFLAAAPVLFAQTADRGALPTLRAAADPGVLGGQYYGPDGLGQQRGAPVVVASSAQSYD
FT                   VDQQRRLWEISEELTKVTFPDL"
FT   gene            131584..132081
FT                   /locus_tag="Mflv_0144"
FT   CDS_pept        131584..132081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0144"
FT                   /product="Cupin 2, conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2, conserved barrel domain protein;
FT                   KEGG: mva:Mvan_0760 cupin 2, conserved barrel domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42639"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2W4"
FT                   /protein_id="ABP42639.1"
FT                   /translation="MSLVVPPYPPPRYTAEQPEVSAWLKRADEPPDYDAFGHVQYHYLA
FT                   GQQDTDGDYGLYRVQIAPRGGGPGPHFHRGMSEAFYVLSGTLSLYNGTEWVDGNAGDFL
FT                   YVPPGGIHGFGNTADEPASILILFAPGAPREHYFEGLAQLGELSDEERREWFDKNDNHF
FT                   VD"
FT   gene            132198..133922
FT                   /locus_tag="Mflv_0145"
FT   CDS_pept        132198..133922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0145"
FT                   /product="type III restriction enzyme, res subunit"
FT                   /note="PFAM: helicase domain protein; type III restriction
FT                   enzyme, res subunit; SMART: DEAD-like helicases-like; KEGG:
FT                   mva:Mvan_0759 type III restriction enzyme, res subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42640"
FT                   /db_xref="GOA:A4T2W5"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2W5"
FT                   /protein_id="ABP42640.1"
FT                   /translation="MRADTAPISDDAGVPAVQALRSWQRRALVKYLTARPRDFLAVATP
FT                   GAGKTTFALRIVSELLAEGTVDAVTIVVPTEHLKIQWAQAAARHGIALDPKFSNSNSQT
FT                   SSEYHGVVVTYAQVASHPSRHRVRTENRKTLVVFDEIHHGGDAKSWGDAIREAFDDATR
FT                   RLALTGTPFRSDDSAIPFVTYETGPDGFQRSQADHTYGYADALADGVVRPVMFMAYSGE
FT                   ARWRDSAGEEHAARLGEPLTAEQTARAWRAALDPKGEWMPAVIAAADKRLQGKRQHVPD
FT                   AGGMIIATDQTAARAYAELLLKITGEAPTVVLSDDKGASDRISQFSAGTSRWLVAVRMV
FT                   SEGVDVPRLSVGVYATSASTPLFFAQAIGRFVRSRRAGETASIFLPSVPNLLLLASEME
FT                   AQRNHVLGKPHRETLEDPLDAELAEQNRDEPGEEENKVEYLGADAELDQVIFDGSSFGT
FT                   ATPAGSDEEADYLGIPGLLDAASMRDLLRRRQDEQMQKRTESGVIPPKTTHGQLRDLRS
FT                   ELNTLVSLAHHRTGRPHGWIHNELRRRCGGPPVAAATREQLQERIEAVRVLQRELTA"
FT   gene            complement(133951..134454)
FT                   /locus_tag="Mflv_0146"
FT   CDS_pept        complement(133951..134454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0146"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0758 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42641"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2W6"
FT                   /protein_id="ABP42641.1"
FT                   /translation="MSSAAMRGPTAMTENMIVTATVDAPVSAVFSVLADPAQHAAIDGT
FT                   GWVREGLDGEFLSRAGQLFRMAMYHDNVPNGHYEMVNKVIAFERDREIGWEPGQAGPDG
FT                   VVGYGGWTWHYTLEPIGPAQTRVTLTYDWSGVPAELREHIEFPPFPDTHLKNSLDNLAT
FT                   LVVG"
FT   gene            complement(134459..135274)
FT                   /locus_tag="Mflv_0147"
FT   CDS_pept        complement(134459..135274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0147"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIA;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   mva:Mvan_0756 HAD-superfamily hydrolase, subfamily IIA"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42642"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2W7"
FT                   /protein_id="ABP42642.1"
FT                   /translation="MAVGGVLFDIDGVLVTSWKPIPGAAETLRTLADNQIACTYLTNTT
FT                   TRTRSQIADLLTEAGMAVRADEVITAAVLTADYVRDRYPDARCFLVNSGQIAEDMPGID
FT                   IVYSSEFTGPRAPERPDVVLLGGAGPEYSHLTLSWVYDWMAQGVPVVAMHRSTAWTTVD
FT                   GLRVDTGMYLIGMEQTSGRKAAAVGKPAPEGFLSAANRLGVDPEEMFIVGDDLNNDVLA
FT                   GQVVGMTGVLVRTGKFRQDTLDRWAADEFAMQPNHVIDSIADLPALLGL"
FT   gene            135364..136137
FT                   /locus_tag="Mflv_0148"
FT   CDS_pept        135364..136137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0148"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein, MerR; TipAS
FT                   antibiotic-recognition domain protein; KEGG: mva:Mvan_1919
FT                   putative transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42643"
FT                   /db_xref="GOA:A4T2V9"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="InterPro:IPR036244"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2V9"
FT                   /protein_id="ABP42643.1"
FT                   /translation="MTQETRMEELTVGEVAKRFGITIRTLHHYDHIGLLTPEQRNASGY
FT                   RVYTSADLTRLSQIIVYRRLEMSLDEIASVLDEGDEISHLRRQRERVMSRLDELTELVG
FT                   AIDQALENAMTNTPMTDDDMRELFGDSFDDYQAEAEQKWGETAEWKESQRRATSYGKDD
FT                   WVRIKAEGQAVEKALADAFRAGLPADSEEAMNAAEQHRHHVNRWFYDCPPAFHRTLGDM
FT                   YVSDPRYVATYDESFGLPGLARYCRDAIHANADRS"
FT   gene            complement(136134..137585)
FT                   /locus_tag="Mflv_0149"
FT   CDS_pept        complement(136134..137585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0149"
FT                   /product="membrane-flanked domain"
FT                   /note="PFAM: membrane-flanked domain; KEGG: mva:Mvan_0755
FT                   membrane-flanked domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42644"
FT                   /db_xref="GOA:A4T2W0"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="InterPro:IPR014529"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2W0"
FT                   /protein_id="ABP42644.1"
FT                   /translation="MTPQADWLRLSPRMLVVHPVHEVVRQIPVLIGSLVVGSATGNPLW
FT                   AVVGVVLIVGYGLARWFTTTYRIGADEVQLRTGVLQRTVLSVPRNRIRSVSTDARLLHR
FT                   LLGLTVLKVSTGQEATGDGVFELDAVPAAEVGRLRAVLLAESLAAPDVARAGGRELARW
FT                   QPSWLRYSPLTFTGLITIVAALGVISQTGVLGALQDSQIVRAGEQATDRVGVAVAVALG
FT                   AGAVLVASVVLSVTQSLISYGNLVLRRDAEVLHLSHGLLRVRERTFDMRRLRGGTLREP
FT                   LLVRLFGGARLDAVMTGVTGAGEASQLLPPCPRATAESVLIDLIEQPAAVTGPLTGHGR
FT                   AAMRRRWTRAMTVPVLLAAALLVWAVFDAVPPWAWAAPAATAVAGALLAADRVRALGHR
FT                   IGDGWLVARAGSLQRRRDCIAAAGIVGWTVRQTLFQRRAGVATLIAATAAGVKRYELID
FT                   VPADAAWAIAGATSPWLAATGWARR"
FT   gene            complement(137582..138064)
FT                   /locus_tag="Mflv_0150"
FT   CDS_pept        complement(137582..138064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0150"
FT                   /product="membrane-flanked domain"
FT                   /note="PFAM: membrane-flanked domain; KEGG: mva:Mvan_0754
FT                   membrane-flanked domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42645"
FT                   /db_xref="GOA:A4T2W1"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2W1"
FT                   /protein_id="ABP42645.1"
FT                   /translation="MHLADPAHPPSRKAPLVWALGAAAPWSIAIVAQVLWFLFDGRLPW
FT                   LHILAALGTVVGVTVSVVVAPLWRYRVHRWEVDPTAVYTRSGWLVQERRIAPISRVQTV
FT                   DTYRGPLDRLFGLANVTVTTASSAGAVRIVALDLDVADRVVAQLTDIAALGQEDAT"
FT   gene            138131..139048
FT                   /locus_tag="Mflv_0151"
FT   CDS_pept        138131..139048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0151"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mva:Mvan_0753 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42646"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2W2"
FT                   /protein_id="ABP42646.1"
FT                   /translation="MTSKWTAADVPDQSGRVAVVTGANTGIGYETAEVLAGKGARVVIA
FT                   VRDAGKGQKALDAITRKHPGAAVSLQELDLSSLGSVRRATDALRSAHPRIDLLINNAGV
FT                   MYPPKQVTRDGFELQFGTNHLGHFAFTGLLLDNLLDVPGSRVVTVASLAHKNLADIHFD
FT                   DLQWERKYNRVAAYGQSKLANLMFTYELQRRLAARGAPTIAVAAHPGISNTELMRHVPG
FT                   TSLPGVMKLAGLVTNTPAVGALPTVRAATDPGVTGGQYYGPSGFNEMVGHPVLVTSNKK
FT                   SHDVAVQQRLWTVSEELTGVKYGV"
FT   gene            139048..140268
FT                   /locus_tag="Mflv_0152"
FT   CDS_pept        139048..140268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0152"
FT                   /product="molybdopterin molybdochelatase"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain; PFAM:
FT                   molybdopterin binding domain; MoeA domain protein, domain I
FT                   and II; MoeA domain protein, domain IV; KEGG: mva:Mvan_0752
FT                   molybdenum cofactor synthesis domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42647"
FT                   /db_xref="GOA:A4T2V5"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2V5"
FT                   /protein_id="ABP42647.1"
FT                   /translation="MRARSDMRSVDEHRRVVADLITPRPALTVPLADALGLALAADVVA
FT                   PLSLPGFDNSAMDGYAVLAGDIAAATDSTPVELPVAEDIPAGRTDIPTLTPGTAHRIMT
FT                   GAPLPFGADTVVPVESTDAGVHTVTIREAKPVGRHIRRAGEDVTEGTTVLHAGQVVTPA
FT                   ALGLAAALGLSELSVIPRQRVLVVSTGTELVTAGTPLQPGQIYESNGAMLAAAVRDAGG
FT                   EVVASPMTGDDVEAFTATLRAHAGDADLIVTTGGVSAGAYEVVKDALGPGERVEFVKVA
FT                   MQPGMPQGAGTWEGGTPIVTLPGNPVSALVSFEVFLRPALRAAMGLTDTQRPRRTAMLT
FT                   EDLTSPRGKRQFRRGVFDPVTDTVTGYGPPASHHLRWLASANCLLELDEDTAEVAAGSR
FT                   VQVWDLR"
FT   gene            140281..140979
FT                   /locus_tag="Mflv_0153"
FT   CDS_pept        140281..140979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0153"
FT                   /product="phosphatidylserine decarboxylase related protein"
FT                   /EC_number="4.1.1.65"
FT                   /note="KEGG: mva:Mvan_0751 phosphatidylserine decarboxylase
FT                   related protein; TIGRFAM: phosphatidylserine decarboxylase
FT                   related protein; PFAM: phosphatidylserine
FT                   decarboxylase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42648"
FT                   /db_xref="GOA:A4T2V6"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4T2V6"
FT                   /protein_id="ABP42648.1"
FT                   /translation="MARRPDLKTGPERLAALVRTTVPPMHPAGLPFVGASLAVALAGRK
FT                   SRWLRNAGVASAAANAAFFRHPPRTPPTRPGVVVAPADGLICLIEDELPPAELELPAVP
FT                   LPRISIFLSLFDAHVQRAPLAGEVVAVEHRPGLFGSAELAAASADNERNSVVIRSPEGA
FT                   EVIAVQIAGLLARRIVCNVKSGDKVGLGDTYGLIRYGSRLDTYLPAGSDVLVEVGQRAV
FT                   AGETVLAELP"
FT   gene            140979..141845
FT                   /locus_tag="Mflv_0154"
FT   CDS_pept        140979..141845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0154"
FT                   /product="CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase"
FT                   /EC_number="2.7.8.8"
FT                   /note="KEGG: mva:Mvan_0750 CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase; TIGRFAM:
FT                   CDP-diacylglycerol--serine O-phosphatidyltransferase; PFAM:
FT                   CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42649"
FT                   /db_xref="GOA:A4T2V7"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2V7"
FT                   /protein_id="ABP42649.1"
FT                   /translation="MRPRIKTPVVSVRILPSAMTVAAICLGLSAVKFALDGRPTEAMAF
FT                   LAIAAILDALDGRLARALNATSKMGEEIDSLADAVNFGVAPAFIVYGTLLSTSRIGWIV
FT                   VLLYAVCIVLRLARFNAMLAVDQPAYEKKYFTGMPAPAGAIGAIGPLAAKMQFGDGWWT
FT                   SEPAVVIWMIAVSLLVVSTLPMRKIHTFSVPPNMVAPLLALLAIGVAASILYGYIVILV
FT                   IIVAYFLHIPFALRTKRFLAAHPEVWDDKPRQQRAARRAIRRTHRTQRAQPRRSTLRLG
FT                   LRRPPRG"
FT   sig_peptide     140979..141113
FT                   /locus_tag="Mflv_0154"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.977) with cleavage site probability 0.731 at
FT                   residue 45"
FT   gene            141847..144036
FT                   /locus_tag="Mflv_0155"
FT   CDS_pept        141847..144036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0155"
FT                   /product="Vesicle-fusing ATPase"
FT                   /EC_number="3.6.4.6"
FT                   /note="KEGG: mva:Mvan_0749 vesicle-fusing ATPase; PFAM: AAA
FT                   ATPase, central domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42650"
FT                   /db_xref="GOA:A4T2V8"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2V8"
FT                   /protein_id="ABP42650.1"
FT                   /translation="MAQLTLTARLNTSALDSRRGVVRLHPEAIAALGIREWDAVSLTGA
FT                   RTTAAVVGIAPAGTPTGTALLDDVTLSNAGLREDTSVLVSDVTVYGARSVTLSGSRLAS
FT                   RSITPATLRQALLGKVMTVGDTVSLLPRDLGPGTSTSTASAALASSVGITWTSELLTVT
FT                   AADPIGPVSVQPNSLVCWASGASEASGTSEAANGTSEVSGAPVRTEQPRTQAVGFDDLK
FT                   GAHAQAGRLTEWLKLALDQPELLEKLGATANLGVLVSGPAGVGKATLVRTVCAERRLIE
FT                   LDGPEVGSLRADDRLAAVSSAAASARDGGGVLLVTDIDALLPVPPDPVATLILTELRSA
FT                   VAGGVVFVATSAVPDNVDPRLRAPDLCDRELGLSLPDGAVRKQLLEVLLRDVPSANLEI
FT                   GEITDRTPGFVVADLAALVREAALRAAARASENGEPPALRQEDLVGALGVIRPLSRSAT
FT                   EEVSVGAVTLDDVGDMAETKQALTEAVLWPLQHPETFQRLGVEPPRGVLLYGPPGCGKT
FT                   FVVRALASSGRLSVHAVKGAELMDKWVGSSEKAVRELFQRARDSAPSLVFLDEIDALAP
FT                   RRGQSFDSGVTDRVVAAMLTELDGIEPLRDVVVLGATNRPDLIDPALLRPGRLEKLVFV
FT                   EPPDAEARTQILRTAGKSVPLAADVDLEVLAADLDGYSAADCVALLREAALTAMRRSID
FT                   AADVTADDVARARETVRPSLDPAQVESLRQFADTR"
FT   gene            144080..144499
FT                   /locus_tag="Mflv_0156"
FT   CDS_pept        144080..144499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0156"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: msm:MSMEG_0722 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42651"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2V2"
FT                   /protein_id="ABP42651.1"
FT                   /translation="MPLIDPGDDWEDAGSDLDALVAPEEDPGPEIPVVQVTNPSGTITI
FT                   TANLDGSIARVALTPAVTRWTESELAAAITELAEVAAKRATAVMHVTVVEMFVAQGVDR
FT                   TEAREFVSSNMPFATPAQADAALEELSARYAHEGR"
FT   gene            144544..145605
FT                   /locus_tag="Mflv_0157"
FT   CDS_pept        144544..145605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0157"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: msm:MSMEG_0078 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42652"
FT                   /db_xref="GOA:A4T2V3"
FT                   /db_xref="InterPro:IPR022536"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2V3"
FT                   /protein_id="ABP42652.1"
FT                   /translation="MALGKLWVDANYFYGVADHANMMSSDPALGSAAIATDAAILMQSL
FT                   AAVGGSTMGATGLATSVATPIINAGLMTLTAASNTLGFGRPEDGERFTDGARQFSEAND
FT                   ELQQAVPPPDWQGDASDAYGLRNTEQQQRAGSMATFDGQIQEVLAEEAGQVQDTRDFVS
FT                   TRQVMLAAAIPAAITAKLIPPGGAAAAMAIELAAVAATVPFAMQRVTEMVSHSADNADR
FT                   IRQIGSHYGVVDESAQMPGGLSGAQSGTPAPLRVSESIRGTAGIQQNVAATIDSARSAP
FT                   DGSAGDVFKTHGVVCTSTAAALKSAELARRSAAEKMHLISTDLSAKLGSSATEYSHTEQ
FT                   QNADAVDRQMPPR"
FT   gene            145610..146362
FT                   /locus_tag="Mflv_0158"
FT   CDS_pept        145610..146362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0158"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: msm:MSMEG_0079 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42653"
FT                   /db_xref="GOA:A4T2V4"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2V4"
FT                   /protein_id="ABP42653.1"
FT                   /translation="MNKVLRRTGIAVTLVVVAMCWGWAYFAAREGYWATVAIALVASVT
FT                   WPVSIRVVLASTSTSPQVEFTPEGTVLKPDARIDTAVRRMTGTGAALCWAALVVSVPYG
FT                   NLYIPIFSTFPESFVIIPLACLGAAVGLTWWWWGYRRRGISYVQLTPEGFRFPALVGTH
FT                   HGRWDDVVGIGTEARDGHTRFWPPMVLTMRDESRCVLESPGIYTPEGTALIELVRHYWQ
FT                   HPQERVELTTGRAVDRLHALRQFYLDSD"
FT   sig_peptide     145610..145684
FT                   /locus_tag="Mflv_0158"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.881) with cleavage site probability 0.717 at
FT                   residue 25"
FT   gene            146410..146856
FT                   /locus_tag="Mflv_0159"
FT   CDS_pept        146410..146856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0159"
FT                   /product="protein of unknown function DUF1707"
FT                   /note="PFAM: protein of unknown function DUF1707; KEGG:
FT                   mva:Mvan_0748 protein of unknown function DUF1707"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42654"
FT                   /db_xref="GOA:A4T2U9"
FT                   /db_xref="InterPro:IPR012551"
FT                   /db_xref="InterPro:IPR025698"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2U9"
FT                   /protein_id="ABP42654.1"
FT                   /translation="MTSPTLRTGDREREATADVLGQALAQGYLDMTEYESRLLAVYDAY
FT                   TTPDLRQLTADLPVADLRRNDPRRQAARTAAARRGIHVHLAGYAAMVVIVLTVWLAVGL
FT                   GSGGWYFWPVWPILGAGIGVLVHALPIRLAMPPCPGFTGHRSHH"
FT   gene            complement(146853..148349)
FT                   /locus_tag="Mflv_0160"
FT   CDS_pept        complement(146853..148349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0160"
FT                   /product="potassium/proton antiporter, CPA1 family"
FT                   /note="PFAM: TrkA-C domain protein; sodium/hydrogen
FT                   exchanger; KEGG: mva:Mvan_0746 sodium/hydrogen exchanger;
FT                   TC 2.A.36"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42655"
FT                   /db_xref="GOA:A4T2V0"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR030151"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2V0"
FT                   /protein_id="ABP42655.1"
FT                   /translation="MTLHQLYVALFLGGLVLLASIAATRLATGVGLPSLLLFLGVGVLV
FT                   GEGGLGLQFDNAQLGQDLGTAALAVILVEGGLTTRFSDIRKVLAPAAVLATLGVAVSTL
FT                   VTAAAVHWLLGMNWQLALLLGAVISSTDAAAVFSVLRVVPLPRRLSGLLEAESGFNDAP
FT                   AVILVMLFSVVPMELNAVDIVGTLVYELGIGTVLGLGFGVLGAMTLRRIALPAAGLYPL
FT                   ATFGLGMLAFAAAGTAHGSGFLAAYLASVVLANSGLPHRSATRSFAEGAGWLAQIGVFV
FT                   ILGLLVSPDQLLDEVVPAIVAGLALLLLARPISVFLSLIGFRVPWREKMFLSWAGLRGA
FT                   VPIVLCTYPIVAGVPDSWRLLHIVFILVVLYTAIQGPSLRRVAEWLNLIPRDTTREIQV
FT                   DAAPLDVLGAELLTMTVLPGSRLHNVTVLELRLPDPSVITLIIRDGQSFVPQPVTRLQI
FT                   GDELLIVTTSVTRDQAERRLRAVSRRGKLAYWFDEYGDPA"
FT   sig_peptide     complement(148266..148349)
FT                   /locus_tag="Mflv_0160"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.969) with cleavage site probability 0.398 at
FT                   residue 28"
FT   gene            148380..149075
FT                   /locus_tag="Mflv_0161"
FT   CDS_pept        148380..149075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0161"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   KEGG: mva:Mvan_0745 TrkA-N domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42656"
FT                   /db_xref="GOA:A4T2V1"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2V1"
FT                   /protein_id="ABP42656.1"
FT                   /translation="MRIAVAGAGAVGRSVAQELVGYGHKVLLIEKEFDRYQPATVPGAE
FT                   WLWADACEIASLEEAEMQICDVAIAATGDDKANLAMALLAKTEFGIDRVVARINDARNE
FT                   WLFTEAWGIDVAVSTPLALVAAVEGAIDVGHLVRLMALGRDSRGDLGQKATNVAKFTLP
FT                   DGGPLVGRRVRDLEMPTDSALVTLMRGIHLIVPGPDEALRAGDELLFVFASGVEERIRA
FT                   MVQGTRRLE"
FT   gene            149164..152070
FT                   /locus_tag="Mflv_0162"
FT   CDS_pept        149164..152070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0162"
FT                   /product="multisubunit sodium/proton antiporter, MrpB
FT                   subunit / multisubunit sodium/proton antiporter, MrpA
FT                   subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   Na+/H+ antiporter MnhB subunit-related protein; KEGG:
FT                   mva:Mvan_0744 NADH dehydrogenase (quinone); TC 2.A.63.1; TC
FT                   2.A.63.1"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42657"
FT                   /db_xref="GOA:A4T2U5"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR007182"
FT                   /db_xref="InterPro:IPR025383"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2U5"
FT                   /protein_id="ABP42657.1"
FT                   /translation="MLAILAAHAAAALLAPLLVYRWGRLAFYPLALVPLGSLVWVVLNW
FT                   PAKGQSRNVDVPWVPGLSMDITLRFDALAAIMSVLVLAIGALVLFYCADYFRHHDGRIE
FT                   KRLPSFAAELVAFSGAMFGLVTSDNMLVLYVFWEITTVLSFLLVGHYAERATTRRAAMQ
FT                   ALLVTTFGGLAMLVGIVVIGNIADTFLLSELIANPPTGVAASVALVLILVGALSKSAIV
FT                   PLHFWLPGAMAAPTPVSAYLHAAAMVKAGVYLIARMTPGFADSPEWRPTVVGLGLLTML
FT                   LAGWRAIREYDLKLILAFGTVSQLGFITIMVGVGGSEMMLAGLAMLCAHAMFKAALFMV
FT                   VGIIDHATGTRDIRRLAWLGDRSKPLLIIGCAAAASMAALPPFFGFIAKEADFETVLHS
FT                   PYLGAASPFVLAGIVLGSVLTTVYSLRFVFGAFGRKGLPHPSTRVEEMHRPELGFLIPP
FT                   AILAAAGLVFGLWPKPLDTVLSNYSDTVPDPQGYDGDYYLALWHGVNLPLILSALVLLA
FT                   GVAVCVGRGRLRRARLPYVPLGNADRTYDAVIRGADILSVRLTALTQRGSLPQTQSFIL
FT                   ITLVLLPLGVLAFGARDRPEFALWDSPPQVIVGLLMVAAAIAAVVMRNRLAAVLMVGVT
FT                   GYGCGAIFAFHGAPDLALTQFLVETLTLVAFVLVLRTLPAETSREENTRYRLPRAALAL
FT                   AVGAAVTTLAAYAMAARTGRPIADLLPEAAYVLGHGSNTVNVLLVDIRAWDTMGEISVL
FT                   LVAATGVASMVFRSRRFGAAPRVSDAGQPDIGLLPSSYNISPAAGEITWLRGSELRDPR
FT                   HRSLVLEVATRLIFPVMMVLSAYFFFAGHNVPGGGFAGGLMAGLALVLRYLAGGRYELG
FT                   ETLPLDAGKILGAGLALSAGTAVASLLLGAPALSSAVIEFDVPVLGSVKFVTALFFDLG
FT                   VYLIVVGLVLDVLRSLGARIDVELSEQRRQTDRTVRQR"
FT   gene            152067..152534
FT                   /locus_tag="Mflv_0163"
FT   CDS_pept        152067..152534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0163"
FT                   /product="multisubunit sodium/proton antiporter, MrpC
FT                   subunit"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase, chain 4L;
FT                   KEGG: mva:Mvan_0743 NADH-ubiquinone oxidoreductase, chain
FT                   4L; TC 2.A.63.1"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42658"
FT                   /db_xref="GOA:A4T2U6"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2U6"
FT                   /protein_id="ABP42658.1"
FT                   /translation="MTTFLIPLILIGVLASAGVYLLLERNLTRMLLGLLLISNAINLLI
FT                   LNAGGPSGNPPVRGRTSGTETATADPLAQAMILTAIVITMGVAAFVLALTYRSYRINTI
FT                   EEVSNDPEDIRVSQLSGKEDDDIEERLMPDASRDTDLPDELDALPGYEGSR"
FT   gene            152531..154147
FT                   /locus_tag="Mflv_0164"
FT   CDS_pept        152531..154147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0164"
FT                   /product="multisubunit sodium/proton antiporter, MrpD
FT                   subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   KEGG: mva:Mvan_0742 NADH dehydrogenase (quinone); TC
FT                   2.A.63.1"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42659"
FT                   /db_xref="GOA:A4T2U7"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2U7"
FT                   /protein_id="ABP42659.1"
FT                   /translation="MIGAHLASVLTPLPVLIPMLGAAATLIAGRRPRLQRAIVVSGLSA
FT                   VVAVSAALLYLADRDGTIALQVGGWGPTEDGLGPLGVTLVVDRLSALMLVVSSIVLLAV
FT                   VFYAIGQGIRDGDERQPVSIFLPTYLVLSAGVFMAFLAGDLFNLFVGFEVLLTASFVLL
FT                   TIGASKERVRAGISYVMVSMVSSLVFLFGIALVYATTGTLNLAEIAVRLDDVPEGTRMA
FT                   LFAVLLVAFGIKAAVFPLSAWLPDSYPTAPAPVTAVFAGLLTKVGVYAIIRAHSLLFPG
FT                   GGMDRILLVAGLLTMVIGIFGAIAQSDIKRLLSFTLVSHIGYMVFGIALSTQLGMAGAI
FT                   YYVAHHILVQTTLFLVVGLIERQAGASTLERLGGLAAASPLLAFVFVVPALNLGGIPPF
FT                   SGFIGKVALLEAGAESGSVLAWILVAGSVITSLLTLYVVARVWTKAFWRARKDAPEGHL
FT                   SGPAPTALLDNTDETMDIEHSDRDDVGRMPVGMLAPTGALIVVGLALTVLAGPIIAYSD
FT                   RAAAEVLDRSQYIGAVLGGQP"
FT   sig_peptide     152531..152602
FT                   /locus_tag="Mflv_0164"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.660) with cleavage site probability 0.351 at
FT                   residue 24"
FT   gene            154144..154683
FT                   /locus_tag="Mflv_0165"
FT   CDS_pept        154144..154683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0165"
FT                   /product="multisubunit sodium/proton antiporter, MrpE
FT                   subunit"
FT                   /note="KEGG: mva:Mvan_0741 cation antiporter; TC 2.A.63.1"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42660"
FT                   /db_xref="GOA:A4T2U8"
FT                   /db_xref="InterPro:IPR002758"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2U8"
FT                   /protein_id="ABP42660.1"
FT                   /translation="MRQPILRVWIVCWLVLVWVLLWGNISAANILSGLAVALVITLLLP
FT                   LPPVPVEGRFHPLSVLRLIATVAGWLVVSSFQVAALAVKPGPPPLTAVLRAHLHLKSDL
FT                   VLALAVNILNLTPGNIVLEIDQSRRMIYVHVLDVGSERTVNRFYHQIDKLQKLLVASFE
FT                   RETDWRPSEDKEVDPA"
FT   sig_peptide     154144..154230
FT                   /locus_tag="Mflv_0165"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.950) with cleavage site probability 0.692 at
FT                   residue 29"
FT   gene            154680..154967
FT                   /locus_tag="Mflv_0166"
FT   CDS_pept        154680..154967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0166"
FT                   /product="multisubunit sodium/proton antiporter, MrpF
FT                   subunit"
FT                   /note="PFAM: multiple resistance and pH regulation protein
FT                   F; KEGG: mva:Mvan_0740 multiple resistance and pH
FT                   regulation protein F; TC 2.A.63.1"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42661"
FT                   /db_xref="GOA:A4T2U1"
FT                   /db_xref="InterPro:IPR007208"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2U1"
FT                   /protein_id="ABP42661.1"
FT                   /translation="MMYVWIAAGAMLSLAALVTMFRMLLGPTTLDRLVALDTLVAVTMC
FT                   AIGTWAAFSLDTTVTYSLTALALITFVGSVSVARFRVPDVADPADKGTAR"
FT   gene            154964..155344
FT                   /locus_tag="Mflv_0167"
FT   CDS_pept        154964..155344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0167"
FT                   /product="multisubunit sodium/proton antiporter, MrpG
FT                   subunit"
FT                   /note="TIGRFAM: monovalent cation/proton antiporter,
FT                   MnhG/PhaG subunit; PFAM: Na+/H+ antiporter subunit; KEGG:
FT                   mva:Mvan_0739 monovalent cation/proton antiporter,
FT                   MnhG/PhaG subunit; TC 2.A.63.1"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42662"
FT                   /db_xref="GOA:A4T2U2"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2U2"
FT                   /protein_id="ABP42662.1"
FT                   /translation="MTVSDIIASVLILGGSALALTAAIGVVRFPDTLSRMHAATKPQVL
FT                   GLLLVLAGAAIRLRGNLDVGMLILTGMFTIITAPVIANRVGQLAYREQNIRDDLLTRDE
FT                   MHEFAAERESGGHDDSGQSRRT"
FT   sig_peptide     154964..155035
FT                   /locus_tag="Mflv_0167"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.677) with cleavage site probability 0.388 at
FT                   residue 24"
FT   gene            155313..156053
FT                   /locus_tag="Mflv_0168"
FT   CDS_pept        155313..156053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0168"
FT                   /product="putative methyltransferase"
FT                   /note="TIGRFAM: putative methyltransferase; PFAM:
FT                   O-methyltransferase domain protein; KEGG: mva:Mvan_0738
FT                   putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42663"
FT                   /db_xref="GOA:A4T2U3"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4T2U3"
FT                   /protein_id="ABP42663.1"
FT                   /translation="MTILDSPGAPDTGIDALALGTAVARVRETSSDQPLFTDRYSQMLV
FT                   DAAGPMEPDQAALAVPGYVAARTKWFDDFFLAASAAGLAQIVLLSPGLDTRAWRLPWLN
FT                   DTVIFEVDRPRTLAFKQQTLTRAGVTPTATYVPVPVDLGDDWPRALTAAGFSHGEPTAW
FT                   AAEGLYADLPEAEQDNLLERIDLYSARGSRIAMDVDADGPDVVCWLCARHWEMGSTDAP
FT                   DVMARYHRDAAGAPSGVFVEGRKL"
FT   gene            156102..156392
FT                   /locus_tag="Mflv_0169"
FT   CDS_pept        156102..156392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0169"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: msm:MSMEG_0842 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42664"
FT                   /db_xref="GOA:A4T2U4"
FT                   /db_xref="InterPro:IPR022536"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2U4"
FT                   /protein_id="ABP42664.1"
FT                   /translation="MSLTVDPEVLRAFAGQVESTSTEIGETQAATAVSTAADGMPGSTT
FT                   QWAARLVGSHVSGQVEAIAAGVALMGDAVRGAGNDYAVTDAALAQSFQGIF"
FT   gene            complement(157024..157656)
FT                   /locus_tag="Mflv_0170"
FT   CDS_pept        complement(157024..157656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0170"
FT                   /product="peptidase S16, lon domain protein"
FT                   /note="PFAM: peptidase S16, lon domain protein; KEGG:
FT                   mva:Mvan_0737 peptidase S16, lon domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42665"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2T7"
FT                   /protein_id="ABP42665.1"
FT                   /translation="MPTLPMFPLEVAMLPGEELPLRIFEPRYSALVRACLAAEDPVFGV
FT                   VLIAAGREVGGGDARSDVGALARITEHSDLGAGRYRLKCVMAERIRVLEWLPDDPYPRA
FT                   VMQEWPDEPGGPVDFAAIRDIEDRMVGLFERIATARGAQVNARDIVHGADDSGDPAQWL
FT                   YALTARLPMGQADRYAILAAPSVADRVAALSEAVDTVIAMVEFQLSE"
FT   gene            complement(157661..158803)
FT                   /locus_tag="Mflv_0171"
FT   CDS_pept        complement(157661..158803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0171"
FT                   /product="glutamate--cysteine ligase, GCS2"
FT                   /note="PFAM: glutamate--cysteine ligase, GCS2; KEGG:
FT                   mva:Mvan_0736 uncharacterized enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42666"
FT                   /db_xref="GOA:A4T2T8"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2T8"
FT                   /protein_id="ABP42666.1"
FT                   /translation="MSSPVPDQRPDSRIDFNGSVRPTLGVEWEFALVDAQTRDLSNEAA
FT                   SVIAEIGENPRVHKELLRNTVEVVTGICDNSGQAMDDLASTLRPVREIVRERGMELFCA
FT                   GTHPFADWSAQKLTDAPRYAELIKRTQWWGRQMTIWGVHVHVGVSSAHKVMPIITSLLH
FT                   QYPHLLALSASSPFWDGEDTGYASNRAMMFQQLPTAGLPFHFQEWREWERFVSDQKKTG
FT                   IIDHMNEIRWDIRPSPHLGTIEVRIFDGVSNLHELSALVALTHCLIVDLDRRIEAGESL
FT                   PVMPPWHVQENKWRAARYGLDAIIILDADSNERLVTEDLDDLLERLQPVARKLDCVDEL
FT                   ARVPDIYHNGASYQRQRRVAEEHDGDLRAVVDALVSELVL"
FT   gene            complement(158784..159494)
FT                   /locus_tag="Mflv_0172"
FT   CDS_pept        complement(158784..159494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0172"
FT                   /product="superoxide dismutase, copper/zinc binding
FT                   protein"
FT                   /note="PFAM: superoxide dismutase, copper/zinc binding;
FT                   KEGG: mva:Mvan_0735 superoxide dismutase, copper/zinc
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42667"
FT                   /db_xref="GOA:A4T2T9"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2T9"
FT                   /protein_id="ABP42667.1"
FT                   /translation="MLRSVAAATLFAVPALALSACSPPGEVPSDSPGTTPSVWTGSPSP
FT                   SAEAGEHGAGHGGGSGQASGETLTAELNLADGTTVANAEIVFSDGYATVTVETTGEGDL
FT                   TPGFHGMHIHQVGKCEPNSVAPTGGAPGNFNSAGGHLQVGGNTGHPASGDLTSLQVRED
FT                   GSAKVVTTTDAFTAEDLTGDAGTAIIIHEKADNFANIPPERYQQVDGAPPPDQTTLATG
FT                   DAGARVACGVITGS"
FT   sig_peptide     complement(159405..159494)
FT                   /locus_tag="Mflv_0172"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.641 at
FT                   residue 30"
FT   gene            complement(159505..159960)
FT                   /locus_tag="Mflv_0173"
FT   CDS_pept        complement(159505..159960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0173"
FT                   /product="putative tuberculin related peptide"
FT                   /note="KEGG: mva:Mvan_0734 putative tuberculin related
FT                   peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42668"
FT                   /db_xref="GOA:A4T2U0"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2U0"
FT                   /protein_id="ABP42668.1"
FT                   /translation="MNQRESSGLPLRAIVMVLLFLGVVFLLVGFQALSGSDDDQSSTAS
FT                   TTVVTTTTTTSAAPEPARPEVRVFNISETPGAGESTATRLRDDEWNVTEVGNLTVPDVT
FT                   VTTVYFGETEGEQEAAEEVGRLLEAPVAPRVPALIEQPPGVVVLVTG"
FT   sig_peptide     complement(159787..159960)
FT                   /locus_tag="Mflv_0173"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.998) with cleavage site probability 0.446 at
FT                   residue 58"
FT   gene            complement(160002..160310)
FT                   /locus_tag="Mflv_0174"
FT   CDS_pept        complement(160002..160310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0174"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="KEGG: mva:Mvan_0733 transcriptional regulator, fis
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42669"
FT                   /db_xref="InterPro:IPR021678"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2T3"
FT                   /protein_id="ABP42669.1"
FT                   /translation="MDGAIARAERSGDDSEPTDGLTRREHDILAFERQWWKYAGSKEDA
FT                   IKELFSMSATRYYQVLNALVDRPEALAADPMLVKRLRRLRASRQKARAARRLGFDVT"
FT   gene            160460..161053
FT                   /locus_tag="Mflv_0175"
FT   CDS_pept        160460..161053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0175"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: mva:Mvan_0732 peptide deformylase; TIGRFAM:
FT                   peptide deformylase; PFAM: formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42670"
FT                   /db_xref="GOA:A4T2T4"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4T2T4"
FT                   /protein_id="ABP42670.1"
FT                   /translation="MAVRPICIVGDPVLHTATEPIPVGPDGSLPADLADLITDLYDTMD
FT                   AAHGVGLAANQIGVNKRVFVYDCADARKKTVRRRGVVVNPVLETSEVPETMPDPEDDDE
FT                   GCLSVPGESFPTGRADWARVTGLDADGTPITIEGTDLFARMLQHETGHLDGFLYLDSLI
FT                   GRNARAAKRAVKSHGWGVPGLTWMPGEDPDPFGH"
FT   gene            161057..161944
FT                   /locus_tag="Mflv_0176"
FT   CDS_pept        161057..161944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0176"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   mva:Mvan_0731 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42671"
FT                   /db_xref="GOA:A4T2T5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2T5"
FT                   /protein_id="ABP42671.1"
FT                   /translation="MIELPEIGSRVSLRYRLPTDAERPMTDVVGHIVDAGAVVRIRTRH
FT                   GDVVDVDRGDVLAVRVVPEMPVRTGEIRNLEHAAALGWPGVDHEWHHGWLLRSGRGATR
FT                   RANSAVPLQYSSFAEITEAIDWYARRDLPALISAPDRLFRIPQGVPTDAENVVMATDVA
FT                   PSRTVPVSPTPEDSWLRVYQRDVPVDVLTAVIDGEVGFGELDGAAVGRVAVTEAPDGTR
FT                   WAGLSAVRVDESARRRGLARTLCEGMLTWAHERGATRAYVQVVTENTAARTLYESMGFV
FT                   VHHRSRYVRAQDLL"
FT   gene            161950..162768
FT                   /locus_tag="Mflv_0177"
FT   CDS_pept        161950..162768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0177"
FT                   /product="Exodeoxyribonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /note="TIGRFAM: exodeoxyribonuclease III;
FT                   exodeoxyribonuclease III Xth; PFAM:
FT                   Endonuclease/exonuclease/phosphatase; KEGG: mva:Mvan_0730
FT                   exodeoxyribonuclease III Xth"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42672"
FT                   /db_xref="GOA:A4T2T6"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2T6"
FT                   /protein_id="ABP42672.1"
FT                   /translation="MRLATWNVNSIRARVDRVTDWLERADVDVLAMQETKCSDEQFPTM
FT                   PFAALGYDVVHCGFSQWNGVAIASRVGIDAVEVGFEGQPTWSDKPEAEAAAEARALGAT
FT                   CGGVRVWSLYVPNGRSIDSPHYTYKLKWLAALHNTAQGWLADDPSTPVALVGDWNIAPV
FT                   DDDVWDISLFSESTHVTAPERAAFNAIVDAGFTDVVRPFTPGPGTFTYWDYTQLRFPKN
FT                   RGMRIDFILGSPTLAELVTHAEIARDERKTGKNRVGSPSDHAPVVVDLRT"
FT   gene            complement(162855..163154)
FT                   /locus_tag="Mflv_0178"
FT   CDS_pept        complement(162855..163154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0178"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_3506 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42673"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2T0"
FT                   /protein_id="ABP42673.1"
FT                   /translation="MSKLTITTAVAAALTAGVLGLSAPALAAPTGGDAQATISQLEAQG
FT                   NRVIVHKLADVDLDDATVVGINRGAPIRGTVQDYANDRTYQNTITGYVYYVNVR"
FT   sig_peptide     complement(163071..163154)
FT                   /locus_tag="Mflv_0178"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.965 at
FT                   residue 28"
FT   gene            163348..164922
FT                   /locus_tag="Mflv_0179"
FT   CDS_pept        163348..164922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0179"
FT                   /product="protein of unknown function DUF222"
FT                   /note="PFAM: HNH endonuclease; protein of unknown function
FT                   DUF222; SMART: HNH nuclease; KEGG: mva:Mvan_0728 protein of
FT                   unknown function DUF222"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42674"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2T1"
FT                   /protein_id="ABP42674.1"
FT                   /translation="MFDSSVPEPAALAGLSDAELVDAAGAAARAENAVCARKLAVMAEL
FT                   FTRRVDLAPEDRLNWWVDPDAAVAAEIAAAVTITQGLATHQTYRAVVLRDRLPKVGALF
FT                   LQGLLSELLVRAIITRTDLITDPELIAAVDADLAADILRWGPQSAKKTEAAIDHIVERH
FT                   DPDAVRQTRQHDVGRTIEIGNPGDAPGYTTVWARMFAGDAAAGHRTLTTMAYSVCDNDP
FT                   RTLDERRNDALTALFHGITTLACRCGNGDCDAATNPRPPRELTVYALTDQTTANIEETT
FT                   ANDADADGGRNAGNGDGDAQPPAPKPRRSKPTLLPGRSGYLFGSGFMPAPLFDALLDDA
FT                   LLDGAKIREILHPGQAGPEPRYTPSTALADFIRCRDLTCRFPGCDTPATEADIDHTVAH
FT                   PVGPTHASNLKCLCRFHHLLKTFWTGRGGWHDRQHPDGTITWTSPTGHTYITHPGSRLL
FT                   FPTLCKPTATLWTGDPPQVPIRERRGAMMPRRAKTRAHSRAVYITAQRRRNAAERADGP
FT                   RGNDPPF"
FT   gene            164931..165311
FT                   /locus_tag="Mflv_0180"
FT   CDS_pept        164931..165311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0180"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0727 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42675"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2T2"
FT                   /protein_id="ABP42675.1"
FT                   /translation="MKILVATGHTQGTHPGDYHFCIERELVWVQEPCDRDRRDPEGPCG
FT                   CGRGFAGAASHRATTTAMVVESGMTREDLVLAFETSLGDGGWPVAWAEDVADENLEIAA
FT                   RLPAGAIITRNLEHFFVRGALF"
FT   misc_binding    165373..165481
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059), score 58.30"
FT   gene            165472..166335
FT                   /locus_tag="Mflv_0181"
FT   CDS_pept        165472..166335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0181"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /note="TIGRFAM: phosphomethylpyrimidine kinase; PFAM:
FT                   Phosphomethylpyrimidine kinase type-1; KEGG: mva:Mvan_0724
FT                   phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42676"
FT                   /db_xref="GOA:A4T2S5"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2S5"
FT                   /protein_id="ABP42676.1"
FT                   /translation="MTHSTTATTSSFLPLTPAGQTPLRVLTIAGSDSGGGAGIQADMRT
FT                   FALLGVHSLVAVTAVTVQNSLGVKGFHEIPLDVIAGQIEAVASDIGLQAAKTGMLASSE
FT                   IIETIADTWVAQGLSGTVPLIVDPVCASMHGDPLLHPSALNALKEKLFPLATLVTPNLD
FT                   EVGLLTGIEVVDEDSQRDAARALHALGPSWALVKGGHLRSSAQSPDLLFDGTDFHRFDS
FT                   TRIDTTHDHGAGDTLAAATASALAHGYSVPDAVAFAKRWVTECIRSAYPLGQGHGPVSA
FT                   LFRLAP"
FT   gene            166332..166964
FT                   /locus_tag="Mflv_0182"
FT   CDS_pept        166332..166964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0182"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0723 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42677"
FT                   /db_xref="InterPro:IPR026555"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2S6"
FT                   /protein_id="ABP42677.1"
FT                   /translation="MTSTSPTEIDAIAGVSHHPDGTPRGGVALTHGAGGSRESPMLVAL
FT                   CDEWARRGFLAVRYNLPYRRRRPKGPPSGSSAADIAGIVEAVATVRALVDGPVLAGGHS
FT                   YGGRMTSMAVADGLALDVLTLFSYPLHPPGKPERARTEHLPRITVPTVFTHGTADPFGT
FT                   LDELRPAAALIGAPVEIVEVTGARHDLGSKKLDVPALAVDGALRLLG"
FT   gene            166979..167710
FT                   /locus_tag="Mflv_0183"
FT   CDS_pept        166979..167710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0183"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0722 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42678"
FT                   /db_xref="GOA:A4T2S7"
FT                   /db_xref="InterPro:IPR026004"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2S7"
FT                   /protein_id="ABP42678.1"
FT                   /translation="MTVPPPPGPPWGPPPPYGQPQYGEPQYGQPQYGQPAYGQPYPPPP
FT                   PLPYPNDPSDPSFGEAPRTNWWAIVSLIFGVIGGVLIALVCGVVGLIKAKQYRSGRGMA
FT                   IAGIVLAAVWTVGIAVFLVLAANSDRVTATDVKVGDCLAEIPDGERVLTVKTISCEEPH
FT                   AGEVFAVLMMPDGDFPGQAEVEAYHERCSPELVAYSPQSMLDESVQLYVLYPTAETWDN
FT                   GDRAVTCIATLDPPRTGSIRG"
FT   gene            167748..169235
FT                   /locus_tag="Mflv_0184"
FT   CDS_pept        167748..169235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0184"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="KEGG: mva:Mvan_0721 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42679"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2S8"
FT                   /protein_id="ABP42679.1"
FT                   /translation="MNSEQFDAVIVGAGFAGIGTAIQLKRSGIENFVILDREDDLGGTW
FT                   YVNHYPGLAVDVPTTTYSYFFEPNPNWSRLFSTGDEIKQYADHVADKYDVRRHIRFGVT
FT                   VEGARWDEDATLWRVSLADGTTLSSRYLLTATGFLSQPHMPDIPGITEFEGRVIHTTAW
FT                   DDSYDPSGEKIAVIGTGATAVQLIPELAKKAADLTVYQRTPIWVVPKVDFRFSERAKRL
FT                   FARVPQTQRVLRWLTDSIYEVMVSVAVRHYGMFRGRFNISAADLAKIHRFVTIRDKDLR
FT                   RRLTPDYDFGCKRPTFSNSYYRTFTKPHVHLQDTGIARVESDGIVAGDGTKTVIDTLVL
FT                   ATGFDLWEANFPAIEVIGRDGRNLGKWWRETRFQAYQGVSIPYFPNYLSLASPYAFIGL
FT                   NFFNTMEYQMRLMDRLFGELRRRGATTFEVTEEANAEFLDRMTDLLGESLFTIGNCASA
FT                   RSYYFNPAGEPTLLRPTSTETAIREATEFPVTDYSFG"
FT   gene            169246..169512
FT                   /locus_tag="Mflv_0185"
FT   CDS_pept        169246..169512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0185"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0720 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42680"
FT                   /db_xref="GOA:A4T2S9"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2S9"
FT                   /protein_id="ABP42680.1"
FT                   /translation="MSNENSRAATVAGLALAATGLSHFVAPHLYEDLTKQAFPTDTRQH
FT                   VYIDGAIETAVGLGIASPKTRKFALIGLAVYLIYMLGNVARNR"
FT   gene            complement(169479..170711)
FT                   /locus_tag="Mflv_0186"
FT   CDS_pept        complement(169479..170711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0186"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mva:Mvan_0719
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42681"
FT                   /db_xref="GOA:A4T2S0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2S0"
FT                   /protein_id="ABP42681.1"
FT                   /translation="MAHSAEDNGIRRRPKDRKAQIARASAEAFSELGYHGVSMEMIASR
FT                   VGISAAALYRHYAGKYELFRDAVLNLGQQLVDGTAGIDGDDPEVVLDRLVSALIDIALA
FT                   NRSSGGLYRWERRYLRGDDQAELLQQLRTVHHRLQTPVSILRPELTARQRSTLSTAVLS
FT                   IVGSIVDHRAKLPAAQIHRVLTQVARAILSTELPDAAPPATPAPAAERIRSAAESSKYE
FT                   ALLAESMRLFNLNGYRDTSMEEIASAVGMPASGIYKYFSGKNDILAAIFRRASDRVSAE
FT                   TAEIVSTVPDPQEALAAVIDAYVTRAFGQPEMESLYYSERLNMSPSDQRIVRDLQRSTV
FT                   ESWVELVAAVRPDWTPGEARFAVHAAMALVIDVGRLVHYAASDEARDTVEGLVDAALRG
FT                   SYRLRATLPSM"
FT   gene            170758..171984
FT                   /locus_tag="Mflv_0187"
FT   CDS_pept        170758..171984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0187"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="PFAM: amino acid permease-associated region; Amino
FT                   acid transporter, transmembrane; KEGG: mva:Mvan_0718 amino
FT                   acid permease-associated region; TC 2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42682"
FT                   /db_xref="GOA:A4T2S1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2S1"
FT                   /protein_id="ABP42682.1"
FT                   /translation="MRRRLGTFDTVTLGLGSMIGAGIFVALAPAAAAAGTGLLVGLAVA
FT                   ALIAVCNAMSSARLAARYPESGGTYVYGRERLGPFWGHTAGWSFIVGKTASCAAMALTV
FT                   GYYVWPAYANAVAVGSVVALTAVSYAGVQRSATLTRVIVALVLGVLAMVVVVVFGSGDV
FT                   DASRLALGPDVDAYGVLQAAGLLFFAFAGYARIATLGEEVRDPARTIPRAIGLALVIAL
FT                   LTYAVVAVAVLAQLGSTGLATADAPLADAVRAAGLPALAPVVAVGAALAALGALLALLL
FT                   GVSRTTLAMARDRHLPHPLAHVHPGHGTPQRAEVAVGVVVAVVAAVVDVRSAIGFSSFG
FT                   VLLYYAVANASAWTLTATPRARLVPAVGLIGCVVLAFTLPPVSVLAGAAVVLVGMLAYT
FT                   TGGALRRGV"
FT   sig_peptide     170758..170859
FT                   /locus_tag="Mflv_0187"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.848 at
FT                   residue 34"
FT   gene            171992..173293
FT                   /locus_tag="Mflv_0188"
FT   CDS_pept        171992..173293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0188"
FT                   /product="uracil-xanthine permease"
FT                   /note="TIGRFAM: uracil-xanthine permease; PFAM:
FT                   Xanthine/uracil/vitamin C permease; KEGG: mva:Mvan_0717
FT                   uracil-xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42683"
FT                   /db_xref="GOA:A4T2S2"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR029935"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2S2"
FT                   /protein_id="ABP42683.1"
FT                   /translation="MTLTWKRVDSTTDPDFVVAPDERLSWPSTLGLGAQHVVAMFGATF
FT                   LVPVLTGFPPATTLLFSGVGTILFLLITGNRLPSYLGSSFSVIAPVTAATASHGTGSAL
FT                   GGIIAVGVLLIIIGAVVHVAGTRWIDITLPPVVTGAIVALIGFNLAPAAKNNFEQGPLL
FT                   GFVTLVLLVVVLAAFRGLLGRLAIFVAVAAGYLLAVFLGEVDTSGIAAAAWIGLPDFQA
FT                   PTFTLSVLPLFLPAVVALVAENIGHVKSVGQMTKRDMDPLTGRALAADGVATTLAGFGG
FT                   GSATTTYAENIGVMAATRVYSTAPYWIAALVAILLSLCPKVGAVIAAIPAGVLGGATVV
FT                   LYGLVGIIGIRIWLTNHVDFSKPVNQMTAAIPLIIGIADFTWSAGSLTFTGIALGSIAA
FT                   LLIYHGMRLLGFRPGRERPSTVYADPAGPAPEPR"
FT   gene            complement(173247..174713)
FT                   /locus_tag="Mflv_0189"
FT   CDS_pept        complement(173247..174713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0189"
FT                   /product="aminopeptidase Y. Metallo peptidase. MEROPS
FT                   family M28A"
FT                   /EC_number="3.4.11.15"
FT                   /note="PFAM: peptidase M20; protease-associated PA domain
FT                   protein; peptidase M28; KEGG: mva:Mvan_0716 aminopeptidase
FT                   Y"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42684"
FT                   /db_xref="GOA:A4T2S3"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="InterPro:IPR041756"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2S3"
FT                   /protein_id="ABP42684.1"
FT                   /translation="MNIQRYAAAFLALAVSIAGCAPAESPPAPDWGPELAKRVVIDNVY
FT                   GHLVTLQEIADAHDGNRADGSPGYQASVDYVAQALRDKGFDVQTPEFERLSGSRGGAPA
FT                   LTVAGRGFRVEQASLKITTPPGGLRAITLRPRRPAGCTAADYREVSVDKAIAVVDDSGC
FT                   SVVQKQRVAVGEGAVGVLVVSAATPSRPVGAPPTLFTPGYYNDLTVPVGVIDPTADAAL
FT                   RRTEAPVTLVLDNKPVMTTSRNVIAQTRTGDPGNIVMVGAHLDSAASGPGINDNGSGVA
FT                   AVLETALQLGAQPQTANAVRFAFWGAEEISLDGSKAYLRSLERDQLNDIALYLNFDMLG
FT                   SINAGYFTDDGDQSTQMEPDFVVAPEGSAGIERTLAGSLLLAGVRPADIPLTRTTDYAP
FT                   FLAAGIPVGGLTTGSSQRKTEVQGRLWGGEAGVPFDPNYHTRRDDIDNVDRTALGRMAS
FT                   SAAFAVGTYADALDGVNGVPERDRRDRRTP"
FT   sig_peptide     complement(174642..174713)
FT                   /locus_tag="Mflv_0189"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.999) with cleavage site probability 0.705 at
FT                   residue 24"
FT   gene            complement(174710..176242)
FT                   /locus_tag="Mflv_0190"
FT   CDS_pept        complement(174710..176242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0190"
FT                   /product="aminopeptidase Y. Metallo peptidase. MEROPS
FT                   family M28A"
FT                   /EC_number="3.4.11.15"
FT                   /note="PFAM: peptidase M20; protease-associated PA domain
FT                   protein; peptidase M28; KEGG: mva:Mvan_0715 aminopeptidase
FT                   Y"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42685"
FT                   /db_xref="GOA:A4T2S4"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="InterPro:IPR041756"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2S4"
FT                   /protein_id="ABP42685.1"
FT                   /translation="MTVAGRANVVAVTRRRVAAVLAVAVLAVAGCGRETAPAPQPQPDP
FT                   TPAGEFADELSGKVTADAMMTHLTRLQEIADAHGGNRALGSPGYRESVDYVADILRDKG
FT                   FDVETQDFVVKIPWADEPSLTVAGNKVEARPMMYTIGTDGDGVSGPIVVAKSEDTPGCT
FT                   ADDYDGLPVDGAIVLVDRGSCPFGGKQAIAAERGAVALIVANNEDGDEFGGGTLGGDTD
FT                   VKIPVVGVTREAGEQLRREPGAPAVLNLNAGVRVERTQNVIAQTTTGSTADVVMLGAHL
FT                   DSVSEGPGINDNGSGVAAILETAVQLGGAPEVANAVRFAFWGAEEDGLRGSNNYVGTLD
FT                   TETLKDIALYLNFDMLGSPNPGYFTYDGNQSTAPDPRIGVPRVPEGSAGIERTLAAYLD
FT                   RAGKPARDTSFDGRSDYDAFTKAGVPAGGLFSGAEAKMSSEEAELWGGEADQPFDPNYH
FT                   KASDTLEHIDRTALQIHGSGVAYAAGLYAQDQRGRNGIPVREDRTRHQLTGP"
FT   sig_peptide     complement(176084..176242)
FT                   /locus_tag="Mflv_0190"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.998) with cleavage site probability 0.785 at
FT                   residue 53"
FT   gene            complement(176220..177131)
FT                   /locus_tag="Mflv_0191"
FT   CDS_pept        complement(176220..177131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0191"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mva:Mvan_0714
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42686"
FT                   /db_xref="GOA:A4T2R6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2R6"
FT                   /protein_id="ABP42686.1"
FT                   /translation="MTDPQTLTLTLPHLTVTALSWGPPDGRLVLCLHGFPDSAWGWRKF
FT                   APILAEHGFRVVAPFSRGYAPTGPAPDGDYHIGALMYDALAVHRELGAPDDAVLIGHDW
FT                   GGFTAAGIAAYPDSPFAEHITMAVAPIGAVNRTRGPLTRQLALLPKQLRNSWYIMFFQL
FT                   PELPERLLPRVIPRLWRDWGPQGYDTGAELADALAALPSPAHRRAAVAYYRAMVRPSEP
FT                   SGRYADLHRWCFDVPRVPILHLQGELDGAMEAEYAAPIATALPAGSRVRIIDEAGHFLQ
FT                   IERPQVTADTVLDYLGDRRGPR"
FT   gene            complement(177143..177901)
FT                   /locus_tag="Mflv_0192"
FT   CDS_pept        complement(177143..177901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0192"
FT                   /product="putative ABC transporter membrane protein"
FT                   /note="KEGG: mva:Mvan_0713 putative ABC transporter
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42687"
FT                   /db_xref="GOA:A4T2R7"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2R7"
FT                   /protein_id="ABP42687.1"
FT                   /translation="MIRTAARAVDAERIKLLTLRSPLWAAAAAAVLSFALAALQASVSY
FT                   GYAAMPVSTAAMGVAVFGVPVLMVVAAMTVTGEYRSGLIATTFTAIPRRTLVVCAKAVV
FT                   AAAFSVVASAVMVFGSVMVARAAAAPGVAAGLTVSATMRFAAAIAVYAALTAVLGVGVA
FT                   VLLRHTAGAVTVLLLWPLLIEPLLGNLPGRSVEIGPYLPFANVFRFLDVQWLFPEYPMH
FT                   WGTLGSLGYFAAVVGVVFAAGLVMVNRRDA"
FT   sig_peptide     complement(177761..177901)
FT                   /locus_tag="Mflv_0192"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.976) with cleavage site probability 0.526 at
FT                   residue 47"
FT   gene            complement(177898..178818)
FT                   /locus_tag="Mflv_0193"
FT   CDS_pept        complement(177898..178818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0193"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mva:Mvan_0712 ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42688"
FT                   /db_xref="GOA:A4T2R8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2R8"
FT                   /protein_id="ABP42688.1"
FT                   /translation="MIELDALTKVFGSGRDGRAPAVDGLTCTIEPGVVTGFLGPNGAGK
FT                   TTTMRMILGLDRPTSGTATIDGRTYRQLAEPLRTVGALLDAKQVHPNRTVRNHLRWIAA
FT                   THRIASRRVDDVVDMVGLSAVAGSRAGTLSLGMSQRLGIAAALIGDPPVLLFDEPVNGL
FT                   DPEGIHWVRTLMRTLAAEGRTVLVSSHLLAEMAETADRLVVIGRGRLIASTTVAEFIGG
FT                   ADGAAVRVRSPRLDDLAAALAAAGMAVVRDGAALTVRHTTTDAVGELAATHSIPLHELT
FT                   GQQVSLEQAYLAVTDDATEYRGRTR"
FT   gene            complement(178815..179576)
FT                   /locus_tag="Mflv_0194"
FT   CDS_pept        complement(178815..179576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0194"
FT                   /product="lipolytic enzyme, G-D-S-L family"
FT                   /note="PFAM: lipolytic enzyme, G-D-S-L family; KEGG:
FT                   mva:Mvan_0711 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42689"
FT                   /db_xref="GOA:A4T2R9"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR037460"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2R9"
FT                   /protein_id="ABP42689.1"
FT                   /translation="MNRYVALGSSMAAGPGIGPRAPGSPRAAGRSARNYPHLVADALGL
FT                   DLVDVTYSGATTAHVLTESQRGVPPQIRALDGSESLVTVTIGGNDAGYVPMLFAAGLPR
FT                   LLRAVPVLGGRLRELLDPSARYVALAEIGASLIEVGREIRRRAPKATVLFVDYLTLVPA
FT                   TGDAPPLRPADLALGRHIAETLRQLTADAAQATGCGLIQAADASREHHAWSAHPWTTRF
FT                   GFPVPGRPAPLHPNADGMRAVADLVIAEVSR"
FT   sig_peptide     complement(179493..179576)
FT                   /locus_tag="Mflv_0194"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.918) with cleavage site probability 0.557 at
FT                   residue 28"
FT   gene            complement(179573..180343)
FT                   /locus_tag="Mflv_0195"
FT   CDS_pept        complement(179573..180343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0195"
FT                   /product="thiazole-phosphate synthase"
FT                   /note="PFAM: thiazole biosynthesis family protein; KEGG:
FT                   mva:Mvan_0710 thiazole biosynthesis family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42690"
FT                   /db_xref="GOA:A4T2R2"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2R2"
FT                   /protein_id="ABP42690.1"
FT                   /translation="MVEFGTGKLSIAGREFGSRLILGTGGAANLAVLEAALVASGTELT
FT                   TVAMRRIDADGGTGVLDLLTRLGITPLPNTAGCRGAAEAVMTAQLAREALQTNWVKLEV
FT                   IADERTLLPDAVELVRAAEQLVDDGFAVLPYTNDDPVLARRLEATGCVAVMPLGSPIGT
FT                   GLGIANPHNIEMIVDSAQVPVILDAGIGTASDAALAMELGCDAVLLASAVTRAADPAAM
FT                   AAAMSAAVRAGHLARHAGRIPKRFWAHASSPAFE"
FT   gene            complement(180336..180533)
FT                   /locus_tag="Mflv_0196"
FT   CDS_pept        complement(180336..180533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0196"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /note="TIGRFAM: thiamine biosynthesis protein ThiS; PFAM:
FT                   thiamineS protein; KEGG: mva:Mvan_0709 thiamine
FT                   biosynthesis protein ThiS"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42691"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2R3"
FT                   /protein_id="ABP42691.1"
FT                   /translation="MKVTCNDEAVEVDDGTTVTQLLGLLGIPEKGIAVAVDWAVIPRSH
FT                   WDTALTDGAKVEVVTAVQGG"
FT   gene            complement(180530..181558)
FT                   /locus_tag="Mflv_0197"
FT   CDS_pept        complement(180530..181558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0197"
FT                   /product="glycine oxidase"
FT                   /EC_number="1.4.3.19"
FT                   /note="TIGRFAM: glycine oxidase ThiO; PFAM: FAD dependent
FT                   oxidoreductase; KEGG: mva:Mvan_0708 glycine oxidase ThiO"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42692"
FT                   /db_xref="GOA:A4T2R4"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR012727"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2R4"
FT                   /protein_id="ABP42692.1"
FT                   /translation="MPAHTRGRLAVIGGGVIGLAVARRAALDGWATRVHRTEHPGASWV
FT                   AGGMLAPHSEGWPGEEQLLTLGLESLRLWHEQFLGSLPAQVVTARESLVVAVDQADAAD
FT                   LRTVAAWLCAQGHPVTPTTSARDMEPLLAQGIRHGFSADTELAVDNRAVVAALAEQCER
FT                   LDVRWAPPVDSLAETADADAVVIANGIDAPALWPGLPVRPVKGEVLRLRWRRGCLPVPR
FT                   RVVRARVRGRQVYVVPRPDGVVVGATQYEHGRDTAPTVGGVRDLLDDACAVMPGLGEYE
FT                   FAEAAAGLRPMTPDNLPLVGRLDERTLVAAGHGRSGFLLAPWTVEKIAAELEGAMVMEV
FT                   AE"
FT   misc_binding    complement(181548..181657)
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059), score 58.78"
FT   gene            181646..182359
FT                   /locus_tag="Mflv_0198"
FT   CDS_pept        181646..182359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0198"
FT                   /product="thiamine-phosphate diphosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="KEGG: mva:Mvan_0707 thiamine-phosphate
FT                   pyrophosphorylase; TIGRFAM: thiamine-phosphate
FT                   pyrophosphorylase; PFAM: thiamine monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42693"
FT                   /db_xref="GOA:A4T2R5"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4T2R5"
FT                   /protein_id="ABP42693.1"
FT                   /translation="MWSRSSLRRLTATVSTVPESPSLQGARLYLCTDARRERGDLADFA
FT                   DAALAGGVDIIQLRDKGSPGEKAFGPLEARAEIDALHVLAEAARRHNALVAVNDRADIA
FT                   RASGAEVLHLGQDDLPLTVARQIVGDRVIGRSTHDLAQAEAAIAEDVDYFCVGPCWPTP
FT                   TKPGRAAPGLDLVREVAALNTTKPWFAIGGIDAQRLPDVLDAGARRVVVVRAITAAEDP
FT                   RAAAEQLAGMLDSAV"
FT   gene            complement(182360..182902)
FT                   /locus_tag="Mflv_0199"
FT   CDS_pept        complement(182360..182902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0199"
FT                   /product="8-oxo-dGTPase"
FT                   /EC_number="3.6.1.-"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: mva:Mvan_0706 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42694"
FT                   /db_xref="GOA:A4T2Q9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2Q9"
FT                   /protein_id="ABP42694.1"
FT                   /translation="MQNQVPRIRRPLPKLVLVRGDGDGWVVSASGAAFWGRHGAAGLLL
FT                   RAPGPNGAPAVLLQHRAPWSHQGGTWGLPGGARDSHETPEQAAVREAEEEAGLSPHQLT
FT                   VRTTVVTAENSGWTYTTVIADATEQLVTVPNRESAELRWVAEDEVTNLPLHPGFAASWA
FT                   RLREVTALIPLMVNPQR"
FT   gene            182991..184310
FT                   /locus_tag="Mflv_0200"
FT   CDS_pept        182991..184310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0200"
FT                   /product="putative conserved membrane protein"
FT                   /note="KEGG: mva:Mvan_0705 putative conserved membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42695"
FT                   /db_xref="GOA:A4T2R0"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2R0"
FT                   /protein_id="ABP42695.1"
FT                   /translation="MTVELAHPSTEPLASRSPTAPSHPRWWFLWTTPGRILSIGMVLAA
FT                   LVIASAFATSTTINDRQQALTAVLNHTEPLAFAAGQLYTTLSVADAAAATAFIAGAEPR
FT                   PVRQRYEQAITDASVAVTRASSGLTEESLVQLLGRINARLAVYTGLVETARTNNRAGNP
FT                   VGSSYLSEASALMQLQILPDAQRLYEETSARVDAETTASTRIPIPVILVVTATLLFGVF
FT                   ANRWLAKRTRRRVNIGFVAGGLAVLIMLMWVGTALIISTADSRSAKETAAESLKTVTTL
FT                   AITAQQARADETLSLIRRGDEDIRKQSYYQRIDEMKQQLARYVARDDSIDKSDLADADA
FT                   LLDRWRAADDRITAYIAVGNYQAATQVALGTGEDDATPAFDKIDEALTRGIDQSRTQLR
FT                   SDIVNARRVLSGATVGAALLSVVAAVSVALGIWPRLSEYR"
FT   gene            184307..185281
FT                   /locus_tag="Mflv_0201"
FT   CDS_pept        184307..185281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0201"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; KEGG: mva:Mvan_0704 extracellular solute-binding
FT                   protein, family 3; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42696"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A4T2R1"
FT                   /protein_id="ABP42696.1"
FT                   /translation="MMKRALRRVGAALAAAVMLSGCAQALPVVPTPTVTLAPPTPAGLE
FT                   ELPPVPARPATPADTDCDPRASLRPFATQEEADAAVANIKARGRLIVGLDIGSNLFSFR
FT                   DPITGEITGFDVDIAGEIARDIFGTPSQVEYRILSSADRVDALRDNQVDVVVKTMTITC
FT                   ERKKLVNFSTAYLIANQRILAPRDSNIRQSSDLSGKRVCVAKGTTSLERIQQISPPPLI
FT                   VGVVTWADCLVALQQRQVDAVSTDDAILAGLVSQDPYLHIVGPSMNEEPYGIGVNLQNT
FT                   GLVRYVNGTLQRIRRDGTWNTLYRKWLTVLGPAPAPPVARYTD"
FT   sig_peptide     184307..184420
FT                   /locus_tag="Mflv_0201"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.398 at
FT                   residue 38"
FT   gene            185278..187578
FT                   /locus_tag="Mflv_0202"
FT   CDS_pept        185278..187578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0202"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; SMART: tyrosine protein
FT                   kinase; serine/threonine protein kinase; KEGG:
FT                   mva:Mvan_0703 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42697"
FT                   /db_xref="GOA:A4T164"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR031634"
FT                   /db_xref="InterPro:IPR031636"
FT                   /db_xref="UniProtKB/TrEMBL:A4T164"
FT                   /protein_id="ABP42697.1"
FT                   /translation="MSEYPDDIDPDTEPEDGPGTQPAGFADLADDSMATLRPMATQAVF
FT                   RPHFDDDDDDSDALVHSGDTEPQDAATTITRHLSPTRRLGGGLVEIPRVPARDPLAALM
FT                   TDPVVAESKRFCWNCGRPVGRSTKDGRALSEGWCPHCGSAYSFLPQLNPGDIVADQYEI
FT                   KGCIAHGGLGWVYLAFDKNVNDRPVVLKGLVHSGDAEAQAIAMAERQFLAEVTHPGIVK
FT                   IYNFVEHEDKHGNPVGYIVMEYVGGTSLKQATLLKHSSRIRLPAAEAIGFMLEILPALG
FT                   YLHSLGLVYNDLKPENIMVTEDQLKIIDLGAVSRINSFGYLYGTPGYQAPEIVRTGPTV
FT                   ATDIYTVGRTLAALTMRLPTRKGRYLDGLPEDNPVLEEYDSFGRLLRRAIDPDPRRRFQ
FT                   TAEELSSQLMGVLREVVASDTGVPRPGLSTMFSPSRSTFGVDLLVAHTDVYLDGQVHSE
FT                   KLTAQEIVKALQVPLVDPTDVGATVLSATLLSQPVQTLDSLRAVRHGALDSDGVDLSQS
FT                   VELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVWFRAVSELLTADYDSATKHFT
FT                   QVLDTLPGELAPKLALAATAELAGASDERTFYKTVWDTDHGVISAGFGLARALSAEGDR
FT                   EGAVRTLDEVPATSRHFTTARLTSAVTLLSGRSTSEITEEHIRSAARRVEALPDTEPRV
FT                   LQIRALVLGTAMDWLADNTASTNHILGFPFTEHGLQLGVEASLRSLARVAPTQAHRYAL
FT                   VDLANSVRPMSTF"
FT   gene            187854..188312
FT                   /locus_tag="Mflv_0203"
FT   CDS_pept        187854..188312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0203"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: mva:Mvan_0702 anti-sigma-factor
FT                   antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42698"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A4T165"
FT                   /protein_id="ABP42698.1"
FT                   /translation="MAISEALPPSSTQRVFRPDPTSFELREEHHRATFSACELPPTTVL
FT                   VTIHGEIDATNNMPLAHYIEKRIGDSRKLIVDLQTVEFFAASGFAALFNVNVVCHRRGV
FT                   RWQLLAGPHVRRLLRVCDPQRELPVTGSSAKYTRTRPRDRKLLVGGYH"
FT   gene            complement(188232..189392)
FT                   /locus_tag="Mflv_0204"
FT   CDS_pept        complement(188232..189392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0204"
FT                   /product="acetate kinase"
FT                   /note="TIGRFAM: acetate kinase; PFAM: acetate and butyrate
FT                   kinase; KEGG: mva:Mvan_0701 acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42699"
FT                   /db_xref="GOA:A4T166"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4T166"
FT                   /protein_id="ABP42699.1"
FT                   /translation="MTRTVLVLNSGSSSVKYAVLEPDSGVLIADGIVERIGQEGGAHDH
FT                   AAAMRGVFDSLAADGHHLEDLGLVAVGHRVVHGGPDLYRPTIVDETVIDRLKELGPLAP
FT                   LHNPPAVLGIEVARDALPDLPHVAVFDTAFFHDLPAAAATYAIDAEVARDWNIRRYGFH
FT                   GTSHQYVSEQAAAFLDVPLESLSQIVLHLGNGASVSAIVGGRPVETSMGLTPMEGLVMG
FT                   TRSGDVDPGVIFYLWREAGMPVEDIESMLNRRSGVRGLGGEIDFRELHRRIESGDDAAE
FT                   LAYEVYIHRLRKYIGAYLAILGSADVITFTAGVGENDAVVRRDALTGLAAFGIEIDEHL
FT                   NDSPGRGARRISADGAPTTVLVIPTDEELAIARACTGVLGARPGDG"
FT   gene            complement(189392..191515)
FT                   /locus_tag="Mflv_0205"
FT   CDS_pept        complement(189392..191515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0205"
FT                   /product="phosphotransacetylase"
FT                   /EC_number="2.3.1.8"
FT                   /note="KEGG: mva:Mvan_0700 phosphate acetyltransferase;
FT                   TIGRFAM: phosphate acetyltransferase; PFAM: phosphate
FT                   acetyl/butaryl transferase; DRTGG domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42700"
FT                   /db_xref="GOA:A4T167"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR016475"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:A4T167"
FT                   /protein_id="ABP42700.1"
FT                   /translation="MRAGAQFGRLWDVPDAAKTTISAIYVASPEGDTGKSTIALGILHR
FT                   LAATVARVGVFRPITRGDGAPRDYILELLLDQTTADLPYEDCVGVTYHQLHEDPEAALA
FT                   EIVDRFHAVADRCDAVLVVGSDYTDVAAPSELSVNARIAANLGAPVVLAVKAKGRNPEQ
FT                   VAQVVELCVDEIAAQHAHTAAVVANRCDPAQLVEVGEALTKIEPQSYVLPEEPLLVAPS
FT                   VAELQAAVEGAVVQGDPALLHREVLDVLVAGMTAEHVLERLTEGGVVITPGDRSDVVLA
FT                   VLSAHAAEGFPSLSGVILNGGLPLHPAIDGLVAGLGQRLPIVETRFGTFETASRVAATR
FT                   GRVTSQSHRKIDTALTLMDTYVDTAELLAHLALPIPSVVTPQMFTHQLLERASADRQRI
FT                   VLPEGNDDRILRAAGRLLQRSVADLTILGDESQVRARAAELGVDLSHAAVLDPKTSELC
FT                   DRFAEQYAELRQHKGVTLDRAREVIHDVSYFGTMLVHNDMVDGMVSGARHTTAHTIRPA
FT                   FEIIRTAPGVSTVSSIFLMCLADEVLAYGDCAIVPDPTAEQLADIAISSARTAAQFGIE
FT                   PRVAMLSYSTGTSGTGADVDKVRQATELVRSREPDLPVEGPIQYDAAVEPSVAQTKMPD
FT                   SAVAGRATVLIFPDLNTGNNTYKAVQRSAGAIAIGPVLQGLNKPVNDLSRGALVEDIVN
FT                   TVAITAIQAQGVH"
FT   gene            191695..193185
FT                   /locus_tag="Mflv_0206"
FT   CDS_pept        191695..193185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0206"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mkm:Mkms_0548 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42701"
FT                   /db_xref="GOA:A4T168"
FT                   /db_xref="UniProtKB/TrEMBL:A4T168"
FT                   /protein_id="ABP42701.1"
FT                   /translation="MTSTANLRRNLRVIEGPRPVTTSNHPSPTVKLPHIDVRWGFRERV
FT                   TAIAVLVLIGYGLDIGRLVADAVAGSRTPMLALTPLLALLIASAYRWPPPGVNDNESDW
FT                   LFVSILGPIGFAGIALVSSRFETLAAAFRLDLLGAALWTVCATAIFLGARHTARMWRVW
FT                   LFTVIGCNPVLFTLAAGMLGGSDSAVAALSVCYGATAVYLAGARAPRLKRLAATSVCLI
FT                   GGWGLGSVLLGTLPLFGTVAVAAAVLPVVVHVGMRRWVGPDAGATGEMPAYPVRSWKSL
FT                   LALVLLAFAVAVVHTSPAPIREPAAVQGDWIGSAGLYGARELPDAQRFLGADARFVRYE
FT                   VPTTAGRPNAAVDVITTSNLASLHDHRDTVWYPSTRPLNFVPASGLQSTAPVEVRAVFS
FT                   NADTAIDTTTPQWYALTWDWRTDSGYQQVTVVVNQNPAESATPPPAPTGLEVVDTLLSP
FT                   ALWIGRQQADDPGRVDDVVVRHATEIADSLLAHVAARA"
FT   gene            193178..194605
FT                   /locus_tag="Mflv_0207"
FT   CDS_pept        193178..194605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0207"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mkm:Mkms_0547 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42702"
FT                   /db_xref="GOA:A4T169"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4T169"
FT                   /protein_id="ABP42702.1"
FT                   /translation="MHSYTPGSRLPEDLSARRVTTDGSVILGVSGILGVAATGVLAPHL
FT                   VLPAVTTVLAALYLASTIDRHWLLVQGLRSPSLLTISDEEARAVPDNQLPVYTVLLPVY
FT                   NEPSIVHNLIAGVGRLEYPKDKLEILLLVEEDDIATRRAMATTELEAVRLILVPNSQPK
FT                   TKPKACNYGMATPGLKGEMVTIYDAEDIPDPLQLRKTVVAFQQLPDNVGCIQARLGYFN
FT                   EEQNLLTRWFSMEYDQWFGMTLPAVEAAGCVVPLGGTSNHMRTSVWRAIGGWDEFNVTE
FT                   DADLGVRLARAGYRTRILDSVTLEEANSDVLNWIRQRSRWYKGYLQTMLVHLRHPAALW
FT                   SQVGGKGILRLLNMTGAVPIVAVINLVFWATMAAWVLGRPDVVELAFPGATYYVYLTMY
FT                   VVGAPLSVFMGLIVTQRLGKPYMWWAAALVPLYWMLQSIAALKAVFQLVTRPQFWEKTV
FT                   HGLSDTVDVPNSTGRPT"
FT   gene            194602..196533
FT                   /locus_tag="Mflv_0208"
FT   CDS_pept        194602..196533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0208"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mkm:Mkms_0546 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42703"
FT                   /db_xref="GOA:A4T160"
FT                   /db_xref="UniProtKB/TrEMBL:A4T160"
FT                   /protein_id="ABP42703.1"
FT                   /translation="MTETARSVLLRLMVCAFLASAAFSAGPSAIAQPPKSPDVVPGAAQ
FT                   PITLSQLGLSDKIDIVGSNQNADIAIPTPVGVQPVQLTGQIGSVVNVRNGRVDVIDSRG
FT                   VVLGSMPVPTGLASVPFSIDLRTAKVGDGRTAITFVLRDDNADANSCSQSPSLTLSQMT
FT                   TAFSGPVPSPTTIADFLPGYLDEILIRVGPEPSRSQQQAALALVAKLTHLYRPIPVRID
FT                   VTAAAQLPPAKPLRRIIDIREGGEGAIGLERPGTPNAVLTVTGVGDELERQVELFSDRR
FT                   FGLAQTPFAATLSASHEAPQLTDIKTFAELGMTGEVSVLGTRTLYAGFDVSAFGLGPIS
FT                   RAKAHIKARYTPVVGGEASVVLRSGSTVLDSRRLDESGLLDTTVDIPAEVITSNVGMGF
FT                   EIRYVPRQECAPLTDRISFSLDPESTISITPGTRNRGGFPVLPMAFTPDFAVVVDDWNR
FT                   IGFAAQAINLLAQQASVVLRPRITDLSQAAASRPGLLAVVSGDTLSGAGMSPPLVPVGS
FT                   DTAAINGVPTATDVDLNGPLGVVQAFTHNDRMVLAVSGSEDWSLVGRTFDHIRGLESRW
FT                   ASLSGDVVATGSAAETVSLTIREGGGLVSNYPGDGWKWWAWLSIGAGCVAVIVAVAVLV
FT                   LRRRRLGH"
FT   sig_peptide     194602..194697
FT                   /locus_tag="Mflv_0208"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.904 at
FT                   residue 32"
FT   gene            196538..198247
FT                   /locus_tag="Mflv_0209"
FT   CDS_pept        196538..198247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0209"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mkm:Mkms_0545 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42704"
FT                   /db_xref="GOA:A4T161"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:A4T161"
FT                   /protein_id="ABP42704.1"
FT                   /translation="MPTATSALPVSEIVADQAPPTARPSWRHTAALFTALSTLYFAVGT
FT                   VLVLRYNLFDGDGPSRVANAGYVFMSREPHLGAIGFVWNPLPSLVEIPILHLSRWIPEL
FT                   KTYGLAGVAQSALFMAGAAVMVRRIALDRGIGTGWRTVAVLCFALHPTIVTYGAAGMSE
FT                   AALTFALIWCARHLLQWVHARRSGDLAWAGVALGVGYLARYEVVAAACGVAILVGVLAF
FT                   RRSRTRRSSHAVLSALIVLFPLGTAVAVWSMSSWIVTGELFPMLSSQYGNESQINAATQ
FT                   GGPMGAIASDDWVIIAARLLGMQPFVILATIGAIAWSLSSRKRDPLVPAAVFGPVLLFA
FT                   AWGQYTFTTFGWFRFYLAAVPLVVIVAMVCWAPRGEHRRRPWQMDSLSSRWGAALLCSS
FT                   VLIGFPVTAYATLDERIGNQALQFGLRSVFDPQTYPSEEQWYGRLMTNDRALADYFDRK
FT                   NLPDGSVLMDTFNTWGVWLSSDRPKQFVITSDYDFTAVMNRPWDFGVRYVVASNPANGV
FT                   KDVLNRRYPDLWADGAGFGELALSVYGGTGDERLRVYRVIEPRTVPGARPVG"
FT   gene            complement(198256..199227)
FT                   /locus_tag="Mflv_0210"
FT   CDS_pept        complement(198256..199227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0210"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   mva:Mvan_0699 endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42705"
FT                   /db_xref="GOA:A4T162"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A4T162"
FT                   /protein_id="ABP42705.1"
FT                   /translation="MIRILATLLGLGALAVAVTGFAARYLPIAGHPTLILAAAAPYLSV
FT                   AALAAMLLFVVARRWVLALLAVALTVALMWVYVPRFLPGPSEQTDAVDVRVLTSNLGMG
FT                   EADPRQLVALAGAGADVVAVQELTQEAADGLSAAGMDTVFPHRVIVPAPGATGIGIWSR
FT                   HPIVHSGRIDGYALPMVGTRIRVPGVRVDATVLSVHLAAPWPMPIEDWKSDYATFPDTL
FT                   REMGVAAGAGAVIVAGDFNATYEMAPFRRLLDGGYSDAGNESGAGLARSYPAGGIGLPL
FT                   IGIDHILIKNCAAATVRTVVVPGADHRGLLATLRLPVDMTAS"
FT   sig_peptide     complement(199114..199227)
FT                   /locus_tag="Mflv_0210"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.998) with cleavage site probability 0.512 at
FT                   residue 38"
FT   gene            complement(199245..200255)
FT                   /locus_tag="Mflv_0211"
FT   CDS_pept        complement(199245..200255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0211"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: mva:Mvan_0698
FT                   luciferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42706"
FT                   /db_xref="GOA:A4T163"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019944"
FT                   /db_xref="InterPro:IPR019945"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4T163"
FT                   /protein_id="ABP42706.1"
FT                   /translation="MAELKLGYKASAEQFAPRELVELAVAAEEHGMDSATVSDHFQPWR
FT                   HEGGHAPFSLAWMTAVGERTTRLQLGTSVLTPTFRYNPAVIAQAFATMGCLYPDRIFLG
FT                   VGTGEALNEIATGYEGEWPEFKERYARLRESVRLMRELWLGDRVDFEGEYYKTKGASIY
FT                   DVPEGGIPIYIAAGGPQVAKYAGRAGDGFICTSGKGEELYKEKLIPAMREGAEAAGKNP
FT                   DDVDRMIEIKISYDTDPELALENTRFWAPLSLTAEQKHSIDDPMEMEKAADELPIEQVA
FT                   KRWIVASDPDEAVAKVADYVDYGLNHLVFHAPGHDQRRFLELFQRDLEPRLRKLG"
FT   gene            200279..201022
FT                   /locus_tag="Mflv_0212"
FT   CDS_pept        200279..201022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0212"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   mva:Mvan_0697 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42707"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A4T155"
FT                   /protein_id="ABP42707.1"
FT                   /translation="MAPVVTAVTDRVHFVRTELVNWTLVRDDDGVILIDAGFPGHRDEV
FT                   LTSLHGLGFGVGDVRAILLTHAHIDHFGTAIWFAATHGTPVYCHADEVAHSRRDHLEQA
FT                   SPIDIAKHAWQPTWLKWSVSIIGKGALTRAGIASTAPLTDHIAAALPGSPVCIPTPGHT
FT                   GGHCSYVVDGVLVSGDALITGHPVASRRGPQLLPSVFNHDEDACRRSLTTLGALDTEVI
FT                   LPGHGPLWRGPVRDAAAQAAQASVR"
FT   gene            complement(201004..201294)
FT                   /locus_tag="Mflv_0213"
FT   CDS_pept        complement(201004..201294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0213"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0696 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42708"
FT                   /db_xref="GOA:A4T156"
FT                   /db_xref="UniProtKB/TrEMBL:A4T156"
FT                   /protein_id="ABP42708.1"
FT                   /translation="MSQATVGWLLLAAAAVTFVFGGVSRLVIGARRDSRAVRMVVHTFR
FT                   RTGIARVLFGRFDDDVLDDDELDAMILMPSIVVACGLVLTAIFLLLYRTLA"
FT   gene            complement(201305..202216)
FT                   /locus_tag="Mflv_0214"
FT   CDS_pept        complement(201305..202216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0214"
FT                   /product="fmnh2-utilizing oxygenase"
FT                   /note="KEGG: mav:MAV_2048 fmnh2-utilizing oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42709"
FT                   /db_xref="GOA:A4T157"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A4T157"
FT                   /protein_id="ABP42709.1"
FT                   /translation="MKAERSKHIHLGARLPASFDSWDSLVHLARTAERGLFDFVLVDDG
FT                   ARRREQRSDALTMLAALAAVTDRVGLVGTVDTGATEPFEVARRIATLDHLSDGRVGWHR
FT                   AGADVRRAGEFLAVARLFWDSWAEDAVLADHDAGRYVDPDRIRAVEHRGPHFDVRGFAT
FT                   LPRPPQRHPVLVQDDDSEDGTAFAAAHADAVITPHAGLEARQRYVADVRTKVAAAGRNP
FT                   DSVTVFALTKLSPGSPAKVADEMDLHVRSGACDGFLLVPDPTPHGLDEFVDDVVPLLQE
FT                   RGSLRTGYCGHTLRDHLAQPAL"
FT   gene            complement(202206..203330)
FT                   /locus_tag="Mflv_0215"
FT   CDS_pept        complement(202206..203330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0215"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: mav:MAV_2049
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42710"
FT                   /db_xref="GOA:A4T158"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A4T158"
FT                   /protein_id="ABP42710.1"
FT                   /translation="MNVPLSVLDLAPICDGSDAATALRNTVDLARHAERWGYRRFWVAE
FT                   HHFVAVASTAPAVLIGQIAAATRTIRVGAAAVQLGQTTAVAVVETFGMLDAFHPGRIDL
FT                   GIGRSGRRARPPRPDGQKRTPRPVPPWREIDGVVIPSPFDLSTLMRNPRLKARMSVLQQ
FT                   PGAVSPEFADQVDDILALIAGRYEIDGFAAHVVPGEGSALTPWVFGSSKGESARVAGAR
FT                   GLPFVASYHLTPATALDAVDVYRAHFRPSATLTEPYVVVSADVVVAEDTATARHLASSY
FT                   GHWVHAIRTGDGAVPYPDPDRVAPLPDEQAATVKDRTATQFVGDPDEVAHRLEALRRVA
FT                   DADELVITSVTHGHEDRLRSHRLLAERWGITGEG"
FT   gene            complement(203327..204259)
FT                   /locus_tag="Mflv_0216"
FT   CDS_pept        complement(203327..204259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0216"
FT                   /product="fmnh2-utilizing oxygenase"
FT                   /note="KEGG: mav:MAV_2050 fmnh2-utilizing oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42711"
FT                   /db_xref="GOA:A4T159"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A4T159"
FT                   /protein_id="ABP42711.1"
FT                   /translation="MSGAPHVAVALEGYGWHPQAWRHSAGAPPVTSGGYWAELVATAER
FT                   GLLDFVTFDDAPAPQRRRRPEIDPRWLAGRPDAVLVAARVAPLTRHIGLIRVATTTHTE
FT                   PAALSESLATLDHLSQGRAGWQVRISASRHEAQLFGRRDPDDLGDLFAHARGVVEIVRT
FT                   RWEGGGGRPVVTALAHTPTVYEFAADSADLVFVTPRDDESLSTILAEVREAGGHELRVY
FT                   ADLYVTFTGVVDERSDARVFSGTADELADTIAGWHRHGVHGVRLRPAVNAVDLPVIADE
FT                   VIPLLQCRTGFRSTYRPGETLRGRLGIES"
FT   gene            204384..205244
FT                   /locus_tag="Mflv_0217"
FT   CDS_pept        204384..205244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0217"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: msm:MSMEG_0771 hypothetical oxidoreductase YqjQ"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42712"
FT                   /db_xref="GOA:A4T149"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4T149"
FT                   /protein_id="ABP42712.1"
FT                   /translation="MDNIRGKTIAITGAARGIGYATAEALLAHGARVVIGDRDVALQES
FT                   SVAKLTNLGPVSGYPLDVTDQESFATFLDKARTDGGGHIDVLINNAGVMPVGPFLDETE
FT                   QSIRSSLEVNVYGVLTGCRLALPDMVKRRSGHIINIASLSGVIPLPGQVVYVGAKYAVV
FT                   GLTTALADEMAPHGVNVSVIMPPFTNTELIAGTKSGGAIKPVEPEDIAAAIVKTLNKPK
FT                   THVSVPPPLRFTAQAAQMLPPKGRRAMNKALGLDTVFLDVDTDKRKGYEERARAARGVV
FT                   EGSQG"
FT   gene            complement(205241..205645)
FT                   /locus_tag="Mflv_0218"
FT   CDS_pept        complement(205241..205645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0218"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0689 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42713"
FT                   /db_xref="UniProtKB/TrEMBL:A4T150"
FT                   /protein_id="ABP42713.1"
FT                   /translation="MSRASEAKKARRRKRRTVRDQTWLPAGVLDELEIASQLEEFDARL
FT                   TERGWVFGEEADEGSGVFWVWPDSAGDVDHDAERADATVILLSPDDSGETAHVVFVGTA
FT                   ADYQFNLDELFEHIDMIEAFRLGDPAPVFD"
FT   gene            complement(205646..206869)
FT                   /locus_tag="Mflv_0219"
FT   CDS_pept        complement(205646..206869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0219"
FT                   /product="O-succinylhomoserine sulfhydrylase"
FT                   /EC_number="2.5.1.48"
FT                   /note="KEGG: mva:Mvan_0688 O-succinylhomoserine
FT                   sulfhydrylase; TIGRFAM: O-succinylhomoserine sulfhydrylase;
FT                   PFAM: Cys/Met metabolism pyridoxal-phosphate-dependent
FT                   enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42714"
FT                   /db_xref="GOA:A4T151"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006234"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4T151"
FT                   /protein_id="ABP42714.1"
FT                   /translation="MSPEPDSVPSVRIPTPLPDGVGQATIGVRGGLLRSGFEETAEAIY
FT                   LTSGYVYESAAEAEKAFTGEIDRYVYSRYGNPTISMFEERLRLLEGAPACFGTASGMSA
FT                   VFTSLGALLGAGDRLVAARSLFGSCFVVCNEILPRWGVETVFVDGEDLAQWEEALSVPT
FT                   QAVFFETPSNPMQSLVDIAAVCDLAHAAGAKVVLDNVFATPILQQGMPLGADVVVYSGT
FT                   KHIDGQGRVLGGAILGDKEYIDGPVQKLMRHTGPALSPFNAWTLLKGLETMALRVQHQN
FT                   SSAHRIAEFLEGHSAVSWVKYPFLESHPQYDLAKRQMTGGGTVVTFELAGATKERAFEV
FT                   LDKLQIVDISNNLGDAKSLITHPATTTHRAMGPEGRAAIGLGDGVVRISVGLEGTEDLI
FT                   ADLDRALG"
FT   gene            complement(206866..207279)
FT                   /locus_tag="Mflv_0220"
FT   CDS_pept        complement(206866..207279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0220"
FT                   /product="Rhodanese domain protein"
FT                   /note="SMART: Rhodanese domain protein; KEGG: mkm:Mkms_0537
FT                   rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42715"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A4T152"
FT                   /protein_id="ABP42715.1"
FT                   /translation="MSYAGDITPEQAWKLLNENPDAVLVDVRTDAEWRFVGVPDLSGLD
FT                   RDVVYIEWNRTDGTRNAGFVDDLQAAGVTPGERPVVFLCRSGNRSIGAAEAATEAGIGP
FT                   SYNVLDGFEGNPDDNGHRGVTGWKAVGLPWRQS"
FT   gene            complement(207299..207760)
FT                   /locus_tag="Mflv_0221"
FT   CDS_pept        complement(207299..207760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0221"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0686 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42716"
FT                   /db_xref="GOA:A4T153"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A4T153"
FT                   /protein_id="ABP42716.1"
FT                   /translation="MMAEPQGNASDDSSSGSAIAPFLGALTIIVAVVIGIWLINVFSGE
FT                   ELTDAQQIARAASGQNDALQRGSYPDYQAFTCPEQHGDESKVLSEHQDSVAERGDRYVD
FT                   RVEGVDIEGDRATADVTYYFDGDREAKQTVEMSFVREDGTWKVCSTGPS"
FT   gene            complement(207762..208895)
FT                   /locus_tag="Mflv_0222"
FT   CDS_pept        complement(207762..208895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0222"
FT                   /product="formate-dependent phosphoribosylglycinamide
FT                   formyltransferase"
FT                   /EC_number="6.3.4.-"
FT                   /note="PFAM: ATP-dependent carboxylate-amine ligase domain
FT                   protein, ATP-grasp; KEGG: mva:Mvan_0685 ATP-dependent
FT                   carboxylate-amine ligase domain protein, ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42717"
FT                   /db_xref="GOA:A4T154"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:A4T154"
FT                   /protein_id="ABP42717.1"
FT                   /translation="MTEMETAHEGRTVVLLLGAGERTRELAPAFEHLGAQVVTADAAAD
FT                   AQTLTALIEQHAARYVVADLDTAEATNVATTGALHAIADRDDVEVFPTLRSIRFALDGE
FT                   ALRRLAADELGLPTAPFWFAGTVEELTAIGQHAGFPLVVKPVSGAPGEGESVLLRPEDV
FT                   EPAWQRAVAAGAPTRRRVIAESVVEVDVEVTLLTVRTAGPAGPTVSFCEPIGHHQSPEG
FT                   SLESWQPQQLSPVALDSAKSIAARIVNSLGGRGVFAVELLVRGDEVYFSDVRPRLQDSG
FT                   LVTLRSQRLSQFELHARAVLGLPVDTIMISPGAAEVTCSADADARLVLGEALAVAESDV
FT                   RVLRSEPPVRVSLATAPDPIVARDRARRVASALRRSV"
FT   gene            complement(208888..209382)
FT                   /locus_tag="Mflv_0223"
FT   CDS_pept        complement(208888..209382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0223"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: mva:Mvan_0684
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42718"
FT                   /db_xref="GOA:A4T145"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4T145"
FT                   /protein_id="ABP42718.1"
FT                   /translation="MQNGDRAQVEALIAADVRALSAASDAIGQSFAALHGLTASDFRAL
FT                   LHVTVAEDDGAPLTAGELRARMGTSGAAITYLVERMIESGHVLRDTDPTDRRKVMLRVA
FT                   DHGMAVARDFFSPLSAHTHAALADLPDEDLLAAHRVFAALTAAMVSFGAELGSGRLKTD
FT                   D"
FT   gene            209443..211479
FT                   /locus_tag="Mflv_0224"
FT   CDS_pept        209443..211479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0224"
FT                   /product="MMPL domain protein"
FT                   /note="PFAM: MMPL domain protein; KEGG: mva:Mvan_0683 MmpL
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42719"
FT                   /db_xref="GOA:A4T146"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A4T146"
FT                   /protein_id="ABP42719.1"
FT                   /translation="MSRRFSWVIALLVVLVSGALMGLLGGGDSSSQSPVAVPADSESAR
FT                   ADAARAALPGGDQVPAILVVTRTDSAPLGPADLAAVDGARDRMLAAAQSGPAGPPVQVS
FT                   DDGQAAVATVPMSSDLSGFDLTDTVTELRGAATDGLPEGLQAQVTGGPAFGADIANSFS
FT                   GANFTLLAVTAAVVALLLIITYRSPVLWLVPLLVIGFADRVAAVIGSAVAEALGMSPDG
FT                   STSGITSVLVFGAGTNYALLLISRYREELGRTDSHNDAIDTAVRRAGPAIIASNATVVL
FT                   ALLTLLFASSPSTRSLGVQAAAGLVVAAVFVLLVLPPALAVFGRKLFWPFIPAVGDQPL
FT                   TDSGVWHRIAAAVARRPARVAIVSIGGLALLCTGILGTPVGLSQTEQFRVEAESVRGFD
FT                   TLAAHFPSGLTDPTRVIATSDRSAEVQRAITATPGVVSAFPAGAEADGRSQWSVVLDAE
FT                   PASDEAFDTIDALRESVHRADPDALVGGSDATARDAAAAAGHDRAVVIPAILVVVLIVL
FT                   YVLLRSALAPLVLVGVTVLSSVAALGLGGWASVHLFGFPALDNTAPLFAFLFLVALGVD
FT                   YTIFLVTRAREETPGHGTRDGIVRAVSATGAVISSAGIVLAAVFCVLGVLPLIVLTQVG
FT                   IIVGLGILLDTFLVRTVIIPALFTLIGPKIWWPALRQETRSDA"
FT   sig_peptide     209443..209538
FT                   /locus_tag="Mflv_0224"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.572 at
FT                   residue 32"
FT   gene            211489..212709
FT                   /locus_tag="Mflv_0225"
FT   CDS_pept        211489..212709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0225"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: mva:Mvan_0682
FT                   cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42720"
FT                   /db_xref="GOA:A4T147"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A4T147"
FT                   /protein_id="ABP42720.1"
FT                   /translation="MSQATGEAAPDLPPLHMRRDGFDPTPHLREIREREGVRSVTNAFG
FT                   MQVYLFTRYDDIKTVLSDHSRFSNGRPPGFVVPGAPPVDEETQARARAGNLLGLDPPEH
FT                   QRLRRMLTPEFTHRRMQRLRPRIAEIVDTQIDALAAAGRPADLVEHFALPIPSLVICEL
FT                   LGVPYADRDDFQRRSARQLDLSIPIPERLELQREGREYMAALVAGARRHPGDDILGMLI
FT                   REHGGELTDDELIGVASLLLLAGHETTSNMLALGVLALLRHPDQLAAIRDDPAAVAPAV
FT                   EELLRWLSIVQTSIPRITTTDVEIAGVAIPAGQLVFASLPAGNRDPEFIEHPEVLDIGR
FT                   GAPGHLAFGHGVHHCLGAPLARMEMAIAFPALFRRFPSLEPAEDFADVAFRSFHFIYGL
FT                   KSLEVSW"
FT   gene            complement(212857..213540)
FT                   /locus_tag="Mflv_0226"
FT   CDS_pept        complement(212857..213540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0226"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0680 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42721"
FT                   /db_xref="GOA:A4T148"
FT                   /db_xref="UniProtKB/TrEMBL:A4T148"
FT                   /protein_id="ABP42721.1"
FT                   /translation="MTHPADRHLRRLTTPRAAAFAGVLFALLFGAALVLIRTELPGGGS
FT                   AGMQWEDGSTHRLRIAIVLMPFAGIAFLWFLGVVRDGLGTLEDRFFSTVMIGSALVFLA
FT                   MIFASTAVGAGLLAARQIAVPGTRSEVAAFGEGLLLALSNTYALRMAGVFMMSLATIWL
FT                   RTRLMPTWLVVLTYVVSLTVLVGSDVSKWMTVLFPVWVLIVSVMMLARAGVIDRRGATR
FT                   SPDTV"
FT   sig_peptide     complement(213406..213540)
FT                   /locus_tag="Mflv_0226"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.898) with cleavage site probability 0.194 at
FT                   residue 45"
FT   gene            complement(213556..214203)
FT                   /locus_tag="Mflv_0227"
FT   CDS_pept        complement(213556..214203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0227"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   mva:Mvan_0678 thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42722"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A4T141"
FT                   /protein_id="ABP42722.1"
FT                   /translation="MSSDFGLDPRRVDPEYDRHGGFPVFEAADPGPGFGRFLTAMRLAQ
FT                   DLAVSTDPDPETWNEAADRVEELVKLLDPYRAREGVGPSNRVPSLPGAGSLLMPPWTVT
FT                   KFEADGVELEVTFSRYHVGGNSAVHGGVLPLLFDSMFGMVIHATGRPISRTAFLHVDYR
FT                   RVTPIDTVLTARGWLREAEGRKAFVNAELLDAEGNVLAESNGLMIRLLPGQP"
FT   gene            complement(214200..215495)
FT                   /locus_tag="Mflv_0228"
FT   CDS_pept        complement(214200..215495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0228"
FT                   /product="Adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="PFAM: adenylosuccinate synthetase; KEGG:
FT                   mkm:Mkms_0526 adenylosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42723"
FT                   /db_xref="GOA:A4T142"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4T142"
FT                   /protein_id="ABP42723.1"
FT                   /translation="MPAIVLIGAQWGDEGKGKATDLLGGRVQWVVRYQGGNNAGHTVVL
FT                   PTGENFALHLIPSGILTPGVTNVIGNGVVVDPGVLLTELKGLEDRGVDTDRLLISADAH
FT                   LLMPYHVAIDKVVERYAGSKKIGTTGRGIGPCYQDKIARQGIRVADVLDPAVLAEKIEG
FT                   ALELKNQVLVKIYNRKALEPAEVVENLLEQAEGFKHRIADARLLLNEALERDEIVLLEG
FT                   SQGTLLDVDHGTYPYVTSSNPTAGGASVGSGIGPTRITTVLGILKAYTTRVGSGPFPTE
FT                   LFDEHGAYLAKTGGEVGVTTGRARRCGWFDAVIARYATRVNGITDYFLTKLDVLSSLET
FT                   VPICVGYTVDGKRTDEMPMTQSDIARAEPVYEELPGWWEDISGAREFDDLPAKARDYVL
FT                   RLEELAGAHVSCIGVGPGRDQTIVRRDILATS"
FT   gene            215621..216232
FT                   /locus_tag="Mflv_0229"
FT   CDS_pept        215621..216232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0229"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0676 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42724"
FT                   /db_xref="UniProtKB/TrEMBL:A4T143"
FT                   /protein_id="ABP42724.1"
FT                   /translation="MDPSSIAVVRPGARRVPRSLRDLPVLTGTGSDLSDDITGYRRLLV
FT                   VGSDRDLSAVLTKLLRADRLDIEVAHLRRPWAARAARTAPAGRVPLIRDETGTVIAGAA
FT                   LWLPPDGARTVRGEAIVDDERLFDGDVTGVRIEPTTAMPGLRATVLTGPMRPKRWISGR
FT                   AAQLGTSGAMVVRDGEPAKRPVRRSTFYRHTQGWLRVGRG"
FT   gene            216235..217005
FT                   /locus_tag="Mflv_0230"
FT   CDS_pept        216235..217005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0230"
FT                   /product="peptidase M50"
FT                   /note="PFAM: peptidase M50; KEGG: mva:Mvan_0674 peptidase
FT                   M50"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42725"
FT                   /db_xref="GOA:A4T144"
FT                   /db_xref="UniProtKB/TrEMBL:A4T144"
FT                   /protein_id="ABP42725.1"
FT                   /translation="MVSLVGVRPSPVFAALVAVTAAGGALAWTSGDDVRPLSYAAVFVL
FT                   VIFGWLVTLCLHEFGHAYSAYRFGDRDVAVRGYLTLNPLKYTHPLLSLGLPVLFIALGG
FT                   IGLPGGAVYVQTALMTDRQKTVVSLAGPAVNLLFAVLLLGLTRPMYDPAHAVFWAGVAF
FT                   LGFLQVTAFVLNMLPIPGLDGYGALEPHLSPETRRALAPARQWGFFILLILLIAPPLNQ
FT                   WFFAAVYWLFELSGVDVYLSQLGGGLTRFWSPWL"
FT   sig_peptide     216235..216318
FT                   /locus_tag="Mflv_0230"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.981) with cleavage site probability 0.756 at
FT                   residue 28"
FT   gene            217027..217950
FT                   /locus_tag="Mflv_0231"
FT   CDS_pept        217027..217950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0231"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   mva:Mvan_0673 cation diffusion facilitator family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42726"
FT                   /db_xref="GOA:A4T136"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:A4T136"
FT                   /protein_id="ABP42726.1"
FT                   /translation="MRIYFWPMGAGHDHSHGGGDTKVSRMVIAAGILTIFFVVELTTAL
FT                   AINSIALLADAGHMLTDLVSMFMGLTAVLLAKRGSASPSRTYGWHRAEVFTAVANAALL
FT                   LGVAGFILYEAVERLGDAPDVPGVPMIVVALAGLLANLIVVLLLRSHSKESLAVKGAYM
FT                   EVVADTVGSIGVLIAGIVTVTTAWPYADVVVAVLVALWVLPRAIALARAALRILSESSP
FT                   AHIDVDELRDALCAVDGVTEVHDLHVWTLVPGKDMVTAHLTSVRESAAVLDDARAVLTA
FT                   RGLGHATVQVEPPDSAADCECETEKR"
FT   gene            complement(217947..218372)
FT                   /locus_tag="Mflv_0232"
FT   CDS_pept        complement(217947..218372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0232"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0672 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42727"
FT                   /db_xref="InterPro:IPR014487"
FT                   /db_xref="UniProtKB/TrEMBL:A4T137"
FT                   /protein_id="ABP42727.1"
FT                   /translation="MGHMTRMGDLLGPEPVLLPGDPAAEAELDAAENPSIVAAAHPAAS
FT                   IAWAVLAEQALEADQAVAAYAYARTGYHRGLDSLRRNGWKGFGPVPFAHEPNQGFLRCV
FT                   AALARAADAIGETPEYQRCLDLLDDCDPAARGRLGLG"
FT   gene            218407..219186
FT                   /locus_tag="Mflv_0233"
FT   CDS_pept        218407..219186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0233"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0671 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42728"
FT                   /db_xref="GOA:A4T138"
FT                   /db_xref="InterPro:IPR024267"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A4T138"
FT                   /protein_id="ABP42728.1"
FT                   /translation="MDKLRGMSNAPGPDGEDDAPAESSEAETEVLPGTDAEHEPATEVF
FT                   APAEPQDGDPSDDAGERRFTAPSGFDAGSTQVINRPHELPTEAFAAHKPAAPQMIPPRG
FT                   ETPKPPKTGRRNWGWVIAIILVIAALAAAAVVGTLLLTRGSATSVSQEDSVRTAIQNYD
FT                   AAIEKGDLATLRSITCGATAESYNKFDERQWKDTHSRVAEAGRYPVVASIDEIVINGDH
FT                   AEANVTTFMAFAPQTRSTRSFDLQFRDDQWKICQAPQ"
FT   gene            complement(219313..220350)
FT                   /locus_tag="Mflv_0234"
FT   CDS_pept        complement(219313..220350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0234"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="KEGG: mva:Mvan_0670 fructose-bisphosphate aldolase,
FT                   class II; TIGRFAM: ketose-bisphosphate aldolases;
FT                   fructose-bisphosphate aldolase, class II; PFAM:
FT                   ketose-bisphosphate aldolase, class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42729"
FT                   /db_xref="GOA:A4T139"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A4T139"
FT                   /protein_id="ABP42729.1"
FT                   /translation="MPIATPEVYAEMLARAKEHSFAFPAINCVGSESVNAAIKGFADAG
FT                   SDGIIQFSTGGAEFASGLGVKDMVTGAVALAEFAHVIAEKYPITVALHTDHCPKDKLDT
FT                   YVRPLLAISSERVQAGRNPLFQSHMWDGSAVPIDENLSIAQELLKQAAAAKIILEIEIG
FT                   VVGGEEDGVEAEINDKLYTTPEDFEKTIEALGVGEHGKYLLAATFGNVHGVYKPGNVKL
FT                   KPEVLAEGQKVASAKLGLEDGSKPFDFVFHGGSGSLKSEIEDSLRYGVVKMNVDTDTQY
FT                   AFTRPVAAHMFSNYDGVLKVDGEVGNKKVYDPRSYFKKAEASMAERVVEACNDLHSAGR
FT                   SVSAG"
FT   gene            220592..221422
FT                   /locus_tag="Mflv_0235"
FT   CDS_pept        220592..221422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42730"
FT                   /db_xref="UniProtKB/TrEMBL:A4T140"
FT                   /protein_id="ABP42730.1"
FT                   /translation="MTKTRSTLSASSATLFVAAVALSGVAAPTAQASPLDGIRAAVNAA
FT                   RSGSPCGPLNYNIDLEGNAQAMVGNRSPGVPPAGRYNGKTAEGDSQEDPTSEAIRVLVD
FT                   KMRPLITNCAYKDFGVGMVRNDDREFSVVSLALGEPPAAPPPPPAAQKPIRCTGGGTVP
FT                   AGQTCPPKPPPAAVEQAPTNAVTLDIVREGLRAKVTVGNTSNLRAQCTYNATEVNGLGI
FT                   PVSREFEVNPKGTTPLEFAAPLPGQTYTVVVACRADFNGQNVEIGRVQQDFSSF"
FT   sig_peptide     220592..220690
FT                   /locus_tag="Mflv_0235"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.999 at
FT                   residue 33"
FT   gene            complement(221436..222449)
FT                   /locus_tag="Mflv_0236"
FT   CDS_pept        complement(221436..222449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0236"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   mva:Mvan_0669 alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42731"
FT                   /db_xref="GOA:A4T132"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4T132"
FT                   /protein_id="ABP42731.1"
FT                   /translation="MPTHKAVHVAGANEDLTLVEVETAPPPPGHVRLAVKACGVCGTDR
FT                   EFRAGHFPGLQWPLTLGHEIAGAVAEVGDGVEDFSVGDRVAVGWFGGNCNRCIPCRRGS
FT                   FMQCERMQVPSWHYPGGYAESVTVPWTALARIPDGLSFVEAAPMGCAGVTTFNGLRQTR
FT                   AKAGDVVAVLGVGGLGHLGVQWSRAMGFETVAIARGTGKAEEARELGAHHYIDSTGQDV
FT                   AAELKKLGGAAVVLATANNAEAMAATVGGLGPAGELVVVGVSADNLPISPLHLINDGLS
FT                   VTGHPSGTSRDVEETLHFAMLSGVRARVEEVPLAQPAEAYEAMDSSRARYRMVLTV"
FT   gene            222483..223193
FT                   /locus_tag="Mflv_0237"
FT   CDS_pept        222483..223193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0237"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0668 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42732"
FT                   /db_xref="GOA:A4T133"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:A4T133"
FT                   /protein_id="ABP42732.1"
FT                   /translation="MVVDNLALMPDFLDPINLLSYFGTWALIGLLVVVFVESGVLFPIL
FT                   PGDSLLFVAGMLAAGISAQSAEGNVAVVNFQLWQLLVFIPIAAVLGAQVGYWIGRNVGT
FT                   AMFTPNARFLKQKYLDEAHLFFEQRGPFAIVIARFVPIVRTLAPITAGAAKMNYAVFTL
FT                   YNAVGAIVWGVGLTLLGFFLGRIEIIQKLLEPIVIGIVILSVLPIAIEWYKRRKAAKQA
FT                   GIATPPMEAGEQAG"
FT   gene            complement(223190..225043)
FT                   /locus_tag="Mflv_0238"
FT   CDS_pept        complement(223190..225043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0238"
FT                   /product="sodium/proton antiporter, NhaA family"
FT                   /note="PFAM: DSBA oxidoreductase; Na+/H+ antiporter NhaA;
FT                   KEGG: mva:Mvan_0667 Na+/H+ antiporter NhaA; TC 2.A.33.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42733"
FT                   /db_xref="GOA:A4T134"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4T134"
FT                   /protein_id="ABP42733.1"
FT                   /translation="MTVTEPATQRGFPLLPSRLSRGSKATRTTDNTAAALLLTFTVVAI
FT                   LWANSPWAHTYSALLDTHVGFSFGSHHAEMTVKHVVNDALMTFFFFIVGLEVTREFTIG
FT                   ELTDRSRAAVPVVAAAAGLILPAVVFLAFNPSGENAHAWGVVISTDTAFLVGALAIIKP
FT                   KFPARVRLFLLTLAVVDDVGALIAIAVLYSDNIQVAPLVVAVALLGALALVRYLPKARG
FT                   PAYAVLGAALWIALYLAGIHPTLAGVAVALLIPVFTPERAPVERAVQQIRAFRQSPNSR
FT                   YARAASRSLRDSISINERLQTAVSPVVSFVILPLFALVNAGVLLDGPSLTAALRSPLTW
FT                   GIVAGLVVGKFVGIAGATWLIRRTGLGVLAPGLTLRRIAGGAALSGIGFTISLFIVDIA
FT                   IDDPSRQDQARIGVLAASVLAFALGWAIFRITDWLSPPEPVGLKLLRPIDPERDHVRGR
FT                   PDAPLTLVEYGDFECPFCSRVTGAIDEVRAHFGDDLLYVWRHFPLERAHPRAFDAARAS
FT                   EAAALQGRFWEMTHELFTHQDDLEWSDMYRYAVAAGCDIEQFDQDVRVHSSKVLHRVSD
FT                   DAEDADAMDLNATPTLFVNGKRHRGPWDAASLIRALEAGRG"
FT   gene            complement(225030..226163)
FT                   /locus_tag="Mflv_0239"
FT   CDS_pept        complement(225030..226163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0239"
FT                   /product="glycoside hydrolase, family 76"
FT                   /note="PFAM: glycoside hydrolase, family 76; KEGG:
FT                   mva:Mvan_0666 glycoside hydrolase, family 76"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42734"
FT                   /db_xref="GOA:A4T135"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR014512"
FT                   /db_xref="UniProtKB/TrEMBL:A4T135"
FT                   /protein_id="ABP42734.1"
FT                   /translation="MDQMWANRAASAEAAITTRHLRRVWGLPGTQLGVVAWPAATGHRR
FT                   FGTWHYWWQAHLLDNLVDAQLRDPAPERLTRINRQIRGQRIRNIGKWTNSYYDDMAWLA
FT                   LALERAQRLTGVGRPKALDTLAEQFLTAWVPEDGGGIPWRKQDQFFNAPANGPAAIFLA
FT                   RHLAAQGESLRRAQQMADWIDETLLDPQTHLIFDGIKGGSLVRAQYTYCQGVVLGVETE
FT                   LAARTSDSRHAERVHRLVAAVAEHMAPGGVINGAGGGDGGLFNGILARYLALVATALPG
FT                   TSPADEQARRTATELVLASGRAAWDNRQTGKDTEDLPLFGAFWDRPAQVPTAGTADARS
FT                   VDGAVNSSEIPERDLSVQLAGWMLMEAACVVTAGDSD"
FT   gene            226237..226779
FT                   /locus_tag="Mflv_0240"
FT   CDS_pept        226237..226779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0240"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mva:Mvan_0665
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42735"
FT                   /db_xref="GOA:A4T129"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A4T129"
FT                   /protein_id="ABP42735.1"
FT                   /translation="MALSRDDLLRAAADFLGRRPNATQDEIAAAVGVSRATLHRHFAGR
FT                   PALMAALEELAVAEMRDVLEDARLQEDSAIDALRRLVTACEPVSPYLALLYSQSQELDF
FT                   DSTLDAWQEIDTAITDLFLRGQRDGDFRPELPAAWLTEALYGLIGGTAWSVRAGRAAAR
FT                   DFNRLILDLLLNGATPR"
FT   gene            226776..228377
FT                   /locus_tag="Mflv_0241"
FT   CDS_pept        226776..228377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0241"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mva:Mvan_0664 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42736"
FT                   /db_xref="GOA:A4T130"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4T130"
FT                   /protein_id="ABP42736.1"
FT                   /translation="MSRRWLALGVLTLAVLLIGVDGTVLALATPFISADLGATGTELLW
FT                   IGDIYSFVLAALLVTMGSLGDRVGHRKLLLCGATAFSAVSALTAYSTSPEMLIGTRALL
FT                   GMAGATLAPATLALIRGLFPDSRERSIAVGIWASAFSAGAALGPVVGGVLLEHFWWGSV
FT                   FLINIPVMVILLVGGLVLLPEHRDPDPGPWDLPSVALSMVGMLGIVYAIKEGFTGLVHG
FT                   LGAEVVIAAAVGVAALTLFVRRQLRLPHPLIDVRLFANPRFSGVVGANLFSVLGLSGLV
FT                   FFLSQYFQLVHGYGPLKAGLAELPAAVTATVFGVLAGVAVRYFSHRSVLTTGLALVGTA
FT                   MAALMASLLIFRPLTPYLPLGISLFVVGVGLGLAFTVASDVILASVPKERAGAAAAVSE
FT                   TAYELGMALGIAVLGSILTAVYRTVTIPAGVPADAAAQARDSLPKAIDAARGLPDAAQS
FT                   ALLESAKESFTLGLSVSAGVGAALLLTSAVAVWWLLRSPGPAEVGVLPDPGVHHDARGD
FT                   GGVDTAGGAELGNRHS"
FT   sig_peptide     226776..226856
FT                   /locus_tag="Mflv_0241"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.999) with cleavage site probability 0.790 at
FT                   residue 27"
FT   gene            complement(228261..228908)
FT                   /locus_tag="Mflv_0242"
FT   CDS_pept        complement(228261..228908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0242"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   mva:Mvan_0663 tRNA/rRNA methyltransferase (SpoU)"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42737"
FT                   /db_xref="GOA:A4T131"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A4T131"
FT                   /protein_id="ABP42737.1"
FT                   /translation="MAEPPGPTEWGGDGHGVGPWSGPPPDDPRYDPALLRDGDSRNVVD
FT                   AYRYWTREAIIADIDTRRHPLHVAIENFGNDANIGGVVRTANAFAVDTVHIVGRRRWNR
FT                   RGAMVTDRYQRLCHHDTTAGLLGFAAEAGLTVVAVDNVPGAVRVEEVSLPRECLLIFGA
FT                   EGPGITEDAKTGAALAVSIAQFGSTRSINASVAAGIVMHAWIRQHADLSRAW"
FT   gene            complement(228901..229803)
FT                   /locus_tag="Mflv_0243"
FT   CDS_pept        complement(228901..229803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0243"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0662 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42738"
FT                   /db_xref="UniProtKB/TrEMBL:A4T124"
FT                   /protein_id="ABP42738.1"
FT                   /translation="MPVRLIALLAALVLAVASCSGDSADRRDVFSVPTATLGESQTLLG
FT                   WNMSVANLRFEAEYVLVDVDAAPAREGEPHAAPEDLRFGLYGALVHPLEADGLGSCEDV
FT                   TSLGVNPVSASPDRMSGTVCIGPLRDRSQVRGVYAYSPRDRIAETTVAYPAAFPVGVLP
FT                   TNSSETGLSVKTSSVDAFRADGAQLNPTALGDPAAFTGNGYMLLGLEVDGLAARYRDDS
FT                   AQRGGPMMVLTAPTIPGKGLSHACDVYGSSVLVLPEASREAVQLRASLCTQGEINAALL
FT                   YATVSLVGTHAALWTTDDG"
FT   sig_peptide     complement(229732..229803)
FT                   /locus_tag="Mflv_0243"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.976) with cleavage site probability 0.302 at
FT                   residue 24"
FT   gene            complement(229804..230580)
FT                   /locus_tag="Mflv_0244"
FT   CDS_pept        complement(229804..230580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0244"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mva:Mvan_0661 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42739"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4T125"
FT                   /protein_id="ABP42739.1"
FT                   /translation="MTRPVALITGPTSGLGEGFARRYAVDGYDLVLVARDESRLNTLAA
FT                   ELRDEAGTAVEVIRADLADDADRALVADRLRAGVQVLVNNAGFGTSGEFWTTDYAVLQS
FT                   QLDVNVTAVMQLTHAALPSMLDAGRGTVLNVASVAGLLPGRGSTYSASKAWVVSFTEGL
FT                   ANGLDGTGVGVHALCPGFVHTEFHERAGIDMAGTAGFLWLEVDDVVRETMADVAKNRVV
FT                   IIPGLQYKALTTGGRLVPRNVVRALTKVVGKGRGRT"
FT   gene            complement(230706..231392)
FT                   /pseudo
FT                   /locus_tag="Mflv_0245"
FT   gene            complement(231581..234127)
FT                   /locus_tag="Mflv_0246"
FT   CDS_pept        complement(231581..234127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0246"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: AAA ATPase, central domain protein; Clp N
FT                   terminal domain protein; ATPase associated with various
FT                   cellular activities, AAA_5; ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase; KEGG: mva:Mvan_0659 ATPase AAA-2 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42740"
FT                   /db_xref="GOA:A4T126"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A4T126"
FT                   /protein_id="ABP42740.1"
FT                   /translation="MDSFNPTTKTQAALTSALQAATAAGNPQITPAHLLMALLTQNDGI
FT                   AAPLLEAVGVEPATIRAETQRLLDRLPSATGSASQPQLSPPAIAAITAATHLATEMDDE
FT                   YVSTEHLLVGLATGDSDVAKVLTGHGASPQALREAFVKVRGSARVTNPDPEGTYQALEK
FT                   YSTDLTARAREGKLDPVIGRDHEIRRVVQVLSRRTKNNPVLIGEPGVGKTAIVEGLAQR
FT                   IVAGDVPESLRDKTVVSLDMGSMVAGAKYRGEFEERLKAVLDDIKNSAGQIITFIDELH
FT                   TIVGAGATGESAMDAGNMIKPMLARGELRLVGATTLDEYRKYIEKDAALERRFQQVLVG
FT                   EPSVEDTVGILRGLKDRYEVHHGVRITDSSLVAAATLSDRYITSRFLPDKAIDLVDEAA
FT                   SRLRMEIDSRPVEIDEVERLVRRLEIEEMALAKEEDAASKDRLEKLRAELADKKEQLAE
FT                   LTTRWQNEKSAIDVVRELKEQLESLRGEADRAERDGDLAKAAELRYGRIPEVEKKLDAA
FT                   LPHAEARENVMLKEEVGPDDIAEVVEAWTGIPAGRMLEGETAKLLRMEEELGKRVVGQR
FT                   KAVTAVSDAVRRSRAGVADPNRPTGSFMFLGPTGVGKTELAKALAEFLFDDERAMVRID
FT                   MSEYGEKHSVARLVGAPPGYVGYDQGGQLTEAVRRRPYTVILFDEIEKAHPDVFDVLLQ
FT                   VLDEGRLTDGQGRTVDFRNTILILTSNLGAGGSEEQVMAAVRAAFKPEFINRLDDVIMF
FT                   DALDPEQLVSIVDIQLEQLAKRLAQRRLTLEVSLPAKKWLAERGFDPLYGARPLRRLVQ
FT                   QAIGDQLARMLLSGQVHDGDVVPVNLSADGDSLVLG"
FT   gene            234309..234932
FT                   /locus_tag="Mflv_0247"
FT   CDS_pept        234309..234932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0247"
FT                   /product="adenylate cyclase"
FT                   /note="KEGG: mva:Mvan_0658 narrowly conserved hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42741"
FT                   /db_xref="InterPro:IPR012042"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:A4T127"
FT                   /protein_id="ABP42741.1"
FT                   /translation="MSDSGIGDFEFERKFFVRDMPAVAASDPSPVLIAQAYLFASDGYA
FT                   VRVRLQGPAPADLDREVSDLVTALGDDAIGTMTAKGPAAGGTRYEAERELDPLVAGQIV
FT                   TRAAHVVLKIRSSVWLGEDGWVIDRFLGGNAPLVLTEVERDGPVVDLAIPSFCTTEVSE
FT                   DDRFRNEYLAHHPFGGWAEAYGRELDLIGPRFVDSLGQNQFEGT"
FT   gene            235060..236562
FT                   /locus_tag="Mflv_0248"
FT   CDS_pept        235060..236562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0248"
FT                   /product="Na+/solute symporter"
FT                   /note="PFAM: Na+/solute symporter; KEGG: pcr:Pcryo_1604
FT                   Na+/solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42742"
FT                   /db_xref="GOA:A4T128"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A4T128"
FT                   /protein_id="ABP42742.1"
FT                   /translation="MFHPSNLSPGIGIALMLGLGALMFVVAFAVRTMVRNTHDFVIADR
FT                   RIGFGFGVGSVIAVWTWSMAVMMSSAQAFSFGTSGLLWFVVPNGLAVMVMVPFALRLRR
FT                   QMPAGYTIVEFIRQRFQNKPATTVMLVAMLLGLLAEIFINLFGVVLVMGVVFGLDPTAV
FT                   LILTLLTVTVYSYFGGLWTSAITATFNTLLITVPAAIVVLFVLQKVGGPELVFQKVDEA
FT                   GANTLDAFDGSAAAAFGISLALGLLASTMADQTFWQKAWALKPASMGRTFVWAGLWFYP
FT                   IPIVLGLLGLVGLGFGVTPEDLGDAGAGGIGPYVISHLGLPVILIALYVLIILNACYSS
FT                   IDGAFSALSSVVAVDILKQAKPDIAPKSLFRYTKTSILVAGVIGGIVVSSGIDYVELVT
FT                   TVFFLKAALIIPLGLAIFWKRMTSTAFVASLVLAIAVGYPVRQYVGELAGIITLEGISL
FT                   VAAVGISLLSRQTFDYGSLRRGDALAGDVITEAPVAEPDPVR"
FT   sig_peptide     235060..235149
FT                   /locus_tag="Mflv_0248"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.949) with cleavage site probability 0.737 at
FT                   residue 30"
FT   gene            236559..236879
FT                   /locus_tag="Mflv_0249"
FT   CDS_pept        236559..236879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42743"
FT                   /db_xref="GOA:A4T120"
FT                   /db_xref="UniProtKB/TrEMBL:A4T120"
FT                   /protein_id="ABP42743.1"
FT                   /translation="MIAFWIAVIAGVAIGIVYVALGIQTFLRVRRDILTSDGDAGPDSA
FT                   GELEGAATTFTWKAGAAVIASTSVIVLLGVDSVFWYLPAILAIGSAVAVTVAFLIDRRV
FT                   AA"
FT   gene            236876..238204
FT                   /locus_tag="Mflv_0250"
FT   CDS_pept        236876..238204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0250"
FT                   /product="thermophilic desulfurizing enzyme"
FT                   /note="KEGG: oih:OB2778 thermophilic desulfurizing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42744"
FT                   /db_xref="GOA:A4T121"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A4T121"
FT                   /protein_id="ABP42744.1"
FT                   /translation="MTDSAKRKAHLLGFVQHGVMNHASTMWAHPRDKVGYHWSRPEYWR
FT                   DLGRTMERGLFDAMFIADELAPYTTYKGSSDPVVKFAGQCPVHEPASVVPIVGAFTKHL
FT                   GIGITLSTSFVPPYMMARQLSTLDHLTGGRVGWNIVTSYSKSEFQAMGKENLTPRDKRY
FT                   EVVEEYMQLLYQLWDSWDDDAIVYDRDNGVFADPAKVREVNFQGEFFQSRGRHFVAPSP
FT                   QKRPVLWQAGSSAQGREFASRHAESVFGIFPTPKSMRAYATDIRTRASDAGRDPESVKL
FT                   IYGLQTIIDRDKGRANDRYAEFVENVQIESALGILSGHTGFDFSTLGLDDNVVDADVQG
FT                   IRGLFDAILEAKDGAPVTVREAAQIYGVSMGAPVAVGTPADVADQMEQYLDEGDCNGFM
FT                   MLATDTPGCFNDMTELLVPELQKRGRFRTRYPGTTLRESLREY"
FT   gene            complement(238227..238580)
FT                   /locus_tag="Mflv_0251"
FT   CDS_pept        complement(238227..238580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0251"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="KEGG: mkm:Mkms_5271 glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42745"
FT                   /db_xref="GOA:A4T122"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:A4T122"
FT                   /protein_id="ABP42745.1"
FT                   /translation="MSLTHVLAVVHVTDVDAGRRWYATLFGRPEGNNPMPTLVEWQVLP
FT                   GAWVQVFLDPDRAGTDELNFAVDDLDRHVRELRARGLEPGDIVDASNGVRLSRMPDPDG
FT                   NVVTLIGGFRVVY"
FT   gene            238682..239359
FT                   /locus_tag="Mflv_0252"
FT   CDS_pept        238682..239359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0252"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0642 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42746"
FT                   /db_xref="GOA:A4T123"
FT                   /db_xref="InterPro:IPR021315"
FT                   /db_xref="UniProtKB/TrEMBL:A4T123"
FT                   /protein_id="ABP42746.1"
FT                   /translation="MPGTWGSILIELIPLALVIALSPLSIIPAVLVLSAARPRPTGLAF
FT                   LAGWVLGLAALTAVFLQLSDLVGGIGTKPPSWASWLRIVVGVLLILWGAYRWLKRASSE
FT                   HMPGWMTRISALTPAKAAATAAALTVLNVKVLFICAAAGLAIGSSGLDTPTVWAAVLWF
FT                   VLVAASTVAAPIVAYAISGERLDPTLNRVQAWMERQHATLIAAILVVIGLLVLYKGIHA
FT                   LAG"
FT   sig_peptide     238682..238786
FT                   /locus_tag="Mflv_0252"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.639) with cleavage site probability 0.403 at
FT                   residue 35"
FT   gene            complement(239348..239974)
FT                   /locus_tag="Mflv_0253"
FT   CDS_pept        complement(239348..239974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0253"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mva:Mvan_0641
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42747"
FT                   /db_xref="GOA:A4T115"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041678"
FT                   /db_xref="UniProtKB/TrEMBL:A4T115"
FT                   /protein_id="ABP42747.1"
FT                   /translation="MPPPAQTGRRRGRRKGDPVSRETVLAAAKGRFARDGFEKTTLRAI
FT                   AEDAGVDASMVLYLFGSKEALFRESLRLILDPGVLIEALSGGEADIGTRMVRAYLGVWE
FT                   SPESAESMRTMLASATSNPDAREAFRGFIQDYVLAAVVGTLGGDDRARLRAMLAASSLV
FT                   GTAMMRYLMEIPPLSELATEDVIRLVAPTVTRYLTAPADELGLPG"
FT   gene            240073..241086
FT                   /locus_tag="Mflv_0254"
FT   CDS_pept        240073..241086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0254"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0640 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42748"
FT                   /db_xref="GOA:A4T116"
FT                   /db_xref="UniProtKB/TrEMBL:A4T116"
FT                   /protein_id="ABP42748.1"
FT                   /translation="MSSAVSHRVTHAHAHHPPAGARAAGIVLAITALLAVVTVAFALPA
FT                   TRSAPHDVPIGAAGPQSAGGRIADVLEQKAPGAFDVTFYPGEEALRDAIRRGDVYGGIA
FT                   LPGSPGDQPAMLIATQAGPAVAQVLTQLGTEISRQTGMPLTTEDLAPPTARDPRGVGLA
FT                   ASALPLTLAGILPAIALLLALRREVWIRYAAAVVFSGLAGITTAALLRFTLGAIDHNFW
FT                   AVAAALSLGVAAAVLSVLGLGSLFGRAGLGAGAALALLVGNPLSGLASAPEMLPAGWGQ
FT                   FGQLLPQGATATLLRSAAAFGGAGATTAITVLTCWIVFGTALVAAAAVRARAVPAQ"
FT   sig_peptide     240073..240201
FT                   /locus_tag="Mflv_0254"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.979) with cleavage site probability 0.568 at
FT                   residue 43"
FT   gene            241127..242269
FT                   /locus_tag="Mflv_0255"
FT   CDS_pept        241127..242269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0255"
FT                   /product="Oxidoreductase FAD-binding domain protein"
FT                   /note="PFAM: globin; oxidoreductase FAD/NAD(P)-binding
FT                   domain protein; Oxidoreductase FAD-binding domain protein;
FT                   KEGG: mva:Mvan_0639 oxidoreductase FAD-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42749"
FT                   /db_xref="GOA:A4T117"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A4T117"
FT                   /protein_id="ABP42749.1"
FT                   /translation="MRILREAFEPGPGSERLVGEFYTRWFAADLTARDLFPPDMAGQRQ
FT                   VFAHAMRWLCDELIAQRAEEPVAFLAQLGRDHRKYGVTPEHYAGLQDALLAAVRTTLTD
FT                   RWDARLEEAATDVVTLAVGVMSGAGEAETAPPFCDGTVLEHLRPTRDVSVIRLKMDHHI
FT                   DYHAGQYVSVQVPQWPRRWRFLSPAIPADPQGYVEFHVRSVAGGMVSTTILGETRPGDR
FT                   WRLAAPHGAMHVDREAGDVLMVAGSTGLAPLRALIMDMCRFAANPRVHLFFGAKYPCEL
FT                   YDLPTLWEVASMNPWLSVTPVSEFDFDPPWAAEYPDNRPPRGLHVRQTGRLDEVVTRYG
FT                   SWGDRQILVCGRPEMVAATRSALIAKGAPAERIQHDPLGN"
FT   gene            242294..243196
FT                   /locus_tag="Mflv_0256"
FT   CDS_pept        242294..243196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0256"
FT                   /product="Aldose 1-epimerase"
FT                   /note="PFAM: Aldose 1-epimerase; KEGG: mva:Mvan_0638 aldose
FT                   1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42750"
FT                   /db_xref="GOA:A4T118"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="UniProtKB/TrEMBL:A4T118"
FT                   /protein_id="ABP42750.1"
FT                   /translation="MEEFETVTLRDPSSALTATYVPIAGMVATSLSDDGVELLGQRRGL
FT                   QAYVSNHKTMGIPILYPWANRLSSMGYGVDGAVVTLTPGTGGVRTDQHGVPIHGTLGGY
FT                   RDWTVTTLLESQLTAELDFAARPALLATFPFPHLLTLDITLADRTLTVTTTVTATTGAR
FT                   VPLCFGFHPYLQLPGVPRSQWQIETPAMRYQPVNAWGIPTGRVEQRPAATEVLGDKFID
FT                   DGFDEVPAGSVFALSGGDRRIEVHFDQGYTAAQVYAPGDDDVVCFEPMAAATDALRRGG
FT                   YHEVQPGESAVARFRIKVS"
FT   gene            complement(243275..243637)
FT                   /locus_tag="Mflv_0257"
FT   CDS_pept        complement(243275..243637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0257"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein, MerR; KEGG: mva:Mvan_0637
FT                   putative transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42751"
FT                   /db_xref="GOA:A4T119"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A4T119"
FT                   /protein_id="ABP42751.1"
FT                   /translation="MSGRKEEARTFLISVAAELAGMHAQTLRTYDRLGLVSPQRSSGGG
FT                   RRYSQRDVDLLREVQRLSQDEGVNLAGIKRIIELTNQVEALQSRVRELTNEVEHLRSQP
FT                   RPKSTALVVWQPRHQR"
FT   gene            complement(243637..244821)
FT                   /locus_tag="Mflv_0258"
FT   CDS_pept        complement(243637..244821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0258"
FT                   /product="chaperone protein DnaJ"
FT                   /note="TIGRFAM: chaperone protein DnaJ; PFAM: DnaJ central
FT                   domain protein; heat shock protein DnaJ domain protein;
FT                   chaperone DnaJ domain protein; KEGG: mva:Mvan_0636
FT                   chaperone protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42752"
FT                   /db_xref="GOA:A4T110"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A4T110"
FT                   /protein_id="ABP42752.1"
FT                   /translation="MAQREWVEKDFYKVLGVASDADEKEIKRAARKILAENHPDRNPGN
FT                   SAAEERYKEASEAKEVLTDPAKRKEYDETRRLFAGGGFGRGRYSGGGGGFGGFGGDGAQ
FT                   EFNLNDLFDAAGQAGGANIGDLFGGLFGRGAQQPRPSRPRRGNDLETETELSFLEATKG
FT                   VAMPLRLTSPAPCTNCHGSGARPGTSPRVCANCNGAGVVSRNQGAFGFSEPCTECRGSG
FT                   SIIDNPCDECKGTGVTTRTRTINVRIPPGVEDGQRIRLAGQGEAGLRGAPSGDLYVTVH
FT                   VKPDKVFGRNGDDLTVSVPVSFHELALGTTLSVPTLEGKVGVRVPKGTSDGRILRVRGR
FT                   GVPKRAGGHGDLLVTVKVAVPPNLEGEAAEALETYAKAERASGFDPRAGWAGNI"
FT   gene            complement(244867..245484)
FT                   /locus_tag="Mflv_0259"
FT   CDS_pept        complement(244867..245484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0259"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: mva:Mvan_0635 GrpE
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42753"
FT                   /db_xref="GOA:A4T111"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:A4T111"
FT                   /protein_id="ABP42753.1"
FT                   /translation="MSDADRVEEPITVTDKRRIDPDTGQVRENPSEPAPSGPATDEFAG
FT                   ETEEEAGKAAELLADLQRVQADFSNYRRRTLRDQQVIADRAKASVITQLLPVLDDLDRA
FT                   RSHGDLDSGPLKAVADKIVTTLEGLGLSGFGEEGDEFDPELHEAVQHEGEGTHPVLGSV
FT                   MRRGYKVGDVVVRHAMVGVVDTVPDASGSGNADSGAQQPSES"
FT   gene            complement(245481..247349)
FT                   /locus_tag="Mflv_0260"
FT   CDS_pept        complement(245481..247349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0260"
FT                   /product="chaperone protein DnaK"
FT                   /note="TIGRFAM: chaperone protein DnaK; PFAM: Heat shock
FT                   protein 70; KEGG: mva:Mvan_0634 chaperone protein DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42754"
FT                   /db_xref="GOA:A4T112"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4T112"
FT                   /protein_id="ABP42754.1"
FT                   /translation="MARAVGIDLGTTNSVVAVLEGGDPVVVANSEGSRTTPSVVAFARN
FT                   GEVLVGQPAKNQAVTNVDRTIRSVKREIGTDWSVEIDGKNYTPQEISARVLMKLKRDAE
FT                   SYLGEDITDAVITVPAYFNDAQRQATKDAGQIAGLNVLRIVNEPTAAALAYGLDKGEKE
FT                   QTILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLGGDDWDDRIVEWLVDKFKGTSGI
FT                   DLTKDKMAMQRLREAAEKAKIELSSSQSTSINLPYITVDADKNPLFLDEQLTRSEFQKI
FT                   TQDLLDRTRKPFQSVIKDAGISVGEIDHVVLVGGSTRMPAVSELVKEMTGGKEPNKGVN
FT                   PDEVVAVGAALQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKRSET
FT                   FTTADDNQPSVQIQVFQGEREIASHNKLLGSFELTGIPPAPRGVPQIEVTFDIDANGIV
FT                   HVTAKDKGTGKENTIKIQEGSGLSKEEIDRMIKDAEAHADEDRKRREEADVRNQAESLV
FT                   YQTEKFVKEQREAEGGSKVPEDTLTKVDAAISDAKAALAGTDIAAIKSAMEKLGEESQA
FT                   LGQAIYEATQAEQAAGGAPGGESTGASNSGDDVVDAEVVEDDQERK"
FT   gene            complement(247534..247956)
FT                   /locus_tag="Mflv_0261"
FT   CDS_pept        complement(247534..247956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0261"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding protein"
FT                   /note="KEGG: mva:Mvan_0633 pyridoxamine 5'-phosphate
FT                   oxidase-related, FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42755"
FT                   /db_xref="GOA:A4T113"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:A4T113"
FT                   /protein_id="ABP42755.1"
FT                   /translation="MPSEPQPVSILPVSECWELLAGAPIGRLVTNFEGESNIFPVNFAV
FT                   QNRTVLFRTAEGTKLVASAVSREVLFEADGYSGGEGWSVIVRGPARSLHTNEEIAEAEE
FT                   AALLPWTNPDDKSHYVRIRPVNVTGRRFFFRDDIAR"
FT   gene            complement(247967..249832)
FT                   /locus_tag="Mflv_0262"
FT   CDS_pept        complement(247967..249832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0262"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="PFAM: pyruvate kinase; KEGG: mva:Mvan_0632 pyruvate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42756"
FT                   /db_xref="GOA:A4T114"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A4T114"
FT                   /protein_id="ABP42756.1"
FT                   /translation="MTTQRSDARAHDDGADGRIGDLAGLAEELDSLLDNLAAGEAAWAD
FT                   ALAAVPASRRASARNMAHYWSLRQTDLRDLQRRLADHGLSSLGRSEAHVEATLQRVRAA
FT                   ARAMAGEGFGDPAPAGLSPSAGRELLQRRTVELLGAAPRDRETRIMVTLPTEAATDPDV
FT                   ARNLLERGMDVARINCAHDDASAWRAMAHHVRTAAAAIDRPCLIAMDLGGPKLRTGPIR
FT                   PGPRVVKMKPRRDGWGRVSALAEALLIAQEAPEPSTGRPLLPVPGDWLARRRAGDEITV
FT                   RDTRGAARRLVVGGTADGGRIVTATKTTYLSTGAALHADGRRDSAALGTVPDLEQSVLL
FT                   RPGDQLRVTRDCSPAAPDADGIPRIGCTLPEVFDNARAGDRIFFDDGKISGVVVAATPD
FT                   ALDVRIARAAETGSKLREAKGINVPDTHLPISALTGKDLADLATVVEVADIVQLSFVQS
FT                   PADVGALYDALEQFGDDGIGVVLKIETRRAFENLPRLLFAAMRRPRVGVMIARGDLAVE
FT                   VGYERLAELQEEILWLCESAHLPVIWATQVLESLAKSGLPSRAEVSDAAMGARAECVML
FT                   NKGPHIGDAVTVLDDILCRMTEHHRKKSALMRRLRSWHPQSGDDG"
FT   gene            complement(249860..251332)
FT                   /locus_tag="Mflv_0263"
FT   CDS_pept        complement(249860..251332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0263"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: msm:MSMEG_3942 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42757"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4T105"
FT                   /protein_id="ABP42757.1"
FT                   /translation="MGTPGNLDAQIHETHTGLVVLLGERAYKAKKAVKTDFLDFSTVEQ
FT                   RARALHHEVTLNRRLAPQSYLGVGEFAMPGAQPEPVIVMRRYPDSARLTSLVAQGKPLT
FT                   AELREIAGRLADFHRDARRGPDIDAQGRPEAVWERWAQNLTELGRHADVVFDRADLDEI
FT                   HALAQRFLAGRSVLMAQRIAQGRIVDGHADLLTDDIFCMPDGPAMLDCLEFDDLLRYVD
FT                   GVDDAAFLAMDLEFHGRGNLGDEFLREYVARAADPAPRSLQNFYIAYRAVVRAKVDCVR
FT                   VEQGHPEAADDARRHLHLAADRLRDGAVRLVIVGGGPGSGKTTVSRALAEVLGAQVIST
FT                   DDVRRELRDAGVISGAVGALDSGLYAPESVARVYDEVLRRAEAAVTGGCSVILDGTWRD
FT                   EEETGRARRLADSTATPLIEFTCVLPVEEAGARIRARTQTTSDATPQIAEALAGRTGVA
FT                   GRHPLDTGRPLAESVAEAQRICRKVISPFTRG"
FT   gene            251357..251905
FT                   /locus_tag="Mflv_0264"
FT   CDS_pept        251357..251905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0264"
FT                   /product="putative lipoprotein LpqJ"
FT                   /note="KEGG: mva:Mvan_0631 putative lipoprotein LpqJ"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42758"
FT                   /db_xref="UniProtKB/TrEMBL:A4T106"
FT                   /protein_id="ABP42758.1"
FT                   /translation="MRTRLMAAAVLASATVLAGCQTVIDGTATRTPDSSFTEPEFPTPR
FT                   PSRPTTAPPSTSAPTPTPTRPRPPGGEVLRPQNGYVFIQTKSGKTRCQLDEQEVGCESA
FT                   FTDAPVIDGMPANGVRLSADGELSWVVGNLGAIPAVTLDYRTYSALGWTIEATESGTRF
FT                   TNDATGRGMVVRIEGVESF"
FT   sig_peptide     251357..251530
FT                   /locus_tag="Mflv_0264"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.997) with cleavage site probability 0.501 at
FT                   residue 58"
FT   gene            251954..253360
FT                   /locus_tag="Mflv_0265"
FT   CDS_pept        251954..253360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0265"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; KEGG: rha:RHA1_ro06610
FT                   probable glutathione-disulfide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42759"
FT                   /db_xref="GOA:A4T107"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4T107"
FT                   /protein_id="ABP42759.1"
FT                   /translation="MRTHDLVVIGAGSGNMVVDDRFSDLDVAIIDDRKFGGTCVNYGCI
FT                   PSKMLSYTAQVADTVAAAGDFDIHIDIDADTDTDADFGRLRWAQLRDRVFGRTDAIAAD
FT                   GEQGRRDSDFITVYNGHARFTQPGRLQVAVDGDTVEIAADRIVIAAGSRPVIPDVVAGS
FT                   GLPYETSDTVMRVDAPPAHLAVLGGGYIAAELAHVFAAAGSRITVIERSDRLLGGPQDD
FT                   AVRTTYTELMRSRYNLRCGSQVTEISGAPGALRIRLDDGSIVDADMLLVAAGRRSNSDR
FT                   LDVAKGDIDTHEDGRVVVDEYCRTTSDGVFALGDVSSEIPLKHVANREAAVVKHNLLHA
FT                   ANLRAVSHELVPSAVFTHPQIASIGRTEKDCRDENLDYRTGVAEFSDVAYGWAMQDESG
FT                   LCKVLAAPDGRILGAHVIGPQAATLVQIFVVALNFGITAAELARRPYWIHPALTEVVEN
FT                   ALLALDKDGS"
FT   gene            253357..254760
FT                   /locus_tag="Mflv_0266"
FT   CDS_pept        253357..254760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0266"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /note="KEGG: mkm:Mkms_0470 glucose-6-phosphate
FT                   1-dehydrogenase; TIGRFAM: glucose-6-phosphate
FT                   1-dehydrogenase; PFAM: glucose-6-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42760"
FT                   /db_xref="GOA:A4T108"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4T108"
FT                   /protein_id="ABP42760.1"
FT                   /translation="MTDDDHPVILVLFGARGDLARRMLFPSLYRLAAAGRLPADHRIIG
FT                   SGRSCPDSVEEFRDSVREGWSESIDDLDDAVVEGLLQRLSFQSADADDGADLAAAVASA
FT                   QKELGEDVRTLIYLSVPPSAMKPMIAMLGREGMAEGARLIVEKPFGTDLDSSRELGAAT
FT                   ESVADEQRIYRIDHFLGKEAVQNILALRFANGLIEPAWNRHHIESVQIDVPEDIALEGR
FT                   GSFYESTGCFRDMVSTHLCQVLGFLAMEPPSALDADGLRNAKAQVFEDMRPLDPARVVF
FT                   GQYAGYRDEDGVDDDSDVETFVALEAYVDNERWRDVPFYLRTGKAMGDNRRTVTLTFRT
FT                   PPGELFGDTRRPDRLVLDLTETPTAQLALNVKRPGPELTVERVGVPVALTPDGTGGDGL
FT                   DAYERLLLDVLRGDQTLFARGDEVDRLWQVCQPVLDDPPAVEAYDKGSWGPQSAVELPR
FT                   SGWWLPDDD"
FT   gene            254791..255414
FT                   /locus_tag="Mflv_0267"
FT   CDS_pept        254791..255414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0267"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0630 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42761"
FT                   /db_xref="GOA:A4T109"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR017519"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A4T109"
FT                   /protein_id="ABP42761.1"
FT                   /translation="MTVAQQERAALVATFRDTAPDSPTLCEGWDVRDLTAHLVVRERRL
FT                   DAAPGILIPAFADYTERVQEQVASSTDWDVLLGRVAEGPPLYSPLKLLDPIANVAEMFI
FT                   HHEDVRRAGADWEPRPLDDQTVSALRRPVAMMARMTLRKAPAKVVFRTPQGDTLATVGK
FT                   GAEVAVTGDPGELLMFAAGRDEAWVSFDGPADLVERVKKSRGGL"
FT   gene            255431..256372
FT                   /locus_tag="Mflv_0268"
FT   CDS_pept        255431..256372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0268"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: mva:Mvan_0629
FT                   luciferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42762"
FT                   /db_xref="GOA:A4T101"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019952"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A4T101"
FT                   /protein_id="ABP42762.1"
FT                   /translation="MSSVDFRVFVEPQQGASYADQLAVARTAEQAGYSAFFRSDHYLAM
FT                   AGDGLPGPTDSWVTLAGLARETSSIRLGTMVTSATFRHPGPLAISVAQVDEMSGGRVEL
FT                   GLGAGWFEAEHKAYAIPFPPLGERFDRLTEQLEILTGLWTTPTGETFDYSGTHYSIADS
FT                   PALPKPAQSPRPPIVIGGRGAKRTPALTARFADEFNIPFVPLDELTTQYARVAAAVEDA
FT                   GRAKDSLTYSAAFVVCVGRDDAEIARRAAAIGREVDEMRSNSPTVGTPAEVVDKLGPFL
FT                   EAGVERVYLQVLDMSDLEHVEFFAEQVIPQIH"
FT   gene            256406..256846
FT                   /locus_tag="Mflv_0269"
FT   CDS_pept        256406..256846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0269"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0628 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42763"
FT                   /db_xref="GOA:A4T102"
FT                   /db_xref="UniProtKB/TrEMBL:A4T102"
FT                   /protein_id="ABP42763.1"
FT                   /translation="MPVNRRDDDAAEVPPDAWHNQTSTLLGASVAGIAAIALIIWLITV
FT                   IARQFSEPDPPPLYYIPPSSSSATVTGSTTSTTSGTITSTSPPMTSDINDTSTSTTPSE
FT                   STTTRSTRPPRTRESDENDDRTTTRTTRAPRTNVTRTLYPGT"
FT   gene            256873..257394
FT                   /locus_tag="Mflv_0270"
FT   CDS_pept        256873..257394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0270"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0627 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42764"
FT                   /db_xref="GOA:A4T103"
FT                   /db_xref="UniProtKB/TrEMBL:A4T103"
FT                   /protein_id="ABP42764.1"
FT                   /translation="MARYGDSDDPNYSDDDPTQLSNYAYGDYEQAPPPDAEPPVPWYRK
FT                   PAALVGLGALGAVLIALIVFGLAKAITGDSDSETTPTSSLTPVTTTSAPAAVPPATVTE
FT                   TASESATTTTEPTTTTTTTEPTTTTTTTTPTTTTTPSTSVSTSTSTSTVTQTETQTETV
FT                   TEPPPAPPTP"
FT   gene            complement(257395..259248)
FT                   /locus_tag="Mflv_0271"
FT   CDS_pept        complement(257395..259248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0271"
FT                   /product="conserved hypothetical proline rich protein"
FT                   /note="KEGG: mkm:Mkms_0459 conserved hypothetical proline
FT                   rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42765"
FT                   /db_xref="GOA:A4T104"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniProtKB/TrEMBL:A4T104"
FT                   /protein_id="ABP42765.1"
FT                   /translation="MRSCLGVSLGTANLVAVADGRATVRPAAVTVPSGLSVTGFVERVG
FT                   DPVPLVLADHSVHRPETLAAAAVEDLTRWASPQRRPDLVTVAVPAHWSGAAIGAFRSAA
FT                   PHVTVVSEVSAAVTALQASPGLPTRGVIALCDLGAGGSSITLVDAGNGFAPVGDTVRLD
FT                   VLSGDGVDGAVLQHVLAEIETDPGGTAHVAALSGLRDRCRAAKERLSVETATGLVWGRT
FT                   TVRLTRPELEALIDDAVGGFVDAVVTTLHRYGVSPAALAAVATVGGGARIPLVTERLSE
FT                   ALQRPVITTPGAALAAAAGAELLARRGAEPVAQTVSVAAPMTAANATVAAPVTPLAWSA
FT                   EADDPGAHAVFEDETVYATAYARPDVHFEPDEIDEADVEPLGWYRRPGVLFAAAACLAA
FT                   VATTGLVLTAQVGPVEADASDIAAPVATAPVQAPTMPVEIAPPPPPVTETVAAAPAPRV
FT                   VQAAPQSPAPQRVVAKQAAPQAVPRPAAPATETVAAPAPSTTPTPTPTPSSTPTPTPSS
FT                   TPTPTPTPSSTPTPTPTPTPTPTPTPTPTPTPTPTPTPTSTPAPTSTPPPVTSQPVPVE
FT                   TPTATQEPAPAETPVTEIPVTETPATETPATECVPTAELAC"
FT   sig_peptide     complement(259165..259248)
FT                   /locus_tag="Mflv_0271"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.630) with cleavage site probability 0.369 at
FT                   residue 28"
FT   gene            complement(259286..260692)
FT                   /locus_tag="Mflv_0272"
FT   CDS_pept        complement(259286..260692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0272"
FT                   /product="isoniazid inducible protein IniC"
FT                   /note="KEGG: mkm:Mkms_0458 isoniazid inductible gene
FT                   protein IniC"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42766"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0Z7"
FT                   /protein_id="ABP42766.1"
FT                   /translation="MHAELDRIGRRLNEPMRIALAGTLKAGKSTLVNALVGETIAPTDA
FT                   TEATRIVTWFRHGPTPKVTANHRGGRRTNVPIARDPHAGGLTFDFARLDPDDVLDLDVE
FT                   WPASELVDATIIDTPGTSSLSKDVSARTLRLLVPDDGVPRVDAVVFLLRTLNAPDIALL
FT                   KQIGELVGGSSGALGVIGVASRADEIGAGRIDAMMSAGDVAARFTKEMEQTGICQAVVP
FT                   VSGLLALTARTLRQSEFGALDKLAGVEPAELAKAMLSVDRFVREDSPLPVDAATRAALL
FT                   DRFGMFGLRISIAVLRAGVRDSVALAEELLERSGLVALRDVIDQQFAQRSDLLKAHTAL
FT                   LSLRQFVQRNPVYATPRILADIEPLLADTHAFEELRLLSRLRSRPTTLNDDEMASLRRV
FT                   IGGSGTDVASRLGLPPGDESDGPRAAFAAVQRWRRRADHPLNDPFTARACRAAVRSAEA
FT                   IVADYARRGR"
FT   gene            complement(260789..262615)
FT                   /locus_tag="Mflv_0273"
FT   CDS_pept        complement(260789..262615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0273"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mkm:Mkms_0457 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42767"
FT                   /db_xref="GOA:A4T0Z8"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0Z8"
FT                   /protein_id="ABP42767.1"
FT                   /translation="MTQPNDPKKVVLELIEHTRKIADTQDRGDLVARLDRAARRVEDPQ
FT                   IRVVIAGQLKQGKSQLLNSLLNMPVARVGDDESTVVATVVSYGEQPSARLVVAGGDGRE
FT                   PELIEIPTADLRNDLRRAPQAGGREVLRVEVTAPSPLLKGGLAFIDTPGVGGHGQPHLS
FT                   ATLGLLPDADAMLMISDVSQEFTEPEMTFMRQALDICPVAVIAATKTDLYPHWRRVVEA
FT                   NAAHLRRAGITTPMVPVSSTLRSHAVALNDKELNEESNFPAIVKFLSDEVLSRHNGGVR
FT                   EQVVAEIRAAAEHLTLAAESERSALTDPHTRQRLTADLEARKQEAQDALQQTALWQQVL
FT                   NDGIADLTADVDHDLRERFRNITFHTERVIETGDPTLHWAEIGAELEDAVATAVGDNFV
FT                   WAYQRAEALAADVARTFTEAGLDAVRIPSLNARDMGADLGEFRSLAQLEAKPLKFGHKV
FT                   VTGMRGSYGGVLIFGMLTSFAGLGMFNPLSLGAGFVLGRKAYKEDMENRLLRVRNDAKT
FT                   NVRRFVDDVAFAVGKESRDRLKGIQRQLRDHYREIANQTTRSLNESLQATLSAAKMEEA
FT                   ERTARVRELDRQLNVLRQVIDHIDHKLRAPAH"
FT   gene            complement(262716..263732)
FT                   /locus_tag="Mflv_0274"
FT   CDS_pept        complement(262716..263732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0274"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0623 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42768"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0Z9"
FT                   /protein_id="ABP42768.1"
FT                   /translation="MNTLIDFILDLFRSPAAAQSFVIDPDGALRDAGLPNVTAAQLASV
FT                   AATAAPAGYALGGGDPIVGLQRAVADHHQLASNFASPFSPQTSYAPTFAPETTTDLLSG
FT                   NNVPVASPVQDAGANAQNGAFNLGFGDITFGDKTSNTATDGGVVVDGDNDGDIVSGDGA
FT                   VLGDGNTMNNGDILAGSGSNVVVGKDNEVEDNSKTAGGDLIADNDAPVLNDVDTSGGNG
FT                   GGADGGGSLIGIGSGTAVGGSGGNGGGIIITDTDVNSGTQVDGDYGSGNVEDNSTNTSV
FT                   QTDIATSTESSIEDNSSTYESNIGSGNETSTELFSDNVTGIDTDLASNNDTTLVDAF"
FT   gene            complement(263994..264509)
FT                   /locus_tag="Mflv_0275"
FT   CDS_pept        complement(263994..264509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0275"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0622 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42769"
FT                   /db_xref="UniProtKB/TrEMBL:A4T100"
FT                   /protein_id="ABP42769.1"
FT                   /translation="MANSLLDFVMALVRDPDAAARYAADPAQAIADADLGSVTSTDVQN
FT                   LIPVVAESLSMSVPAHGLDAFGAEPQANVWATGAATAAFDAFDVQVPATVVADSTPFAP
FT                   AVVEDIEPEGAVPTALDLVEPAVSVQMDDPAVLDDVPSTGVGLGAEWDTHLVDTDPGDL
FT                   PSSFDLFD"
FT   gene            264713..266539
FT                   /locus_tag="Mflv_0276"
FT   CDS_pept        264713..266539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0276"
FT                   /product="conserved hypothetical proline and threonine rich
FT                   protein"
FT                   /note="KEGG: mva:Mvan_0621 conserved hypothetical proline
FT                   and threonine rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42770"
FT                   /db_xref="GOA:A4T0Z2"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0Z2"
FT                   /protein_id="ABP42770.1"
FT                   /translation="MTEPLGLSIGTTNLVAARVGRPPVTRRAILTLVAGQAPQVGTPEE
FT                   NAGNNPSGVVLTGFVDRVGDPVPLIAEDGSAHRGEQVLAAALDAMARLVDGGSPVAIAV
FT                   PSHWGPGTVGALRGALRTVPSLSPGGVPATLIPDSTAALASLRVSPGLPGSGVVVLVDL
FT                   GGSGSSVTLADAGANLVVVGQTVRYPEFSGDGIDRALLDHVLAGVSDTGQADTAGTAAV
FT                   GPLMRLREECRAAKERLSSETATAVPVDLPGFRSEVRVTRPELEQMIAGPLDGLLSLID
FT                   DTLTRNGVATENISAIATVGGGAAIPLVTQRLSERLRAPVVTTPQALLNIGAGAALIAN
FT                   QTLDADAPTGMAPTGMAAAADVPTAMGPAVDAPTALGPAAPPVAGGALAWSQDDDGVQD
FT                   PLPYTGADYTSPAGYGDAATGARPPVAFAPGDDGYSDDLPPLPWYKRPPVLFGLAAAAA
FT                   LLAVGGLAVTLTSSEGSTTVTETASTTAPSDTTPVELPPPVTTVTIGPDGVATTTVSQP
FT                   PPPPPSSTSSTTTTTPSSSTTTTTTTTTTTTTTTTNTAPTTTTTRTTTAPPTTTPPPTT
FT                   TQAPPPPTTEEPPPTVDPPDPIVTTVIPDGGA"
FT   gene            266543..269044
FT                   /locus_tag="Mflv_0277"
FT   CDS_pept        266543..269044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0277"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein, LuxR; Sigma-70, region 4
FT                   type 2; KEGG: mkm:Mkms_0453 response regulator receiver
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42771"
FT                   /db_xref="GOA:A4T0Z3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0Z3"
FT                   /protein_id="ABP42771.1"
FT                   /translation="MLPAAREAIAAVDADPRAATKSLVTGGIGTGKTTLLAAMRTTFRS
FT                   AGRQVLSRPPDAGTPGDGAGYALVVDDAHLLGDDDLDRLTDLAGDPASTVVIATQALMH
FT                   RSRLQVLMTVLARENPEVALRPLTAAQVQEAATSALGASVGPELTRLLVSVTGGFPFLV
FT                   SAALSAIPDGAQSARQAAHFALIERLARLDGHLLDTLLVMTLSPGLGPDDVAAALRIPA
FT                   DEAVAAVDSARATALIDPAHTSQFLAAVHDGIAQIVGAARHHDVEMAVLDSQLALCTLT
FT                   ADLALRIADHGVRDDRLATALTDFAARVPDRPARAARLYRAATDAGTTAVRPALADALV
FT                   LTGDCVTAGRLADDLLTSQDPDERAAAVRIAASIALHDGAARQAADLFAWLGPAPDAVV
FT                   GAAETIAALAVGDAAAVRSTAQGPPSGPPTAVARSARAITEGLVMTLDQPYPAAIARLS
FT                   QAIAVDAVHGVLPDTPAALVTLAALHGGDPVRARSVIGRAVLADSRPDRADATFVTSRH
FT                   RLLQGWAYMQDGQLAAAAAAIPADGDPRLHRRDALWAAALHTGIARRSGDTGAMQMHWR
FT                   SAMDVLAESSADLFTVLPLGELWIAASRLRQVDQVRHSLDEVFGLLAALGDPLLWSIPL
FT                   HWAGVHAGILANSPDAVAPHGAALTAAAPHAQFAKALAAAGRTWLRVLADRVDVAEVTA
FT                   AARGLALHGHTWDATRLAGQAALQTTDSRAAQAMLQLARDLKATVAASDASVPSSATDT
FT                   VAPPPAVPQRVSSTQLSEREREVAELLLQGLPYREIGSQLFISAKTVEHHVARIRRRLG
FT                   AESRSEMLSMLRAALDTPASR"
FT   gene            269186..272320
FT                   /locus_tag="Mflv_0278"
FT   CDS_pept        269186..272320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0278"
FT                   /product="protein of unknown function DUF224, cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; protein of unknown function DUF224, cysteine-rich
FT                   region domain protein; KEGG: mva:Mvan_0619 protein of
FT                   unknown function DUF224, cysteine-rich region domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42772"
FT                   /db_xref="GOA:A4T0Z4"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0Z4"
FT                   /protein_id="ABP42772.1"
FT                   /translation="METQMLIRIIAGVLMLAVVGVFAAKRVLWLTKLIRSGQPLSEGNN
FT                   RKDHLQKRITTQFEEVFGQTRLLRWSIPGIAHFFTMWGFFVLATVYLEAFGLLVDHDFH
FT                   IPLIGRWDALGFLQDFFAVAVLLGIITFAIIRIVREPKKHGRDSRFYGSHTGGAWLILF
FT                   MIFNVIWTYALVRGAAAVVGNLPYGNGAFFSQFMGWIMRPLGHTANEWIETIALLAHIA
FT                   IMLVFLLIVLHSKHLHIGLAPINVTFKRLPNGLGPLLPVESKGELVDFEDPAEDAVLGR
FT                   GKIEDFTWKGYLDFTTCTECGRCQSQCPAWNTGKPLSPKLVIMNLRDHMFAKAPYFLDG
FT                   KESPLENTPEGGLGEELRGEKHSEKHSHEHVPESGFERIPADSPLQATRPLVGTLEEGG
FT                   VIDPDVLWSCTTCGACVEQCPVDIEHIDHIVDMRRYQVMMESEFPGELGVLFKNLETKG
FT                   NPWGQNSKDRTNWIDEVDFDVPVFGKDVDSFEGYEYLFWVGCAGAYEDRAKKTTKAVAE
FT                   LLSAAGVKYLVLGEGETCNGDSARRSGNEFLFQQLAAQNVETLNDLFSGIERVDRKVVV
FT                   TCPHCFNTLGREYPQVGGNYTVLHHTQLLNRLVRDKKLVPVKSTDGSPNGQDITYHDPC
FT                   YLGRHNKEYSAPRELIGASGAKLTEMPRHADRGLCCGAGGARMWMEEHIGKRVNTERTE
FT                   EAIDTGASAIATGCPFCRVMMTDGVDDVSATRDIEKVEVLDVAQLLLGSLDKSTFTLPE
FT                   KGTAAKESEERAARIAAEAPAEVEAEEPEAAPAEEAAPAEAKAGTATETKPVTGLGVAG
FT                   GAKRPGAKKTAAAPAEDKPAAAAAPAKGLGIAGGAKRPGAKKAAPAAEAAPAADAPAKA
FT                   EPEVKGLGIAGGAKRPGAKKAAPAVEAAPAADAPAKAEPEAKGLGIAGGAKRPGAKKAS
FT                   GTVVQPPNVDPDKAEAGTESAGTADSDRGLDDAPKPEPEVKGLGIAAGARRPGAKKKAP
FT                   AAAPDSAPAAAPESAPAAPSSNGSDSSKGDDRVVGDEAPVKGLGIAKGARRPGKR"
FT   sig_peptide     269186..269257
FT                   /locus_tag="Mflv_0278"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.946) with cleavage site probability 0.945 at
FT                   residue 24"
FT   gene            272421..273689
FT                   /locus_tag="Mflv_0279"
FT   CDS_pept        272421..273689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0279"
FT                   /product="L-aspartate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.1"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   mva:Mvan_0618 aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42773"
FT                   /db_xref="GOA:A4T0Z5"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0Z5"
FT                   /protein_id="ABP42773.1"
FT                   /translation="MSTHQAHWQAGTGQHARQREFAQSSKLQDVLYEIRGPVHEHASRL
FT                   EAEGHRILKLNIGNPAPFGFEAPDVIMRDIIAALPYAQGYSDSKGIVSARRAVFTRYEL
FT                   VEGFPRFDIDDVFLGNGVSELIQMTLQALLDNGDQVLIPAPDYPLWTACTSLAGGTPVH
FT                   YLCDETQGWNPDVADIESKITDRTKAIVVINPNNPTGAVYSREVLTQIADLARKHQLLL
FT                   LADEIYDKILYDDAEHISLASVAPDLLTLTFNGLSKAYRVAGYRSGWLVITGPKEHAAS
FT                   FIEGISLLANMRLCPNVPAQHAIQVALGGHQSIDDLVLPGGRLLEQRDIAWETLNEIPG
FT                   VSCVKPQGALYAFPRLDPEVYDIADDEQLVLDLLLQEKILVVQGTGFNWPTPDHLRIVT
FT                   LPWARDLSAAIERLGNFLVSYRQ"
FT   gene            complement(273751..274383)
FT                   /locus_tag="Mflv_0280"
FT   CDS_pept        complement(273751..274383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42774"
FT                   /db_xref="InterPro:IPR025412"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0Z6"
FT                   /protein_id="ABP42774.1"
FT                   /translation="MVRSAAERSALKRVYESVLSGEVMPLLGSRGFTRSQNTFRRSRGP
FT                   LYDVINFQANWNNSVTPWYGFFVNVGVGSVEIDQACPGHPHVHPPEGFLLDRRWEHLVP
FT                   DAPYEVRFDLRTDMSAFGANLCTNLERVIDEVERTTSTRELVEYAVTNNLLIAYEKTCC
FT                   YLAATNDTDTLNAYVGRLHEYFGHQDRWKTLSDSISAVAGPVVLRRI"
FT   gene            274444..275685
FT                   /locus_tag="Mflv_0281"
FT   CDS_pept        274444..275685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0281"
FT                   /product="YibE/F family protein"
FT                   /note="PFAM: YibE/F family protein; KEGG: mva:Mvan_0617
FT                   YibE/F family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42775"
FT                   /db_xref="GOA:A4T0Y7"
FT                   /db_xref="InterPro:IPR012507"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0Y7"
FT                   /protein_id="ABP42775.1"
FT                   /translation="MRVAHSHSHTHSLSGPSPLGPLAAKVVVGLLVVIGVAVMIGAALL
FT                   WPDGQKSDIPLPFQNAAGGAVTTESGHVLSSVAATCGSPSAGSVLTSAPLPAEGGGAEC
FT                   VQSLVSIDSGPNEGADTLLEIGVGPGQPSLAVGDDVRLSRQVDDAGTTTYAFYDFERTW
FT                   PLTAFALVFAIVIVAVARWRGLRALVGIVIAFGVLVVFLLPALRDGAPAVPVALVASAA
FT                   ILYAVLYLAHGVSLRTSAALLGTLASLLLAAGLSWAAIEFTHITGLSEDQNNEVAAYLG
FT                   NVSITGMLLAGFIIGSLGVLNDVTVTQASTAFELAAVGDGATRRQVFVGAMRVGRDHIA
FT                   STVYTLVLAYAGSALPLLLLFSVANRSLGDVLTSESVAIEVARSAVGGIALALSVPLTT
FT                   GIAAMLATPQQRRH"
FT   gene            275727..276248
FT                   /locus_tag="Mflv_0282"
FT   CDS_pept        275727..276248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0282"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: msm:MSMEG_0686 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42776"
FT                   /db_xref="GOA:A4T0Y8"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0Y8"
FT                   /protein_id="ABP42776.1"
FT                   /translation="MSQPLHTSHIDLTVDGDQRSLDVDNRLTLLDALREKLGATAPKKG
FT                   CDHGQCGSCTVLVDGRRVTSCLTFAVAADGMRVTTAAGLGDADTLHPVAQAFQDEDAFQ
FT                   CGYCTPGQICSAVGMLDEVKSGAPSFVSDDLDAPPELTADEIRERMSGNLCRCAAYPNI
FT                   VAAIGRAADR"
FT   gene            276245..277237
FT                   /locus_tag="Mflv_0283"
FT   CDS_pept        276245..277237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0283"
FT                   /product="molybdopterin dehydrogenase, FAD-binding protein"
FT                   /note="PFAM: molybdopterin dehydrogenase, FAD-binding;
FT                   KEGG: msm:MSMEG_0685 oxidoreductase, molybdopterin-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42777"
FT                   /db_xref="GOA:A4T0Y9"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0Y9"
FT                   /protein_id="ABP42777.1"
FT                   /translation="MKPFEYHLATSPADAVATLARHPDAAYLAGGTNLVDHMKLGVAEP
FT                   RLLVDVSRLDLTEVALTDDGGLSIGANVRNSDLAAHPVVRSRYPMLARALLSGASGQLR
FT                   NAATTGGNLLQRTRCVYFQDVTTPCNKREPGSGCAALGGYVRYHAILGASRHCVATHPS
FT                   DMAVAMSALDAHIVVEGADGSRRIPATDFHRLPGDEPQFDTVLDHGELITAVELPAPPP
FT                   HAVSDYRKVRDRASYAFALVSVAAELSFVGESIATARIALGGVAHKPWRARRAEQMLAG
FT                   AEATDETFAAAADAEISAAEPLPGNEFKVELARRTLMAQLRMLTERGTR"
FT   gene            277234..279333
FT                   /locus_tag="Mflv_0284"
FT   CDS_pept        277234..279333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0284"
FT                   /product="xanthine dehydrogenase, molybdenum binding
FT                   subunit apoprotein"
FT                   /EC_number="1.17.1.4"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase,
FT                   a/b hammerhead; aldehyde oxidase and xanthine
FT                   dehydrogenase, molybdopterin binding; KEGG: mkm:Mkms_0447
FT                   aldehyde oxidase and xanthine dehydrogenase, molybdopterin
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42778"
FT                   /db_xref="GOA:A4T0Z0"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0Z0"
FT                   /protein_id="ABP42778.1"
FT                   /translation="MTMLEPRAIGAPTARRDGQAKVTGAAAYAYEQQVDSPAYLHPVQA
FT                   TIARGRVIAMDTNLARAVDGVLDILTVSDAPKLADASDGELAILQDATVHFRGQLIGGV
FT                   VAETAEIAREAAALVHVEYQEKEHDAALRADHPGLYTPESVNPSYPPDSDQGDVESAFP
FT                   AAEFTVDQTYRTPTEHNNPMEPHACVAQWTVRDGTPAVTMYDSTQGVHVVRKTLAPIFG
FT                   LEPEQMRVVAPHVGGGFGSKGAPHAHDVLTVMAAQRAGGRPVKLALTRQQMFSLVGYRT
FT                   PTIQRVRLGADRDGRLTALVHDAIGQTATVKEFAEQTAVTSRKMYAAANRRTSHRLAAL
FT                   DVPVPFWMRAPGECPGTYAAEVAMDELAVAAGIDPIQLRIRNDPPTDPETGKPWSGRHL
FT                   VECLEVGAERFDWSSRDPEPGTRVLGDWLVGTGVASATYPGMAMPGNAARITYSAEGHY
FT                   DVHIGAADIGTGTWTTLSQIAADALDCDLAAITLQIGDTDLPAASVAGGSSGMTSWGTT
FT                   IVLAAQQFRRDHGNPPVIGATTVTEAPDPENDEVTVQSFGAHFVEAHVNRHTGEIRVPR
FT                   MLGVFSIGRAINPRTLRSQLIGGMTMGLSMALHEESVRDPRFGHVVTQDFATYHISSHA
FT                   DVVDIDAIWLDEVDEHLNPMGSRGAGEIGIVGSAAAVVNAVYHATGIRVRDLPVTLDKV
FT                   LAGLP"
FT   gene            complement(279339..280202)
FT                   /locus_tag="Mflv_0285"
FT   CDS_pept        complement(279339..280202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0285"
FT                   /product="Glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /note="TIGRFAM: glucose-1-phosphate thymidylyltransferase;
FT                   PFAM: Nucleotidyl transferase; KEGG: mkm:Mkms_0446
FT                   glucose-1-phosphate thymidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42779"
FT                   /db_xref="GOA:A4T0Z1"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0Z1"
FT                   /protein_id="ABP42779.1"
FT                   /translation="MRGIVLAGGSGTRLYPITLGVSKQLMPVYDKPLIYYPLSTLMMAG
FT                   IRDILIITTPRDAPDFHRLLGDGSAFGVNLTYAEQEEPEGLAQAFVIGASHIGSDPVAL
FT                   VLGDNIFYGPGLGTGLQRFQNVTGASIFAYWVADPAAYGVVEFDADGNALSLQEKPARP
FT                   RSHYAVPGLYFYDNDVVEIARHLKKSDRGEYEITEVNQTYLDQGRLRVEVLARGTAWLD
FT                   TGTFDSLLDASDYVRTLERRQGLKISVPEEVAWRVGFIDDATLEARGKALLKSGYGAYL
FT                   LELLDR"
FT   gene            complement(280202..280570)
FT                   /locus_tag="Mflv_0286"
FT   CDS_pept        complement(280202..280570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0286"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0602 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42780"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0Y2"
FT                   /protein_id="ABP42780.1"
FT                   /translation="MTTSELATVLAWHDALNAADMDTLLSLSSEDIEIGDAGGAAQGHA
FT                   ALREWAQALDVRIEPGRVYVNDGIVVAEQQTVSVTGETGSEASAFRVVHDHVTSVFRHD
FT                   TLAAALAATGLGEADLTG"
FT   gene            complement(280589..281335)
FT                   /locus_tag="Mflv_0287"
FT   CDS_pept        complement(280589..281335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0287"
FT                   /product="protein of unknown function DUF1503"
FT                   /note="PFAM: protein of unknown function DUF1503; KEGG:
FT                   mva:Mvan_0601 protein of unknown function DUF1503"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42781"
FT                   /db_xref="GOA:A4T0Y3"
FT                   /db_xref="InterPro:IPR010872"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0Y3"
FT                   /protein_id="ABP42781.1"
FT                   /translation="MDFRAALLEQTRAFGELIRSADPATPVPTCGDWTLKQLFRHVGRG
FT                   NRWAAQIVSERRTEPLDPRDVRDGRPPEDPDGAIEWLNAGAQVLIDAVDRARPDTKVWT
FT                   FTGPRPGGWWLRRRLHEVVVHRADAALALGADLRLEPEMAADGISEWIELAANNRRGPA
FT                   PLDRGESLHLHATDDKLGPTGEWTVVHDEDGVWWSHNHGKAGVALKGPATGLLLAITRR
FT                   VTAEQAGLEMFGDTAVWDAWLERTPF"
FT   gene            complement(281338..282672)
FT                   /locus_tag="Mflv_0288"
FT   CDS_pept        complement(281338..282672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0288"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: mva:Mvan_0600
FT                   cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42782"
FT                   /db_xref="GOA:A4T0Y4"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0Y4"
FT                   /protein_id="ABP42782.1"
FT                   /translation="MAVHPLRQRIRWLALHGVIRGLSKLAARRSGDPQARLIADPEARN
FT                   DPAAFADEVRTGDPVVRCRAVLLTVDHQAANEILRSDDFRVSSLGAGLPAPLRWVNRKT
FT                   HPGLLHPIEPPSLLSIEPPDHTRCRKLVSSVFTTRAVNALRDRVQLTADQLLDDLERES
FT                   GVVDIVERYCSQLPVAVISDILGVPEQDRKHILHFGELGAPSLDIGLSWRQFQQVEEGL
FT                   VGFNAWLGDHLEALRRNPGDDLMSELILASAAADEAGRLSERELQATAGLVLAAGFETT
FT                   VNLLGNGIRMLLDTPQHLETLAARPDLWPNTVEEILRLDSPVQMSARFARRDVEVAGTR
FT                   IERGELVIVHLAGANRDPNVFDDPHRFDIERDNAGRHLSFSGGRHFCLGAALARAEGEV
FT                   GLRTFFQRYPDAQLAGSGSRRDTRVLRGWSTLPITLGKAPAALGS"
FT   gene            complement(283006..284340)
FT                   /locus_tag="Mflv_0289"
FT   CDS_pept        complement(283006..284340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0289"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="PFAM: UDP-glucose/GDP-mannose dehydrogenase; KEGG:
FT                   mva:Mvan_0598 UDP-glucose 6-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42783"
FT                   /db_xref="GOA:A4T0Y5"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0Y5"
FT                   /protein_id="ABP42783.1"
FT                   /translation="MRCTVFGTGYLGATHAAGMAELGHEVVGVDIDPGKVAKLAAGEVP
FT                   FYEPGLREALQRNIEAGRLRFTTDYAEAAEFADVHFLGVGTPQKKGEYAADLRHVYAVI
FT                   DTLVPLLRRPAVIVGKSTVPVGTAAELVERAAGLAPDGVTVEVAWNPEFLREGFAVQDT
FT                   LHPDRIVLGVQKDSRIAEPVLRELYAALLADGAPFLVSDLQTAELAKVSANAFLATKIS
FT                   FINAISEVCEAVGADVTLLADALGHDARIGRRFLNAGLGFGGGCLPKDIRAFMARAGEL
FT                   GANQALTFLREVDSINMRRRTRMVELATTACGGSLLGANIAVLGAAFKPESDDVRDSPA
FT                   LNVAGMLQLHGATVNVYDPKAMDNSRRLFPTLNYSASALDACERADAVLVLTEWSEFVG
FT                   MHPDELSAAVRTKVIVDGRNCLDIGVWRDAGWQVHALGRTVEVGA"
FT   gene            complement(284417..286078)
FT                   /locus_tag="Mflv_0290"
FT   CDS_pept        complement(284417..286078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0290"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0590 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42784"
FT                   /db_xref="GOA:A4T0Y6"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0Y6"
FT                   /protein_id="ABP42784.1"
FT                   /translation="MDIVLGVSMTPTTVRMVLVEGEKADGVTVDHDTFAVDSVEGSANA
FT                   AEHVVSAVLGTRESAETGGHHLKSIGVTWSDHAEATALRDALAAHGIDDVMLVSESHAA
FT                   ASLAQAVGRAVDYDTTALLFVDRDTATLSVVKTDDGSVVKVLSRSLHSADAMAVLAEMA
FT                   AAIDTRTQDAPPQGIFVVGSGVDISSVKDHLKHLVAVPIHAPDDAELALARGAALASAS
FT                   APAFEATTVGLAYSQDPDGTTAGSVFAGLAGAQTQMAPVGGDVPVDEFAPTEMRPVDEE
FT                   RKPFLLVGSALTSLFVVGVVALVISLAISIRPTADQRPSPAQAAIVPSSQAPTAEPAPA
FT                   RQEAAQIPPPPSTAETIKPPVPVVQQAPQQAPRTVFVEQAPAPAPAAPAPAPAPVAPPP
FT                   APAPIPAAPPVVAPVVLPPPVVVLPRPQWNPPRPAWTWPNQRPDVDDDSDDSPWTPQKP
FT                   PRTPSQPPTTRPPVPQVPQVPQIPQVPQVPQVPQWPGAGSGSGSGSGSSSGSGSSRGDS
FT                   GSRGGDSSSGRGSGSGVPGDINGDGCFLIFCGSGRN"
FT   gene            complement(286264..286836)
FT                   /locus_tag="Mflv_0291"
FT   CDS_pept        complement(286264..286836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0291"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /note="TIGRFAM: deoxycytidine triphosphate deaminase; PFAM:
FT                   deoxyUTP pyrophosphatase; KEGG: mva:Mvan_0589 deoxycytidine
FT                   triphosphate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42785"
FT                   /db_xref="GOA:A4T0X9"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4T0X9"
FT                   /protein_id="ABP42785.1"
FT                   /translation="MLLSDRDIRAEFQAGRLGLDPFDDSLIQPSSVDVRLDNLFRVFNN
FT                   TRYTHIDPAQRQDDLTSLVEPKEGEPFVLHPGEFVLGATLERCTLPDDLAGRLEGKSSL
FT                   GRLGLLTHSTAGFIDPGFSGHITLELSNVANLPITLWPGMKIGQLCLLRLTSPAQHPYG
FT                   SSQVGSKYQGQRGPTPSKSYQNFVKSN"
FT   gene            287405..288793
FT                   /locus_tag="Mflv_0292"
FT   CDS_pept        287405..288793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0292"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: msm:MSMEG_6033 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42786"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0Y0"
FT                   /protein_id="ABP42786.1"
FT                   /translation="MHSAPAMETGLYAAPSKPRVSKFLAAGVAVVGAGAVAITPVSPIV
FT                   ADDVRSQTHAVALTAAANPTYGSDTSAVYGNLFSQSSANFQNLFQAFASDPFPILSQVA
FT                   ANQWAYGTKFLSGFSGVSESFNSWWTGANGKAMIEAGFEHFSNGEFADGWDRLNRSFVY
FT                   ALNIGSPLYSAFWSQAPSQRNPEGNMGIPEQMAINFQQVVSLVFDRNSIVNEMTKTVLG
FT                   PFLGLGFEVALLADAVTLAMKEGDGEGLVRALVNAPGVMLNTFLNGYVNPECEGSNCEV
FT                   FPGLINAGGTLISLFSELPKAIAEALKPDPVPGAPWTPPAPSLAAVDSTTMLAARTVTL
FT                   EIESAAPATETEQAETAPVADEAAPVEDVVAPVEETEEADETAPVTEEAETEAGTEEAA
FT                   TEEDGDAEAPAADESDSDSKDSDDSGDARKSGKPAQAERSSGSSDSSDSGSSSSDSGSS
FT                   GSDD"
FT   sig_peptide     287405..287545
FT                   /locus_tag="Mflv_0292"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.900) with cleavage site probability 0.765 at
FT                   residue 47"
FT   gene            288923..288996
FT                   /locus_tag="Mflv_R0001"
FT                   /note="tRNA-Gly1"
FT   tRNA            288923..288996
FT                   /locus_tag="Mflv_R0001"
FT                   /product="tRNA-Gly"
FT   gene            289390..290574
FT                   /locus_tag="Mflv_0293"
FT   CDS_pept        289390..290574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0293"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="PFAM: filamentation induced by cAMP protein Fic;
FT                   KEGG: fra:Francci3_0673 filamentation induced by cAMP
FT                   protein Fic"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42787"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR025758"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0Y1"
FT                   /protein_id="ABP42787.1"
FT                   /translation="MQLERFASSPIGNLWPIAGTDGRNGRFYEHSAYVAHPLGVEPQLD
FT                   GATWRAVTRASRALAHLDQASRQVPNPRILRRPTLSREAQSTSALEGTFAPIDDVLAAD
FT                   SAADEDKSAALMEVLNYVDAADVAFDYVAEHRTITTSLLFDAHQQLVSGTDSETRDAGR
FT                   VRRCQVAIGSPDGTIESARFVPMPPGPELEAAVRDLVGWITTAGDRDPLIAAAMTHYQF
FT                   ETLHPFNDGNGRIGRLLIVLQFMIDDLLQEPLLSVSPWFESRRNEYEDELAKVSQTGEW
FT                   DSWIRFFSRGVEASAIDTARRINLMLNAQRSYVQILQDSGYRGGVARDIVESLVDTPIV
FT                   RVPALARRFNKTPQGIDTAVKKLAALGIVDGPFGSYGRYYVAREVYRAITAAAP"
FT   gene            290728..291237
FT                   /locus_tag="Mflv_0294"
FT   CDS_pept        290728..291237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42788"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0X5"
FT                   /protein_id="ABP42788.1"
FT                   /translation="MSIRSRRHRATCVIAVDAVCAVTLAGVASAQPPDPITGESLRIGL
FT                   GSQPHASQLPLVYGVDRNGGDFGLALDTTLRAMKELKSDFTVFRAAVAEYIDAPPSDES
FT                   LRELFDLIQKYPFWTDDGGLSDDSVRFMIDIANESGVLSQPMNAADVVDRETLSRAVEL
FT                   AKMPTR"
FT   sig_peptide     290728..290820
FT                   /locus_tag="Mflv_0294"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.992 at
FT                   residue 31"
FT   gene            complement(291301..292170)
FT                   /locus_tag="Mflv_0295"
FT   CDS_pept        complement(291301..292170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0295"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mav:MAV_4982 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42789"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0X6"
FT                   /protein_id="ABP42789.1"
FT                   /translation="MSKVLLISGASRGLGRAITESALAAGHLVVAGVRATSSLSDLATR
FT                   EPDRLAVVELDVTDDRHARAAVATAVERFGRLDVLVNNAGYANMSAIEDVDVDDFRAQI
FT                   ETNFFGVVNLTRAALPAMRRQRDGHIVQISSVGGRLVRPGLAAYQSAKWAVTGFSGVLA
FT                   VEVAPLGIKVTVLEPGGMRTDWAGSSMRIAPVREEYAATVGAAASLSDPNVLGASDPAK
FT                   VAGLLLDVIGMPDPPRRLLVGPDAYRYATAAGRDLLAVDERWRTLSMSTAADDVSPEQL
FT                   DPLGSASR"
FT   gene            complement(292200..292991)
FT                   /locus_tag="Mflv_0296"
FT   CDS_pept        complement(292200..292991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0296"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   rsp:RSP_0610 putative 3-oxoacyl-(acyl-carrier-protein)
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42790"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0X7"
FT                   /protein_id="ABP42790.1"
FT                   /translation="MDMGLSGKRALVTGSSSGLGRAIAESLAAEGASVVVHGRDEVRTG
FT                   AVADGIRARGGDAWAAVGDLATEGGAGAVAAAAGEVDILVNNAGVYDGLAWSDLAPRQW
FT                   QSIYEVNVVSGVRMIEYLVPGMRQRGWGRIIQIGGGLALQPAADQPHYNATLAARHNLT
FT                   VSLARELAGTGVTSNTVAPGAILTEPVREMTYRVAAQRGWGPTWEDVEKAAATTWFPND
FT                   IGRFGRPEEVAAAVAFLAGVHAGYISGADLRVDGGAIRSVA"
FT   sig_peptide     complement(292896..292991)
FT                   /locus_tag="Mflv_0296"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.644) with cleavage site probability 0.330 at
FT                   residue 32"
FT   gene            293073..293684
FT                   /locus_tag="Mflv_0297"
FT   CDS_pept        293073..293684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0297"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: rpc:RPC_4666
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42791"
FT                   /db_xref="GOA:A4T0X8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041678"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0X8"
FT                   /protein_id="ABP42791.1"
FT                   /translation="MPSEPPRRRNAAFTRAAILQSAIQHFARAGYDGAGVRDIATDAGV
FT                   TAMLVNRYFGSKEKLFAEAVETSFATPVFIASESEDLARDIAAALAVHSAPGAESVSAF
FT                   LIMLRSVSNPAAVRIVRAALARHAGRRLSDQLPEPGRLLRSDVALAVMSGVLLMRQVIG
FT                   TRALSRSSADELETLLESVFSAVFDTPLDSRGDAPRTGED"
FT   gene            complement(293681..294541)
FT                   /locus_tag="Mflv_0298"
FT   CDS_pept        complement(293681..294541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0298"
FT                   /product="glycoside hydrolase, family 16"
FT                   /note="PFAM: glycoside hydrolase, family 16; KEGG:
FT                   mva:Mvan_0446 glycoside hydrolase, family 16"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42792"
FT                   /db_xref="GOA:A4T0X1"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0X1"
FT                   /protein_id="ABP42792.1"
FT                   /translation="MPEMDRRKAMLMMGLGAAVVASPLGSAHAQPPAVPSEPLPAGDAG
FT                   PLMLFQDEFDGPAGAPPDPARWFIVPARETIRNPVEWDKPFNMGRYVTDQEHVFQDGNG
FT                   NLVIRATRGEGTTIQEKYASAKIMGTWRGGIGTTWEARVKLDCLTDGAWPAFWLVNENP
FT                   VRGGEVDLVEWYGNNDWPSGTTVHARLDGTAFATNRHPVDNAWHTWRMTWQPTGLYFWK
FT                   DYQPGMEPFFTVPANSIPDWPFNDPGFTMVPVFNIAVGGSGGREPAAGTYPAEMRVDWI
FT                   RVFAS"
FT   sig_peptide     complement(294452..294541)
FT                   /locus_tag="Mflv_0298"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.985 at
FT                   residue 30"
FT   gene            294875..296671
FT                   /locus_tag="Mflv_0299"
FT   CDS_pept        294875..296671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0299"
FT                   /product="Lipocalin family protein"
FT                   /note="PFAM: Lipocalin family protein; KEGG: mva:Mvan_0445
FT                   lipocalin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42793"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0X2"
FT                   /protein_id="ABP42793.1"
FT                   /translation="MTSQRWAIWLGAFGAGACIALGAGHGVAAADSDTADAADTSSQSA
FT                   ETRTAADQPAAREPDEPEARETEAEAEETDADAAAESEGEGADTDDTADVTAEEDAAVE
FT                   SASARKPRAERREAVAEAASETEPASEQAPEPAQTPAAPTQAVASAPTGVKTGRAPLTI
FT                   PVGDKGYRTRADWYLPTQGDGTVTATGVIWLQHGFLGNKSFVSALARNLSQQTNSIVVA
FT                   PNLSSFPLACAACWINGVPMREAVAGMFLDQRTSLTASAQAAGYVGALPEDFVLSGQSA
FT                   GGGFAAAVGGFYAANPLGDNDLRGVVMFDGFAFDGALADSLAKLDDPFVPVYQIAAPSQ
FT                   PWNGKGSSTRELVVARPDQFVGVTLAGGSHSDSLLGGNPITDLLLQLVTGRSPAGNTAA
FT                   AYTLANGWINDMYAGLGPADGTGIYGTPDQYIVMGDTAAVVLAPPPPVDLDRYLGTWFE
FT                   VGSVKQFFSIGLVNTKAQYSLNPDGSVRVENSGNYFVNNGPQSSIVGSALPVDATNNRL
FT                   TVRFFGPPSAAPPGNYWIVDLDPEYRWAVVTDPTGLSGFLLSREAVVTDAFYRELLDRA
FT                   SVYGVKARITPTRQPAAQTTTI"
FT   sig_peptide     294875..294967
FT                   /locus_tag="Mflv_0299"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.556 at
FT                   residue 31"
FT   gene            296706..297929
FT                   /locus_tag="Mflv_0300"
FT   CDS_pept        296706..297929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0300"
FT                   /product="PGAP1 family protein"
FT                   /note="PFAM: PGAP1 family protein; KEGG: mkm:Mkms_1215
FT                   PGAP1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42794"
FT                   /db_xref="GOA:A4T0X3"
FT                   /db_xref="InterPro:IPR012908"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0X3"
FT                   /protein_id="ABP42794.1"
FT                   /translation="MRTADMHALGDVAAEGLTVLNTLIRGMHAGIAGRVFTSIGPAAKP
FT                   VEKVHDAIAGTVYDILGAAGHRLPPALSTFVAAGLAFDDDAALDEHPRMAEVIAALNGI
FT                   YGDELAGRASPLAPPMTLRVSGRPVPLTADAVTAAYPRPTDAVAVFVHGLCQTESSWRR
FT                   PPRPTAHSEDGPYGERLYNDLGFTPVDIRYNTGLHISTNGRHLDEILTRLLEVWPVPVR
FT                   RIALIGHSMGGLVIRSACHYGQEQNRRWVRATRQVVCLGSPHLGADLEKGVNVATWAMA
FT                   RVGETRSIAELLNLRSDGIKDLRFGALLDDDWAESDPDEFLRDRCREVPFLPGATYHFV
FT                   ATSAAPRYLGAVLGDHLVRPSSASGRGQRRRVPFPAESGLTLTGLHHFDLLNHPDIYVR
FT                   LREWLGAS"
FT   gene            complement(298547..300016)
FT                   /locus_tag="Mflv_0301"
FT   CDS_pept        complement(298547..300016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0301"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rha:RHA1_ro05093 multidrug transporter, MFS superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42795"
FT                   /db_xref="GOA:A4T0X4"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0X4"
FT                   /protein_id="ABP42795.1"
FT                   /translation="MTGLRMGTAAGRWVLLATVLGSGIVMVDATVVNVALPHIAADLGG
FT                   GFGDLQWVVNAYTLTLASLILLGGSLGDHFGRRKVFVLGVVWFALASIACGLAPSIEVL
FT                   IVARALQGVGGALLTPGSLALISAAFASGDRGAAVGAWSGLGGIAGAIGPFLGGALVEW
FT                   NWRAAFLINVPLAAFVIAVTLLRVPESRDPSASRRLDVGGAVLTVVGLGALTFGLTELG
FT                   NRGASPAAVVSVGGGLVALVVFVLVEQRSSHPLMSPKLFADRNFGVANAVTLLIYGALG
FT                   AVFLLLVLQLQTVSGFSPVAAGTALLPFTIVMLLFSSRAGALSGRIGPRLPMTVGPVLA
FT                   GLGLLLMLRIGEDASWVFDVAPAALVFGAGMVLVVAPLTATVLDAAPEHMAGSASGVNN
FT                   AVARAGGLLAVAVLPGVAGISGNDYADPAAFSAGFHTAVVISAVLMVAAAVLAAIGIRR
FT                   APARSDERMAVENCTHCAITGLPAHPAAETR"
FT   sig_peptide     complement(299927..300016)
FT                   /locus_tag="Mflv_0301"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.608) with cleavage site probability 0.568 at
FT                   residue 30"
FT   gene            complement(300020..300520)
FT                   /locus_tag="Mflv_0302"
FT   CDS_pept        complement(300020..300520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0302"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0421 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42796"
FT                   /db_xref="GOA:A4T0W5"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR014878"
FT                   /db_xref="InterPro:IPR022939"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4T0W5"
FT                   /protein_id="ABP42796.1"
FT                   /translation="MVAPVPLHPDVVALAPLLGVWVGEGTGEYPTVPSFAYTEEITFGH
FT                   VGKPFLSYVQRTRAADDGRPLHSETGYVRSPAPHCVEWILAHPTGITEILEGILERIVT
FT                   GEGDTLRIDVESTAVGRSASAKEVSAVGRTIELAGDTLTYSVRMAAVGMPLQHHLSAVL
FT                   HRA"
FT   gene            300701..301450
FT                   /locus_tag="Mflv_0303"
FT   CDS_pept        300701..301450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0303"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   mmu:56196 Traf and Tnf receptor associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42797"
FT                   /db_xref="GOA:A4T0W6"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0W6"
FT                   /protein_id="ABP42797.1"
FT                   /translation="MCPVLTVSTFNIWFDAYFADERYRALADLLAAHPADVMVFQEVTD
FT                   RALDVLLAQPWIRRDYAAAAVTGRRVGNYGMLLLSRIPLSQVTYTRLPTAAHRGFLTAV
FT                   LISGGTETVLCSVHLDSGKRNSALRARQFREIDAEFAHADDVVLLGDFNMRDDENSRIT
FT                   APWCDVWPALRAPEPGFTEDTSINHMRCDATGKERFVRFDRVLVKGEQWRPDSVELIGT
FT                   EPISPAHPRVFPSDHFGLRCVLVRNTG"
FT   gene            301473..302720
FT                   /locus_tag="Mflv_0304"
FT   CDS_pept        301473..302720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0304"
FT                   /product="monooxygenase, FAD-binding protein"
FT                   /note="PFAM: monooxygenase, FAD-binding; KEGG:
FT                   mva:Mvan_0442 monooxygenase, FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42798"
FT                   /db_xref="GOA:A4T0W7"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0W7"
FT                   /protein_id="ABP42798.1"
FT                   /translation="MRDDDTVSDTTTCAIVGGGPAGMVLGLLLARAGVEVTVLEKHADF
FT                   LRDFRGDTVHPTTLRLLDDLGLWPRFADISHSRLDHATVDVGAGRSVTMVDFRRLRQPH
FT                   PYIAMVPQWDLLNLLADAGRAEPTFTLRMSTEVTGVLREGSRVTGVRYETADGTGELQA
FT                   GLTVACDGRGSLLREKTGLRTQEFPVGFDVWWFRLPRPETDEMYTLFPRLAPGRAMIVI
FT                   PREGYLQIALLIEKGTDAALRAHGLDAFHADVLALLPEAAGTVGSIASLDEVKMLDVKL
FT                   NRLRCWHIEGMLCIGDAAHAMSPAGGVGINLAIQDAVAAARLLAEPLRRGTVTGRDLAR
FT                   VRRRRILPTVVTQALQRLIDRRLLGPIVRGGSGGPSPGLIRTVERLPWLTVIPAYLVGV
FT                   GVRPERAPRFARRRPQ"
FT   gene            302731..303516
FT                   /locus_tag="Mflv_0305"
FT   CDS_pept        302731..303516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0305"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mva:Mvan_0441 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42799"
FT                   /db_xref="GOA:A4T0W8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0W8"
FT                   /protein_id="ABP42799.1"
FT                   /translation="MTTTSANPFDLTGHVAVVTGGGSGIGLGMAGGLARAGATVAILGR
FT                   NAQRLDDAAATLRTHGNPVLPLVCDVTDEEAVTETMARIRDEFGWLDSCFANAGVRGRF
FT                   TPVLETSLAEFRSVTSVDLDGVFLTLREAARQMVAAGRGGSLVGVSSLGAFQGMPRQPA
FT                   YAASKAGVTSMMDSFAVELARHGIRANTVAPGWFETEMTSEGMADERFTSRVLPRVPVR
FT                   RWGAAEDVAGVGVAVYLAGPASAYHTGDVLRLDGGYLKF"
FT   gene            303580..304302
FT                   /locus_tag="Mflv_0306"
FT   CDS_pept        303580..304302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0306"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0440 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42800"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0W9"
FT                   /protein_id="ABP42800.1"
FT                   /translation="MNLLLSALPAPAVHITDTGVEAALSAAVRIINPLLDVLWETDPLD
FT                   LKRRDDALGRLLNAVDVPGTPSWEDMDTDARIHWWVWRVGAVNTVAVAFPGVLGIVARQ
FT                   LPLQDLFGFVSQAVVLCAVARELGVTDQRTQVRMLAAVLCERDLSVVVFDGDDRRPLAS
FT                   IPHSATGVAKAIWNLVGLFDAIADELAKRPHPRGPIKYLGLLPGVGAVAAYIGECGALA
FT                   RAAKQGRRWLEKPARSEP"
FT   gene            complement(304291..305325)
FT                   /locus_tag="Mflv_0307"
FT   CDS_pept        complement(304291..305325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0307"
FT                   /product="malate dehydrogenase (NAD)"
FT                   /EC_number="1.1.1.37"
FT                   /note="TIGRFAM: L-lactate dehydrogenase; PFAM:
FT                   Lactate/malate dehydrogenase; KEGG: mva:Mvan_0439 L-lactate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42801"
FT                   /db_xref="GOA:A4T0X0"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0X0"
FT                   /protein_id="ABP42801.1"
FT                   /translation="MFSAVGSIGCGGDSRSTDILLWGEDGPMPVEQNTKVSVIGMGSVG
FT                   TAIAYACLIRGSAGALALYDLNAAKVRAEVLDLNHGSQFVPHCRITGSDDIAVTDGSAV
FT                   IVVTAGAKQKPGQSRLELAATNVAMAQTLTPQLLERSPDAVIVFVTNPVDVVTFAAARS
FT                   VNAAPGHIFGSGTVLDSSRFRYLIADRADLAVANVHGIIVGEHGDSEISLWSSVSVGGV
FT                   PAAQFRRDGVPVFDEDTRKRISAEVVNAAYEIIAGKGATNLAIGLSTARIVEAVLGDEH
FT                   RVLPVSTVQEGAYGILGVALSLPTVVSAHGAGRVLEVALSEDERVGLQASATTLRQAQE
FT                   RLGL"
FT   gene            complement(305407..307203)
FT                   /locus_tag="Mflv_0308"
FT   CDS_pept        complement(305407..307203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0308"
FT                   /product="conserved hypothetical proline and threonine rich
FT                   protein"
FT                   /note="KEGG: mva:Mvan_0433 conserved hypothetical proline
FT                   and threonine rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42802"
FT                   /db_xref="GOA:A4T0W1"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0W1"
FT                   /protein_id="ABP42802.1"
FT                   /translation="MSDALGLSIGSTNLVAATVGNEPVLRRSVLTVYGHAAPQVGDGAD
FT                   AGGATLTDFVERVGDPVPLVASDGATYPAEQLLVEALETMAGLATSQRLADVVIAVPSY
FT                   WTVEATRALAQTVTASDLLAPSGAPPRLISDTEAALTALNANPGLDRRGVAVLLDFGGS
FT                   GTSITAVDAAAFTVIGTHRHPDFAGDQIDQALLGHVLAAAGGDTDPAQTAAVGSLARLR
FT                   DDCRVAKERLSNQTATQLTVELPGAGTEIRVTRAELDDLLRRPLDGVFTALDDLLSRNG
FT                   IAPDAVTSVAMVGGGASIPLIGQQVSQRLQVPVITTARPALDGAVGAAMFAAYGRSADT
FT                   STVAAAPVVLPPGVDSGDSGDATYALAWSQDDPSADDIVPYTGEEPAERPNPYVLSDPY
FT                   GPTEVIAQEAPPADEPRPRVPLTLTGILAAVALLAVGGAAIALTSVQTSDRTPPKPANA
FT                   PLSSPFVPPSAAPETVTVPQQQDEPAPPPATAEAPPPVVVTTAPPAAPETTTATTTTTT
FT                   TTTTSPTTTTTTTTTTTTTPPTTTTTAPTTTTAPPTTTAPTTTVPPTTVPPTTTGGIAT
FT                   TTTYLTVPFVPVPIPILVPDVP"
FT   gene            307283..307741
FT                   /locus_tag="Mflv_0309"
FT   CDS_pept        307283..307741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0309"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0432 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42803"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0W2"
FT                   /protein_id="ABP42803.1"
FT                   /translation="MSDIDEIKQVKYRYLRALDTKHWDDFADTLTEDVVGRYGESIGEE
FT                   HHFTNRDDLVGFMRNSLGPEVLTEHRVNHPEITVDGDEASATWYLQDRVIAPDFNFMLI
FT                   GAGFYHDRYRRTADGWRICETGYDRTYDASMKLDAVEFKVKPGRALNI"
FT   gene            complement(307753..308418)
FT                   /locus_tag="Mflv_0310"
FT   CDS_pept        complement(307753..308418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0310"
FT                   /product="putative conserved exported protein"
FT                   /note="KEGG: mva:Mvan_0431 putative conserved exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42804"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0W3"
FT                   /protein_id="ABP42804.1"
FT                   /translation="MAMLRRLSTLLCAIAVAGLLTAPHAGAFAPWFANSVGAATQVLAV
FT                   TGAGGSDAKLDVWQRTPAGWKPVDGGVGIAAKVGAKGLSPNHFEGSMMTPTGVYSLDFA
FT                   FGTRPDPGSGLKYVQVGSNHWWDGDVASPTYNTMQVCDRQNCRFATSGTGTENLNIPQY
FT                   AHAVVMGVNKERIPGKGSAFFLHSSTGDATAGCVAIDDATLVTIMRWLRPGAVIAIAE"
FT   sig_peptide     complement(308302..308418)
FT                   /locus_tag="Mflv_0310"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.575 at
FT                   residue 39"
FT   gene            308471..309964
FT                   /locus_tag="Mflv_0311"
FT   CDS_pept        308471..309964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0311"
FT                   /product="phosphoesterase, PA-phosphatase related protein"
FT                   /note="PFAM: phosphoesterase, PA-phosphatase related;
FT                   diacylglycerol kinase, catalytic region; KEGG:
FT                   mva:Mvan_0430 phosphoesterase, PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42805"
FT                   /db_xref="GOA:A4T0W4"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0W4"
FT                   /protein_id="ABP42805.1"
FT                   /translation="MDLLPVGRRGRGIRQIGVGLGTLDREVFEAIAESPSPLLDAVMPR
FT                   LTRAADHSKLWFGIAAGLMALGSPSVKRGAVRGVATLAVTSLVTNQGAKRVWKRERPNW
FT                   SFVPLARQTRRHPTSNSLPSGHSASAAAFSIGVGLENPPAGLGLALLAGLVGMSRVATG
FT                   AHYPGDVLAGFGLGAGIAVLGARIVPPIVETRLPVSDPLRVDTPERPEGEGLVLVINPA
FT                   SGSGTGARVVDEVREALPKAEIVELDEDDDVASVLQSAADRAEVLGVGGGDGTVAAAAS
FT                   IAVAAGLPLAVFPAGTFNHFAKDIGCDTTAKTVAAIRQGTVSCVDIVCMNEKQMVVNTA
FT                   SIGAYPRFVQTREKLEHKIGKPLAGVYAMFHTLRRGEPVRIEYDNKTLQTSLFFLGNSG
FT                   YLPTGFAPSRRTRMDDGLLDVRILETGRRLSRLRILTALVLGRLTRSPLYHELKVPEFS
FT                   FRSPDGPTVLALDGEVGTEIDEASFSVQYRALPVFRPAV"
FT   gene            complement(309918..310586)
FT                   /locus_tag="Mflv_0312"
FT   CDS_pept        complement(309918..310586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0312"
FT                   /product="phosphoesterase, PA-phosphatase related protein"
FT                   /note="PFAM: phosphoesterase, PA-phosphatase related; KEGG:
FT                   mva:Mvan_0429 phosphoesterase, PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42806"
FT                   /db_xref="GOA:A4T0V6"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0V6"
FT                   /protein_id="ABP42806.1"
FT                   /translation="MTPDNRRLLAGVVAALAVYGLLWAGWAQDWGWLTRADDAALDAAH
FT                   RVGESHSGWVTAWDVFCTVLGPGAFRLAVLVLIVLALLRRRIRLAVFLVVTVELSGLVT
FT                   EIAKHLAGRARPDTAFVDAWGLSFPSGHALGVLVAVAALLSVAVPAVAPSRRAWLIALG
FT                   VVIVVTVGVGRVILNVHHPSDVLAGWALGYAYFLVCLRLVPPATLTRRDETPAELDIAR
FT                   "
FT   gene            310721..311203
FT                   /locus_tag="Mflv_0313"
FT   CDS_pept        310721..311203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0313"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0428 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42807"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0V7"
FT                   /protein_id="ABP42807.1"
FT                   /translation="MAVFLRKLFRIGKLPSALRAEVEAEGVLFMSEYVAVTRRFRGTVP
FT                   GLRSGGSIASYVGSLVLTNERVLGTLSTVPKLAGRTIDQRWDAPQTGSVKAELSETGLT
FT                   LDVDVSAVDPRCSGELSLHYKEDIPRDVLARLPRTSLAFDASPEFVFRAVGVPYHP"
FT   gene            complement(311217..312755)
FT                   /locus_tag="Mflv_0314"
FT   CDS_pept        complement(311217..312755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0314"
FT                   /product="protein of unknown function DUF222"
FT                   /note="PFAM: HNH endonuclease; protein of unknown function
FT                   DUF222; KEGG: mva:Mvan_0426 protein of unknown function
FT                   DUF222"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42808"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0V8"
FT                   /protein_id="ABP42808.1"
FT                   /translation="MFEELIDAAGRSRGAAAIGAWARIENAAVAQRLSAMADLLESRLT
FT                   DKDSAERDQWCLDNWDAVSAEVAAGQHTSLGVASNELLDAWTLRRRLPRVAEVFASGAI
FT                   SYRLVKSVVKRTRLVVDPEVMAKIDAEIAAHIRGWGPLSVAKHEAEIDHWVDLYDPAAV
FT                   VHAESAARSRHVDVTPAADGSGTCFVEAVLYAHDGEVMDRRLDDMARGVCLADPRTHEQ
FT                   RRADALAAIMNKADRLSCLCGAEDCEAGARTTSSVVVHVIAEESSLTDDTPVALNGDKP
FT                   ASPEPEPESEPKPEPSRFESLLGPVPAAGPAKTNPAVVLGGGLLPGPLLAATLAQTATI
FT                   RRLVHPGDSPAEPRYVPSAKLADFVRCRDMTCRFPGCDVAAYSCDLDHTIAYPVGPTQA
FT                   SNLACLCRKHHLLKTFWGWRDVQYPDGTVLWTSPGGQTFTTHPGSRVLFPSLCRPTAPV
FT                   AVDAGVRAPTPSAPSGLGMPRRTQTRAQVRARRIHDQRAENQALLEGRNHAPPF"
FT   gene            312849..314147
FT                   /locus_tag="Mflv_0315"
FT   CDS_pept        312849..314147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0315"
FT                   /product="transposase, IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="PFAM: transposase, IS204/IS1001/IS1096/IS1165 family
FT                   protein; KEGG: rha:RHA1_ro00013 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42809"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0V9"
FT                   /protein_id="ABP42809.1"
FT                   /translation="MKDAHVVEPLGFGVTTPTSTARTTHVRVSTAFNRLLAIPGASVTD
FT                   VVIGERDVEVTLRPTARLLTCPCGKRQPSVYDRRRRRWRHLDLGVKRLWLVNEIRRLNC
FT                   PDCGVITEAVPWARPGSRFTRDFEDMVLWLAQRSDRTTVSTLMRCAWESVTAIINRGVA
FT                   ELLDKRRLQTLYRIGVDEICYRHPHRYLTIIGDHATGTVVNIRPGRSEQSLTDFYTAQP
FT                   DSMLKQIQAVSMDVSKPYIGATRSKVPEAIICFDGFHIMRWINRALDAVFSEAAAGPDK
FT                   VHMSSAQWRTTRWALRTGENRLTDTKRELVNQIAKQNRRVGRAWALKEQARDLYRYDHQ
FT                   PGVARALLKAWITAAKRCRIPAFVALGKRLAVYFDGILAAIELGISNALAESINAKIRL
FT                   INARGYGHHTAETLTSMIYLCLGGLQVKLPTRT"
FT   gene            complement(314251..315018)
FT                   /locus_tag="Mflv_0316"
FT   CDS_pept        complement(314251..315018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0316"
FT                   /product="Trans-aconitate 2-methyltransferase"
FT                   /EC_number="2.1.1.144"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: mkm:Mkms_0395 trans-aconitate
FT                   2-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42810"
FT                   /db_xref="GOA:A4T0W0"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR023149"
FT                   /db_xref="InterPro:IPR023506"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4T0W0"
FT                   /protein_id="ABP42810.1"
FT                   /translation="MWNPAVYLTYADHRGRPYYDLLSRVDAREPRRIVDLGCGPGNLTR
FT                   TLTQRWPGAVVEAWDSSEEMVTAARERGVDARVGDVRDWAPLPDTDVVVSNATLHWVPE
FT                   HPDLLLRWAGQLRAGSWIAFQVPGNFDAPSHRAVRDLVSSARWAHLLRDFPFEKSEVVR
FT                   PAAGYAELLTDAGCTVDAWETTYVHELTGEKPVLEWIGGTALRPVRAALPDHDWQEFRA
FT                   ELIPLLDAAYPRRADGITFFPFRRIFVVARVKN"
FT   gene            315058..315717
FT                   /locus_tag="Mflv_0317"
FT   CDS_pept        315058..315717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0317"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0423 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42811"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0V2"
FT                   /protein_id="ABP42811.1"
FT                   /translation="MRDVEPDSVPDEVLPLPVPDVRGADATARGLPRRVDLTLRQRLIV
FT                   DSSAVADLALRTSIASLLSVTMVPTLAQALNRSAAATEQEHLRFYAELAAAQDPQLSFP
FT                   APQSPPRVSSRAANPVAEWVAHGKVRNIRFESGFRAVNPALRDHRAGFARNNIVHAQHW
FT                   RHDDGPRPTLCLIHGFMGSAYLFNGLFFSLPWFYRCGYDVVLYTRQGPSADHRRPR"
FT   gene            315746..315871
FT                   /locus_tag="Mflv_0318"
FT   CDS_pept        315746..315871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0318"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0423 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42812"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0V3"
FT                   /protein_id="ABP42812.1"
FT                   /translation="MLWRHWDHCAFHWFPGNHVLHVSQPDYLRRMTKFLAPFMFG"
FT   gene            complement(315858..316763)
FT                   /locus_tag="Mflv_0319"
FT   CDS_pept        complement(315858..316763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0319"
FT                   /product="putative conserved transmembrane protein"
FT                   /note="KEGG: mva:Mvan_0422 putative conserved transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42813"
FT                   /db_xref="GOA:A4T0V4"
FT                   /db_xref="InterPro:IPR021368"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0V4"
FT                   /protein_id="ABP42813.1"
FT                   /translation="MIVRLTLAALFVIPAAMAYPWQTTFDRWLLGVAVAVVVILFAWWR
FT                   GLFVTTLVARRIRLLTRRGRSADDGDAGEFATVALRVEQGQADLPLALAADHLDRYGIA
FT                   FDKVRVTSREAAGHRTTWVSLTLGAASNIAALTARSPQIPLQDTVEVAARRLADHLRER
FT                   GWEVTIDDAPGPLPGDGGKETWRGVVDGHGHLAAYRVRVDERLTETLAAAGSAGTEFWS
FT                   AVEFTGSRTSPEIAASCALRTTDRPPAIAGLTAERGLHRSALDALGPTSHRRLLAPPVP
FT                   ATPELVAQLRLPVGAILSRT"
FT   sig_peptide     complement(316707..316763)
FT                   /locus_tag="Mflv_0319"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.677) with cleavage site probability 0.626 at
FT                   residue 19"
FT   gene            complement(316760..318127)
FT                   /locus_tag="Mflv_0320"
FT   CDS_pept        complement(316760..318127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0320"
FT                   /product="peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin"
FT                   /note="PFAM: peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin; KEGG: mva:Mvan_0421 peptidase S8 and S53,
FT                   subtilisin, kexin, sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42814"
FT                   /db_xref="GOA:A4T0V5"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023834"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0V5"
FT                   /protein_id="ABP42814.1"
FT                   /translation="MTPVIRPAAALAVAAAVFTIVAAPAGAIPPPDVDPAATPPSGAAG
FT                   PVAPMTQRNPCAVTGVVPGSDPAAPSPNQLSLNMSDAWRHSDGRDQLVAVIGTGVTPGP
FT                   RLPNVDPGGDFVGSGDGLTDCDGSGTLVAGLIAGAPGPDGFSGVAPAARILAIRQTSPR
FT                   YAPSSTGEDPALTRASIETRTLARAVVRAADSGARVIAISSVTCVPAGMSVDQSELGAA
FT                   LRYAAVEKDAVIVAAAGDTEGSTGCGENPLNDPARPADPRNWAGVSTLAIPAWWEQYVL
FT                   SVGSVGPQGRPSAFTMAGPWVGIAAPGEDITSVSNDAAGGLANGTLNGEQQYDPLSGTG
FT                   YATAYVAGVAALVRSRFPALTGPQVRERLTGTANQAARAPSNLVGAGRVDPVAALTWNV
FT                   PAAGVDASVPKQVAAPPDTPPADPLPRLVAYAGVGVLAAVVIAAAVLRAKRKDPSA"
FT   sig_peptide     complement(318044..318127)
FT                   /locus_tag="Mflv_0320"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.492 at
FT                   residue 28"
FT   gene            complement(318131..319579)
FT                   /locus_tag="Mflv_0321"
FT   CDS_pept        complement(318131..319579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0321"
FT                   /product="protein of unknown function DUF571"
FT                   /note="PFAM: protein of unknown function DUF571; KEGG:
FT                   mva:Mvan_0420 protein of unknown function DUF571"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42815"
FT                   /db_xref="GOA:A4T0U8"
FT                   /db_xref="InterPro:IPR006707"
FT                   /db_xref="InterPro:IPR024962"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0U8"
FT                   /protein_id="ABP42815.1"
FT                   /translation="MPQSALSDTNTAMPIVRVAVLTATAGDEDGDRAGRLTEIALPAQL
FT                   PLREIIPAVQRIVAPSDDAPGTDPVSLAPIGGAPYSLDATLTTVGVVDGDLLALQPIPA
FT                   GPPAPRIVEDIADAAMIFSAAREKPWGTPQIQRGATVAVVGLMLVATALAVAHRVVTDS
FT                   IIGVFAVSAVAIAAVLGALVARTGSPRVATALAAAALPSVGAAFTLAVPGDFGASAVLL
FT                   GAAGIAAWSIISITVGERAIAVFTAVAAAALGVAVAAAAATVWSLSLLDIGCVLILIAL
FT                   LITVQAAQLSAMCARLPVPVIPAPGDPAPSALPRRVLEDLPRRIRAGDAYQTGFIAAGV
FT                   LLAVTGSVLVVWPAVSGDGGVPVWSWYLVAATALAAALRARVWDSSACKAWLLGHGYLV
FT                   TTVLLVLSAAHEKYSAAWWALGVLAVLVAAWAVAALNPRIAQPDTYSLPMRRVVGFVAT
FT                   ALDASVIPVMAYLVGLFTLVLNGF"
FT   gene            complement(319561..320433)
FT                   /locus_tag="Mflv_0322"
FT   CDS_pept        complement(319561..320433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0322"
FT                   /product="putative DNA-binding protein"
FT                   /note="KEGG: mva:Mvan_0419 putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42816"
FT                   /db_xref="GOA:A4T0U9"
FT                   /db_xref="InterPro:IPR025734"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0U9"
FT                   /protein_id="ABP42816.1"
FT                   /translation="MRANAVELSAASAWFLAEELGAGSYPWVLAITPPYSDVSARGPFE
FT                   REQTEKLRGAGIMTAERTVDPAVARWIRRVCRPTQWLELRFVGSRGAVLRGVLARDGAG
FT                   TVIALRSGGLITLTELDIDHPEALVPVVTAGLSGRAPARFDGFSLPARVGAKADEQIRK
FT                   GAAVGGLLDYLGIPPSARPVVVAAFEDSRTYVEIVAGQHRDGHRVSTDVGVSVVDTVLG
FT                   RVLVSPAKARDGEWISTFAPGDPVAIAAAVERLTAALPDGPWFPDHALTRDFDERTAER
FT                   REERCHSPL"
FT   gene            complement(320443..320730)
FT                   /locus_tag="Mflv_0323"
FT   CDS_pept        complement(320443..320730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0323"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0418 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42817"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0V0"
FT                   /protein_id="ABP42817.1"
FT                   /translation="MSQIMFNYPAMLNHAGEMSSYAGALQAIGADIAAEQAALKSAWQG
FT                   DTGVTYQAWQAQWNTAMEELVRAYRAMASTHEMNTTSMAARDQAEGAKWG"
FT   gene            complement(320744..321037)
FT                   /locus_tag="Mflv_0324"
FT   CDS_pept        complement(320744..321037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0324"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0417 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42818"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0V1"
FT                   /protein_id="ABP42818.1"
FT                   /translation="MSLLDAHIPQMIASEAAFGAKAGLMRSTIAQAEQAAQSAQAFHMG
FT                   ESAGAFQAAHARFVETSAKINALLDIAQANVGDAAGAYVAEDAAAASTYPAV"
FT   gene            complement(321034..322656)
FT                   /locus_tag="Mflv_0325"
FT   CDS_pept        complement(321034..322656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0325"
FT                   /product="PPE protein"
FT                   /note="PFAM: PPE protein; KEGG: mva:Mvan_0415 PPE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42819"
FT                   /db_xref="GOA:A4T0U4"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0U4"
FT                   /protein_id="ABP42819.1"
FT                   /translation="MTSPVASLAPVTSPVWMALPPEVHSTMLSSGPGPGSLLAAGVAWQ
FT                   SLSAEYASAAAELTSILAGVQSGAWEGPSSQQYVAAHTPYLAWLAQQSAVSAATAVQHD
FT                   TAAAAYTTALATMPTLPELALNHTTHAVLVGTNFLGINTIPIALNEADYVRMWIQAATT
FT                   MATYQSVSGAALAATPTSAPAPSVLLPGVGEAGRAAADMSAFAAQPMAAQAGAAFDVSN
FT                   IIADIIRLYGEVLRFLFEPIFNFLRDPIGNTFALITDFLTNPVQALITWGPFLLAVVYQ
FT                   AVSWVGASILYPSLFLLPLLATTLAIVAGVGQHLLSLLNTPPAEEAAEEPAPAQSAPSR
FT                   PDQQSFPATMSAPPPPSGAPIAANTVSAGSPPAPGAPAAAAATFVPYVVAGRDPYEGFS
FT                   PTVRDSTGAKAPAGTIPAAASGIAASAAERRKRRRRQKEEIKGRGYADAYADYEELPDD
FT                   GPPEQPAPRVTASTRGAGPMGFAGTVSRGDEQAGGLTTLAGDSFGGGPREPMLPGTWDP
FT                   DATDDRHTDGRDGHDGHDGKEKP"
FT   gene            complement(322662..322970)
FT                   /locus_tag="Mflv_0326"
FT   CDS_pept        complement(322662..322970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0326"
FT                   /product="PE domain protein"
FT                   /note="PFAM: PE domain protein; KEGG: mva:Mvan_0414 PE
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42820"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0U5"
FT                   /protein_id="ABP42820.1"
FT                   /translation="MTLRVVPEGLTAASAAVEALTARMAAAHAAAAPLVTAVLPPAADA
FT                   VSLQTATGLSANGVEHQSIAARGVEELGRSGVGVGDSAASYVSGDAMAATSYLIARG"
FT   sig_peptide     complement(322881..322970)
FT                   /locus_tag="Mflv_0326"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.971) with cleavage site probability 0.875 at
FT                   residue 30"
FT   gene            complement(322970..326956)
FT                   /locus_tag="Mflv_0327"
FT   CDS_pept        complement(322970..326956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0327"
FT                   /product="cell division protein FtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; SMART: AAA ATPase;
FT                   KEGG: mva:Mvan_0413 cell divisionFtsK/SpoIIIE"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42821"
FT                   /db_xref="GOA:A4T0U6"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR023836"
FT                   /db_xref="InterPro:IPR023837"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0U6"
FT                   /protein_id="ABP42821.1"
FT                   /translation="MSRLIFEHRKRLPAPVARKGTITIEPPPELPRVVPPSLLRRALPY
FT                   LIVILIVGMIVALVATGLRLISPTTLFFPFVLLLAATALYRGTDNKMRTEEVDAERADY
FT                   LRYLSVVRDNVRAHADEQRTALQWSHPEPAALNGIPGTRRQWERDPHDPDFLVLRAGLH
FT                   DQPLDVTLRVKDTADEIDLEPVSHTTLRGLLDAQRTLYDVPAGIALTRVSRITVLGDDA
FT                   EVTGALRAWVAQAMTWHDPSVLGIAFAGEALESEAWSWLKWLPHVDVPGRIDGVGPARY
FT                   LAGDASDLRTLLAPALADRSGFTGDATGTTKHLLIVLDDPDADPSEFIGSGLAGVTVIH
FT                   RSATEPDRDQYSDPERPVLRISGGRIERWQNGTWASNIDSADHLGAADARHIARRLARW
FT                   DSNPDHARSATTGGAAFTTLLGIPDASALDVAALWAPRNRDDELRVPIGVTATGEPLIF
FT                   DLKDEAEGGMGPHGLMIGMTGSGKSQTLMSILLSLLTTHPADRLIVIYADFKGEAGADI
FT                   FRNFPQVVAVISNMAEKRSLADRFADTLRGEVARREQLLKDSGRRVQGSAFNSVTEYEN
FT                   AVREGHDLPPIPTLLVVADEFTLMLADHPEYADLFDYVARKGRSFRIHLLFASQTLDVG
FT                   RIKDIDKNTSYRIGLKVASPSVSRQIIGVEDAYHIESGREHKGVGFLVPAPGALPVKFR
FT                   STYVDGIYEPPRVDRSIVVHAIPKPQLFSAGWVDPEPDTVIVDDGADVEVLPPRKLIAT
FT                   IGEQLVHYGPRAPQLWLPPLEEAIPLQGLLERSGIGAGQWRWPLGEIDRPFDMRRDPLV
FT                   FDATSAAANMVIHGGPKSGKSTALQTFVLSAAALHAPGDVSFYCLDYGGGQLRVLDGLA
FT                   HVGSVASPLESERIRRTFGELEQLLQARQRHGAAVNNGGYRDGYGEVFLLIDNLYAFSR
FT                   DNTDTFNTRNPLLAKVTELVNTGLAYGIHVVITTPNWLEVPLAMRDGLGLRLELRLHDA
FT                   HDSNVRVVGALRRPAEGVPADQPGRGLTMAAEHFLFARPAPETIPALNARFPGQSAPEV
FT                   RLLPTRLSPRAFASLYPAPERVVIGQREEDLAAVSVDFADNPLLMVFGDTKTGKTTLLR
FT                   HLIRTLRENSRADQVAFTVIDRRLQLVDEPIFPDNEYTPNIDRILPAMLGLAGLLEKRR
FT                   PPAGLSPQELRGWDFRSSANGSGSHLHYLIIDDVDQIPDGPAVSGPYAGQRPWTPVIGL
FT                   LSQASELGLRVIVTARAAGSAHAVMTAPLLRRLNELQATTLLLSGNPQDSGKIRGHRFS
FT                   RLPAGRGLLLDDSNLSDTPTYVQLVDPLADDATAPAGHLGKEYS"
FT   gene            complement(326953..328491)
FT                   /locus_tag="Mflv_0328"
FT   CDS_pept        complement(326953..328491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0328"
FT                   /product="protein of unknown function DUF690"
FT                   /note="PFAM: protein of unknown function DUF690; KEGG:
FT                   mva:Mvan_0412 protein of unknown function DUF690"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42822"
FT                   /db_xref="GOA:A4T0U7"
FT                   /db_xref="InterPro:IPR007795"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0U7"
FT                   /protein_id="ABP42822.1"
FT                   /translation="MSGADGDRRSFTSRTPTNENPDRVSFRRGFVTRHQVSGWRFMVRR
FT                   MASGVALHDTRMLVDPLRTQSRSVLVGALILVTGLIGCFLFSLIRPAGDVGTDSILAER
FT                   DTAALYVRLGDQVHPVLNLASARLITGRPDNPAMVKSSELDELPRGNMLGIPGAPGRMA
FT                   VNTTRDAYWTVCDAAAGAVTGVTVIAGAPDDTGERATVLPDGHAVLAENNGRTWLLWDG
FT                   RRSAIDLADRAVAGGVGIGVGVAAPQPIATGLFNAIPEAPALITPVIPNAGLPSDLGLP
FT                   EPFPVGSVVVSYDEDNTLRHYVVLTDGLQPISPVVAAILRNSNSWGLASPPRLDADLVA
FT                   RTPQAEVVDVDAYPAERVTLVDTAAEPVICAAWSEHEGAQESSMELRSGAALPVADGVS
FT                   TVALVSAGAPGGPANQVALPQGTGYFVDNAGSLFWLSDTGVRYGIDTGADADGADTVAA
FT                   LGLTTTPLPIPSSVLSLFAAGPTLSRGDALLAHDTLAPNPSPARVEALPGLENP"
FT   gene            complement(328488..330338)
FT                   /locus_tag="Mflv_0329"
FT   CDS_pept        complement(328488..330338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0329"
FT                   /product="AAA ATPase, central domain protein"
FT                   /note="PFAM: AAA ATPase, central domain protein; SMART: AAA
FT                   ATPase; KEGG: mva:Mvan_0411 AAA ATPase, central domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42823"
FT                   /db_xref="GOA:A4T0U0"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR023835"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041627"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0U0"
FT                   /protein_id="ABP42823.1"
FT                   /translation="MDIGSDTLAPPAGTSRVDQDVVSRFATCCRALGLSVHERRRPADL
FT                   TAARAGFAALTRIASDQCDAWTGLAAAGDVTPQVIERVWQTSGATAGLLSRRIELAPQA
FT                   LGFTYDSGLYLRFRASTPDDFALAYTVCLSDAACYEEADQLLEGLLARRRGWFEARWVR
FT                   IAMYHRAARWSDVVRMLTPLVTDATLDETSAHAARVTLGIALARLGMFAPALSYLERPE
FT                   GPVTVAATDGALVKALSLRAQGEDEEALQLLQELYAVNPEHAQIEEALLDTSFGIPTTT
FT                   AARIEARSNPWDPETEPGEADFVDSGAKDRKAHLLVEAEAELAEFIGLDEVKYQVARLK
FT                   SSVAMAIRRQERGLAVAQRTNHLVFAGPPGTGKTTIARVVAKIYCGLGLLKKETVREVH
FT                   RADLIGQHIGETEAKTNAIIDSALDGVLFLDEAYALVSTGAKNDFGLVAIDTLLARMEN
FT                   DRDRLVVIVAGYRKDLDTFLDANEGLRSRFTRSIDFPSYSPKELVEIAVRMAEKRDSHF
FT                   EDSARSDMESLFSYLAESSSPDANGVNRRSLDIAGNGRFVRNLVERSEEEREYRLDHSD
FT                   AEDFTDDELMTITAADVGQSAGPLLRGLGLAVPQHASDER"
FT   gene            complement(330506..331411)
FT                   /locus_tag="Mflv_0330"
FT   CDS_pept        complement(330506..331411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0330"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0410 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42824"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0U1"
FT                   /protein_id="ABP42824.1"
FT                   /translation="MTLNESVPAALPVVERPINDVVVDVPTGRRARRGDDGMLGLGLLA
FT                   GPANVIMQLARPAVGYGVLESRVESGRVDRHPIKRARTTFTYLAVSTNGTPEQQKAFRR
FT                   AVNGAHAQVFSTDESPVKYHAFDKDLQLWVGACLYKGVVDVHRLFVGEMDEETADRVYV
FT                   QGRALATMLQVPESMWPADREAFDRYWAASLDEVHIDDTVREYLYPIAASRLRGLRLPG
FT                   PLQRRNEELALLITTGFLPQRFRDEMRLPWGPDHQRRFDRLMKVLRVANTVSPKFVRQF
FT                   PFNLLLKDVDRRIRTGRPLV"
FT   gene            331511..332140
FT                   /locus_tag="Mflv_0331"
FT   CDS_pept        331511..332140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0331"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /note="KEGG: mva:Mvan_0409 FadD27"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42825"
FT                   /db_xref="GOA:A4T0U2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0U2"
FT                   /protein_id="ABP42825.1"
FT                   /translation="MGCMAQVRPYRGVDAPARVAERRRRLLEAGLDLLGGQLNPPELTV
FT                   RAICAQSGLAARYFYESFTDKDVFVGAVFDRVIADIATTTQAAVAAAPPREQSRQGMAN
FT                   IVRAISEDARVGRLLFNAHLDNPVVVRKRAESGALFALLSGQHAGSALRLERNDRITSA
FT                   AHFVVGGVAQTLSAWLAGDLTFTEAQLAAQLGALIDQLADPALYRD"
FT   gene            complement(332147..332722)
FT                   /locus_tag="Mflv_0332"
FT   CDS_pept        complement(332147..332722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0332"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: mva:Mvan_0408
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42826"
FT                   /db_xref="GOA:A4T0U3"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0U3"
FT                   /protein_id="ABP42826.1"
FT                   /translation="MIKPDNTNTEFALGGINHVALVCSDMARTVDFYSNVLGMPLIKSL
FT                   DLPGGMGQHFFFDAGNGDCVAFFWFAEAPDRVPGISSPEAIPGIGDIVSAVSTMNHLAF
FT                   HVPAEKFDEYRQKLKAKGVRVGPVLNHDESPAQVSATLHPGVYVRSFYFLDPDGITLEF
FT                   ACWTKEFGDSDTATVPKTAADRRVPVNG"
FT   gene            332831..333967
FT                   /locus_tag="Mflv_0333"
FT   CDS_pept        332831..333967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0333"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0405 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42827"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0T6"
FT                   /protein_id="ABP42827.1"
FT                   /translation="MSRTTAAQAPGVTREFVGLDSTTARRAGSGGHPCQGLYHRGMGRR
FT                   PKVAMIATHYQIDFSEHYLADYMATRGIGFLGWNTRFRGFESSFLLDHALVDIGVGVRW
FT                   LREVQGIETVILLGNSGGGSLMAAYQANAVDKHVTPLDGMRPAAGLDDLPAADGYVASA
FT                   AHPGRPDVLTAWMDASVVDENDAVATDPDLDLFNERNGPSYDAEFVTRYRAAQVARNEA
FT                   ITDWAEAELARVRAAGFSDRPFTVMRTWADPRMVDPLLEPTKRPPNMCYAGVPVKANRS
FT                   THGIAAACTLRNWLGMWSLRHAQTRAERHLARIDCPALVINAEQDTGVFPSDAQRIYDA
FT                   LAGDDKTLCAMDTDHYFTTPGARSEKADTIAKWITRRW"
FT   gene            333964..334911
FT                   /locus_tag="Mflv_0334"
FT   CDS_pept        333964..334911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0334"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase, NAD-binding; KEGG: mva:Mvan_0404 D-isomer
FT                   specific 2-hydroxyacid dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42828"
FT                   /db_xref="GOA:A4T0T7"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0T7"
FT                   /protein_id="ABP42828.1"
FT                   /translation="MRVLAHFLPGPKVTEFLSPHTDWLDIRYCAEDDDETFYRELPDAE
FT                   VIWHVLRPISGDDLSKAPKLRLVHKLGAGVNTVDVDTATARGIAVANMPGANAPSVAEG
FT                   TLLLMLAALRRLPELDRATRTGNGWPSDPTLGESVRDLGGCTVGLVGYGNIAKQVERIL
FT                   LAIGAEVVHTSTRDDGLPGWRTLPDLLSESDIVSLHLPLTGATEGLLGRKALAQMKTDA
FT                   VLVNTSRGAIVDEAALVDALRAGTLAAAGLDVFAVEPVPSDNPLLGLPNVVLTPHVTWY
FT                   TADTMRRYLEFALDNCERLRDGRALAHVVNDPSG"
FT   gene            334972..337158
FT                   /locus_tag="Mflv_0335"
FT   CDS_pept        334972..337158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0335"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   mva:Mvan_0403 acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42829"
FT                   /db_xref="GOA:A4T0T8"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0T8"
FT                   /protein_id="ABP42829.1"
FT                   /translation="MPIAILEEHNDLADSVRAFVERVAPSEVLHEALETPVPNPPPYWR
FT                   SASEQGLHGVHLAESVGGQGFGILELAIVVAEFGYGAVPGPFVPSAIASALIAAHDPDA
FT                   ADLGGLASGDVIATYAIDSGLTATRQGENLVIRGEVRAVPAAAQASLLVLPVAIESGEE
FT                   WVLIDAAQLEIEPVPSVDPLRPVAHVRANAVEVGDDRVLSNLSRAHARALMSTLLSAEC
FT                   VGVARWATDTASAYAKIREQFGRPIGQFQAIKHKCATMIAETERATAAVWDAARAIDEA
FT                   RENPDTAYEFAAAVAATLAPVAAQHTTGDCIQVHGGIGFTWEHDTNVYYRRALVLAASF
FT                   GRASEYPQRVVDLATSTGMRALDLDLDPETEKLRDEIRADVAALKEIPREKRAAAIAEA
FT                   GWVQPHLPVPWGRAAKPVEQIIIAQEFSSGRVKRPQMGIAAWIIPSIVAFGTDEQKERF
FT                   LPPTFRGEMIWCQLFSEPGAGSDLAALSTKATKVDGGWRITGQKIWTTGAQYSQWGALL
FT                   ARTDPSAPKHQGITYFLLDMAADGVEVKPLRELTGNAMFNTVFIDDVFVPDELVLGDVN
FT                   RGWEVSRNTLTNERVSLGSSEPPFLPSLDKFVEFVGEGHFDQIAQNHAGILIAEGHAAK
FT                   ILNMRSTLLTLAGGDPMPAAAISKLLSMKTGQGYAEFAVSSFGTDAVVGDPAQPTGRWA
FT                   DYLLASRSTTIYGGTSEVQLNIIAERLLGLPRDP"
FT   gene            337193..337450
FT                   /locus_tag="Mflv_0336"
FT   CDS_pept        337193..337450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0336"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mkm:Mkms_5338 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42830"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0T9"
FT                   /protein_id="ABP42830.1"
FT                   /translation="MRGNPSTRTPRQGGPRRGVHGRKKTAMALDDDDIDTTPGSGEGTA
FT                   DGGSNPEGHDGGADGTASGEGTADGGSNPEGHDGGADGTA"
FT   gene            337461..338669
FT                   /locus_tag="Mflv_0337"
FT   CDS_pept        337461..338669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0337"
FT                   /product="Cupin 4 family protein"
FT                   /note="PFAM: Cupin 4 family protein; SMART: transcription
FT                   factor jumonji, jmjC domain protein; KEGG: mkm:Mkms_5339
FT                   cupin 4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42831"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR039994"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0T1"
FT                   /protein_id="ABP42831.1"
FT                   /translation="MLSRCIAIDPEVFAAEYWGRTPLLSHADALPRDFCDLLSPAMVDE
FT                   LIAERGVRAPFIRLAKEGQVLAKDSYLGPAGFGAEITDQVDPAKVLTQLAAGATVVLQG
FT                   LHRLWPPLIDFTHRAVADIGHPVQVNAYITPPGNRGFDFHHDVHDVFVLQIAGSKRWIV
FT                   HEPVHAHPLPDQSWTQFRDLIDERVTADPVIDTALTEGDALYLPRGWVHAAQALDTTSI
FT                   HLTVGVSATTGVDVARAVLDELAGIDEFRAPLPLGIDPAAGDHTAAIAAKVIAQMVGHL
FT                   QEDAAALSTAAAERLQARHRSRTRPEALRPLESLRAAEHAATIRVRRREGLAASVRHGA
FT                   DGRVSIHLTDKTVTFPALCAAALEEILGGRVAEADTLPGLDGADGAVLLRRLLREGVVV
FT                   PAS"
FT   gene            338666..339568
FT                   /locus_tag="Mflv_0338"
FT   CDS_pept        338666..339568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0338"
FT                   /product="Sucraseferredoxin family protein"
FT                   /note="PFAM: Sucraseferredoxin family protein; KEGG:
FT                   mkm:Mkms_5340 sucraseferredoxin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42832"
FT                   /db_xref="InterPro:IPR009737"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0T2"
FT                   /protein_id="ABP42832.1"
FT                   /translation="MTATKRLPCSEQSLARDEPMYGTASAGSSWLLLELEGGWGPSAFL
FT                   ESPGSIEPDLGRAIVRRAEAAGMRIAAIRRHGRRSATPRWRWFVAKADVGRHALFSGEV
FT                   DEARDYLDVSLDGSDGAATDGPLVAVCAHGRHDQCCAVRGRSAVSAISAAYPESTWECS
FT                   HLGGDRFAATMLILPEGLCYGRVDSADAAELVRLYCDGRLDDRFLRGRTSLPHAVQAAQ
FT                   HFARVAYGDDRIEAYPLVSMEGGDDTVRVVLAAGPGPIEVVLDVVMSEPLFSQCRAATA
FT                   GPVRTFRLRSLSDTGMHPS"
FT   gene            339565..340836
FT                   /locus_tag="Mflv_0339"
FT   CDS_pept        339565..340836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0339"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; FAD dependent oxidoreductase;
FT                   KEGG: art:Arth_3390 amine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42833"
FT                   /db_xref="GOA:A4T0T3"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0T3"
FT                   /protein_id="ABP42833.1"
FT                   /translation="MSHGDYDVLVIGAGLAGLRCAALLASSGRSVAVWESGDAVGGRVR
FT                   TDVVDGFRCDRGFQVLNPAYPELRRAIDVPALRLHPFLAGVAIRDTDRARHWVHPLRAP
FT                   RRLPGMLTGGGLRPRDVVALMRWAAPALRPATLTEGRDDVSVADALDRSGVDGLARRVV
FT                   DKFLAGVVLDDQGSTSNAFTLLLARMFALGVPGLPAEGMQALPRLMSAPIADRITLNHR
FT                   VDRIVRDGRGWAVSAGGDTVRASHVVVATDPQTAETLTGAPAPPMKGVVTDWWATEDTI
FT                   PGSRLLWVDGRPTPPGPLVNTAIVSAVAPGYAPAGHHLIAASALIGGDGEAPPESVTRT
FT                   HAADILRVTGAQGWSLVTRHVVPEALPVQPPPLRVRRPVRTPDGLWLCGDHRDTASIQG
FT                   ALVSGRRVADAIDRCDRRSDTAHA"
FT   gene            340865..341185
FT                   /locus_tag="Mflv_0340"
FT   CDS_pept        340865..341185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0340"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0402 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42834"
FT                   /db_xref="GOA:A4T0T4"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0T4"
FT                   /protein_id="ABP42834.1"
FT                   /translation="MTNDRDFVEKRFNRPGEYRSAVVYSLIVVALAAAAFVVYAFGPRD
FT                   SVFSAALVPAFLFAGGVGALIRTYREWKAGSGWTAWQGAGWFLLLLMLLTLAVPGSAAF
FT                   AG"
FT   gene            complement(341264..342973)
FT                   /locus_tag="Mflv_0341"
FT   CDS_pept        complement(341264..342973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0341"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mva:Mvan_0397 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42835"
FT                   /db_xref="GOA:A4T0T5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0T5"
FT                   /protein_id="ABP42835.1"
FT                   /translation="MSKLSDLPAQALATVSQTLGKSVGKYVERGSAELHYARKMFQAGA
FT                   LKLEPPQDIAAFVADMVRWGEFGMIPALNARRHPHRTAVIDDFGEFTFGELDEAVNAVA
FT                   NGLLAKGVKGGDGVAILARNHRWFLVSVYAAGKVGARIILLNSEFSGPQIKEVSHREGA
FT                   KLVIYDDEYTAAVKAAEPELGKLRSLGVNPDKDAPSGSTDETLEELIARTSSTPPPKAT
FT                   KHSSIIILTSGTTGTPKGANRSAPPSLAPIGGILSAVPFKSEEVTSLPAPMFHALGFLH
FT                   ATIAMMLGSTLVLRRRFKPATVLADIEKHRATAIVVVPVMLSRMLDELDKTSPKPDLSS
FT                   LRILFVSGSQLGAELATRALKDLGPIVYNLYGSTEVAFATIAGPQHLSINPATVGPVVK
FT                   GMRVKILDDNGNELPRGEIGRIFVGNFFPFEGYTGGGGKQIIDGLLSSGDVGYFDDNDL
FT                   LYVSGRDDEMIVSGGENVFPAEIEDLVSGHPEVVEATALGVEDKEWGHRLRCFVVKAEG
FT                   ATIDEDAIKAYVRDNLARYKVPREVIFLDELPRNPTGKILKRELREMDVPES"
FT   gene            343030..344268
FT                   /locus_tag="Mflv_0342"
FT   CDS_pept        343030..344268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0342"
FT                   /product="DNA primase, small subunit"
FT                   /note="PFAM: DNA primase, small subunit; KEGG:
FT                   mva:Mvan_0396 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42836"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0S7"
FT                   /protein_id="ABP42836.1"
FT                   /translation="MAARESYEIGGRTVPVTHLDKVVFGELGLTKLDLIDYYASVADGA
FT                   LRGVRDRPMILKRFVKGIDEEAVFQKRAPKNRPDFVDVAELKYASGTSAAEAVLRDPAG
FT                   LVWAVNLGCVDLNPHPVRAEDLDHPDELRVDLDPMPGVGWRQILDVAFVAREVLEDHGL
FT                   VAWPKTSGSRGFHIYARIHPRWPFKQVRLAAEAVAREVERRAPESATARWWKEERHGVF
FT                   VDFNQNAKDRTVASAYSVRATPDARVSTPLFWDELAGCKPEEFTVHTVPARFAELGDPW
FT                   EGMDDAAGGLEALLELSDRLGPAEKAPRGAKKSVDGRRASVMPLIEIARTKTKDEALSA
FT                   LAQWRDKYPAVSEKLEPADVLVDGMRGPSSIWYRIRINLQHVAEDQRPPQEELLADYSP
FT                   WTHYTGAQQQRRD"
FT   gene            344426..344833
FT                   /locus_tag="Mflv_0343"
FT   CDS_pept        344426..344833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0343"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: mva:Mvan_0395 anti-sigma-factor
FT                   antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42837"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0S8"
FT                   /protein_id="ABP42837.1"
FT                   /translation="MYGNPTFHCAGADIRAHCRQLATVVKVAGRLDNANVERAGRYIDR
FT                   FILPEKPFVLDLSEVDSFGEEAISLLFVIDDLCTAAGEEWSLIASRAVEQTLRDSGIEF
FT                   PAAGSVPEALNHFADAMVARRRLLPLLTKTA"
FT   gene            344975..346159
FT                   /locus_tag="Mflv_0344"
FT   CDS_pept        344975..346159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0344"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   mva:Mvan_0394 acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42838"
FT                   /db_xref="GOA:A4T0S9"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0S9"
FT                   /protein_id="ABP42838.1"
FT                   /translation="MGTDADLVADTARRVVAEHDPKTVPIQQFLGACFDAGLSWVHFPE
FT                   GFGGLGVSRGLQAVADGILQGAGSPVPLGLNPMGYGMAAPTVREHAQTDDVRRQLLRPL
FT                   ATTEHIWCQLFSEPGAGSDLAGLATSAVLDGDTWVVNGQKVWTSLAHRAKWGLLLARTD
FT                   PNMPKHKGLTYFVIDMHGEGVQTRPLRQLTGHAEFNEVYMTDARIPDTFRLGAVGDGWR
FT                   VAMTTLMNERSALGGSGSRRGAGTISDAVALWTSRPDLHTPVLRDRLSSLWLRSEAQRL
FT                   TSKRSRAAATVGGPGPEGSVGKLVGAELNQHIYEFCMDLLGPEGILYDGYGMGDGDAAD
FT                   WRGPIQQRFLRSRANTIEGGTSEVMRNILAERVLGLPGDLRADAGMAWKEIPRG"
FT   gene            346152..347321
FT                   /locus_tag="Mflv_0345"
FT   CDS_pept        346152..347321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0345"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   mva:Mvan_0393 acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42839"
FT                   /db_xref="GOA:A4T0T0"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0T0"
FT                   /protein_id="ABP42839.1"
FT                   /translation="MADTAGEWVFSDEQNQLRAAVRAFCADHVDESSVRAAMESDPPFD
FT                   AKVWSRLGSELGVLGMAVPESAGGAGGNLVDQAVAVEQLGAALACGPLFGTVYLAIPAL
FT                   VAASGGQELLGPLVDGTRTAAFAVRDDAGAFDASSVEVQAVPTEQGWALSGTVERVVDA
FT                   GAADVLLVAATTPDGVGLFVVEADSLGVQRIRLTTLDLTRPQATVGLLDAPAQLIAGPE
FT                   EAERVITHALQVGAALLAVEQVGAAQHLLDLSVDYAKNRLQFGRPIGSFQAVKHRLADD
FT                   LVAVEHARSTAYHAVWALSDGSDDPALAVSIAQATTSAAFVRVATDTIQVHGGIGFTWE
FT                   HQAHLYYKRAYTDAALLGGAEEHRARVADFVLVVAPEKDAPRVATGMPS"
FT   gene            347602..349014
FT                   /locus_tag="Mflv_0346"
FT   CDS_pept        347602..349014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0346"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; sulphate
FT                   transporter; KEGG: mva:Mvan_0392 xanthine/uracil/vitamin C
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42840"
FT                   /db_xref="GOA:A4T0S1"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0S1"
FT                   /protein_id="ABP42840.1"
FT                   /translation="MNSVDRFFEITARQSTLGTEIRGGVVTFIAMAYIIVLNPIILSGS
FT                   EDVTGAKLDFAQVSATTSLAAGVMTILFGLIARLPFALAAGLGINSFLATTVVGDLTWA
FT                   EAMGLVVINGLLIVLLAVTGLRRLVFDAVPMELKLGITAGIGLFILFIGLVDAGFIGST
FT                   GRPSPPVGLGSGGLGSISTVPTLVFILTLLLTAALVIRKVRGGILIGLVCGTVVAVIIE
FT                   AVWHLGSAVDKPGGWSLSVPTLSGSPFALPDLSLVGEFSLDSFGRIGVLAAVMLVFTLV
FT                   FANFFDAMGTMTGLSREAGLSDAKGTFPRLKSALIVEGAGAVVGGATSSSSNTVFIESG
FT                   AGIEEGARTGLANVVAGVLFLAAMFISPLASIVPTEVAAAALVVVGAMMVSQLRHIDLT
FT                   DFSVALPVVLTVAVMPFSYSIANGIGVGFISWAVLRTAAGKGREISPLLWVVAAGFAVY
FT                   FARTPLESLLGV"
FT   gene            complement(349030..350646)
FT                   /locus_tag="Mflv_0347"
FT   CDS_pept        complement(349030..350646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0347"
FT                   /product="sulfite reductase (NADPH) alpha subunit"
FT                   /EC_number="1.8.1.2"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; FAD-binding domain protein; flavodoxin/nitric
FT                   oxide synthase; KEGG: rha:RHA1_ro01797 sulfite reductase
FT                   [NADPH] flavoprotein alpha-component"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42841"
FT                   /db_xref="GOA:A4T0S2"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0S2"
FT                   /protein_id="ABP42841.1"
FT                   /translation="MAEVPPFSLILGFATETGNSAMVAKKFAQAAAAAGIDVEPQYLND
FT                   LDLDALRAATHFVVVTATYGDGELPYDAEVFWEELSADTPGRLGQLSFAVCGLGDSFYP
FT                   YFNNAGKLVDARLEELGATRIVDRVDCDLEFEEPSEAWTAEVVARLAELTTTTGRAAVV
FT                   PADLAPDSAWTRRNPFPARLAANRLLTSPGSDKSVRHYELDVADSGIVYRAGDSVGVHP
FT                   VNDPRLVDAVLARLGVDADVVVPEHVHPVGLLLTEHLELRVPSGALQALVAARTSDPQV
FT                   RAILEGGDSAALTGWLYGRDVLDLLALADLGADEVIPTLRPLQHRDYSIASSPLVHPDR
FT                   IHLTVAAIDYRARDRAYRGVASGYLAERAEQVRIHLAPNDGFRLPAPDVPIVMVGPGTG
FT                   IAPFRAFLQERQATAATGGSWLFYGGRHRADDFLYGDELVGFQKSGTLDRLSCAFSRDR
FT                   GPQGPKDYVQHHMTAHAGRLYSWLQDGAHFYVCGDADHMAKDVHRALHEVIRSAGGLSE
FT                   DDAHIYVNDLITSRRYLRDVY"
FT   gene            complement(350694..351284)
FT                   /locus_tag="Mflv_0348"
FT   CDS_pept        complement(350694..351284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0348"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0389 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42842"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0S3"
FT                   /protein_id="ABP42842.1"
FT                   /translation="MLAEDGPRGLSHLKVDRRAEVPDGTTSFYYRTRTALLHGVADQLV
FT                   RYDAEAFTDAFETAPLDDGDVIAAQLARQILSIRDEPQLSRTRARLELTLLSRNDPVIS
FT                   ANFQQIGESMRALVERLVVAVQAGSRPLERGLLDEQVSVVLSYLGGLILAFANGSPEPL
FT                   SGEDISRQFRAVIRGVAAERADRRREPAQSSSF"
FT   gene            351619..353043
FT                   /locus_tag="Mflv_0349"
FT   CDS_pept        351619..353043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0349"
FT                   /product="Diacylglycerol O-acyltransferase"
FT                   /EC_number="2.3.1.20"
FT                   /note="PFAM: protein of unknown function UPF0089; KEGG:
FT                   mul:MUL_1818 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42843"
FT                   /db_xref="GOA:A4T0S4"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="InterPro:IPR014292"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0S4"
FT                   /protein_id="ABP42843.1"
FT                   /translation="MRLSSVDAAFWFAENLKWHMHIGAIALCDPSDVPDFGFEQVRDLI
FT                   ISRLPELPQLRWRVVGAPLGLDRPYFVEDEDIDVDFHIRRIAVPSPGGRKELDDLVGRL
FT                   MSYKLDRSKPLWELWFIEGLEGGRVAVVTKMHHAVVDGVSGAGISEILLDTTPEPRPPA
FT                   VDASRSLVGVKPPSRERQAVNGLINVWFKTPYRITRLLEQTVRQQIAVRNIDNKPPRYF
FT                   DAPKVRFNGPISPHRSVAGASVPLDRVKAVKNAFDVKLNDVVLALVSGALRSYLKDRGE
FT                   LPAKSLVSQVPVSTRAQADDTVGNQVNAMTVVLATDVADPAERIKAIYSYTQGAKEMTK
FT                   ALTAHQIMGYTETTPPGLLALASRAYAASGIGSNIAPMNVVISNVPGPTFPLYLGGARV
FT                   EHLMPVGPLLFDVALNVTCFSYCGAVDFGFITTPEIAADIVDLADQIEPALHDLEVAAG
FT                   LVSDPTRPKPRKRGRR"
FT   gene            353072..353656
FT                   /locus_tag="Mflv_0350"
FT   CDS_pept        353072..353656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0350"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mva:Mvan_0384
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42844"
FT                   /db_xref="GOA:A4T0S5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR041347"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0S5"
FT                   /protein_id="ABP42844.1"
FT                   /translation="MEGMNPEQPGLRERKKTRTRETVRREAFRLFELNGYAQTTVDQIA
FT                   EAAFVSPRTFFRYFPTKESVLFSDDLFNPIIEEFLAAPAELSPVAAYRHAAARVFETMA
FT                   GSDYDYIIARQRLLYDLPEAKGALWNEHVGAIRRLTSAIAKRLGRPEDDYQARVTAGAI
FT                   IGVFMAASDDEPMSGEAFLEALDLLDQALPR"
FT   gene            353710..354951
FT                   /locus_tag="Mflv_0351"
FT   CDS_pept        353710..354951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0351"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: mva:Mvan_0383
FT                   amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42845"
FT                   /db_xref="GOA:A4T0S6"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0S6"
FT                   /protein_id="ABP42845.1"
FT                   /translation="MPEPAPQFRDAPIFDADQHMYETPDALTKFLPDRYTRAVQYGQFG
FT                   RHTRIVINNRVSDFIPNPTFERVAAPGAHEKFFAGENTEGLTLREMQGPAIEAPAATRN
FT                   PADRVAELDRQGVREALNYPTLASLIEHATADDPELTLAVIHALNQWMAEHWTFDYQGR
FT                   VFSTPIINLSEVDGAQRELEYILTQGARVALIKPGPVNGLRGWRSPALPEFDPFWRDVE
FT                   SAGLPIVLHASYPPLDDYVGKWEPPYTQNFMTQSAFRWMVLGHREIADMITALICHGTL
FT                   TRFPKLRIASVENGSSWIFPLFNDFEELAKKMPQNFGEHPLDVFRRNIWVSPFWEGCVS
FT                   DVVTTVGWDKVMFGSDYPHPEGLPEPKGFWKYAEGMDVRRTYDFMGDNARRFMGLPIAN
FT                   PDPEAARPPALSTA"
FT   gene            354974..355744
FT                   /locus_tag="Mflv_0352"
FT   CDS_pept        354974..355744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0352"
FT                   /product="precorrin-4 C11-methyltransferase"
FT                   /EC_number="2.1.1.133"
FT                   /note="TIGRFAM: precorrin-4 C11-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; KEGG: mva:Mvan_0382 uroporphyrin-III
FT                   C/tetrapyrrole (corrin/porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42846"
FT                   /db_xref="GOA:A4T0R7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0R7"
FT                   /protein_id="ABP42846.1"
FT                   /translation="MNHPVQFVGAGPGAADLLTVRAARLLADAGLVLYPGTYLDPDVLA
FT                   HCSPSADLVDTGNLDLDTIVARLVDGHRGGVAVVRLVSGDPSVYSAVSEQTRRLDAAGV
FT                   PWQVTPGVPAYAAAAARVGRELTVPLVAQSVVLTRTRARSTQMPDTESLAAFAATRATL
FT                   VLHLAITRIRELMAEIEGDYGPDCPVVVVYRASQPQEIVLRGTVSDIADAVESAGLRQA
FT                   AVILVGRALAGRPDPEAGESYLYDASRDRSGRDR"
FT   gene            355741..356379
FT                   /locus_tag="Mflv_0353"
FT   CDS_pept        355741..356379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0353"
FT                   /product="cob(II)yrinic acid a,c-diamide reductase"
FT                   /EC_number="1.16.8.1"
FT                   /note="TIGRFAM: cob(II)yrinic acid a,c-diamide reductase;
FT                   PFAM: nitroreductase; KEGG: mva:Mvan_0381 cob(II)yrinic
FT                   acid a,c-diamide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42847"
FT                   /db_xref="GOA:A4T0R8"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR012825"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0R8"
FT                   /protein_id="ABP42847.1"
FT                   /translation="MSAETAALYDVINRRRDTRREFTGAPTDDEVLERVLLAAHAAPSV
FT                   GMSQPWDFVLVRSPETLRAFRDHVAGEREVFAAELSGERADVFDRIKIEGICESGLGIV
FT                   VGYDPTRGGPAVLGRHAIPDAGLYSVVCAIQNLWLAATAEGLGVGWVSFYREETLRSLV
FT                   GMPDHVRPVAWLCVGPVADLPDVPDLERFGWQARRSLDTVVHRERYPEP"
FT   gene            356404..357480
FT                   /locus_tag="Mflv_0354"
FT   CDS_pept        356404..357480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0354"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   mkm:Mkms_2710 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42848"
FT                   /db_xref="GOA:A4T0R9"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023805"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0R9"
FT                   /protein_id="ABP42848.1"
FT                   /translation="MTATPLAERLLDITRIYHEPGVEHSARAAEVLARFPAAERIEVPS
FT                   HQAIPGLYGNAGNIGDWVRIKQQVLVLGEKKSLTARRNERSSDWIAPSTANGCAMACAY
FT                   CYVPRRKGYANPITVFTNIDAIVGYLERHAARQGVKPEPNQCDPADWVYDIGENCDCSV
FT                   DAMVSDNVADLVALFARLPHAKASFATKLVNPDLLTYEPRGGTRIRFSLMPGETSRLVD
FT                   IRTSGVADRIAALDDFVEAGYEVHLNFSPVIVHETWRADWAELLEQIADNTSERTRRQL
FT                   AAEIIFLTHNEGLHDINLGWHPKAEDLLWRPDLQQPKRSQNGQLNVRYRTGWKGRWVRQ
FT                   LTDLVAEKLPDCRIRYAF"
FT   gene            complement(357773..358297)
FT                   /locus_tag="Mflv_0355"
FT   CDS_pept        complement(357773..358297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0355"
FT                   /product="adenosylcobinamide kinase"
FT                   /EC_number="2.7.1.156"
FT                   /note="PFAM: cobalbumin biosynthesis enzyme; KEGG:
FT                   mva:Mvan_0379 cobalbumin biosynthesis enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42849"
FT                   /db_xref="GOA:A4T0S0"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0S0"
FT                   /protein_id="ABP42849.1"
FT                   /translation="MRILVTGGVRSGKSRHAEELLAGAGHVTYVAPGRAADGTDPDWDA
FT                   RVSRHRARRPAHWRTVETADVAVAVRDAQGTVLVDCLGTWLTAVLDDNGLWDKGSREAT
FT                   DEVEIRVTALCDALAGAAGAVVVTNEVGLGVVPSHRSGVLFRDLLGTVNQRVAQVCDEV
FT                   HLVIAGRVLTL"
FT   gene            complement(358334..359935)
FT                   /locus_tag="Mflv_0356"
FT   CDS_pept        complement(358334..359935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0356"
FT                   /product="purine catabolism PurC domain protein"
FT                   /note="PFAM: purine catabolism PurC domain protein; KEGG:
FT                   mkm:Mkms_0359 transcriptional regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42850"
FT                   /db_xref="InterPro:IPR012914"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0R2"
FT                   /protein_id="ABP42850.1"
FT                   /translation="MPLTLADVIALPVVQRGRPEVLSSRRWDDTIRWVHVSDLADLSTL
FT                   LQGGELVLTTGAAMARSPRTYLRGLAEAGAVGVVVEVGAVVPEVPPGVGGIAEQLDLAL
FT                   VVLHRTVRFVEVTEAVHRMIVAEQYDVVEFDRRVHETFTDLSMKRASLSGIVDAAAKLL
FT                   GEHVVLEDLSHQALVASTGIPADLLTDWARRSRRSPGGGAGAEPWSATDVGPRFEQWGR
FT                   LVVPYAPADATRAATVLERAAAALAMHRMVEQNRTGLQHQAQSGLIDDVLRGRVVDDRD
FT                   AAARAQALGLRSNAQYLPVVVRVARPAEIDDPVAGHRRNVAVLDAVAHTVNACGHTGLF
FT                   SLRGDGEVGAVLSLKDSRTRSVDQALGALARRIHTEIRRVDGSDRVVVTLGPSARNVTD
FT                   AIAGLAEAIDTAEVALSLRGDVRDFYRTSDIRLRGLISLLRDDPRIRRFAETELRALLA
FT                   HDAGAEPSNISVLREYLRLAGNKSALAERLHMSRPALYKRLRGIEDALGVDLDDGESMT
FT                   SLHVAVMVLDSLTGSG"
FT   gene            359947..361509
FT                   /locus_tag="Mflv_0357"
FT   CDS_pept        359947..361509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0357"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /note="TIGRFAM: methylmalonate-semialdehyde dehydrogenase;
FT                   PFAM: aldehyde dehydrogenase; KEGG: mva:Mvan_1824
FT                   methylmalonate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42851"
FT                   /db_xref="GOA:A4T0R3"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0R3"
FT                   /protein_id="ABP42851.1"
FT                   /translation="MRTQTGRYTSSPHRHAPPPQNKCMAETISHWMNNAPFAGASEATA
FT                   PVTNPATGAVTGQVALASVADAQAVIDAAAAAFPAWRDTSLAKRTQVLFRFRELLNDRK
FT                   GELAEIITAEHGKVVSDALGEVSRGQEVVEFACGIPHLLKGSYTENASTKVDVHSLRQP
FT                   LGPVAIISPFNFPAMVPMWFFPVAIAAGNTVVLKPSEKDPSASLWLAELWKEAGLPDGV
FT                   FNVLQGDKTAVDELLTNPRIKSVSFVGSTPIAQYVYATGTAAGKRVQALGGAKNHAVVL
FT                   PDADLDLAADAMVNAGFGSAGERCMAISACVAVGPIADDLVAKIRERTVGLKIGDGTKD
FT                   SDMGPLVTRAHRDKVASYIDAGESAGAKVVVDGRAVKADGGQEGFWLGPTLLDNVTPEM
FT                   SVYTDEIFGPVLSVVRVDTYDQALDLINSNPYGNGTAIFTNDGGAARRFQNEVEVGMVG
FT                   INVPIPVPMAYYSFGGWKASLFGDSHAHGMDGVHFFTRQKAITTRWLDPSHGGINLGFP
FT                   ENS"
FT   gene            361610..363004
FT                   /locus_tag="Mflv_0358"
FT   CDS_pept        361610..363004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0358"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   mva:Mvan_1823 aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42852"
FT                   /db_xref="GOA:A4T0R4"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0R4"
FT                   /protein_id="ABP42852.1"
FT                   /translation="MTITDQPTDTAGLPTGEDLDSAIARGRRAYDLDRRHVFHSWSAQA
FT                   QITPMTVLAAQGSYVWDGDGTRLLDFSSQLVNTNIGHQHPKVVAAIAEQAATLCTIAPQ
FT                   HVNDVRSEAARLIAERTPGDLNRIFFTNGGADAVEHAVRMARLHTGRYKVLSRYRSYHG
FT                   GTETAINLTGDPRRWPNDHGNAGIVHFDGPFLYRSTFHADTEEQETQRALEHLDRLIRM
FT                   EGPSTIAAIILESVPGTAGIMVPPPGYMAGVREICDRHGIVFIADEVMAGFGRTGTWFA
FT                   IDNFGVVPDLITFAKGVTSGYVPLGGVAINDAIYSTFADRAYPGGLTYSGHPLACACAV
FT                   ATITAMEDEGMVANAARIGREVLGPGLRELAARHRSVGEVRGLGVFWAVELVANQQTRE
FT                   PLAPYGGSSPAMNAVVAACKSGGLLPFANFNRIHAVPPCNVTDDEVAEGLRILDAALSV
FT                   ADDYTV"
FT   gene            complement(362992..363726)
FT                   /locus_tag="Mflv_0359"
FT   CDS_pept        complement(362992..363726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0359"
FT                   /product="precorrin-6A reductase"
FT                   /EC_number="1.3.1.54"
FT                   /note="KEGG: mva:Mvan_0378 precorrin-6x reductase; TIGRFAM:
FT                   precorrin-6x reductase; PFAM: Precorrin-6x reductase
FT                   CbiJ/CobK"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42853"
FT                   /db_xref="GOA:A4T0R5"
FT                   /db_xref="InterPro:IPR003723"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0R5"
FT                   /protein_id="ABP42853.1"
FT                   /translation="MRVLILGGTAEARALAELLTADGVEVMSSLAGRVADPRLPVGDVR
FT                   IGGFGGVDGLAATARDYTAVVDATHPFAQHISANAVAACTSAHTPLLRLERPGWSGRSQ
FT                   ESWHWVDSHEDAAATAARLGGRPFLTVGRQEMHRFVPDLGDHAVLARVVQAPEFPLPSA
FT                   WRLLTSRGPYELAGELALMRNHRTDVLITKDSGGQHTWPKMEAAVTLGVPVVVVRRPPR
FT                   SQAVPTVHEVADAAEWVRRQTV"
FT   gene            complement(363726..365201)
FT                   /locus_tag="Mflv_0360"
FT   CDS_pept        complement(363726..365201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0360"
FT                   /product="adenosylcobyric acid synthase
FT                   (glutamine-hydrolysing)"
FT                   /EC_number="6.3.5.10"
FT                   /note="TIGRFAM: cobyric acid synthase CobQ; PFAM: Cobyrinic
FT                   acid a,c-diamide synthase; CobB/CobQ domain protein
FT                   glutamine amidotransferase; KEGG: mva:Mvan_0377 cobyric
FT                   acid synthase CobQ"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42854"
FT                   /db_xref="GOA:A4T0R6"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4T0R6"
FT                   /protein_id="ABP42854.1"
FT                   /translation="MTGLLVAGTTSDAGKTAVTTGLCRALARRGVKVAPYKAQNMSNNS
FT                   MVCTSVDGAGAEIGRAQWVQALAARATPEPAMNPVLLKPGSDRRSHVVLMGRPWGQVSS
FT                   SDWLEGRRALATAAHEAFDELASRYEVVVAEGAGSPTEINLRAGDYVNLGLARHAGLPT
FT                   VVVGDIDRGGVFAAFFGTVALLSPQDQALIAGFVVNKFRGDVDLLAPGLRDLERLTGRR
FT                   VYGTLPWHPDIWLDSEDALELAGRRSAQSGARRVAVIRLPRISNFTDVDALGLEPDLDV
FT                   VFASHPGSLADADLVVLPGTRATIADLAWLRSRGLDSALRRHVAAGRPVLGICGGFQML
FT                   GRVIRDPHGVEGPVAGVDGLGLLDVETTFGPDKVLRLPSGRWFGAPATGYEIHHGRITR
FT                   GDGVDEFLDGARCGQVFGTMWHGALEGDELRSRFLQEALGVAPSGVSFPAAREARLDLL
FT                   GDLVERHLDVDALLDLAKTGPVAGLPFLPPGAP"
FT   gene            complement(365198..366019)
FT                   /locus_tag="Mflv_0361"
FT   CDS_pept        complement(365198..366019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0361"
FT                   /product="precorrin-6A synthase (deacetylating)"
FT                   /EC_number="2.1.1.152"
FT                   /note="KEGG: mva:Mvan_0376 precorrin-6A synthase
FT                   (deacetylating); TIGRFAM: precorrin-6A synthase
FT                   (deacetylating); PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42855"
FT                   /db_xref="GOA:A4T0Q7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR012797"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0Q7"
FT                   /protein_id="ABP42855.1"
FT                   /translation="MRLRRGCSATGERARDNRCMAAAVTIRILGVGMGPQHVTPEVADA
FT                   LNGVDYVLAADKGEDDALLALRREIVRAHGGAEVLGLRDPARDRSDGLSTGAYESAVAD
FT                   WHDARAAQYADVLRRRGGTAAFLVWGDPSLYDSTIRVVEKVRDLLGPDTDVDFDVLPGI
FT                   SAPQLLAARHRIVLHEVGRPVHITTGRRLQEAVAAGLDNILAMLNPAPDRLDFTGLDDW
FT                   TIWWGANLGAAGERLVAGRVGDVLPAIADARAAAHADDGWVMDAFLIRRTR"
FT   gene            complement(365985..366854)
FT                   /locus_tag="Mflv_0362"
FT   CDS_pept        complement(365985..366854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0362"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; KEGG: mva:Mvan_0375
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42856"
FT                   /db_xref="GOA:A4T0Q8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017685"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0Q8"
FT                   /protein_id="ABP42856.1"
FT                   /translation="MTDHLDTAHLAALSAVVEFGSFDAAGAHLHITPSAVSQRIKALEQ
FT                   RVGQVLVLREKPCVATPAGAPLLRLAAQTALLQAEALAELRGGTADLPRIALAVNADSM
FT                   ATWFTEVLTRLPHVLFDVRIEDQDHSARLLREGVVMGAVTTERAPVAGCRVHALGVMRY
FT                   VPVASRDYVARHFPDGFTREAASKAPSLAWNRDDALQDQLVRKVFRRSVQRPTHYVPTA
FT                   TGFGAAVHAGLGWGMYPIALLDGSFVPITEQHLDVPLYWQCWKLDSAVVAQVTAAVDAA
FT                   AAGLLRDR"
FT   gene            367035..368264
FT                   /locus_tag="Mflv_0363"
FT   CDS_pept        367035..368264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0363"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: mva:Mvan_0373
FT                   cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42857"
FT                   /db_xref="GOA:A4T0Q9"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0Q9"
FT                   /protein_id="ABP42857.1"
FT                   /translation="MTASTTARNVFDADLPALTYDLSSTPAEVWPSLREARSLAPVAVG
FT                   PLGPEVLSYDMARAILRDPRFAIPPGINLAAQGVTSGPLFDKVMSSLLCLEGAEHQRLR
FT                   KLVSKAFSPRATERLHDTIVAVVDELIDQVVDAGRCDVVADIARPYPIPIICALLGAPR
FT                   EDWRLFSQWAEDVVRVFGFSVDVAARQDHVMRAWNALDDYVDAMVEDRRTRLTDDLISE
FT                   LIRAEDDGDRLSSAELQMLAVSLLMAGTDTTRNQLAASVQALSEQPDQWALLAEQPDLA
FT                   MRAVEETMRHSPVVCGTPRIVVADVEFAGYLFPAGTFVFVNTFTANRDPALYDDAERLD
FT                   LRREGAPAILTFGGGVHYCLGANLARRELAEALRILAARLPNPRISGEAPWKPMLGMTG
FT                   PTALELEFGA"
FT   gene            368257..368919
FT                   /locus_tag="Mflv_0364"
FT   CDS_pept        368257..368919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0364"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mva:Mvan_0372
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42858"
FT                   /db_xref="GOA:A4T0R0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0R0"
FT                   /protein_id="ABP42858.1"
FT                   /translation="MRSRGWSGQWPASDEEAITRILDAADELVAADASVLRIADVARAL
FT                   GVTRQTVYRYFPHPEAIRLACAMRAADGFFDRLAKQVGGMTDPVAVMVECVASAVERLA
FT                   GDPQFEALVTARRHGARAVSLTSDTALTFARTILHRFDIDWEQHGFDTAGLDRLAELSI
FT                   RTVHSILVDPGDPAREGAELRRFVAGWLGPAILYPRLARAVDAITAPGVSPASPMRY"
FT   gene            complement(369058..370719)
FT                   /locus_tag="Mflv_0365"
FT   CDS_pept        complement(369058..370719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0365"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42859"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0R1"
FT                   /protein_id="ABP42859.1"
FT                   /translation="MAHRRARLLLSASAAAAISGLLLIAAPAVSAEPDGGGTETTVRSS
FT                   AKPADGDDRAAEADDASGPERTDRKAGSDTDEAPRKPRKPQGDRMILDSPDAEAAEDPE
FT                   TPEEAADTERALTETTQIDPLPEAPPETSTVVPAERSESTPTDPVPDTDIDTTAPGAAI
FT                   VPIATVEATEANRASEAGDRRPTLLNVVGSLVLNLLVGFIQVIDGPPVLPPNSTVTVRT
FT                   SSLTLPIGGGRSVQADWYFPEEYSSGQLDSATRLVYLQHGFLASGPLYSYTAARLAERT
FT                   GAIVVAPSLTSNFFAADAAWVGGSTMHRAVADLFAGDRPALTQSASAAAGYVVRLPEKF
FT                   VLVGHSAGGSLVTSAAGFMADNGAIDALTGIVMLDGVEPAGSRLVGSALAKLRGSSDRP
FT                   VYLISSERYFWSRGGDMADKLQLARPGRFNGVGLQGGLHIDYMEGGNPLVQFGEYVVAG
FT                   FSLRRNVDAASEITIGWVDDLFAGTAAGVYGSPGDVVAVVTPSGTATAVVLPLGEPARP
FT                   VWPPLLDAALTAVFDFAGRHLFVYEPLRGYDLQPTG"
FT   sig_peptide     complement(370624..370719)
FT                   /locus_tag="Mflv_0365"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.976 at
FT                   residue 32"
FT   gene            370818..371516
FT                   /locus_tag="Mflv_0366"
FT   CDS_pept        370818..371516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0366"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mva:Mvan_0369
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42860"
FT                   /db_xref="GOA:A4T0Q2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0Q2"
FT                   /protein_id="ABP42860.1"
FT                   /translation="MAEADSEPFAPSASGRSTSPARRRGRPVGGGNTSDQARTVLMDAA
FT                   ERSILRRGFQASTMELVAREAGYSRAAIYRHFPSRRLLLEALVERKTRRHQTEISARLT
FT                   ENASLADLLTEGLVIVATELIHDPLLRTLSEQTDEGTVAHLVAGAARIPEQVEQLIAAT
FT                   DGGESEKIFRPGVEAGDVGQFLITAALTMLLGVIPGIEDPETARRYVRTFVLPAILADP
FT                   PAPQQVFRPR"
FT   gene            complement(371513..372307)
FT                   /locus_tag="Mflv_0367"
FT   CDS_pept        complement(371513..372307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0367"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; Male
FT                   sterility C-terminal domain; KEGG: mva:Mvan_0338
FT                   NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42861"
FT                   /db_xref="GOA:A4T0Q3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0Q3"
FT                   /protein_id="ABP42861.1"
FT                   /translation="MVYYCIVDTRAELKDPAPLFATNVEGLRKVLDVAADANLDKFVFL
FT                   STIGTIAVGADGEQVDEDTPFNWAERAGSYIESRRAAEQLVLSYAAERGVPAVVVNVSN
FT                   PYGPPDWQPRQGMFVQMAALGKMPFYVRGVGSEVVGIDDAADAMLRASVRGRVGERYIA
FT                   SERFMTHRELVTTAADAVGARRPRIGIPMAVVYGFAYLADAIGSVLPVQVPMSRQSAFL
FT                   LAHTSPASHAKATRELGWTPKPTEGFIARAAEHYVQRQQAGV"
FT   gene            complement(372268..372534)
FT                   /locus_tag="Mflv_0368"
FT   CDS_pept        complement(372268..372534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0368"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mkm:Mkms_1836 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42862"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0Q4"
FT                   /protein_id="ABP42862.1"
FT                   /translation="MTSDDVTVAGQRALVMGASGNVGACVTRHLAAGGADVRVLLRPTS
FT                   STRGIDGADIDRRLGDPFDPRPPPRRWLTATWSITASSTPGPS"
FT   gene            complement(372586..373395)
FT                   /locus_tag="Mflv_0369"
FT   CDS_pept        complement(372586..373395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0369"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0337 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42863"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0Q5"
FT                   /protein_id="ABP42863.1"
FT                   /translation="MIEIPLSEMRTWFGFGVAGNFAGHLEQAGEAVDFVNVASEGTAPK
FT                   GIFPWYAPGSDTFLGEFPLSNDAIVLPAESPEFSGPLNLQIEPEVGLACRVVWDGDTVV
FT                   TLQPFALGAFNDCSIRRPGAPKISHKKNWGPSSKGVSPEFFDISDLTPDGPTASLRLVC
FT                   FLDSDGEEHEYGVDSPLIGYSYYGEVLLDWIVERLANQKGSPDTPLEDVGALMVACGHP
FT                   ENVLIGIGATRYTLLGESTFLKKGDQAIVRVYDTASDAAAELRQHVR"
FT   gene            complement(373697..374047)
FT                   /locus_tag="Mflv_0370"
FT   CDS_pept        complement(373697..374047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0370"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0333 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42864"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0Q6"
FT                   /protein_id="ABP42864.1"
FT                   /translation="MCTVAHTEPLHAKRIQKRCVMNRSLFVAGAGTAALALTFSGVALA
FT                   EPEDPAPAVDGTASEAPSAADQVAALQAEGKSVQVVGNDNGMLQNCDVVTITEGEVANT
FT                   VMMEVDCGLNYP"
FT   sig_peptide     complement(373910..374047)
FT                   /locus_tag="Mflv_0370"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.958 at
FT                   residue 46"
FT   gene            complement(374125..374571)
FT                   /locus_tag="Mflv_0371"
FT   CDS_pept        complement(374125..374571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0371"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0332 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42865"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0P8"
FT                   /protein_id="ABP42865.1"
FT                   /translation="MTTIEVEPQPRIDALVRALDGTELRRTDYTGVVWFDGKPEISGMV
FT                   LRRAANAPRGIRMPNVEASLYLPDSLAYSGTAVADATLTVSVALRGVGDTGVLTRAVAA
FT                   FTPDPSGQPSWVHLYLHGHLGWPAAVSYRIVALTRPDAVLGVPR"
FT   gene            374734..375102
FT                   /locus_tag="Mflv_0372"
FT   CDS_pept        374734..375102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0372"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP1745c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42866"
FT                   /db_xref="InterPro:IPR021866"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="InterPro:IPR038396"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0P9"
FT                   /protein_id="ABP42866.1"
FT                   /translation="MIEMLPDMPEGVSGFTVSGRASGEDLRNFKPTMEKMLQGGEVRIV
FT                   EVIAPSYEGFGPGGLAEDLKLGFGALIRHHSAFKRIAVVTDKEWAIHTLQALSWMVPGE
FT                   IALFRMDELEQAKSWAAG"
FT   gene            375189..375797
FT                   /locus_tag="Mflv_0373"
FT   CDS_pept        375189..375797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0373"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   mva:Mvan_0310 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42867"
FT                   /db_xref="GOA:A4T0Q0"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="InterPro:IPR004777"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0Q0"
FT                   /protein_id="ABP42867.1"
FT                   /translation="MSTTSLVVLSGFASSMALIAAIGAQNAFVLRQGIRGEHVLPVVAV
FT                   CAVSDLVLIAAGIAGVGALIAAHPDVVTVTRYGGAAFLIGYGLFAARRAVKPGVLTPAD
FT                   AAPARLAAVLATCLALTFLNPHVYLDTVVLLGMLANEHQDSRWLFGVGAVTASAVWFAG
FT                   LGFGATRVRHWFASPRTWRLLDAAIAAVMIALGVSLLMR"
FT   sig_peptide     375189..375263
FT                   /locus_tag="Mflv_0373"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.997) with cleavage site probability 0.651 at
FT                   residue 25"
FT   gene            375855..376367
FT                   /locus_tag="Mflv_0374"
FT   CDS_pept        375855..376367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0374"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0309 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42868"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0Q1"
FT                   /protein_id="ABP42868.1"
FT                   /translation="MHIVKVAALNALLSCAALAAATHAGAQPAVPFDPPPPPPAAAPAQ
FT                   PQTPVFQYIPIAEGAAPGSPAAPAGPVAPPAPPPAGAPFIPPVPNANFGNTGQFDFLRD
FT                   LWNMRNSPEFMQSVGPGQMDPSTWVPPTPYGDPAAAPAPPAAGSPPVPASAPPPIWPPV
FT                   PVPAPVP"
FT   sig_peptide     375855..376037
FT                   /locus_tag="Mflv_0374"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.364 at
FT                   residue 61"
FT   gene            376406..377353
FT                   /locus_tag="Mflv_0375"
FT   CDS_pept        376406..377353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0375"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   mva:Mvan_0308 periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42869"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0P4"
FT                   /protein_id="ABP42869.1"
FT                   /translation="MWSRRSFLGLTAGAAATLTACGQDKPGTVAGDGSVTVAHVFGETK
FT                   IPVPPTRVVSAGLTDADDLLALGVVPIAVTDWFGAEPFGVWPWARPQLGAAQPVVLSLA
FT                   DGVQVEQIASLNPDLIIATDAGLDQDTYTRLSQIAPTVAQSGRAAFFEPWRDQATAIGQ
FT                   AVFRHDDMQKLIADVDAQFSAAKDAHPEFSGKTALLLAGSVTGDGVRVTGPAWRREFLT
FT                   AMGLTVLDTDDEIPRDRMPDVLDEADVLIWTTESDEEQASLLADPAIADLRATTRSSHV
FT                   FTGKELAGAIAYASTLSYPVLADRLPPMLADALT"
FT   sig_peptide     376406..376501
FT                   /locus_tag="Mflv_0375"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.779 at
FT                   residue 32"
FT   gene            377368..378048
FT                   /locus_tag="Mflv_0376"
FT   CDS_pept        377368..378048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0376"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /note="TIGRFAM: conserved hypothetical integral membrane
FT                   protein; PFAM: protein of unknown function DUF165; KEGG:
FT                   mva:Mvan_0307 conserved hypothetical integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42870"
FT                   /db_xref="GOA:A4T0P5"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0P5"
FT                   /protein_id="ABP42870.1"
FT                   /translation="MNDRNQHASFARVGSAYYPVLVAVFTALVIISNVTATKGVEFGPI
FT                   ITDGGFLVFPLTYVIGDVLTEVYGFKAARRAIYTGFAMNVLAALAFWATVYLPAADFYP
FT                   NQEHFENIVGAYTGLIIAGMAGFLVGQTLNAWSLVLIKERTREKHLWARLVGSTFVGQL
FT                   GDTLVFCAIAASVIGITSFGDFVTYTAQGWLYKTIVEVALLPITYRVIAFIKHREPTYQ
FT                   SVPA"
FT   gene            378232..378933
FT                   /locus_tag="Mflv_0377"
FT   CDS_pept        378232..378933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0377"
FT                   /product="Allophanate hydrolase subunit 1"
FT                   /note="PFAM: Allophanate hydrolase subunit 1; KEGG:
FT                   mva:Mvan_0304 allophanate hydrolase subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42871"
FT                   /db_xref="GOA:A4T0P6"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0P6"
FT                   /protein_id="ABP42871.1"
FT                   /translation="MSVTSEAIDTVRTGGVRRIAEYGDRALLLEFDSSAEVLAWIEVVR
FT                   GADLPGAVDIVPAARTILVKLAGQRYLAPTRQRLAGLQMTDAAAADAVPPETADVVIDV
FT                   VYDGEDLDEVARLTGLAVDEVVAAHTGRMWRVGFSGFAPGFAYLVGGDERLVVPRRAEP
FT                   RTKVPVGAVGLAGEFSGVYPRESPGGWQLIGRTSAVLWDIDRENPALLTPGMWVQFQAA
FT                   DASSDAGEMTP"
FT   gene            378930..379826
FT                   /locus_tag="Mflv_0378"
FT   CDS_pept        378930..379826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0378"
FT                   /product="urea amidolyase related protein"
FT                   /note="TIGRFAM: urea amidolyase related protein; PFAM:
FT                   Allophanate hydrolase subunit 2; KEGG: mva:Mvan_0303 UreA
FT                   amidolyase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42872"
FT                   /db_xref="GOA:A4T0P7"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0P7"
FT                   /protein_id="ABP42872.1"
FT                   /translation="MSAVTLEILQPGPLALVEDLGRPGLSHIGVTRSGAADRRAHTLAN
FT                   RLVANPDDRATVEVTLGGFTARVHDGNGDGVAIAVTGADANPSVNGVPFGTNSIHHAHD
FT                   GEVISLAPPRSGLRSYLAVRGGIDVRPVLGSRSYDVMSAIGPGPLRAGDVLPVGPHTDD
FT                   FPELDQAPVAAIDDDFLELKVVPGPRDDWFVDPDVLIRTNWQVTNRSDRVGMRLVGMPL
FT                   EYRSPDRQLPSEGATRGAIQVPPNGFPVILGPDHPVTGGYPVIGVVTDDDIDKIAQARP
FT                   GQTVRLHWSRPRRPWES"
FT   gene            379860..380402
FT                   /locus_tag="Mflv_0379"
FT   CDS_pept        379860..380402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0379"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   mva:Mvan_0302 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42873"
FT                   /db_xref="GOA:A4T0P0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0P0"
FT                   /protein_id="ABP42873.1"
FT                   /translation="MRARLVHTSDLDDETREDARRMVLDAFDGDFSEDDWEHALGGMHA
FT                   LICQRGDVIGHAAVVQRRLYYGDMALRCGYVEGVAVTEEHRGQGLGGVLMDAVEQVVRG
FT                   AYHLGALGASELGEPLYTRRGWIRWKGPTSVLAPSGMTPTPDDDGAVFVLPADLPPSVT
FT                   LDPGAPLACDWRGGDVW"
FT   gene            380523..381665
FT                   /locus_tag="Mflv_0380"
FT   CDS_pept        380523..381665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0380"
FT                   /product="Uroporphyrinogen III synthase HEM4"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   Uroporphyrinogen III synthase HEM4; KEGG: mva:Mvan_0301
FT                   uroporphyrinogen III synthase HEM4"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42874"
FT                   /db_xref="GOA:A4T0P1"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0P1"
FT                   /protein_id="ABP42874.1"
FT                   /translation="MTDPDWAPLTGFRVAVTSARRADELAALLRRRGATVTSAAAIEMV
FT                   PLPDDDELRQRTQSLIDAPPDIVIATTGIGFRGWVAAADGWGMAADLTTALSTARIVSR
FT                   GPKATGALRAAGLPEEWSPESESSRELLHYLVEGGIAGTRIAVQLHGATAEWDPFPEFL
FT                   DELRAAGAEVVPIRVYRWHPAPRNGDFDQLVAGIAEEKFDAVSFTSAPAVASVLLRATE
FT                   MGLEAEVLSALRNGVHAMCVGPVTARPLVRLGVPTSAPERMRLGALARHITDELPLLQA
FT                   RTVRVAGHLLEIRGTCVLVDGTVKALSPAAMATIRALALKPGAVVSRTDLLRALPGSGT
FT                   DTHAVETAVLRLRAALGDKKMVSTVVKRGYRLPVDEAFAS"
FT   gene            381662..382420
FT                   /locus_tag="Mflv_0381"
FT   CDS_pept        381662..382420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0381"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiX
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiX
FT                   protein; KEGG: mva:Mvan_0300 cobalamin (vitamin B12)
FT                   biosynthesis CbiX protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42875"
FT                   /db_xref="GOA:A4T0P2"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0P2"
FT                   /protein_id="ABP42875.1"
FT                   /translation="MSLVLVAHGTRKQRGVSLIGDLSARVSAVLDRPVRVAFVDVLGPT
FT                   PSELLREEFHRPTVLVPAFLSRGYHVSRDIPSHVEASGHREVTVTRALGPDPALIRVLV
FT                   DRLVESGCHPEDSVILAAAGTSDPAAMRDLHTTAAALSATIGSRVELAFAATGEPRVSD
FT                   AVAEVRRRGCRRVVVASYLLSEGLFQDRLRDSGADLVTDPLGTHPGVTRLIASRFQRAG
FT                   YDTPCYDTPAEIAFQQRNVEADSYGQCNIR"
FT   gene            382435..383640
FT                   /locus_tag="Mflv_0382"
FT   CDS_pept        382435..383640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0382"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   mva:Mvan_4654 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42876"
FT                   /db_xref="GOA:A4T0P3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0P3"
FT                   /protein_id="ABP42876.1"
FT                   /translation="MPSGVAVGWPVKREFFDLVCDGMPTTEASLAVGVSRRTGWFWWRQ
FT                   AGGMKLRKGGDGLGGLADAGDLERPGGRGRRLSFAERFEIDRGLQAGRSYAEIGRELGR
FT                   DRSVIAREVKRNCLPDGRYHALMAHAAASQKARRPKTFKLDNPVLCALIAGWMDEGWSP
FT                   KLISQVLAEVYAGDKLMQVSHETIYQCLYVQTRGQLRADLHKCLSTKRQARSPRGHRGR
FT                   TGVYDPDTIFTISDRPAEANDRAVPGHWEGDLILGARHGSAIGTLVERSTRFVILLHLP
FT                   VDHTAQSVAAAMIEAMGELPAHLRRSITWDRGSEMASWKHIQMQLNSPVFFCDPHSPWQ
FT                   RGTNENTNRLLRFWFEKGSDLSVHTRDDLNIVAAKLNNRPRPTLDLDTPAQRMAALLSQ
FT                   AA"
FT   gene            complement(383710..384138)
FT                   /locus_tag="Mflv_0383"
FT   CDS_pept        complement(383710..384138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0383"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: mva:Mvan_0299 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42877"
FT                   /db_xref="GOA:A4T0N6"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0N6"
FT                   /protein_id="ABP42877.1"
FT                   /translation="MQSRRDQTRDFRPLTTTAARPTVDGMTYVIGSACVDIVDKSCVQE
FT                   CPADCIYEGDRAMYINPNECVDCGACRIACRVDAIYYETDLPDEELAFLDDNAAFFTTT
FT                   LSGRDEPLGDPGGAAKLGRVGADTPLVAALPASTTPHP"
FT   gene            complement(384182..385186)
FT                   /locus_tag="Mflv_0384"
FT   CDS_pept        complement(384182..385186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0384"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   mva:Mvan_0306 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42878"
FT                   /db_xref="GOA:A4T0N7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0N7"
FT                   /protein_id="ABP42878.1"
FT                   /translation="MTAAIGSQRQALAMIDLSRSTWHYRTNPRPPVSDPLPQKHRAYPS
FT                   RIDEADRAVIRDKILAGWEAGSSVDHAFAASWDEGVMLASRRSWWRIAAAIEDQSARPV
FT                   APTRSTSKTPRQAPVLKATGPQQIWSWDITDLRSPWRGVAFKAYSILDIYSRKIVGWRV
FT                   EERECDDLAVDMFEAAFAGHGLPAVVHADSGPAMRSTVLKDLLAGLKIGQTHNRPRVSN
FT                   DNPFSESEFRTMKYRPNYPGVFTDLDSARAWVSAYVSWYNQHHRHSGVELFTPDSVHDG
FT                   TWAQLWDRRDTALQAYYDAHPERFRNRPRTKSPSPVVGINLPTENDPDRLQAA"
FT   gene            complement(385183..385644)
FT                   /locus_tag="Mflv_0385"
FT   CDS_pept        complement(385183..385644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0385"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0305 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42879"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0N8"
FT                   /protein_id="ABP42879.1"
FT                   /translation="MGVSAKGMSVSISAGFSIAEIREFVVEYQRVPHGQKGSWLAASGV
FT                   SGGQFRRWQAAVFSGDLDRGLIPREGSEMTVPPALRKALAKVDAARQDRDEAELAQLRE
FT                   RVRELEATNEALGKAIGLLHTMSAHEPDAAPTIHDLDDSSTPRTDLSPS"
FT   gene            complement(385705..386064)
FT                   /locus_tag="Mflv_0386"
FT   CDS_pept        complement(385705..386064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0386"
FT                   /product="nitrite reductase (NAD(P)H), small subunit"
FT                   /note="TIGRFAM: nitrite reductase [NAD(P)H], small subunit;
FT                   KEGG: mva:Mvan_0298 nitrite reductase (NAD(P)H), small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42880"
FT                   /db_xref="GOA:A4T0N9"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017881"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A4T0N9"
FT                   /protein_id="ABP42880.1"
FT                   /translation="MTVENETRNGTGVWITACRYDFLIPNRGVGVLLPEGEQAALFRLD
FT                   DGTLCAVGNIDPFSGAAVMSRGIVGDRGGRLTVQSPIKKQAFALDDGSCLDNSDYALPV
FT                   YPTRITEDGVVQVGS"
FT   gene            complement(386071..388629)
FT                   /locus_tag="Mflv_0387"
FT   CDS_pept        complement(386071..388629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0387"
FT                   /product="assimilatory nitrite reductase (NAD(P)H) large
FT                   subunit precursor"
FT                   /EC_number="1.7.1.4"
FT                   /note="TIGRFAM: nitrite reductase [NAD(P)H], large subunit;
FT                   PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; nitrite/sulfite reductase, hemoprotein
FT                   beta-component, ferrodoxin domain protein; nitrite and
FT                   sulphite reductase 4Fe-4S region; BFD domain protein
FT                   [2Fe-2S]-binding domain protein; KEGG: mkm:Mkms_0268
FT                   nitrite reductase (NAD(P)H), large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42881"
FT                   /db_xref="GOA:A4T3Y6"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3Y6"
FT                   /protein_id="ABP42881.1"
FT                   /translation="MASNSHVVVVGHGMVGHRFVEALRSRDTEGTWRVTVLAEELDAAY
FT                   DRVGLTGYTDHWDRALLALPGNDYAADDLVEVRLGQRVAAVDPAAKTVTTTDGTQIGYD
FT                   ALVLATGSYAFVPPVPGRDLPGCHVYRTLDDLDAIRADALRTRETSRTPVGVVIGGGLL
FT                   GLEAANALRGFGLTAHVVERSGRLMSQQLDEAGGALLGRMIGELGITVHTDVGTESIRP
FT                   AQRNKPLKRSAEDNSMRVALSDGTFIDAGVVVFAAGVRPRDELARDAGLEVAERGGVLT
FT                   DLGCVTSDPAVYAIGEVAAIEGRCYGLVGPGYTSAEVVADRILGGAAEFPEADMSTKLK
FT                   LLGVDVASFGDAMGVTPDCLEVAVNDAVNQTYAKLVLSDDAKTLLGGILVGDASAYGVL
FT                   RPMVGEELPGDPLALIAPAGTEGGATQLGVGALPDAAQICSCNNVTKGDLTGAIAGGCC
FT                   DVADLKRCTLAGTSCGSCVPLLKQLLEAEGVEQSKALCEHFSHSRAELFEIVSATSIRT
FT                   FSGLIERFGTGKGCDICKPVVASILASTSSEHILDGEQASLQDSNDHFLANIQRNGSYS
FT                   VVPRVPGGDITPEHLILIGQIAKDFGLYTKITGGQRIDMFGARVDQLPEIWRRLVEGGM
FT                   ESGQAYGKSLRTVKSCVGSDWCRYGQQDSVQMAINLELRYRGLRAPHKIKMGVSGCARE
FT                   CAEARGKDVGVIATETGWNLYIGGNGGMTPKHAQLLAGDLDDETLVRYIDRFLMFYIRT
FT                   ADRLQRTAPWVEQLGLEHLREVICDDSLGLAAEFEAAVQRHVDGYACEWKGVLEDPDKL
FT                   SRFVSFVNAPDVPDPTIEFTEIAGRKVPSPVAIGMPKVGR"
FT   gene            388828..389280
FT                   /locus_tag="Mflv_0388"
FT   CDS_pept        388828..389280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0388"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: mva:Mvan_0296
FT                   heat shock protein HSP20"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42882"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3Y7"
FT                   /protein_id="ABP42882.1"
FT                   /translation="MSTVLNNKALWRRPAFDTDRFVREFFGPATAGEWAAGINPAVEVD
FT                   RDGEDAVIRVDLPGVDVAKDVTVEVDQGRLVIRGERRDMKVEDDTERAGRKVSEVRYGS
FT                   FHRSFRLPSHVSGDAVSAGYEAGVLTVRVAGAHKGAEPQRVAIESR"
FT   gene            389352..389783
FT                   /locus_tag="Mflv_0389"
FT   CDS_pept        389352..389783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0389"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0295 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42883"
FT                   /db_xref="GOA:A4T3Y8"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3Y8"
FT                   /protein_id="ABP42883.1"
FT                   /translation="MSTPLAVDTALTVLAAGLIFLWALVLGIWKYRQMATSADHLAHPY
FT                   VDIAHRAALLYSFATMLLAVFVELSAWPTAVNLTAAAVVVAFFVLAIATYIAHGIRRDT
FT                   TNQFEHVDTTIRIAMAALIVGEIGGFAVLLAGFVAGQFF"
FT   gene            389887..390288
FT                   /locus_tag="Mflv_0390"
FT   CDS_pept        389887..390288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0390"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: mva:Mvan_3342 UspA
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42884"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3Y9"
FT                   /protein_id="ABP42884.1"
FT                   /translation="MRAVQRAATLAAEADATLIVASAYTPATREAAAIDPDQPKGEDYR
FT                   TRGDAPVFDLLRDAAATARAAGARNVEERAVAGVPADALIALAEEVGADLLVVGSVGMN
FT                   SMVGRLVGSVPRLVRKKAGTEVLVVETSE"
FT   gene            complement(390386..391147)
FT                   /locus_tag="Mflv_0391"
FT   CDS_pept        complement(390386..391147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0391"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0289 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42885"
FT                   /db_xref="GOA:A4T3Y1"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3Y1"
FT                   /protein_id="ABP42885.1"
FT                   /translation="MARTEDLKARAEALLALHQPGNPVILPTVWDAWSAHLAVDAGFSA
FT                   LTVGSHPLADSIGKPDNEGMTFDDVLTRVAQITAAVDVPLSVDIESGYAEEPGRLIDGL
FT                   LSVDAVGLNIEDTVHSEGGRLRSSGEHAALVGGLRAAADAAGVHVVVNARTDLFLRQDG
FT                   DEADRVDRAIARLKEAADAGADVLYPVGVHPPEVMRRLTSELPLPVNAIARPDQSDPAS
FT                   YGPLGVARISFGPFWQAALAERSKELLARWR"
FT   gene            391262..391564
FT                   /locus_tag="Mflv_0392"
FT   CDS_pept        391262..391564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0392"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mkm:Mkms_0265 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42886"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3Y2"
FT                   /protein_id="ABP42886.1"
FT                   /translation="MSSTSTTELAQLHDLIGSLRRCVTSLASRYGDSPATRRIVNDAER
FT                   ILNDIDRLDIDAEELELARGVSRHHHVAERIPIPDTQYDTEFWRGVDDEGLGGTH"
FT   gene            391635..392456
FT                   /locus_tag="Mflv_0393"
FT   CDS_pept        391635..392456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0393"
FT                   /product="putative succinate dehydrogenase (membrane anchor
FT                   subunit) (succinic dehydrogenase)"
FT                   /note="KEGG: mva:Mvan_0287 putative succinate dehydrogenase
FT                   (membrane anchor subunit) (succinic dehydrogenase)"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42887"
FT                   /db_xref="GOA:A4T3Y3"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3Y3"
FT                   /protein_id="ABP42887.1"
FT                   /translation="MSAPTADRKATGVFSPGRAQIRQRTLRTDNWLKSPILIDLGFAAF
FT                   IIYATVRAFMQDHYYVEKYGYLTPFYSPCVSTGCVPEASHFGQFLPDVWWLPYAAVSLP
FT                   FLLLFRLTCYYYRGAYYRTVWQAPTACAVAEPHAKYTGETRFPLIIQNTHRYFFYIAVL
FT                   ISLVNTYDAIIAFSKPDGGFGVGLGNLILVVNVVLLWTYTVSCHSCRHVAGGRLKHFSK
FT                   HPVRYWMWTQISKLNVRHKQYAWITLGTLMLTDFYVMALAAGWFSDPRLIG"
FT   gene            392512..394446
FT                   /locus_tag="Mflv_0394"
FT   CDS_pept        392512..394446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0394"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /EC_number="1.3.5.1"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; KEGG: mva:Mvan_0284
FT                   succinate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42888"
FT                   /db_xref="GOA:A4T3Y4"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3Y4"
FT                   /protein_id="ABP42888.1"
FT                   /translation="MASEEAQLERHEYDVVVIGAGGAGLRAVIEARERGLRVAVVTKSL
FT                   FGKAHTVMAEGGCAAAMRNVNTKDSWQVHFGDTMRGGKFLNNWRMAELHAQEAPDRVWE
FT                   LETYGALFDRTKDGRISQRNFGGHTYPRLAHVGDRTGLEIIRTLQQKIVSLQQEDKREL
FT                   GDFDARIRVFHECSITEIIKENGRVAGAFGYYRETGKFVLFEAPAIVLATGGIGKSFKV
FT                   SSNSWEYTGDGHALALRAGSGLINMEFIQFHPTGMVWPLSVKGILVTEGVRGDGGVLKN
FT                   SEGKRFMFDYIPDVFKGQYAESEEEADQWLKDNDSARRTPDLLPRDEVARAINEEVKNG
FT                   RGTPHGGVYLDIASRMPAEEIKRRLPSMYHQFIELAEVDITKDEMEVGPTCHYVMGGIE
FT                   VDPDTGEAATPGLFAAGECSGGMHGSNRLGGNSLSDLLVFGRRAGLGASDYVRSLDNRP
FT                   AVTDAALQRAEQLALLPFEPKADAENPYTLHAELQESMNDLAGIIRKENELHEVLAKID
FT                   ELKKRYQNVVVEGGRIFNPGWHLAIDMRNMLLVSECVAKAALQRTESRGGHTRDDYPKM
FT                   DSHWRNKLLVCKTVGGGDEPGDPIIPEVSVEVEPQPPMRPDLLATFELSELEKYYTPEE
FT                   LAEHPEQKG"
FT   gene            394451..395206
FT                   /locus_tag="Mflv_0395"
FT   CDS_pept        394451..395206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0395"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /EC_number="1.3.5.1"
FT                   /note="TIGRFAM: succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein; PFAM: ferredoxin; KEGG:
FT                   mva:Mvan_0283 succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42889"
FT                   /db_xref="GOA:A4T3Y5"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3Y5"
FT                   /protein_id="ABP42889.1"
FT                   /translation="MAAYNAKLRVWRGDDTGGELKDFTVEVNEGEVVLDIIHRLQATQT
FT                   PDLAVRWNCKAGKCGSCSAEINGRPRLLCMTRMSTFGEDEVVTVTPLRTFPVMRDLVTD
FT                   VSFNYEKAREIPAFTPPKDLQPGEYRMQQEDVNRSQEFRKCIECFLCQNVCHVVRDHEE
FT                   NKLAFSGPRFLMRQAELDMHPLDTHGHRSEQAQEENGLGYCNITKCCTEVCPEHIKITD
FT                   NALIPMKERAADRKYDPVVWLGNKLFRRK"
FT   gene            395215..395658
FT                   /locus_tag="Mflv_0396"
FT   CDS_pept        395215..395658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0396"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0282 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42890"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3X5"
FT                   /protein_id="ABP42890.1"
FT                   /translation="MDERDDDTSRAVVRSLRTEDSYVVAGSVATQGSAVVAGSIATAGS
FT                   AGVAGSIATARSAAVANSIATAGSAAVAQSIATAGSAAIANSILVVLSLACAKCLACLG
FT                   CIACTSCKACVGCIDCEDCIGCVGCIDCSGLRGAVGLRGVHAA"
FT   gene            complement(395670..396152)
FT                   /locus_tag="Mflv_0397"
FT   CDS_pept        complement(395670..396152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0397"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family; KEGG:
FT                   sco:SCO1299 transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42891"
FT                   /db_xref="GOA:A4T3X6"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3X6"
FT                   /protein_id="ABP42891.1"
FT                   /translation="MFDAIIGGMGDDDRIALDRTDEAILKALQDDGRISTADLARAVSL
FT                   SPSSTADRVRRLVDAGVITGYTATVSATALGYTITAFVRLAYPSGNYKPLHSLLDVTPE
FT                   VVEAHHVTGDDCFILKVLARSMSDLERLTGRLATLGAVTTNVVYSSPLTRRRLEPG"
FT   gene            396189..397928
FT                   /locus_tag="Mflv_0398"
FT   CDS_pept        396189..397928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0398"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   mva:Mvan_0281 acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42892"
FT                   /db_xref="GOA:A4T3X7"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3X7"
FT                   /protein_id="ABP42892.1"
FT                   /translation="MAARGLLLNPNHFDPAWLDPESRRLLRALIDWFEQRGKARLLRDD
FT                   LDGVWVADFLEFVKKERLFATFLTPSEFAEGDPNKRWDTARNAVLSEILGFYGLSYWYA
FT                   EQVTILGLGPIWQSDNVKARERAAAQLEAGEVMAFGLSERAHGADIYNTDMLLTPASPG
FT                   ADDPVVFRASGEKYYIGNGNVAGMVSVFGRRTDVEGADGYVWFVADSRHPDYELIGNVV
FT                   HGQMFVSNFALRDYPVYEEDILATGQDAFSAALNTVNVGKFNLCSGSIGMCEHAFYEAI
FT                   THANNRILYGNPVTDFPHVRATFVDAYARLIAMKLFSDRAIDYFRSAGPHDRRYLLFNP
FT                   VTKSKVTSEGEKVVTLLWDVLAAKGFEKDTYFYQVTRLIGALPRLEGTVHVNVAQILKF
FT                   MPNYMFNPAEYPPIGTRDDPADDVFFWSQGPARGASKVRFADWAPVYERHAGIPNVGRF
FT                   YEQVQAFKQLLTVSAPDADQQADLDFVLVVGHLFSLVVYGQLILEQAEITGLDRDVLDQ
FT                   IFDVAVRDFSAYAVALHGKPSSTAAQQDWALSAVRKPEPDSGRFDRVWEQVRGYDGVYT
FT                   MRP"
FT   gene            complement(398207..398707)
FT                   /locus_tag="Mflv_0399"
FT   CDS_pept        complement(398207..398707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0399"
FT                   /product="flavin reductase domain protein, FMN-binding
FT                   protein"
FT                   /note="PFAM: flavin reductase domain protein, FMN-binding;
FT                   KEGG: mva:Mvan_0279 flavin reductase domain protein,
FT                   FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42893"
FT                   /db_xref="GOA:A4T3X8"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3X8"
FT                   /protein_id="ABP42893.1"
FT                   /translation="MSGSEPQRISLDPSSLREAFGHFPSGVIAIAAEVDGTRVGLAAST
FT                   FVPVSLDPPLVSFCVQNSSSTWPLLKDLPYLGISVLGEAHDEAARTLAAKTGDRFAGLE
FT                   TASSERGAVFVHGTSVWLETSIDQLVPAGDHTIVVLRVADITVHPDIAPIVFHRSVFRR
FT                   LGA"
FT   gene            398782..399438
FT                   /locus_tag="Mflv_0400"
FT   CDS_pept        398782..399438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0400"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0277 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42894"
FT                   /db_xref="GOA:A4T3X9"
FT                   /db_xref="InterPro:IPR021315"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3X9"
FT                   /protein_id="ABP42894.1"
FT                   /translation="MWITLLAMAVAVSLEPFRIGMTVLMINRPRPGLQLLAFLTGGFAM
FT                   GTAVGVAVLFLLRPVLDSAQFTLPRVQIVVGLVVLCTAAAVGSGLVGRPRDPGRAPGVL
FT                   AMRARRLLDGRSLWTAAAVGLGTALPSVDYLAALALIAASGAAAATQFGALMAFNAVAF
FT                   ALIEIPLLCYLVSPDRTRAVLASLNSWIRARGRVGVCALMAIVGGVLLVVGLAGL"
FT   gene            complement(399465..400607)
FT                   /locus_tag="Mflv_0401"
FT   CDS_pept        complement(399465..400607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0401"
FT                   /product="PE-PPE, C-terminal domain protein"
FT                   /note="PFAM: PE-PPE, C-terminal domain protein; KEGG:
FT                   msm:MSMEG_0412 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42895"
FT                   /db_xref="InterPro:IPR013228"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3Y0"
FT                   /protein_id="ABP42895.1"
FT                   /translation="MRRHLAFATAITTLGATGILGLGIAAAQPAPAPPPPPAPGAAAGA
FT                   PTPLGTPGRGYALGGAHVLGIPYDEYIMRTGADWFPGLDREIVDYPAGQVQGHTLERLF
FT                   PGIGAFGDRIAPGLGLDGPSYGESIDVGAPNLIGAIRRGGPGTAIGLSEGASVLDEVQA
FT                   RLAYDPAAPPPDQLSFATYGNPVGKHAFGESFLTQNFPVGSVVPSLDYRIPAPVESQYD
FT                   TYKFVSAYDSIADWPDRPDNWLSVANAIVGLATGHTAVAFTDPSMVPERNIRTTVNSRG
FT                   ATTTTYMIPEEHLPLVLPFKYLGVPKDTLMELDKVLLPYVDAGYSRNDDPATAPITVDP
FT                   VNGYDPAEVTAPATQAAFGGGADPVSQLLSGLQYILNNPP"
FT   sig_peptide     complement(400473..400607)
FT                   /locus_tag="Mflv_0401"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.766 at
FT                   residue 45"
FT   gene            complement(400671..402392)
FT                   /locus_tag="Mflv_0402"
FT   CDS_pept        complement(400671..402392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0402"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mva:Mvan_0272 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42896"
FT                   /db_xref="GOA:A4T3X1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3X1"
FT                   /protein_id="ABP42896.1"
FT                   /translation="MLHGRASMRPDDVAFTFTEYADDPAGVAETVTWSQLSRRTANVAR
FT                   VLARHGSAGDRAVILAPQGLEYILAFLGSMQAGMIAVPLPLPHRGSNHDRVSAVFTDTT
FT                   PAVVLTTSAVAGDVGAYVDEARMQIAPTIVTVDTLDLDGTPSDDEPAVAAGEAPDIAYL
FT                   QYSSGSTRLPTGVMISHRNLQSNYEQLMRSFFAVPHIRSTAELTIVSWLPFYHDMGLVL
FT                   GVCAPILGGHPAKLTSPVAFLEKPSRWVRALAENPQAFSAAPNFAFELAARKTRDSDLA
FT                   GLDLGGVLGIINGAERVNPATLERFADRFAHFNFRDNMLRPSYGLAEATVFVASGIYRE
FT                   SADEARFDSNELSAGRVARRTTGGTALVNYTLPQAPTVRIVDVETNRECASDVVGEIWV
FT                   HGENVAAGYWSRPADEQQCFGATLADPSPGTPAGPWLRTGDLGFVHGGELFIVGRIKDL
FT                   LIIRGRNHYPEDIEATVQGITRGRVAAISVPENSTEKLVTVIELKKSAEPDADATRWLS
FT                   EVKSDITSAISNAHGLNVEDLVLVPPGSIPTTTSGKVRRSACVDHYRQDQFDRLDA"
FT   gene            complement(402506..405511)
FT                   /locus_tag="Mflv_0403"
FT   CDS_pept        complement(402506..405511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0403"
FT                   /product="Transport protein"
FT                   /note="TIGRFAM: Transport protein; PFAM: MMPL domain
FT                   protein; KEGG: mkm:Mkms_0256 transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42897"
FT                   /db_xref="GOA:A4T3X2"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004707"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3X2"
FT                   /protein_id="ABP42897.1"
FT                   /translation="MRRLADVVVRWPWAVIGVWIALAVALPLSFPSLGQMAAKNPLQIL
FT                   PADAPSSVTAQKMAEAFDEPGSDNLLVVAFINESGLVPEDELTYRNVVDALRDDVADVV
FT                   SVQDFLGTPQLRQFLTSEDKTTWVLPVSLVGELGTPRAYESFNRVADVIRHEVPDAGTG
FT                   GSSLTVHVTGPAATVADLTVAGEQDRLPIEIAIAVLVLGVLLLVYRNPVTMLLPLLTIG
FT                   ASVLIAQGVVAGYSELTGAGVSNQSIVFLSAILAGAGTDYAVFLISRYHDYLRRGAEAG
FT                   EAVRAAMASIGKVITASASTVGITFLAMSFAEMGVFRTIGVSAAIGIGVAYLAGVTLLP
FT                   AILVLAGPRGWIKPRRELTAQFWRRSGIRIVRRPVPHLVASALVLALLAGFAIVADFNY
FT                   DDRKAVDAAAPSSVGYAALERHFPISQSIPQYILIQSPKDLRNPQALADLEQMASRIAQ
FT                   LPDVSLVSGVTRPLGEVPAEFRATFQAGIVGDRLAAGSAQIGERSGDLTTLADGATTLA
FT                   DSLGDVRSQVNEIAPSLKGIIDTFSSVRTEYGGDKLVRDVATAAKLVDSVNKLGLSMGI
FT                   NFRAVRDMFAWIGPVLTALQGNRVCDANPSCVDTRMQFEKLVSAREDGRVDEINQLAGQ
FT                   LQGVDDRQSLTATVNQLNGALAQVTKAISAMGLDTPAGARAGLDDLQDGADRLADGSRQ
FT                   VAGGVDQLVEQIKVMAAGLDQAAAFLLTMRNDASSSNMAGFSIPAEVLGAVEFQKASEA
FT                   FVSPDGHSVRYLVQTKLNPFSSEAMDQVNTISDIARGAQPNTMLSDASISMGGFPAALR
FT                   DTRDYYERDIRFIIVVTLVIVMLVLMLLLRSLIAPLYLVGSVVVSYFAAIGIGVLVFQL
FT                   LLGQQLHWSVPPLAFVVLVAVGADYNMLFVSRMRDESPHSVRFGIIRTLGSTGGVITAA
FT                   GLIFAASMAGLLFSSIGIVVQGGFVIGVGILLDTFVVRTITVPAIATLLGRANWWPSRV
FT                   AAPARERVSADT"
FT   sig_peptide     complement(405326..405511)
FT                   /locus_tag="Mflv_0403"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.879) with cleavage site probability 0.439 at
FT                   residue 62"
FT   gene            complement(405548..406969)
FT                   /locus_tag="Mflv_0404"
FT   CDS_pept        complement(405548..406969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0404"
FT                   /product="condensation domain protein"
FT                   /note="PFAM: condensation domain protein; KEGG:
FT                   mva:Mvan_0270 condensation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42898"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3X3"
FT                   /protein_id="ABP42898.1"
FT                   /translation="MRIGKITVGALEEWSLSPGKVISWHPTAASIEKARQAPVSSVPVS
FT                   YMQGQHLRNYCDRTTEGLNFSRQIIASCDVAGVCDIEAMDHAVNAYLRRHDTFRSWFEH
FT                   SGDGEFVRRALVDPEDIEFVPVEHGHMGVDEIHAHVVAIPSPLEWGCFTFGVIQNDDHF
FT                   SFFASMDHVHGDATLIGTTMMEANGMYSALSSGGAALALPDAGSFDDFCVREREYTAEL
FT                   TEDSPGVRAWIEFAENNSDGFPEFPLPLGNPKDSTRSVMTSAVLMDTAQTERFDAAATA
FT                   AGARFVGGLFACLAQVEHELTGALTYYGLTPRDSRSGSDNFMTQGWFTGLIPITVPIGA
FT                   ASFGEAAWAAQSSFDSGLNMAKVPYYRVLELAPWLGWPRPNFPVSNFFHGGAAPLNAIL
FT                   AASEMGLADNIGIYPDGRFSYQLTIYIFRYGQGTEMAIMHPDNPVAKRSVERYMQTMSS
FT                   VASLVADTGHWGRVA"
FT   gene            407208..418247
FT                   /locus_tag="Mflv_0405"
FT   CDS_pept        407208..418247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0405"
FT                   /product="beta-ketoacyl synthase"
FT                   /note="PFAM: beta-ketoacyl synthase; acyl transferase
FT                   domain protein; NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR;
FT                   phosphopantetheine-binding; Alcohol dehydrogenase,
FT                   zinc-binding domain protein; Alcohol dehydrogenase GroES
FT                   domain protein; KR; KEGG: mva:Mvan_0269 beta-ketoacyl
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42899"
FT                   /db_xref="GOA:A4T3X4"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3X4"
FT                   /protein_id="ABP42899.1"
FT                   /translation="MGSAAHQGESAHRFAIVGYAGRFPGARDAESFWELLADGRDAISE
FT                   VPEDRWDVEAFFDPDPSTPGKVVTRRAGFVDDVSGFDAPFFGMSTREVRLMDPQHRLLL
FT                   ETAWRAIEHSGTAPSELANTNTGVFVGLATHDYLGMASDELSYPEIEAYMAIGTSNAAA
FT                   AGRISYRLGLQGPAVAVDTACSSSLVAIHQACQALRLGECDLALAGGANVILTPATMIT
FT                   FSNAHMLAPDGRCKTFDAAADGYVRGEGCGVIVIKRLEDAVRDGDRIRAVIRGSAINQD
FT                   GASGGLTVPNGVAQQRVIGDALSRAGLAPGDVDYLEAHGTGTSLGDPIEAQAAGAALGP
FT                   GREPQRPLLIGSAKTNIGHLEAAAGIAGVIKVVLSLEHETLPKHLNFENPSPHIPWDRL
FT                   PVEVVKESIPWRRGQRGGRPRIAGVSSFGFAGTNAHVILEEAPLAAEPAQESVDDGRFT
FT                   LLPLSARTPAALMAVADRYRDWLVANPDATLADLCFTAGTARSHLEHRAALVVNTREAA
FT                   LDLLGALADDRPAPGLVRGESHDTPKTAWLFTGQGSQYPGMSRELFDTEPLFAETLREC
FT                   AAAVDGMLEKPLLDVIFDTDGVLDTDSNETLRHTSYAQPALFAVEMGLARLWQSWGFEP
FT                   DVVLGHSVGQYAAACVAGVLSLRDGARLMAERGRLFGSLPSGGRMAAVFAAAERVEALT
FT                   DEYPALSVAAYNGANTVLSGPATDLERAVAGLVADGVRCDWLETSHAFHSALLDPILDD
FT                   FESYARGITFTAPQRILIDNRTGAALGRSVTLDAAYWRRHARQPVEFAKSVHTLADMNC
FT                   KLLVEIGPRPVLTAAALSAWPDPATSPRVIASLRRTTADQRQITEAVADAYVLGHLPRF
FT                   AAFRRDGARVLDLPTYPFEHRQYWFSDSREPVAAAPQRGARTETVRLLEDGRIEELAAL
FT                   LGGTVDDPFTFDVLNRLAAQHNQQRSTESIADDRYQIRWETAAEPPVGADAADGITWLL
FT                   VGDDTDATRPLVDVLAARGHRYRILGLPKSGAEEHELADTLRDAAADATDLRIVHVAAL
FT                   DAAESDTSMKSLLRMQHRVLGGTRRLFGAAVAAQLRSPMWLVTRGAQHVTDTDVVAPDQ
FT                   TCLWGFGRAASLEHPQIWGGLADLGGGTSDEWSRLLNRIAATHDPAVMEDQVAVRGSTS
FT                   YVPRLVHRDTLPSGKPLHLRADATYLVTGGLGSLGLEIAGYLAANGAGHLVLTSRRTPD
FT                   EAAASRIEALRERHGCEVRVVTADVADAHAVARLLATVQAEMPPLAGIVHAAGEIGTTP
FT                   LADLDDAEVDRVFAGKVWGAWHLSEATSDLQLDFFISTSSIASVWGGFGQAAYGAANAF
FT                   LDGLAWRLREQGVAGVSVNFGPWSAGMADAQSRARLEQRGIKTLSPADALAGLSDAVIS
FT                   AAPHPVVARVDWSRFLPLYQQAGRRGFLAELERELPAAPAQQGPAVTASGRTPLVERLT
FT                   TAPLQQRKRLLTDYLRDAVAEVTRVDAAEIREDAGFFDLGMDSLMAVELRRRIETGVGK
FT                   EIPVTLVMDHPRLSDAADYLLGDVLGLTEAATAPKAATVVSTAADEPIAIVAVSCRFPG
FT                   APNPEAFWDLLSGGVDAIREVPEDRFDIDEFYDPDPDAAGKTYTRYGGFLDHIDEFDPE
FT                   FFGLSPREAVWIEPQQRLMLETVWEGLERAGYAPSALRGSRTGVFVGVAANEYAHLLSA
FT                   ESIDKIEPHFITGNALNAISGRVAFALGLEGPAVAVDTACSSSLVAVHQATQALRSGDC
FT                   DMALAGGVNVLLSPVTVVAASRARMLSPVGRCKTFDASADGYVRSEGCGILVLKRLSDA
FT                   VRDGDRVCAVIAGSAVNQDGASSGLTVPNGGAQQRLIGTVLARAGITGGEVDYLEAHGT
FT                   GTPLGDPIEVQAAAAAYAGARDADRPLLMGSVKTNIGHTESASGAAGLIKVVLSLQHET
FT                   LPQSLHFDTPSPHIPWDSLPVRVVDTAMPWQPNGRPRRAGVSSFGFTGTNAHVLIEEAP
FT                   TDLAGPTEPTAPAEPVDEDAAADPAPAPVEVLPLSARSPEALVALAQRYETWLTAHPEA
FT                   DLADVCRTAGTGRSHFEHRAALVVDSVESARIALTDLAQNRLRPGVVRGEHLNHPTTAW
FT                   MFTGQGSQYPGMARELFDTEPVFADTVTRCADAVADLLPRPLLDVMFAGGREAGVPPTE
FT                   TLRHTSFAQPALFAVEMGLARLWQSWGIVPDVVLGHSVGQYAAACVAGVFSLEDGARLM
FT                   AERGRLFGSLPEGGRMVAVFADAKRVEQVAADFPRVSVGAYNGPNTVLSGPGEDLEQIV
FT                   GTFGEDGIRCTWLETSHAFHSELLDPVLDEFESYAAQLQFAAPTLPLVCNRTGAVLTGQ
FT                   TSLDAQYWRRHSRQPVQFAESVRTVAALGCSVLMEIGPQPVLTGAAVQVWPEHLAAPRA
FT                   IASLRKGVADRRQIADALAAAYIGGHKPDFAALHEQRGVRLELPTYPFQRRRFWPKSAG
FT                   MAIDGRVGASAGSGILGSGKDLASGDSVYTSRLSVKTQPWLSDHVIYGTVVVPGATYAA
FT                   MALAAVGTPAHAKDVFFYEPIILPEKSSREVQLTVHPSVDGESKFQVHSRPYGERGAEW
FT                   ALNAEGVVASGVGDSPAAAGDLEDPVDEAIERLNRMRPQELFETFADLELAWGPTWSGS
FT                   LKSLWLGEGEAIGDILVGAELAEQLGTEPMHPVLMDLCTGVAFPAFPALLAAEQGVNDL
FT                   YLPLRYGQVSLQEKMPRRFYCRATWHEAPLDSETQVFDLEYLDRDGRHLGGVREFTVKR
FT                   APREALLRGLGGDATRLLYTLGWHEVPVPESGDGAAPQGTWLIGGFDELAVSVPGCIPA
FT                   DRTNPESLRQLLTDAHGRGLPFSGVVWRAARSDGDESDAEVAARLEAEIAELLGAVHTV
FT                   QGGEVKLPGGLWIVTERAVATESGEPVDPVQAALWGFGRTAINEEPALRCRLVDCDGSP
FT                   QAVQALAALLSTPVDEPELAVRQGKLLASRLLPWSRSGHLTVPRGGDYVLAPTERGAID
FT                   NLRLTDSEVPPPAEGYVQVRVEAAGLNFRDVLNVLGLYPGDPGPIGGDFAGTVTQLGEG
FT                   VTGLDVGQRVYGSMQGAFASRFNVPGQFLAPIPDGVSAVEAATIPAAALTVRLSFDWAQ
FT                   VKSGDKVLIHAASGGVGLAAVQMAQQCGAEVYATASTFKRATLRKLGVKHVYDSRTTDF
FT                   AEQILADTDGAGVDVVLNSLTSEGFIEATLRATAQHGRFAEIAKRDIWTVEQMAAARPD
FT                   LAYEIVALDTVMFTEPDRIRDLLTEVSAGLRDGAWTPLPAEVYPLTEARAAFRRMQQAR
FT                   HIGKIVVQIPNPLQPQPDRSYLITGGLGAIGLHTAGYLAQLGAGDIVLTSRRAPDAAAQ
FT                   QAIADIADRTKARLHVFTADVGVEADVAALLERIRAELPPLAGVAHLAGVLDDALLSQQ
FT                   SVERFRTALAPKAFGAVHLDRLTRVDDLDFFLVSSSVSSLFGSPGQSNYATANAFLDGL
FT                   VAQRRAQGLPATGVNFGPWARGGMASSEAAAANISAQGLIPLEPSAALTAMAEVVANGT
FT                   AQATVLKANWQRAAKVLGSSRPPILDLVLPSAVGEITGDSELLKQLQEIPVPQRAGFVT
FT                   EFLQKEVQNFLRLAQPPAATSRFLDLGTDSLMAIELRNRLHSQFGGAFTINATAVFDYP
FT                   TIGGLAEYLVAQLPDAETPQAAPQSESEPGPDVTE"
FT   gene            418297..418800
FT                   /locus_tag="Mflv_0406"
FT   CDS_pept        418297..418800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0406"
FT                   /product="TspO-and MBR-like protein"
FT                   /note="PFAM: TspO/MBR family protein; KEGG: mva:Mvan_0268
FT                   TspO and MBR like proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42900"
FT                   /db_xref="GOA:A4T3W7"
FT                   /db_xref="InterPro:IPR004307"
FT                   /db_xref="InterPro:IPR038330"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3W7"
FT                   /protein_id="ABP42900.1"
FT                   /translation="MTSDSVSTSVSARTTPWLALAISFAAVILASALGGLSANSADGYA
FT                   QLEQPGFAPPSWVFGPTWTLLYALMAIAAWLVWRTGPSPETRRALTLYGVQLVLNAAWT
FT                   PLFFGLGWCGVAFFELSALLVVLIATVVMFWRRSTLAGALLLPYLAWSTFALCLNFAVW
FT                   QLNN"
FT   sig_peptide     418297..418419
FT                   /locus_tag="Mflv_0406"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.996) with cleavage site probability 0.708 at
FT                   residue 41"
FT   gene            418819..419610
FT                   /locus_tag="Mflv_0407"
FT   CDS_pept        418819..419610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0407"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mva:Mvan_0267 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42901"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3W8"
FT                   /protein_id="ABP42901.1"
FT                   /translation="MTKSVFITGAATGIGRATALLFAGRGYRVGGYDLDEDGLAVLAAD
FT                   ITAVGGTPVVAHLDVTDPDEVARRLAEFAEGSGGRIDVLINNAGLLNAGRFEEIPLEVH
FT                   HREIEVNVKGVVNGLHAAFPYLKGTPGAVVVNLASASAIYGQAELANYSATKFFVRAIT
FT                   EALNLEWGHYGIRVIDMWPLYVNTAMTKDVKTGTTQSLGIRLTAQDIANDIVAAVDATW
FT                   ARKALAQVHFPVGLQAKALALGARFSPAWLTRLVNKGLAGS"
FT   gene            complement(419692..420780)
FT                   /locus_tag="Mflv_0408"
FT   CDS_pept        complement(419692..420780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0408"
FT                   /product="dihydrodipicolinate reductase"
FT                   /note="PFAM: dihydrodipicolinate reductase; KEGG:
FT                   mva:Mvan_0266 dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42902"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3W9"
FT                   /protein_id="ABP42902.1"
FT                   /translation="MQRAIGVAVWGTGNMGSTAIRSTAAFPGLALAGVITSSADKAGRD
FT                   AATFGGLEAPTGIAATTDVDAALAACDAVAYMASGDIRPDDALADIERCLRAGRHVVTP
FT                   SLYSLYDPASAPAEWIERLTAAAEEGRATLLVSGVDPGWGNDALAVTAASLCTRINTIT
FT                   CQEIFDYSTYDQPFAVKVSCGFGGSMDETPMMLLPSIPTMVWGGNVRLVGRGLGIEIDE
FT                   ITEEVERLPLEETVETVMGTFEKGTQGAFWLKVIGWSDGRQRIVIDHITRIHPSCAPHW
FT                   PQPDQGDGEHRVVVDGDPQLTITSRADVPGGTRADGGNTTAANRLLGALNWLVEQKPGI
FT                   YDGLAVPLRSALPPEAEDARWA"
FT   gene            421019..422854
FT                   /locus_tag="Mflv_0409"
FT   CDS_pept        421019..422854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0409"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   mva:Mvan_0265 acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42903"
FT                   /db_xref="GOA:A4T3X0"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3X0"
FT                   /protein_id="ABP42903.1"
FT                   /translation="MGHYKSNVRDQVFNLFEVLGVDKALGQGAYAELDVDTVTEMLGEM
FT                   AKLAEGPVADSFAEGDRNPPVFDPKTHSVTLPEAFKKSVRAVTDGGWDKLSASEEIGGA
FT                   ALPSVISWALQEHILGANPAVYMYAMGAGFADIFYHLGTDEQKKWAKLAADRGWGSTMV
FT                   LTEPDAGSDVGAGRTKAVQQPDGTWHIDGVKRFITSADSDDLFENIMHLVLARPEGAGP
FT                   GTKGLSLFFVPKFHFDHETGEPGERNGVFVTNVEHKMGLKISTTCELSLGQHGTPAVGW
FT                   LVGEVHDGIAQMFDVIEQARMMVGTKAIATLSTGYLNALAYAKDRVQGADLTQMTDKTA
FT                   PRVTITHHPDVRRSLMTQKAYAEGLRALYLFTATHQNAEMAKVVHGIEPDLAVRVNDLM
FT                   LPIVKGVGSEQAYAKLTESLQTFGGSGFLQDYPIEQYIRDAKIDSLYEGTTAIQAQDFF
FT                   FRKIVRDKGVALAHVAGQIEQFVKAETGNGRLKAERALLATALEDVQGMAASLTGYLMA
FT                   SQEDQAAIYKVGLGSVRFLMSVGDLVIGWLLQQQAAVAIEKLDAGVEGADRAFYEGKIA
FT                   VASFFAKNFLPLLTSTRSIIENLDNEVMELDEASF"
FT   gene            complement(423192..424112)
FT                   /locus_tag="Mflv_0410"
FT   CDS_pept        complement(423192..424112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0410"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: mva:Mvan_0261
FT                   luciferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42904"
FT                   /db_xref="GOA:A4T3W2"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019910"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3W2"
FT                   /protein_id="ABP42904.1"
FT                   /translation="MQISMFGQISAFGGNAIDATIGYLSQLRDEGFGRVWISQLPYEPD
FT                   LLTVLAVALHEVDTIEVASGVVPIQNQHPMQMAQRALTVSLASNGRFILGLGMTHAAVT
FT                   EGMWGIPWDKPVRRLNEYLDGLLPLLAGEPANATGETVTTRGALMIPGAPRPDVYIAAL
FT                   GPQLLRLAGRRTQGTCTWMTGPATLRDHVSPTLRQAAADAGRPDGSVRVVASLPVAVTD
FT                   DVDELRKQAADQFAMYGTLPSYRAMLDREGYAGPEDAAIIGDEATVRDQIAELGAAGVD
FT                   EYVGAVFDSSVEGRDRTRALLRELG"
FT   gene            complement(424311..425612)
FT                   /locus_tag="Mflv_0411"
FT   CDS_pept        complement(424311..425612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0411"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: mva:Mvan_0260 acetyl-CoA acetyltransferases;
FT                   TIGRFAM: acetyl-CoA acetyltransferases; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42905"
FT                   /db_xref="GOA:A4T3W3"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3W3"
FT                   /protein_id="ABP42905.1"
FT                   /translation="MADSKTARRVAILGGNRIPFARSDGAYAQASNQDMFTAVLDGLAD
FT                   RFNLKGEKLDAVIGGAVLKHSRDFNLMRECVLGSSLSSYTPAFDLQQACGTGLQSAIAA
FT                   ADGIARGRYDVAAAGGVDTASDAPIAFGDDLRKVLLGLRRAKSNVDRLKLVGKLPASLG
FT                   VEIPVNSEPRTGMSMGEHAAVTAKEMGVKRVDQDELAAASHRNMSAAYDRGFFDDLVSP
FT                   FLGLYRDNNLRPDSSAEKLAKLKPVFGVRNGDATMTAGNSTPLTDGASVALLSSEEWAA
FT                   QHSIPVLAYLVDAETAAVDYVNGRDGLLMAPTYAVPRLLTRNGLTLQDFDYYEIHEAFA
FT                   SVVLATLAAWESDEYCKERLGLDKALGSIDRSKLNVNGSSLAAGHPFAATGGRIVAQLA
FT                   KQLAEKKKQTGQPVRGLISVCAAGGQGVTAILEA"
FT   gene            425691..427124
FT                   /locus_tag="Mflv_0412"
FT   CDS_pept        425691..427124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0412"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR; KEGG:
FT                   mva:Mvan_0259 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42906"
FT                   /db_xref="GOA:A4T3W4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3W4"
FT                   /protein_id="ABP42906.1"
FT                   /translation="MRQCWVTPAPTPQQMYPDPAKGSTVASDLLSQVVNSGPGSFLAKQ
FT                   LGVPQPEPLRRYKQGEPPLVGSLLIGGEGRVVEPLRAALADDYDVVANNLGGRWADSFG
FT                   GLVYDATGITEPEGLKGLKGLYEFFTPLLRNLGHSGRVVVIGTTPEETGSIHERTVQRA
FT                   LEGFTRSLAKELRNGSTASLVYLSADAKPAATGLESTLRFLLSGKSAYVDGQVFHIGAA
FT                   DATPPADWDKPLDGKVAVVTGAARGIGATIAQVFARDGAKVIAVDVEGAVEALTETATK
FT                   VGGTALTLDVTAADAVDRITEHVREHYDGTLDILVNNAGITRDKLLANMDESRWDSVIA
FT                   VNLLAPLRLAEELVGSGLIGDGGRIVGLSSMAGIAGNRGQTNYAATKAGMIGLTDALAP
FT                   QFAEKNITINAVAPGFIETKMTEAIPLATREVGRRLNSLFQGGQPVDVAEAIAFFASPA
FT                   SNAVTGNTIRVCGQAMLGA"
FT   gene            427124..427972
FT                   /locus_tag="Mflv_0413"
FT   CDS_pept        427124..427972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0413"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   mva:Mvan_0258 MaoC domain protein dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42907"
FT                   /db_xref="GOA:A4T3W5"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR003965"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3W5"
FT                   /protein_id="ABP42907.1"
FT                   /translation="MSDKQPSGLKNLALAAAGALPFVPRGDTLPTRTLTVEDLSIDPVN
FT                   VAEYADVTGLRFDNTVPLTYPFALTFPTVMQLITGFDFPFAAMGSVHLENHITQLRPIA
FT                   VTDTVSVAVHAENMREHRRGLLVDILTDVRVGNELAWQQVTTFLHQQRTSLSDEPKPPP
FT                   QKQPKLPPPNAVLRITPAQIKHYASVGGDHNPIHTNGIAARLFGFPTVIAHGMFTAAAV
FT                   LANVEGQLPDGVKYSVRFAKPVILPARAGLYVDRRADGWDLTLRHLTKGHPHLTGTLTS
FT                   L"
FT   gene            complement(427962..428609)
FT                   /locus_tag="Mflv_0414"
FT   CDS_pept        complement(427962..428609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0414"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mva:Mvan_0257
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42908"
FT                   /db_xref="GOA:A4T3W6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041669"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3W6"
FT                   /protein_id="ABP42908.1"
FT                   /translation="MAGGTKRLPRAVREQQMLDAAVEIFSVNGYHETSMDAIAAEAQIS
FT                   KPMLYLYYGSKEELFGACLHRELTRFVDEVNSNIDFTAPPKELLRTAVLAFLNYIDANR
FT                   ASWMVLYTQATSSQAFAHTVREGRERIIEIVGRLLRSGTRFPEPDTDFDMMAVALVGAG
FT                   EAIASRVSTGDADVHEASELMINLFWRGLKGSPSAASDRDADATDATAVITS"
FT   gene            complement(428686..429672)
FT                   /locus_tag="Mflv_0415"
FT   CDS_pept        complement(428686..429672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0415"
FT                   /product="Beta-N-acetylhexosaminidase"
FT                   /EC_number="3.2.1.52"
FT                   /note="PFAM: glycoside hydrolase, family 3 domain protein;
FT                   KEGG: mva:Mvan_0256 beta-N-acetylhexosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42909"
FT                   /db_xref="GOA:A4T3V8"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3V8"
FT                   /protein_id="ABP42909.1"
FT                   /translation="MSTRDKLAQLLMVGVTGAADARTAAAEYHVGGIMVGSWTDLSMLT
FT                   DGSLPDIANAGLLPLAVSVDEEGGRVSRLSGLIGPQPSARVLAQTKTPDEVRAIARDRG
FT                   AKMRNLGITVDFAPVVDVSDAPDNTVIGDRSFGADPTTVTDYAGAYAQGLRDAGVLPVL
FT                   KHFPGHGSGSGDSHVGSVVAPSLEQLQASDLVPYRTLAAQAPVGVMVGHVEVPGLTGSD
FT                   PASLSPQAYGLLRSGGYGGPPFGGVVFTDDLSGMQAISDRLGVAEAVLRALQAGADVAL
FT                   WLSTGEVPAVLDRLEKAVGAGELTMSGVDGAVTRIVAMKGPSPRCGG"
FT   sig_peptide     complement(429592..429672)
FT                   /locus_tag="Mflv_0415"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.825) with cleavage site probability 0.430 at
FT                   residue 27"
FT   gene            430086..430571
FT                   /locus_tag="Mflv_0416"
FT   CDS_pept        430086..430571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0416"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: mva:Mvan_0255 UspA
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42910"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3V9"
FT                   /protein_id="ABP42910.1"
FT                   /translation="MTSPVPTDKKTVIVIAFDGSPTARRAVAYAARFLTADRAVVLTAW
FT                   TPLNRGTDPQDYDYDLDGPPDPRDEELDIALAEAQRINDEGVELAVAAGLPAEPMRRAV
FT                   TFTVWQAIIEAADELDADLIVTGTRATTGFRSLIQSSVADHVLRRGHRPVLIVPPEP"
FT   gene            430626..430799
FT                   /locus_tag="Mflv_0417"
FT   CDS_pept        430626..430799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0417"
FT                   /product="small secreted protein"
FT                   /note="KEGG: mva:Mvan_0254 small secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42911"
FT                   /db_xref="InterPro:IPR022566"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3W0"
FT                   /protein_id="ABP42911.1"
FT                   /translation="MNRFLVPAAASIVVGLLLGAAAVFGVTLMVQEDTKPPLQAGDPAS
FT                   SVLNRVEYGDRT"
FT   sig_peptide     430626..430703
FT                   /locus_tag="Mflv_0417"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.999) with cleavage site probability 0.742 at
FT                   residue 26"
FT   gene            431086..435129
FT                   /locus_tag="Mflv_0418"
FT   CDS_pept        431086..435129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0418"
FT                   /product="putative conserved transmembrane protein"
FT                   /note="KEGG: mva:Mvan_0253 putative conserved transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42912"
FT                   /db_xref="GOA:A4T3W1"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR021798"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3W1"
FT                   /protein_id="ABP42912.1"
FT                   /translation="MPGWVTQRLWWALLLVVGFWGVLRVSEALGIGTTPARVIGAVAYA
FT                   LSPRVLTTLGAISSETLPMMLAPWVLLPVILALQGGSGGVGRAQGGSGGVGRAQGGSGG
FT                   VGRAQNGRRIRTLAARSALAIALMGAVNAVATLTACLCAAVWLLCHRPNRVWWRFVAWW
FT                   LPCVALAVTWWVIALLHLGRISPPFLDFIESSGVTTRWMSLTEMLRGTGAWTPYVAPTA
FT                   TAGAPLVTGSVAVLATTLVAAGGLAGLAMTRMPARGRLITMLLVGVVLLASTYSGGLGS
FT                   PIAHAVQIFLDADGTPLRNLHKLEPLLRLPLALGLIYLLGRIPLPGSVARPVWRDAFAH
FT                   PENDRRVAVGIVLLAALTAATSLAWTGRLTPPGTFDAIPQYWHDTADWLDDNNTGGRVL
FT                   VAPGAPFATQVWGNSHDEPLQVLGDSAWGVRDSIPLTPPETIRALDSVQRLFAAGRPSD
FT                   GLADTLARQGISYVVVRNDLDPETSRSARPILVHRAVDGSPGLTRVASFGDPVGPGTLD
FT                   GFVADSGLRPRYPAVEIYRVDSPGSLTPYVAEADSMARVDGGPESLMRLDERRRLTGEP
FT                   ALGPVLLTQDAARAGLPAPLVTVTDTPTARETDYGRVDDHSSAIRGPDDARNTFNRVPD
FT                   YPSEGADLVYGQWDGGRVTVSSAASDSTALPNVSPSSGPASAIDGDTSTSWVSNALQTA
FT                   IGQWLQVDFDLPVTNATLTITPSATAVGAQVRRMEVSTVNGTTSVRFEEAGKPLTVALP
FT                   YGESPWVRITATGTDDGSPGVQFGLTDINVTQYDANGFAHPVTLRHTVDVPGPPPGSAV
FT                   AQWDLGSELLARAGCAESPTGIRCAAAMALASEEPANLSRTLAVPEPIEVTPTVWVRAR
FT                   QGPQLADLVAQPGTTRAVGDSDPIDVLGSAYAAADGDPGTSWTAPQRSVQPHTPPSLVL
FT                   RLPEPRNVAGIRLTPSSSALPAHPRMIAVDLGDGPQVRRMSADGTQTLDLHPRVTDSVT
FT                   VWLMDWDDVIDRNALGFDQLKPPGLAEATVLDDRGQPIGAADAAANRERTVSLPCGRGP
FT                   VIGVAGEFVQTSVTTTVGDLLAGRPVPAQPCRDQPIRLPAGQQELLISPGGALIVDGVQ
FT                   LSTARAGEIGSATTSSVTINRWGPADREVSTPPSESTQVLVVPESVNPGWVARAASGAT
FT                   LNPVTVNGWQQGWVLPPDTEGPVTLHFTSNSTYRAGLIGGLALLPLLLVLAFVPVRAGA
FT                   AAGAAARPWQPPAVAVGAAAAVAATVISGVGGLLVTGVALGVRYLLRRRERLVDRLTVG
FT                   VAASGLILAGAVLSGNPWRSVDGYVGHSAGVQFLALLSVVAVAVSTVSFPDSGRRRPSG
FT                   DEGK"
FT   gene            435131..436609
FT                   /locus_tag="Mflv_0419"
FT   CDS_pept        435131..436609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0419"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mva:Mvan_0252 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42913"
FT                   /db_xref="GOA:A4T3V3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3V3"
FT                   /protein_id="ABP42913.1"
FT                   /translation="MTEGQASAVDAPVPPISTQVSALAARSPDAAAITCAGRTVTRAEL
FT                   DATSNRIARGFASRGVGIGDYVTIVLPNSIDWAYAVLACWKLGAVPQPLSARMPDAELG
FT                   ALLQLRRPALLVGRTDPTGLTAGTTTDLAREFADESDAALPEAVSPVWKAMASGGSTGR
FT                   PKLIEAGNDSRVPPAIGYPLGAQEGDVNLVSVPLSHNTGFTTFAIGLLQGHHLVVMPRF
FT                   EPREFLRLITEHRVTFLTTVPTIMQRLLPVYRADPDAYDLSSIRRFWHVASACPPAVKR
FT                   AWIDIVGPDALWELYGGTELQALTFISGTQWLTHPGSVGVVVAGEMKVLDDDGNECPPG
FT                   VPGEIYMRPAPGARPTYRYIGSTAKSRDGWDSLGDLGYFDEDGFLYLNDRRVDMFTVGG
FT                   RNVYPAEIESALAEHPGVLSSLVVGLPDDDLGHVPHAIVQADLSEADVLAFLGERIASY
FT                   KLPRTVEFTDRPLRDDAGKARRSAVRDEVLARRA"
FT   gene            complement(436710..437915)
FT                   /locus_tag="Mflv_0420"
FT   CDS_pept        complement(436710..437915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0420"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: mva:Mvan_0251
FT                   acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42914"
FT                   /db_xref="GOA:A4T3V4"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3V4"
FT                   /protein_id="ABP42914.1"
FT                   /translation="MSATGTASSRGDVGASGDGVGGTRSFLPAVEGLRAWAAIGVVITH
FT                   VAFQTGQSGGAVGRILGRFDLAVAVFFALSGFLLWRGHAAAARGLRSRPSTGHYLRSRI
FT                   VRIMPGYLVAVVVILTLLPEAKADVTVWLANLTLTQIYVPLTLTAGLTQMWSLSVEMSF
FT                   YLALPLLALLARRVPVRARIPVLIGAAAASLLWVHIPFDGASGHNLWNWPPAFFSWFAA
FT                   GMVLAELTVSPVGWAHRLARRRVLMALLALTAFLIAASPLAGREGLHPGSIAQVTLKTV
FT                   MGAIVAGALLAPLVLDRVDTSHRMLGSPVMVTLGRWSYGLFVWHLAALAMVFPVIGAFP
FT                   FNGHFTVVLLLTLLFGFAIAAVSYALVESPCRNALRRWERRNAPTPLDSSITEEIEPEV
FT                   AR"
FT   gene            438097..439302
FT                   /locus_tag="Mflv_0421"
FT   CDS_pept        438097..439302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0421"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0250 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42915"
FT                   /db_xref="GOA:A4T3V5"
FT                   /db_xref="InterPro:IPR021424"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3V5"
FT                   /protein_id="ABP42915.1"
FT                   /translation="MNRAVALRIAACGIMGLGAALLIAALLLSTYTQGKIAKIPLTVDS
FT                   TLVSDGTATAFDPASLLGERFVVNEDVPVVSQQQTSVEAPANADVVTLQVGTSLRRTDQ
FT                   QGDNGLLLAMVDTVTMNRETAEAVSSETNPGGSVQKPRAMEDENPPTSIALPHEGLTYR
FT                   FPFDTEKKTYQVFDPIAQEPFDANYSGEEDVNGLTALKFTQNVGFDADGKLVEPVRFAS
FT                   LYDDDADAQVTARASLWGLEGDPEEPITMTRYYAAQRTFWVDPVSGTIVKQTDRGYHYY
FT                   AREALKPEMTYVDYTVTTDEESVESQVASAQDERDRISLWGRILPITFTALGLVALVGG
FT                   AVLGTFSLRAESMLIDPGLDGAGDRFYGKRDEEGEPVPGAEAMTEKLPAQRPSDLPPDR
FT                   PV"
FT   sig_peptide     438097..438201
FT                   /locus_tag="Mflv_0421"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.984) with cleavage site probability 0.409 at
FT                   residue 35"
FT   gene            439323..441095
FT                   /locus_tag="Mflv_0422"
FT   CDS_pept        439323..441095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0422"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0249 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42916"
FT                   /db_xref="GOA:A4T3V6"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3V6"
FT                   /protein_id="ABP42916.1"
FT                   /translation="MAPAYALALTVAVTAPLLQPGYLLLRDAVSTPRSYLTDAALGLTQ
FT                   AAPRALPQDFLVALVSTVVDGGVVVKALLMLGLWLAGWGAARLVAEVLQAGVAGQCVAV
FT                   TIAIWNPYVAERLLQGHWSLLVGYGCLPWVAVSMLSLRAGSPRMSMSPPAAPNLHSSRQ
FT                   SASRRLLECNFGGVAAVVFWVALAGLTPTGLMLAATIALTCALAPGAGRPRWWCAAVGM
FT                   AAALAAALPWLVATVVAPGWAAADAGQKAGVEAFAARAEPGLGTLGTLAGLGGIWNADA
FT                   VPASRTTLFAIVSTVVLLAIVAVGVPLLVRRRVPVPLLVLAVVAVVAPALMATGPGLLA
FT                   VEAVIGAVPGLGVLRDGQKWVALAMPAYALAGAATVLTLRSRIPTLATGAVCCAALIAT
FT                   LPDLAWGVGGRVTPVDYPPGWSAAAAVINADPATVAVLPVDSMRRFAWAPGAPVLDPLP
FT                   RWLRADVLSTGDLTIAGTTVLGEGARAREVQQMLASGADRDELAAAGVGWVVVEGSGVR
FT                   LALPESYRDENLTVYRVGGDSPSSAHRGVVIAAHSVWLAALGVGFLGMLVARRRSRRAH
FT                   GREQEVDRPQAGDQ"
FT   gene            complement(441297..442154)
FT                   /locus_tag="Mflv_0423"
FT   CDS_pept        complement(441297..442154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0423"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0247 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42917"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3V7"
FT                   /protein_id="ABP42917.1"
FT                   /translation="MNANRIQITRRTARWSDDPVRVGDAMDFWSFAAGAANVIMQLSRP
FT                   GVGYGVVESKVDSGNLMKHPWKRARTTFQYLAVAIFGSDDDRAAFRAAVDEAHRHVKST
FT                   PSSPVRYNAFDRDLQMWVAACLFVGLEDTYQLLRGEMTAEQADHFYASAWTLGTTLQVT
FT                   EDQWPPTRADFDRYWDEACGQVAMDDVVRSYLLDLVDLRMINPVLGIPFRPLLKFLTAG
FT                   FLAPVFRDALGLTWGDGRQRLFERLFLCVAFVNRFIPGFLRQGGSHVLLADVRMRVRRH
FT                   RQLV"
FT   gene            complement(442151..442378)
FT                   /locus_tag="Mflv_0424"
FT   CDS_pept        complement(442151..442378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0424"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mav:MAV_0111 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42918"
FT                   /db_xref="GOA:A4T3U8"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3U8"
FT                   /protein_id="ABP42918.1"
FT                   /translation="MGMLSDLRRLLSYEMTLAEWLGTAVLLVTPHLVLGVVYAVLQPGY
FT                   ITSVDGAERVAAAVGTVVFWPVLLIAELCP"
FT   gene            442454..443674
FT                   /locus_tag="Mflv_0425"
FT   CDS_pept        442454..443674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0425"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: mva:Mvan_0246
FT                   cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42919"
FT                   /db_xref="GOA:A4T3U9"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3U9"
FT                   /protein_id="ABP42919.1"
FT                   /translation="MPADAITLGGADLADPDTYLAGMPYDAFRTLRREAPVAWHPQVDK
FT                   PGFWALTGYDEIYAVSRDSETWSSQATGVFLDVPAPEDSYQLALMMLTMDPPRHTALRA
FT                   LVSRGFTPRHVARLGARTADMARAIVDDALAHGQCEFVDEVAGALPSYVIAELLGIPLE
FT                   DGRRLYTLTDIMNTRPLHDPELVAAQMQMFEYAAELAARKRSEPGDDIATALLHAEVDG
FT                   RRLTDLEFNLFFLLLINAGGDTTRNLVAAGTLALIEHPDQWRRLAADPSLMPTAVEEML
FT                   RWTSPVTVFSRTATRDTDVGGIRLREGERVAMFYPSANRDEKHFADPDRFDIGRMPNPH
FT                   LAFGGGGTHFCLGASLARVEAAAIFRELITRTREIGLVGPVERVRSVLMNGIRSMPAQF
FT                   TPAVVPA"
FT   gene            complement(443678..444838)
FT                   /locus_tag="Mflv_0426"
FT   CDS_pept        complement(443678..444838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0426"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   mva:Mvan_0242 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42920"
FT                   /db_xref="GOA:A4T3V0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3V0"
FT                   /protein_id="ABP42920.1"
FT                   /translation="MSDLPLRSVLLLCWRDTGHPQGGGSETYLQRIGAQLAASGTEVTL
FT                   RTARYPGAARDEVVDGVHVQRRGGSYTVYVWAGLAMAAARLGLGPLRRVRPDVVVDTQN
FT                   GLPFLSRLVHGRRAVVLVHHCHREQWPVAGPVMSRIGWFVESRLAPRLYRRNQYVTVSL
FT                   PSARDLAVLGVPADHVAVVRNGVDAAPGESLTVPRSATPRVVVLSRLVPHKQIEDALDV
FT                   IAALRGRIADVHLDVLGDGWWSQKLVEYAHRLGISDAVTFHGHVDDATKHVVLQRSWVH
FT                   VLPSRKEGWGLAVVEAAQHAVPTIGYRSSGGLTDSIVDGVTGVLVDGPADLADALERLL
FT                   TDDVLREQLGAKAQVRSGEFSWKESADAMRTVLESVHAGRMTSGVL"
FT   gene            444877..445644
FT                   /locus_tag="Mflv_0427"
FT   CDS_pept        444877..445644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0427"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: mva:Mvan_0241 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42921"
FT                   /db_xref="GOA:A4T3V1"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4T3V1"
FT                   /protein_id="ABP42921.1"
FT                   /translation="MAATDLLAGRATLSRSLRLLSAFRFEQTDPDRFYGALASDTVAMV
FT                   DDLWRATTGTSTRNLTVLDVGGGPGYFASAFTDAGLHYVGVEPDPGEMHAAAPRTHSRA
FT                   GSFVRASGTALPFADGSVDICLSSNVAEHVAQPWRLGEEMLRVTRPGGLAVLSYTVWLG
FT                   PFGGHEMGLSHYLGGYRAAERYTRRHGHRPKNDYGSSLFAVSAADGLRWARSTGALAAA
FT                   FPRYHPRWAWGLTRVPGVREFLVSNLVLVLRPT"
FT   gene            445699..447177
FT                   /locus_tag="Mflv_0428"
FT   CDS_pept        445699..447177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0428"
FT                   /product="Betaine-aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: mva:Mvan_0240
FT                   betaine-aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42922"
FT                   /db_xref="GOA:A4T3V2"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3V2"
FT                   /protein_id="ABP42922.1"
FT                   /translation="MTQSTAFRTEWDKLFIGGKWVEPASSEVIEVRSPATGDVVGKVPL
FT                   ASAADVDAACAAAREAFDNGPWPQMSPTERAEVLGRAVKLMEERADELKFLLAAETGQP
FT                   PTIVDMMQYGAAMSSFQFYAGAADKFTWQDIRDGVYGQTLVVREPVGVVGAVTAWNVPF
FT                   FLAANKLGPALLAGCTVVLKPAAETPLSVFAMAEMFVEAGLPEGVLSIVPGGPETGQAL
FT                   TANPNLDKYTFTGSSGVGKEIAKIAADKLKPCTLELGGKSAAIILEDADLDSTLPMLVF
FT                   SGLMNSGQACVGQTRILAPRSRYDEVIEKLGEAVRNMAPGLPDNPAAMIGPLISEKQRD
FT                   RVEGYIKKGIEEGARVITGGGRPEGLDSGWFVEPTVFADVDNSMTIAQEEIFGPVLSVI
FT                   PYEDEDDAVRIANDSVYGLAGSVYTTDNDRALKIARRIRTGTYAVNMYAFDPCAPFGGY
FT                   KNSGIGRENGWEGIEAYCEQKSILLPFGYTPPAS"
FT   gene            complement(447264..447662)
FT                   /locus_tag="Mflv_0429"
FT   CDS_pept        complement(447264..447662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0429"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0239 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42923"
FT                   /db_xref="InterPro:IPR011944"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3U1"
FT                   /protein_id="ABP42923.1"
FT                   /translation="MSDDQRQIRDTVERWVEAIRARDLDGVLAAHTDDLVMFDVPPPYD
FT                   GIRGMDAYRDSWPPFFDFLAGGAQFELVELDVVAGETAGFAYALLRCGRPEDFEAEPDV
FT                   RLRITMGLRKVDGRWLIAHEHHSFPIKG"
FT   gene            complement(447707..449542)
FT                   /locus_tag="Mflv_0430"
FT   CDS_pept        complement(447707..449542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0430"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   mva:Mvan_0238 acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42924"
FT                   /db_xref="GOA:A4T3U2"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3U2"
FT                   /protein_id="ABP42924.1"
FT                   /translation="MGHYKSNVRDLEFNLFEVLALEKALATGDFGDLDLQSARDMLAQA
FT                   VELAEGPVAEAFSETDRRPPSFDPATHVVSIPEPFKKSFRAWYDGEWFRVGMAEEIGGV
FT                   PAPSMLEWAINELALGAQPAAFMYAAGPKMAHILHAIGNEQQRHWAGLMIERAWGATMV
FT                   LTEPDAGSDVGAGRTKAVQQPDGTWHLDGVKRFITNGDADDLFENIVHVVLARPEGAGP
FT                   GTKGLSLFIVPKFHFDPQTGDLGERNGVFVTGLEHKMGLKASATCELTFGQHGVPAVGW
FT                   LVNDTHSGIAQMFKVIEYARMMVGTKAIATLSTGYLNALAYAKTRIQGADMIQMTDKTA
FT                   PRVTIMHHPDVRRALMTQKAYAEGLRALYLYTAAHQDTTVADIVSGADAAMAGRVNDLL
FT                   LPIVKGVGSERAYQCLTESLQTFGGSGFLQDYPVEQYIRDAKIDSLYEGTTAIQAQDFF
FT                   FRKIARDQGGALLHVVSHMRRFLDDAAARPELATERALLATAVGDVQEMVAAMTKFLVD
FT                   SQENPRELYRLGLESVPFLLSVGDLLLAWLLLQQAEIALNALDGTVSERDRAFYTGKVA
FT                   TGKFFARNVLPRLSAQRAILQAVDLTAMDLPEAAF"
FT   gene            complement(449611..450132)
FT                   /locus_tag="Mflv_0431"
FT   CDS_pept        complement(449611..450132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0431"
FT                   /product="bifunctional deaminase-reductase-like protein"
FT                   /note="KEGG: mva:Mvan_0237 bifunctional
FT                   deaminase-reductase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42925"
FT                   /db_xref="GOA:A4T3U3"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3U3"
FT                   /protein_id="ABP42925.1"
FT                   /translation="MSTIYYTASSLDGYIVDDHGSLDWLTSRAIDADGPFGIEPFMADI
FT                   GSLVMGADTYEWILRNHPGEWMYTQPSWVVTHRPDIVAADHPVRTFAGDVVDLHPTLLD
FT                   AAAGRNVWVVGGGDLARQFAAAGLIDEMIVSYAPCTLGAGSPVLPMRSEWTLQTCAANA
FT                   DFVCAHWRRV"
FT   gene            complement(450133..451056)
FT                   /locus_tag="Mflv_0432"
FT   CDS_pept        complement(450133..451056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0432"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="SMART: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: mva:Mvan_0236 helix-turn-helix-domain
FT                   containing protein, AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42926"
FT                   /db_xref="GOA:A4T3U4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3U4"
FT                   /protein_id="ABP42926.1"
FT                   /translation="MNDPARRDRLRELLDAVTDAGNSGVGDMARSTYASEFHFSREVRR
FT                   LTGEAPAALRRRVMLERAAWRLQHGEPVSAVAADEGWSSPEVFSRAFRRTYGVPPSQAV
FT                   DVHFRLPSPNGLHFHPPQSLWLDSDRSDDPGVPDIAALMIAHDIDDTAYLLTRAAELTR
FT                   AQWTAEVAPGQTVLEWDGPEPSVGAVLGALVWNKEVWLATIAGEDFPSRAATQPDLVDA
FT                   RTLAAHHDDIAKRWRAMISEYAAAGRLGDTVIDALCDPPESFQLYGIVAHVLTYSAHRR
FT                   ELVRAMLAGHGVPTGLGDPLDWMRGR"
FT   gene            complement(451116..451943)
FT                   /locus_tag="Mflv_0433"
FT   CDS_pept        complement(451116..451943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0433"
FT                   /product="Arylamine N-acetyltransferase"
FT                   /EC_number="2.3.1.5"
FT                   /note="PFAM: N-acetyltransferase; KEGG: mva:Mvan_0235
FT                   arylamine N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42927"
FT                   /db_xref="GOA:A4T3U5"
FT                   /db_xref="InterPro:IPR001447"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3U5"
FT                   /protein_id="ABP42927.1"
FT                   /translation="MSRLSDAYLSRIGFSGPAAATVDTLRRIVAAHNAAIPFENLDPLM
FT                   GVPVVDLSAEALSDKLIGRRRGGYCYEHNGLLGYVLEDLGYAVERLVGRVVWMHEGDAL
FT                   PAQTHQVLAVTLPDGYGPWLVDVGFGGQTLTSPIRLQTGVVAQTRHEPYRLLDHADGMQ
FT                   LQALIRDVWQPLYLLDPAPRPRIDLEVGSWYVSTFPRSGFVTGLTAALVTDDARWNLRG
FT                   RHLAVHRAGGTEKTRLDTAAEVMELLATRFGIDLDDLGNRADVASRITAVLDT"
FT   gene            452291..453100
FT                   /locus_tag="Mflv_0434"
FT   CDS_pept        452291..453100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0434"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   mva:Mvan_0233 phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42928"
FT                   /db_xref="GOA:A4T3U6"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR016676"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3U6"
FT                   /protein_id="ABP42928.1"
FT                   /translation="MGASDKIPSEITKWDPALTERVMGLLKPFLKGWHRAEVRGLDDFP
FT                   AGGALVVSNHSGGLFPMDVPVFASGFYDKFGFDRPVYTLSHDMLMVGPTGAFFKKTGFI
FT                   PANHKNADEALRSGGVVVVFPGGDYDVYRPSLAANKIDFGGRTGYVRAALNAGVPIVPT
FT                   VGIGGQESQLFLARGTDLAKALGPIAKLARTKIIPVSFGFPFGLSVVLPLNVPLPAKIT
FT                   MKALPPIDIVEEFGEDPDIDEVDAHVRRVMQRALDELAQERKLPILG"
FT   gene            453104..454738
FT                   /locus_tag="Mflv_0435"
FT   CDS_pept        453104..454738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0435"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mva:Mvan_0232 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42929"
FT                   /db_xref="GOA:A4T3U7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3U7"
FT                   /protein_id="ABP42929.1"
FT                   /translation="MGITDPVTNALGLISTMMRAGVIAPMRPDKYMRIVGAMQRENMAI
FT                   TSGFAAAAQRCPDRAGLVDELGILTWRQIDQRADALAAALQALPEGQPEVIGLMARNHR
FT                   GFVDSLIAANRIGADVLLLNTSFAGPALAEVLQREGEGRAVAVIYDEEFTETVDRAVAD
FT                   RPETTRILAWTDSDTDALTVEGLIAEHGGQEPVRSVEKARVILLTSGTTGTPKGAKHSG
FT                   GDPGVLKSILDRTPWRAEQPVVIVAPMFHAWGFSQLAFAASMSCTIITRRKFDPEATLE
FT                   LVDKFRATGLCVVPVMFDRIMELPEEVLDKYSGRSLRFAAASGSRMRPDIVIKFMDRFG
FT                   DVIYNNYNATEAGMIATATPRDLRAAPDTAGRPAEGTEIKILDSEFNEVPTGETGGIWV
FT                   RNSTQFDGYTSGSTKDFHDGFMSSGDVGYLDEEGRLFVVGRDDEMIVSGGENVYPIEVE
FT                   KTLTSHPDVAEATVLGVDDEKFGQRLAAFVVLNPGAAATPEALKQHVRDNLANYKVPRE
FT                   ITVLDELPRSITGKISRKDLKDRLDNA"
FT   gene            454731..455999
FT                   /locus_tag="Mflv_0436"
FT   CDS_pept        454731..455999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0436"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: mva:Mvan_0231 alpha/beta hydrolase fold-3 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42930"
FT                   /db_xref="GOA:A4T3T6"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3T6"
FT                   /protein_id="ABP42930.1"
FT                   /translation="MPKPRPLLRAAAELLNAANGVQPLARDGYPTIPVFAFGWPTSELS
FT                   PLYMAGSMADAVRRGIRGDFRGPRGRIALGLTAVAWALLYLIHRRNVASQPHFEEPLRD
FT                   VLGDDYQEIAEKAKSSRRRYFGVFPNEVIRRRYVEKAGTVQYGPLRVNRADIWRRPDLP
FT                   RDGKAPVLLQVPGGAWAIGMRKPQSYPLMSHLADHGWICVSIDYRVSPRNTWPDHIVDV
FT                   KRALAWIKEHIAEYGGDPDFVAITGGSAGGHLSSLAALTADDPQFQPGFEDADTSVVAA
FT                   VPVYGRYDWVSAQGSGRREFLAFLQKFVVKKPVTRNRQVYVDASPTHRLRADAPPFFIL
FT                   HGQDDSIIPVPEGREFAEALKEVSTSPVVYAEIPYAQHAFDFYYGSPRAHYTAQAIETF
FT                   LSWVMATRRSESADRPTSPVRAS"
FT   gene            complement(456000..456530)
FT                   /locus_tag="Mflv_0437"
FT   CDS_pept        complement(456000..456530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0437"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mva:Mvan_0230
FT                   putative transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42931"
FT                   /db_xref="GOA:A4T3T7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3T7"
FT                   /protein_id="ABP42931.1"
FT                   /translation="MAANSGDDVGARILDAALELLRARGPKAVTMQAVVDATGIAKTTI
FT                   YRRHPNRRTLLAAALETLGERPSVPADATRHERLNWVITQSVDVIAHGIGAGGFAALLT
FT                   DDDPEFSDAFRAILGAYRRHAIDALDVDVATGETVIDLIVGGYVAELARTGSVDDGWNA
FT                   RMADAVERVLPSR"
FT   gene            456629..456937
FT                   /locus_tag="Mflv_0438"
FT   CDS_pept        456629..456937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0438"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0229 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42932"
FT                   /db_xref="GOA:A4T3T8"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3T8"
FT                   /protein_id="ABP42932.1"
FT                   /translation="MRSKSFNKAPLPIFGYLLTLVGFVFLGSFTAALALGSTLAGFFGI
FT                   AMVASYALAVLCFVLRSRQMAAADPDADIVLGFDPIRGDTDRSAAERYLARYRSNAA"
FT   sig_peptide     456629..456739
FT                   /locus_tag="Mflv_0438"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.999) with cleavage site probability 0.358 at
FT                   residue 37"
FT   gene            complement(457006..458424)
FT                   /locus_tag="Mflv_0439"
FT   CDS_pept        complement(457006..458424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0439"
FT                   /product="Diacylglycerol O-acyltransferase"
FT                   /EC_number="2.3.1.20"
FT                   /note="PFAM: protein of unknown function UPF0089; KEGG:
FT                   mva:Mvan_0228 protein of unknown function UPF0089"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42933"
FT                   /db_xref="GOA:A4T3T9"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="InterPro:IPR014292"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3T9"
FT                   /protein_id="ABP42933.1"
FT                   /translation="MKRLRGWDAVLLYSETPSVHMHTLKLAVIELDDLGGAKFGVEELR
FT                   KVIHGRLYKLDPFRYELVDIPFKFHHPMWRENAEVDLDYHVRSVRVDAPGGRRELDEAV
FT                   GRIASTPLDRSRPLWEMYLIEGLADGRIAVLGKIHHALADGVASANLLARGMDLQDGPQ
FT                   VDRDSYATDPAPSKGELVRTAFTDHLRQIRRFPDVVRYTAAGMRRVRSSGQKLSPELTR
FT                   PFTPPPSFMNHQIDATRKFATATLALDDVKQTGKHLGATINDMVLAMSAGTLRKLLLRY
FT                   DGQADHPLLASVPVSFDFSRDRISGNYFTGVLVSIPVELDDPVERVRAAHDAAVAGKES
FT                   NNLLGPELVSQWSAYLPPAPAEALFRWLGTKDGQNKVMNLPISNVPGPRERARVGGALV
FT                   TEIYSVGPLTVGSGINITVWSYVDQLNISVLTDGKTLEDPHELTSAMLDDFVEIRRAAG
FT                   LSEELTVVETALPN"
FT   gene            complement(458516..459745)
FT                   /locus_tag="Mflv_0440"
FT   CDS_pept        complement(458516..459745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0440"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: mva:Mvan_0227 alpha/beta hydrolase fold-3 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42934"
FT                   /db_xref="GOA:A4T3U0"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3U0"
FT                   /protein_id="ABP42934.1"
FT                   /translation="MTERPDTRYPGPTLTTRLEWLLNAGPSDYMLALSVASASLPVIGK
FT                   HLEPLGALTAAGVWGARHAPDFVGALAKSLVAPNDVGKKEKQQQERDSTNAITQAALRG
FT                   LVSQKDLEIEWPAAERTPPVWKMREHRRHVHRTSVRYGPRPTQLLDVWRRDDVPADAPV
FT                   MIFVPGGAWVHGGRMLQGYALMHHLAEMGWVCLSVEYRVAPHNPWPAHINDVKTAIAWA
FT                   RANVDKFGGNRDFVAIAGTSAGGHLAALAGLTANDPEMQGELPEGSDTSVDAVVGIYGR
FT                   YDWEDKSTVERVRFMDFLERVVVKRKFDKHPDVFRKASPMARIHSEAPPFLVIHGTGDS
FT                   VIPVAQAQSFVERLRNVSRSVVGYVELPGAGHGFDMTDGARTGAAATAIGLFLNHIHRN
FT                   RSLVGAKEVI"
FT   gene            459941..462130
FT                   /locus_tag="Mflv_0441"
FT   CDS_pept        459941..462130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0441"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   mva:Mvan_0226 acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42935"
FT                   /db_xref="GOA:A4T3T1"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3T1"
FT                   /protein_id="ABP42935.1"
FT                   /translation="MSKTASASKLAITDDHQDLAAAVTGQLDRLKALVLARATLDAADT
FT                   DGASNPSDLWSAATGLGWTGLALAEDVGGSGFGLAELAVVVECLGHQLAPGPFLTSVSA
FT                   AVVIDRCAPDSVRAELLPGSASGDTVAALGISGTVAVGADNTATGECATVLGAPDASLL
FT                   VLVAGDDVVIVDAGDDGVTVTRLDCLDTTRSIGSVTLDGVAVPADRILRGAARDARTVF
FT                   RTLTAAEAVGVSWAALDMAVEYAKVREQFGRTIGTFQAVKHHAANMLVSAETATAAVWD
FT                   AARADDVDSAWFAAAVAAALAIKAQVFNAQNNIQLHGGIGFTWEHDAHLYLRRARTLAA
FT                   LMADGVDPLIDIVDGQRTGRAHGASFTLPPEADEYRTQAREAAEAVRRLPAEQQRDYLV
FT                   DSGYLVPHWPKPWGRAADVLEQLVIEEEFAAIERADMGITGWVALTIAQAGTDEQRERW
FT                   VEPVLRGQVMWCQLFSEPGAGSDAAAVRTSAKKVDGGWRVTGQKVWTSLAHMCQWGLAT
FT                   VRTDPDAAKHAGVTMMAIDMNADGVTVNPLRGLTGDSHFNEVFFDDVFVPDADVVGDVN
FT                   KGWLVARATLGNERVSIGGGSGGVTGTTPDHLIKLLDSSPDRAPMFVRQAGEVIAEIHS
FT                   LRLLNLRRATRAISGAEPGPEGNVTKLVVAESGQHLTELAFELAGTAAVVEQMPQLTRS
FT                   YLGNRAMTIAGGTSEITRNTIAERILGLPRDPLLR"
FT   gene            462164..463069
FT                   /locus_tag="Mflv_0442"
FT   CDS_pept        462164..463069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0442"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: mva:Mvan_0225 alpha/beta hydrolase fold-3 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42936"
FT                   /db_xref="GOA:A4T3T2"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3T2"
FT                   /protein_id="ABP42936.1"
FT                   /translation="MHGVDFHPELRRAARMLPRQVVTPVTLPLLRRASRLMWRRAPAPD
FT                   VEVLTLESGVGVRLFRPAGATRPGPALLWIHGGGYILGDAAQDDVLCRRFAHELGATVA
FT                   SVDYRLAPEFPYPAPVEDCYSALKWLSALPAVDPSRVAIGGASAGGGIAAALAFLARDR
FT                   GEIPLAAQLLVYPMIDDRTVLRTGLDNPGHRLWNQAANRFGWQAYLGDADRDVAVPARR
FT                   DDLAGLPPAWIGVGTLDLFHDEDLAYAERLRAAGVPCEVEVVKGAFHGFDGIAPKAEVS
FT                   QSFFRSQCALLRGAFEPAAA"
FT   gene            complement(463066..464340)
FT                   /locus_tag="Mflv_0443"
FT   CDS_pept        complement(463066..464340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0443"
FT                   /product="Amidohydrolase 3"
FT                   /note="PFAM: Amidohydrolase 3; KEGG: mva:Mvan_0224
FT                   amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42937"
FT                   /db_xref="GOA:A4T3T3"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3T3"
FT                   /protein_id="ABP42937.1"
FT                   /translation="MLIRNAVLIDGTRTDIRVGDTVTEVADDVTAAPGEDEFDAAGGTV
FT                   LPGLNDHHLHLRAAAAALRSLRVGPDEVRDRAALAGVLAAAVPDQNGWIRAVGYHDSVA
FT                   GPLTRDLLDAIAPEVPVRIQHRSGVQWTLNTAGLALVGKHDHPDGVLRSADPSWTLPAT
FT                   EPDLEGLGATLSRYGITGVTDATPDLGAGDITELQRRMPQTVRALAPGKRILHDDELDL
FT                   DALTSWIRHTHSVGVPVALHCVTAAQLVVTLTALRSAGRHPLDRIEHAAVVPDGSVADL
FT                   ADSGVTVVTQPNFVAERGDQYLVDVPEHEHHELWRVGSLLEAGVPVALSTDAPFGHSDP
FT                   WAAMRAAVHRRTPSGTVLGPNERITEATALAMFTGNRAGHPGAVVPGAPGDLCILATPP
FT                   PQALAELDAAAVAATVIAGRVVYER"
FT   gene            complement(464334..465428)
FT                   /locus_tag="Mflv_0444"
FT   CDS_pept        complement(464334..465428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0444"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0223 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42938"
FT                   /db_xref="GOA:A4T3T4"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3T4"
FT                   /protein_id="ABP42938.1"
FT                   /translation="MSPVRVPVAVLARAQAALGDLRADAEVLIGGRAALLGLAPDGRIS
FT                   AGGATRLLAGPDGWCALTLSRPDDVDAVPALLGADDLPDDMWSAIGRVIAETGVWVFAE
FT                   RARLLGLPVGVLGEATEAPTALCRNGERKAFGDLNGLLVADLSSMWAGPLCGRLLSDAG
FT                   ATVVKVETRTRPDGTRQGSAAFFDWMNSGKLAYAADLEDPGLRRLLGAADVVIESSRPA
FT                   ALQRRGLGPTDVAGPAGRVWVRITGHGTDGARADWVAFGDDAAVSGGLVSGSPADPRFC
FT                   GDAIADPLTGIRAAAEVLASRRRGGGELIELSMAGVAAEYAQLPRGDEKPCVATPVAAP
FT                   RGPALGADNAAVDRLVADRATLPC"
FT   gene            complement(465470..466498)
FT                   /locus_tag="Mflv_0445"
FT   CDS_pept        complement(465470..466498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0445"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0222 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42939"
FT                   /db_xref="InterPro:IPR016790"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3T5"
FT                   /protein_id="ABP42939.1"
FT                   /translation="MPAVTLYGQIPGGPFFDDLSVGQVFDAAPSMTLTPGVAATHQAIL
FT                   GDRLRLPLDADLSSAVTGSTAALAHPALVCDVAIGQSTLVTQRVKANLFYRGLTFHRYP
FT                   VLGDTIYTRTEVVGLKQNSAKPGRAATGLAALRMTTIDGIGRLVLDFYRCAMLPLSSDD
FT                   VQTGHDDDLSTVGAGGSDAASGTRLVDPTRDWDDAAFRDRVPGPHFDPALAGTVLRSTA
FT                   DVVSSAPELARLSLNIAATHHDSRVAGKRLVYGGHTIGLALAQASRLLPNLVTVLGWES
FT                   CDHTGPVHEGDTLYSELRVESVQPRPDGRGGTVALRSTVFAASDETEDRPVLDWRFTGL
FT                   LF"
FT   gene            466553..467710
FT                   /locus_tag="Mflv_0446"
FT   CDS_pept        466553..467710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0446"
FT                   /product="Butyryl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.1"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   mva:Mvan_0221 butyryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42940"
FT                   /db_xref="GOA:A4T3S6"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3S6"
FT                   /protein_id="ABP42940.1"
FT                   /translation="MVDGLSSEEAMLVQTVRAFIDRDVKPTVRDVEHANTYPEAWIDQM
FT                   KQIGIYGLAVPESYGGTPVSTRCYVLVTQELARGWMSLAGAMGGHTVVAKLLTLFGTEE
FT                   QKQRYLPAMATGEIRATMALTEPGGGSDLQAMGTVARRDGDDLVLSGTKTWISNARRSG
FT                   LIALLCKTDPDATPKHSGISVVLVDNPTPGLTVSRDLPKLGYKGVESCELAFDACRVPA
FT                   SAILGGTPGKGFSQMMKGLETGRIQVASRALGVASAALEDALAYAQDRESFGRPIWKHQ
FT                   AVGHYLADMATKLTAARQLTLYAADRYDSGERADMEAGMAKLFASEVAMEIALNAVRIH
FT                   GGYGYSTEYDVERYFRDAPLMIVGEGTNEIQRNVIAGQLVARGGI"
FT   gene            467710..468432
FT                   /locus_tag="Mflv_0447"
FT   CDS_pept        467710..468432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0447"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; UbiC
FT                   transcription regulator-associated domain protein; KEGG:
FT                   mva:Mvan_0220 regulatory protein GntR, HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42941"
FT                   /db_xref="GOA:A4T3S7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3S7"
FT                   /protein_id="ABP42941.1"
FT                   /translation="MPPAYQVLRERLRDEIAAGCYPDGTRLPTESELVARLGLSRQTVR
FT                   RAFQDLVAEGAVYRVPGRGSYAGDRGRRYLRQLGSIEDLLSLSEDTTMEVLDGLRRRVD
FT                   IDAASRLRLDGDVVYTVVFRRLHDGIAFGHTMVHLPPAVAAPVLASPHLMTGAVSTHTV
FT                   IGLLEPHLERPIDEAAQSITVVSADEAAAAAVHCAPGHPMLRVDRLYADDEGRPVELAV
FT                   SQFLPEQYTYRVTLRRSG"
FT   gene            complement(468534..469421)
FT                   /locus_tag="Mflv_0448"
FT   CDS_pept        complement(468534..469421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0448"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   mva:Mvan_0219 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42942"
FT                   /db_xref="GOA:A4T3S8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3S8"
FT                   /protein_id="ABP42942.1"
FT                   /translation="MNTLVELAGGIVVGVGTPSDAATFTLTDEDTDDRRAVRVASVDEA
FT                   LAELTERCLRWPQAAAVCDDVLRAFDPQGCTFTGVITESLAYSTLQAGAEFARWLDARG
FT                   PARVPEIADPVVAERVDDVLTIRFNRPQRHNAFSTDARAALLDALEVARLDPSVTGMVL
FT                   TGNGPSFCSGGDLAEFGTFTDPASAHLARTRYSPALVLAEITARLGDKCRAEIHGQVQG
FT                   SGLEMAAFCGTVSCDAGAVLGLPELALGLIPGAGGTVSITRRIGRWRTAYLVLSGRSID
FT                   AATALRWGLVDAVG"
FT   gene            complement(469418..470968)
FT                   /locus_tag="Mflv_0449"
FT   CDS_pept        complement(469418..470968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0449"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mva:Mvan_0218 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42943"
FT                   /db_xref="GOA:A4T3S9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3S9"
FT                   /protein_id="ABP42943.1"
FT                   /translation="MQIRDTAVATPDKPAVIMYPAGTVVTFGELEARANRLAHLFRDAG
FT                   LVEGDAVALLMENNEHFHAVMWAARRAGLYYVPINTHLTAAEVAYIVDNSGAKAIVGSA
FT                   KLADTLAGLEAELPNGLPQLLLVAGAELSATSASGGDVDGWQRYPECVADKLETPIADE
FT                   IDGDLLQYSSGTTGRPKGIKRELPHLPPAEVPGMMAMLVEFWMHPDAVYLSPAPLYHTA
FT                   PSVWSMQVQAGGITTVVMEKFDAEGALDAIQKYKVTHGQFVPVMFARMLKLPEDVRKSY
FT                   DVSSLQRVMHAAAPCPVEIKKQMIDWWGPIVDEYYASSEAHGSTLITADQWLERPGSVG
FT                   KPLTGVVHIVGEDGNELPAGQAGEIYFEGGYDFEYLNDPDKTASSRHPQGWKTVGDIGY
FT                   VDEEGFLFLTDRRHHMIISGGVNIYPQEAENLLVTHPKVMDAAVFGIPDEEMGQRVKAV
FT                   VQLVDQADATEEFADELIGWLRDRLAHYKCPRSLSFEEQLPRTDTGKLYKQELIKKYS"
FT   gene            471327..472391
FT                   /locus_tag="Mflv_0450"
FT   CDS_pept        471327..472391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0450"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase, IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: mpa:MAP3286
FT                   IS1547_2 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42944"
FT                   /db_xref="GOA:A4T3T0"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3T0"
FT                   /protein_id="ABP42944.1"
FT                   /translation="MVIVGTDVHKRTHTFVAVDEVGRKLGEKVVPATTAGHRTAVAWAR
FT                   EQFGDELLWGIEDCRNLSARLEIDLLGMAQSAVRVAPKLMSQSRACARTRGKSDPIDAL
FT                   AVAHAVLRHPDLPVAAHDEVSRELKLLTDRREDLVAQRTSTINRLRQRVHELDPAAEPN
FT                   PGSLHRPTPCATLAAWLNTQTGILSELARDELADIVRLSEAINAVAARIGERVREVAPT
FT                   LLALPGCGELTAAKILGETATVSRFRSEAAFARHTGTAPIPVWSGNTAGRVRLSRSGNR
FT                   QLNAALHRIAITQIRLTDSAGQRYYRKRLAEGKATKEALRCLKRQLARIVYRHLHTDEN
FT                   TRKTKPHNNAQTAA"
FT   gene            complement(472426..474255)
FT                   /locus_tag="Mflv_0451"
FT   CDS_pept        complement(472426..474255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0451"
FT                   /product="Phosphoenolpyruvate carboxykinase (GTP)"
FT                   /EC_number="4.1.1.32"
FT                   /note="PFAM: phosphoenolpyruvate carboxykinase (GTP); KEGG:
FT                   mva:Mvan_0201 phosphoenolpyruvate carboxykinase (GTP)"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42945"
FT                   /db_xref="GOA:A4T3S1"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4T3S1"
FT                   /protein_id="ABP42945.1"
FT                   /translation="MTAATIPGLDSAPTKHEGLLAWVREVAELTQPDRVAWADGSEEEY
FT                   ERLCAHLVEAGTFQKLNPDKQPNSYLALSDPSDVARVESRTYICSEREIDAGPTNNWMD
FT                   PAEMRGIMTDLYRGSMRGRTLWVVPFCMGPLNAEDPKLGVELTDSEYVVVSMRTMTRMG
FT                   AAALEKIGDDGFFVKALHSIGAPLEPGQADVPWPCNDTKYITHFPETREIWSYGSGYGG
FT                   NALLGKKCYSLRIASAMAHDEGWLAEHMLILKLISPENKAYYIAAAFPSACGKTNLAML
FT                   QPTIPGWRAETVGDDIAWMRFGKDGRLYATNPEFGFFGVAPGTNWDSNPNAMKTIAAGN
FT                   TVFTNVAKTDDGDVWWEGLEGEPDHLIDWKGNDWVLRETETKAAHPNSRYCTPISQCPT
FT                   LAPEWDDPQGVPISAILFGGRRKTTVPLITEARDWQHGVFIGATLGSEQTAAAEGKVGT
FT                   VRRDPMAMLPFLGYNVGDYFQHWINIGKQADESQLPKVFFVNWFRRGDDGRFLWPGFGE
FT                   NSRVLKWAVERIEHKADGKSTPIGIVPTAADLDLSGLDVNAADVDEALDVKVDEWRAEL
FT                   PLIEEWFEFVGEKLPTGIKDEFDALKTRLAEES"
FT   gene            complement(474417..475643)
FT                   /locus_tag="Mflv_0452"
FT   CDS_pept        complement(474417..475643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0452"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0200 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42946"
FT                   /db_xref="GOA:A4T3S2"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3S2"
FT                   /protein_id="ABP42946.1"
FT                   /translation="MTGPPRAGVSTVAAGLRQRMPAVRVLDGAEAGTTPVAVVFVVSAV
FT                   APLTESDCVLADAAAVDAEVVVAVVSKIDDHRGWREVLEAGRAVADRSSGRLAGVPWLG
FT                   VAAAPRLGEPRLDDLVDVLGRALADPSQRARNSLRAKQFRVSRLQDERDGLVALRRRTR
FT                   LDAAGRLSRDLRQLRVTLSHDVRRRCAGLRADLLHRAGAVGRRDVAGFPQHAWERCTEV
FT                   LTGIEQDITEVTGADVGCGDVPVNLPPDPPPHPPPRSWRLERQLTAVLGAGFGLGVAMV
FT                   VTRLVAGLAPGLTAAGLAVGGVLGFLTTAWVVRARALLHDRAVLQAWAADAVAAVRAAA
FT                   DERVGTGTLAVEAGRAGAGARSDEDAALGRRIASLDAEIQRLSQRSPDGPVLPVGRPAG
FT                   GGHLNRSCE"
FT   gene            complement(475664..476632)
FT                   /locus_tag="Mflv_0453"
FT   CDS_pept        complement(475664..476632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0453"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0199 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42947"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3S3"
FT                   /protein_id="ABP42947.1"
FT                   /translation="MPIFTEVLAQFVADRPALAAVDARLRAPLSVTVQGRAGVGCRTVA
FT                   GALAAAGVRIARSSTAADVHVVAVAETLKPEDRHLVRADGPAVVVLTKADLAGRVHGGP
FT                   LAHAERTATELTASTGVPVVPMVALLAGVEIDDDLFEALRTLTTAPADMTSVDAFVAGD
FT                   HAVPASVRRALVARLDRFGIAHAVLAVADGASRAEVASSLHALSGADQVLDVLAGTAAE
FT                   VGYRRVRSALDELTRLAVETGDDGLWSFLTGDALVIAAMAAAVDLMQAAGLRVDPRDDA
FT                   DAHLGRALRWRRYAHTPMNALHQQCAADIARGSLRLLGRSR"
FT   gene            476823..477614
FT                   /locus_tag="Mflv_0454"
FT   CDS_pept        476823..477614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0454"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="KEGG: mva:Mvan_0198 tRNA
FT                   (guanine-N(7)-)-methyltransferase; TIGRFAM: tRNA
FT                   (guanine-N(7)-)-methyltransferase; PFAM: putative
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42948"
FT                   /db_xref="GOA:A4T3S4"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4T3S4"
FT                   /protein_id="ABP42948.1"
FT                   /translation="MSDHGRMHSTGSEVAAPVAPDPDTEGVHPHFNRRVTSFRARRSTI
FT                   SDGQQATWDRLWPQLGRQARDGDEPPGPLDTDAWFGRHAPVVLEIGCGTGTSTLAMAQA
FT                   EPGIDVVAVEVYRRGLAQLLSAIDRTAATEHPVSNIRLIRGDGVDVLTHMFGSASLTGV
FT                   RVFFPDPWPKARHHKRRLLQPDTMALIADRLRPGGVLHAATDHQGYAAHIAEVGDAEPR
FT                   LRRVAMDSADLPMSVTRPVTKYERKALAGPVVTELLWERTP"
FT   gene            477611..478324
FT                   /locus_tag="Mflv_0455"
FT   CDS_pept        477611..478324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0455"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0197 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42949"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3S5"
FT                   /protein_id="ABP42949.1"
FT                   /translation="MSMTENMPASTDEAPVTPADLGADTALAARVLLVWDAPNLDMGLG
FT                   SILGGRPTAAHRPRFDALGRWLLSRTADLSTEYARTGRTVALEPEATVFTNIAPGSADV
FT                   VRPWVEALRNVGFAVFAKPKIDEDSDVDSDMLAHIALRNEQGLAGLIVASADGQAFKQP
FT                   LEDIARSGVEVQVLGFREHASWALASDTLEFVDLEDIPGVFRESLPRIGLDSLPEQGAW
FT                   LQPFRPLSSLLTSRV"
FT   gene            478385..481717
FT                   /locus_tag="Mflv_0456"
FT   CDS_pept        478385..481717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0456"
FT                   /product="drug exporters of the RND superfamily-like
FT                   protein"
FT                   /note="KEGG: mkm:Mkms_0180 drug exporters of the RND
FT                   superfamily-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42950"
FT                   /db_xref="GOA:A4T3R6"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="InterPro:IPR025241"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3R6"
FT                   /protein_id="ABP42950.1"
FT                   /translation="MFAWWGRTVYQYRYIVIGVMVALCLGGGVYGMSLGQHVTQSGFYD
FT                   EGSQSVHASLVSDEAYGRDRTSHVVAILTPPDGEKVDNPEWMEKVTGELNDLVAENEDR
FT                   IVSWVGWLRAPDAAAETVQQMKTEDLSKTFVSIPLKGENDDEILKNYQAIEPQLSQVND
FT                   GGIQLAGLQPLASELTGTIGEDQKRAEVAAIPLVCVVLFFVFGGVIAAALPGIIGGLTI
FT                   AGALGIMRVFAEFMPVHFFAQPVVTLMGLGIAIDYGLFMVSRFREEIAEGYDTEAAVRR
FT                   AVMTSGRTVMFSAVILVASSVPLLLFPQGFLKSITYAIIASVMLAAILSVTVLPAALAI
FT                   LGPRVDALGVRWLLKFVNNEVSSDPSNTRTNQFAIASIPAGLLLPPVGIFLGHRARKQI
FT                   RQTGEQGLPLTMIGLALGYVGLLGWIAYLAIANRESLGDGLYWVLIGVVIFVAVVAGGL
FT                   ALARYVPLARGPIVWWVEWLAEKTQKTKTRAEVEKGFWGKLVNVVMKRPIAFAAPILIG
FT                   MILLILPLGQLALGGISEKYLPPDNGVRTAQEDFDRTFPGFRTEPLTLVIERQDGEPVT
FT                   DQQLAEVRAKAMTVPGFIDPDNDPSKMWQERAAQDTGTKDPSIRVLQNGLVDRNDASQK
FT                   IDELRSIQPPRGVDISVGGTPALEQDSIHSLFDKLPLMGLVLIVTTTILMFLAFGSIVL
FT                   PIKAALMSALTLGSTMGILTWMFVDGHGSGLMNYTPQPLMAPMIGLIIAVIWGLSTDYE
FT                   VFLVSRMVEARERGLSTAEAIRIGTATTGRLITGAALVLAVVAGAFVFSDLVMMKYLAF
FT                   GLLIALLLDATIIRMFLVPAIMKLLGDDCWWAPRWMKRIQEKLGLGETELPDERKRPAV
FT                   REEREAPAEALVGAGGPPVMAPPRALPPHDPTHPAPGRPAPVRPPAVTTRMGTPTYPDP
FT                   AAAGTTRIPTAPPRPPVTPPPPAQDEPQTTRLSIAKNAVRNAVSGAAAAAQRAMPSSSP
FT                   TPPSPTPPSPTPPPSGSPARDEREIESWLGDLRGGGTTGPAGAPQPMRPSAEPTRAMPD
FT                   SGEDAASDDEPDDTATRAIPAQRKPDAEAATEKLNTRPDPDAPRRGGSGVSAQDLLRRE
FT                   GRL"
FT   gene            complement(481802..482953)
FT                   /locus_tag="Mflv_0457"
FT   CDS_pept        complement(481802..482953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0457"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   mva:Mvan_0195 protein of unknown function UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42951"
FT                   /db_xref="GOA:A4T3R7"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3R7"
FT                   /protein_id="ABP42951.1"
FT                   /translation="MSARPPFDSIADDSVTPLVRMAAAWSWRLLVIFAAIVTLLWLVLR
FT                   LEILVVPVALATIIAALLLPVVDFLDRRGAPRGGAVALVLLTGFALFGGLLAFVVTQFV
FT                   EGAPDLVGQVSTSIEGVGKWLTDGPLQVSDQQINQARDTAIEALQSNQEKLTSGALSTA
FT                   GTLTEIVTGALLVFFTLIFLLHGGRNIFSFVTRIFPSHVRGRVHDAGRAGFRSLIGYVR
FT                   ATFLVAAVDAIGIGVGLAIMGVPLALPLASLVFMGAFVPLVGAVVTGFLAVIVALIAKG
FT                   WIYALITLGLIIAVQQLEGHVLQPLVMGRAVAIHPLAIVLAIAGGAVLAGIVGALLAVP
FT                   VLAFLNSAIRVLTADDPVAEEQAMEEQDEGLVNAEPDDVEARE"
FT   gene            483031..484134
FT                   /locus_tag="Mflv_0458"
FT   CDS_pept        483031..484134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0458"
FT                   /product="conserved hypothetical protein 374"
FT                   /note="PFAM: conserved hypothetical protein 374; KEGG:
FT                   mva:Mvan_0194 conserved hypothetical protein 374"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42952"
FT                   /db_xref="GOA:A4T3R8"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3R8"
FT                   /protein_id="ABP42952.1"
FT                   /translation="MSHDVPASDTLPGSAGAARGRGKYWWLRWVVIAVAVIVLAVEIAL
FT                   VRDQLAKAWKSLLSANWVWLIAAVVAAMASMHSFAQIQRTLLRSAGVRVHQWRSEAAFY
FT                   AGNALSTTLPGGPVLSATFLYRQQRLWGATPLVASWQLVMSGVLQVIGLALLGLGGAFL
FT                   LGASKNPLSLIFSVGGFVALILLAQAVATRPELIDGIGARVLTWFNSVRGKDADTGLAK
FT                   WREILSQLEAVQLGRRDLGAAFGWSLFNWVADVACLLFACYATGWHPSIAGVTVAYAAA
FT                   RAVGSIPLMPGGLLVVEAVLVPGLVSSGMSLAAAISAMLIYRLISWIFISAIGWVVFFF
FT                   MFRTEQQIDPDAPPPGNGAEPAPRTDD"
FT   gene            484144..484533
FT                   /locus_tag="Mflv_0459"
FT   CDS_pept        484144..484533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0459"
FT                   /product="putative conserved transmembrane protein"
FT                   /note="KEGG: mva:Mvan_0193 putative conserved transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42953"
FT                   /db_xref="GOA:A4T3R9"
FT                   /db_xref="InterPro:IPR021414"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3R9"
FT                   /protein_id="ABP42953.1"
FT                   /translation="MTTEPSSPGSALKALAADLVCVVVFCTIGRRSHAEGLSLAGIAET
FT                   AWPFLTGTAAGWVLARAWQRPAALLPTGLIVWVATIVVGMLLRKVTGQGTATSFIVVAS
FT                   LTTAVLLLGWRGVALAVSRRSARTS"
FT   gene            complement(484539..485882)
FT                   /locus_tag="Mflv_0460"
FT   CDS_pept        complement(484539..485882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0460"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein;
FT                   histidine kinase, HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: mva:Mvan_0192 integral
FT                   membrane sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42954"
FT                   /db_xref="GOA:A4T3S0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3S0"
FT                   /protein_id="ABP42954.1"
FT                   /translation="MPRLPRFLSSASLRTRVAIASAAAAAAVVAAFTILTSLVLANNDA
FT                   AQLDRRLDAIVDASVFPDQLTDPRRGVLQTGRSRSSGQVVFQRGFQLPPLPPGTETVIV
FT                   NGVEYRVRTIPVDEGGGVLMSIGIRADSILLSAARVPFYIGVGVVTVLLAGVLGWLLAG
FT                   PAIRPLRKLTEHTKQLGDGAEQIPAVRGVREAEDLSEAMSAMLDRLAAAQRVTTNSLQA
FT                   AQDFAANAAHELRTPLTAMRADLDTLRIHNLPDEERDEVVADLARAQRRVEGIITALGQ
FT                   LASGQLAQVEDREQIDVADLLDRVARENMRVSRDVQIDIDAVDDLGSVQGWPSGLRLAV
FT                   DNLVRNAVTHGQASQIVLSARREDSAMTIVVDDNGRGLPADEHQTVLGRFSRGSTAAPG
FT                   GSGLGLALVAQQAALHGGTIELTDSPLGGLRATLTISTSLVPLGDPES"
FT   sig_peptide     complement(485757..485882)
FT                   /locus_tag="Mflv_0460"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.985 at
FT                   residue 42"
FT   gene            complement(485929..486675)
FT                   /locus_tag="Mflv_0461"
FT   CDS_pept        complement(485929..486675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0461"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: mva:Mvan_0191 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42955"
FT                   /db_xref="GOA:A4T3R2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3R2"
FT                   /protein_id="ABP42955.1"
FT                   /translation="MRDRVDAPPARGGEPSAHDGAGRTVLMVDDDPDVRTSVARGLRHS
FT                   GFDVRVAATGKEALRLLSSESHDALVLDVQMPELDGVAVVTALRALGNDIPICVLSARD
FT                   TVNDRIAGLEAGADDYLTKPFDLGELVARLHALLRRAHHSDPTSDTMTVGSLTIDTARR
FT                   LVFVAGERVELTKREFDLLAALAENAGVVLSRQRLLELVWGYDFDVDTNVADVFVSYLR
FT                   RKLERDGLPRVIHTVRGIGYVLREEA"
FT   gene            complement(486684..487085)
FT                   /locus_tag="Mflv_0462"
FT   CDS_pept        complement(486684..487085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0462"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0190 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42956"
FT                   /db_xref="GOA:A4T3R3"
FT                   /db_xref="InterPro:IPR032407"
FT                   /db_xref="InterPro:IPR038378"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3R3"
FT                   /protein_id="ABP42956.1"
FT                   /translation="MLNSAPMVRRAVAGVLGAGAVSGAVLFGVLGAAPASAQPVPQNDP
FT                   PNCTAADFAGVASGVSAATSAYLFTHPEVNTFFSNLHGAPRAQIDAEVAEYLASHPQVE
FT                   AELKGVRQPLADIKHRCGFTPTDPDGPDF"
FT   sig_peptide     complement(486972..487085)
FT                   /locus_tag="Mflv_0462"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.585 at
FT                   residue 38"
FT   gene            complement(487235..487669)
FT                   /locus_tag="Mflv_0463"
FT   CDS_pept        complement(487235..487669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0463"
FT                   /product="transcriptional regulator, fis family"
FT                   /note="KEGG: mva:Mvan_0189 transcriptional regulator, fis
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42957"
FT                   /db_xref="GOA:A4T3R4"
FT                   /db_xref="InterPro:IPR030937"
FT                   /db_xref="InterPro:IPR032407"
FT                   /db_xref="InterPro:IPR038378"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3R4"
FT                   /protein_id="ABP42957.1"
FT                   /translation="MIFAMNSAINTALGVAALAAALIVGPVLPSASAAPDPCAASEVAR
FT                   TVAEVATYTGNYLEANPKANTALTSISQQGGPESVAALKTYFDANPKVASDLQRLQAPL
FT                   VTLSGTCRLPVTLPQIFGLMQAAQQGPAQPVAHSVAPAPR"
FT   sig_peptide     complement(487568..487669)
FT                   /locus_tag="Mflv_0463"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.945 at
FT                   residue 34"
FT   gene            487954..490890
FT                   /locus_tag="Mflv_0464"
FT   CDS_pept        487954..490890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0464"
FT                   /product="MmpL11"
FT                   /note="KEGG: mva:Mvan_0188 MmpL11"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42958"
FT                   /db_xref="GOA:A4T3R5"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3R5"
FT                   /protein_id="ABP42958.1"
FT                   /translation="MMRVSSNLRRFRWAVFAVWLLLLLPSVYLAMNQAGNLTGGGFEVE
FT                   GSQSLYVQRQLEAQFPDQGASPLALVAAPRPDASFEDMNNAVAQLESLAAEIPSITVVP
FT                   SPQQPPPQPDRPYVVTLAMDFENTGAVDIAKQLREKVGVDGEDAGETENGKVRLYVIGQ
FT                   GALGAAATEATKDDIAQAEKWNFPIVLVILLAVFGSLAAAAMPLLLGVCTVVVTMGVVF
FT                   VLSMYTTMSVFVTSTVSMFGIAVAIDYSLFILMRFREELRAGREPEDAADAAMATSGLA
FT                   VVLSGLTVIASVTGIYLINTPVLQSMATGAILAVAIAVLTSTTLTPAVLATFGRRAAKR
FT                   SSYLHWGRGVEATQSKFWTRWTGWVMRRPWLSAMAAAAVLLTFAAPAFSMMLGNSMQRQ
FT                   FDTTHEIRGGVSAAAEALGPGALGPIRVLITFPDGDAASASAKEPLLAELRQTMAGAPN
FT                   VVSVTPPVFGTDYRIALLSAVLSVDPEDMGARETIDWMREKLPPVAGDAASIDVGGPTA
FT                   LIKDFDDKVSATQPLVFAFVALIAFVMLLVSIRSVFLAFKGVLMTVLSVAAAYGSLVVV
FT                   FQWGWLSSLGFDQLSSLDSTIPPLVLALTFGLSMDYEIFLLTRIRERFLQTGNTRDAVA
FT                   YGVSTSARTITSAALIMIAVFIGFAFAGMPLVAQLGVACAVAIAVDATIVRLVLVPALM
FT                   AMFDEWNWWLPRWLDRLLPSVDFEKPLPKADIGDLVIIPDDISALAPSGSDLRTVVKSA
FT                   AKLKTLVPQAVTVADPLAFSGCLPCNKMTGTRVGRDERITAAVSNRAHGKTVAVKLPKH
FT                   PVTMWRGRLDVALEALATERAQNEGHPTIERISPLETTNVLLPTGDRLQIPTGAETLRL
FT                   KSYLILERNSTRDFSEFSELVDSMDTSTAAEVLASMDRYYSGQSARDQQAGARTRHWVA
FT                   TQLVRRLAEPAPADGPDIAAAGADGEAEWATVRQRCLSVAVAMLEETR"
FT   sig_peptide     487954..488079
FT                   /locus_tag="Mflv_0464"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.839) with cleavage site probability 0.485 at
FT                   residue 42"
FT   gene            490887..491393
FT                   /locus_tag="Mflv_0465"
FT   CDS_pept        490887..491393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0465"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0187 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42959"
FT                   /db_xref="GOA:A4T3Q9"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3Q9"
FT                   /protein_id="ABP42959.1"
FT                   /translation="MTPGVSQTPQTRRDTGAENATPPPADTRPVEFWPTAAIRAALESD
FT                   DLSVWQRIVVAIKRDPYGRTARQVEEVLETARPYGVSKAMAEVLTRTREHLEANECAEV
FT                   ARHVRLLLERSGLGEQEFASRIGVPADDFATYLQGSVSPAASLMIRMGRLSDRFARMRA
FT                   QRPPS"
FT   gene            complement(491397..492641)
FT                   /locus_tag="Mflv_0466"
FT   CDS_pept        complement(491397..492641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0466"
FT                   /product="glycosyltransferase, MGT family"
FT                   /note="TIGRFAM: glycosyltransferase, MGT family; PFAM:
FT                   UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl
FT                   transferase, family 28; KEGG: mkm:Mkms_1286
FT                   glycosyltransferase, MGT family"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42960"
FT                   /db_xref="GOA:A4T3R0"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="InterPro:IPR006326"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3R0"
FT                   /protein_id="ABP42960.1"
FT                   /translation="MAVILAYTAPALGHLFPFCAVLQELARRGHDIHVRTLAAGLQICR
FT                   DEGFTAAAVDPRIEAIQADDTLTGTVRAAADTVEVLTARAPLEVADLLSAVESVQPDVV
FT                   IVDANCWGAMSVAETLGRPWVVLSPFTPYLRSPGAPPFGPGATPWPGPLGRIRDWGIGL
FT                   VTTAVFDRPFARQIAPLRRALGLTPVRTAGDLLLRAPAVLVATGKPLEYPHTDWGETVT
FT                   MIGPAVFEPRAAQRPSWLDHIDDPIVLVTTSSVGQSDAALVETAVEALRDEPVHLVVTA
FT                   PTGDVDVMTRPGVTQVRFAPHSMLLEHAVCVITHGGMGVTQKALARGVPVCVVPFGRDQ
FT                   FEVARRVELAGCGTRLPAGKLSVGRLRTAVKTAATMTGGAARVAAGFAATGGVARGADV
FT                   VESRLVARCALPEEQ"
FT   gene            complement(492641..494836)
FT                   /locus_tag="Mflv_0467"
FT   CDS_pept        complement(492641..494836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0467"
FT                   /product="MMPL domain protein"
FT                   /note="PFAM: MMPL domain protein; KEGG: mva:Mvan_1577
FT                   polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42961"
FT                   /db_xref="GOA:A4T3R1"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3R1"
FT                   /protein_id="ABP42961.1"
FT                   /translation="MLSRCARWALEAPRRVVVCIALLTVAAGIIGFPVVSHLSAGGFAD
FT                   PGAESSQANRVLSEKFGKGDVQLILVVSGGEGDGEATAAEGRRIVDLLAGSPNVLGVLS
FT                   PWTSPPEMAAGLRSADGRADLIVADLRGGESDGPGYARELVERIDADLAAGGSSVSVTP
FT                   GGSAMVFDQITTQTLRDVLIMESIAVPLSLAVLVWVFGGLLVAALPVLVAVVAIVATMA
FT                   VLRLIAMGTDVSIFALNLASALGLALAIDYTLLIVSRFRDEMALDHDRSRALRTTMATA
FT                   GRTIVFSALTVALSMSTLVLFDVPFLRSFGYAGVATVVLCAVAALVFSPALMVLLGDRL
FT                   MRRPGRHRADGDGRDAVHHRFWFRSTQFVLRHALPVGLAGSALLVCAGLPFLGVKWGYP
FT                   DDRVLPASASAHQVGDQLREQFVGLSGTETTVVAPDATGISDADWERYAADLSRVPDVT
FT                   AVAAPAGTFVDGRPAGPAAVGAEIADGSAYLTVTGSAALFSAESEDQLADLKAVPGPGG
FT                   RDVVMTGAAAVNRDSIHSIAEKLPTVLGLTAAVIFVVLFALTRSVVLPLKALVLNGLSL
FT                   TAAFGALVWIFQDGHLGAFGTTPTGTLVATIPVLLFCIAFGLSMDYEVFLLARIREFWL
FT                   RSGRSAADLDRSVVLGLAYTGRVVTAAALIMTLSFAGLIAAQVSFMRMFGVGLVLAVLV
FT                   DATLVRMVLLPAYMKLLGRFNWWAPRLPTRAVVRERV"
FT   sig_peptide     complement(494702..494836)
FT                   /locus_tag="Mflv_0467"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.993) with cleavage site probability 0.624 at
FT                   residue 45"
FT   gene            complement(494952..496532)
FT                   /locus_tag="Mflv_0468"
FT   CDS_pept        complement(494952..496532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0468"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mav:MAV_4843 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42962"
FT                   /db_xref="GOA:A4T3Q3"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3Q3"
FT                   /protein_id="ABP42962.1"
FT                   /translation="MLRGDGPGPARQWSADAVVVGVLAFALGVAAAGRPSLWVDEAGTL
FT                   SAATRPVDALWTLVHHVDAVHGFYYLLLRGWFEIVPVTEFWARVPSALMVGVAAAGTCV
FT                   LGSRLSGRKVGIAAGVVFAVLPRTTWAAVEARPYALSMACAVWLTVLFVAAVRRGGRRW
FT                   WLGYGAALVGAVTVNVMVVLILAGHAAMLAATRPDRRTVRAWLVTVVVASVALIPLFVV
FT                   LLSQQAQIAWIWPVGPVTLGQIAGEQYFPSVYSDSVRAVGPDQQQFSAEQLRVAMSAWA
FT                   RVAPLIVVIVIVAALAVRARRRHGALIENPSGTRVLVLGAVAWIVVPTVVLLGYSVLVR
FT                   PLYQPHYLTFTTPALALLIGLCVVTLCRDDTRRLTATLAVLAVAAAPNYLAQRGPYAKY
FT                   GSDYSQVAELLARESGPRDCVVVDDRTAPSVPHAIEGARRAHPVAARDLGLAPPERTAL
FT                   FSARDPLGVRADDLRTCAVLWTIGDAAPGSPADAPVDRVARAQGFVPAERWRFNQTEVV
FT                   RSVPAGARS"
FT   gene            complement(496544..497233)
FT                   /locus_tag="Mflv_0469"
FT   CDS_pept        complement(496544..497233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0469"
FT                   /product="putative conserved transmembrane protein"
FT                   /note="KEGG: mva:Mvan_0186 putative conserved transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42963"
FT                   /db_xref="GOA:A4T3Q4"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3Q4"
FT                   /protein_id="ABP42963.1"
FT                   /translation="MRNRWRVLVFDLLAPAAAIAALVYIGVALSWPLWWVAVCSVLCLL
FT                   IVEGVVVNLVLARRDAVTVGTDDEGPGLRLAVAGTAAAAVVAAAVVGYVSWTVPDRVLR
FT                   DDTAEVAGIASSVAEASATFTPQNPTGSIDRAAAMMSAASAERFKSEFAAVAEDLGSRN
FT                   VSAQARTVSAGVEAIGPDAASVAVILRGTQSAPGRRPDTAVLALRVALSKTDGRWVVED
FT                   VSPIHSR"
FT   sig_peptide     complement(497141..497233)
FT                   /locus_tag="Mflv_0469"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.795) with cleavage site probability 0.740 at
FT                   residue 31"
FT   gene            complement(497230..497844)
FT                   /locus_tag="Mflv_0470"
FT   CDS_pept        complement(497230..497844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0470"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0185 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42964"
FT                   /db_xref="GOA:A4T3Q5"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3Q5"
FT                   /protein_id="ABP42964.1"
FT                   /translation="MPDDEQPSDPAPGGGVSGVSGVSGVFSGYGVASAVAGVVAVVAVV
FT                   LAGLFWSGHRADTDELRYRTQVLQTAADWTGILINLNKDTIEADMARLHDGTVGRLNAD
FT                   FESSMEPFRTLVQTLKSSTTGQVDSVAIETIHHDDPDEPAAPPATDLTGFSSRTDTVMV
FT                   IATSLSENSGTEAPQTVRWTLRLDVTDVDGELKVSRLESVR"
FT   gene            complement(497870..498424)
FT                   /locus_tag="Mflv_0471"
FT   CDS_pept        complement(497870..498424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0471"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: bba:Bd0323 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42965"
FT                   /db_xref="GOA:A4T3Q6"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3Q6"
FT                   /protein_id="ABP42965.1"
FT                   /translation="MTEIFLSIQVSVDGYIAGPDGDLSWTDVGDDDVDELMAEQLRGID
FT                   AMIFGHTSYGLLAPYWQDGPTERAVDREHTRLMNTVTKLVLSHGTPDLSWGPAERIGAD
FT                   LPAEMARLKDGGGRAVAVFAGAETARTLLPYVDEIRLVVYPVLLGSGLALFGERRQPLS
FT                   LVGAREFPASGVVQLRYRRGS"
FT   gene            498488..500488
FT                   /locus_tag="Mflv_0472"
FT   CDS_pept        498488..500488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0472"
FT                   /product="endothelin-converting enzyme. Metallo peptidase.
FT                   MEROPS family M13"
FT                   /EC_number="3.4.24.71"
FT                   /note="PFAM: peptidase M13, neprilysin; peptidase M13;
FT                   KEGG: mva:Mvan_0184 neprilysin"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42966"
FT                   /db_xref="GOA:A4T3Q7"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042089"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3Q7"
FT                   /protein_id="ABP42966.1"
FT                   /translation="MTVEATSDTSAKSGIDLRYVDADARPQDDLFGHVNGRWLAEYQIP
FT                   GDRATDGAFRTLYDRAEEQIRDLITEAASAHAAEGTDQQRIGDLYASFMDEQTVRDRGL
FT                   APLLDELGAIDAAGSPDALAEVLGSLQRTGIGGATGLYVDTDSKNSTRYLLHLTQSGIG
FT                   LPDESYFREEQHAEILAAYPGHIAAMFGLVLGGDPGEHAATAQRIVALETKLAAAHWDV
FT                   VKRRDADLTYNLRTFAELTDESPGFDWTRWLGGLGADRDKAADVVVRQPDYLTAFASLW
FT                   SGSSLEDWKDWLRWRVIHGRAFLLTDELIAEDFSFYGKRLSGTEEIRDRWKRGVSVVEA
FT                   LMGEALGKLYVERHFPPQAKARMDELVANLREAYRVSINTLDWMTPQTREKALVKLDKF
FT                   TPKIGYPNTWRDYSALVIERDDLYGNYRRGYALEYDRDLAKLGGPVDRDEWFMTPQTVN
FT                   AYYNPGMNEIVFPAAILQPPFFDADADDAANYGGIGAVIGHEIGHGFDDQGAKYDGDGN
FT                   LVDWWTDEDRAEFGKRTTALIEQYEQFTPRGLEPSHHVNGAFTVGENIGDLGGLSIALL
FT                   AYRLSLKGEPAPVIDGLTGVQRVFYGWAQVWRTKSREAEAIRRLAVDPHSPPEFRCNGV
FT                   IRNMDAFYDAFDVDPEDALYLEPQRRVHIWN"
FT   gene            complement(500509..500949)
FT                   /locus_tag="Mflv_0473"
FT   CDS_pept        complement(500509..500949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0473"
FT                   /product="putative thiol-disulfide oxidoreductase DCC"
FT                   /note="PFAM: putative thiol-disulphide oxidoreductase DCC;
FT                   KEGG: mxa:MXAN_4998 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42967"
FT                   /db_xref="InterPro:IPR007263"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3Q8"
FT                   /protein_id="ABP42967.1"
FT                   /translation="MSHPTPDLTTRPAPVLLYDGVCGFCNGAVQTILRLDPHGSLRFAA
FT                   LQGEFADGVLTRHPFLAGVDSIVFVENPGQSDERVAVRTDAALRVAAYLGGPWRALRVA
FT                   GVIPAPVRDRLYDGFARVRYRIFGTHDTCPIPAPEVRARFLG"
FT   gene            complement(501027..501434)
FT                   /locus_tag="Mflv_0474"
FT   CDS_pept        complement(501027..501434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0474"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mkm:Mkms_0165 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42968"
FT                   /db_xref="GOA:A4T3Q0"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3Q0"
FT                   /protein_id="ABP42968.1"
FT                   /translation="MTRSLLPVAFGVLMTGAAAYRASGPALLVLGAAVAAVVASAWLRP
FT                   AGTVAVVLVVGAIVLTPSAPLHTVLAGLAATVYLVVLHTVATVPTMVFAVGFGAVAAVV
FT                   AALPLGVPWLPLIAAPALLAGYLLALRPFTR"
FT   sig_peptide     complement(501309..501434)
FT                   /locus_tag="Mflv_0474"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.990) with cleavage site probability 0.423 at
FT                   residue 42"
FT   gene            complement(501431..502645)
FT                   /locus_tag="Mflv_0475"
FT   CDS_pept        complement(501431..502645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0475"
FT                   /product="protein of unknown function DUF58"
FT                   /note="PFAM: protein of unknown function DUF58; KEGG:
FT                   mva:Mvan_0181 protein of unknown function DUF58"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42969"
FT                   /db_xref="GOA:A4T3Q1"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3Q1"
FT                   /protein_id="ABP42969.1"
FT                   /translation="MVAVELRWRASALTQSIATCVAAAITVALVAGRWELVAFAAPLAG
FT                   ALCSIGWQRRLPTVTVTGSPPFQRCFEDEQVSVGMTAVADDGAAVTLDCTAPAPMVLTH
FT                   RPAGELTVQSSRWGRYPVRAGVRVCGRGGLVTGTGTVDAAEVCVFPLAPAQSTAIPRTD
FT                   LLDRLGTHLTRHTGPGVEFADIRPYVPGDQLRIVNWPVSARRGTLHITERLTDRAADVV
FT                   VLVDTYPQPPGPATAATERTARGAAQVVQSALRYGDRAGLVALGGRSTRWLGADIGRRQ
FT                   FYRILDTVLGADDTFEKATGTLAPRAAVPTGAIVVAFSTMLDTEFALALIDLRKRGHPV
FT                   VVVDVLEGSPVEGEHDPLVHRMWAMQRSFMYRDMATVGVDIVAWPGDATLDQAMALVPA
FT                   RRRRL"
FT   sig_peptide     complement(502523..502645)
FT                   /locus_tag="Mflv_0475"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.947) with cleavage site probability 0.944 at
FT                   residue 41"
FT   gene            complement(502650..503603)
FT                   /locus_tag="Mflv_0476"
FT   CDS_pept        complement(502650..503603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0476"
FT                   /product="ATPase associated with various cellular
FT                   activities, AAA_3"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities, AAA_3; ATPase associated with various cellular
FT                   activities, AAA_5; KEGG: mva:Mvan_0180 ATPase associated
FT                   with various cellular activities, AAA_3"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42970"
FT                   /db_xref="GOA:A4T3Q2"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3Q2"
FT                   /protein_id="ABP42970.1"
FT                   /translation="MSTPALTTARCEAVLDEIGRAVVGKRGALNLILITVLARGHVLVE
FT                   DLPGLGKTLIAKSFAAALGLEFTRVQFTPDLLPADLLGSTIYDMQSGRFEFRRGPVFTN
FT                   LLLGDEINRTPPKTQAALLEAMAERQVSIDGATHRLPEPFLVLATDNPIEYEGTYPLPE
FT                   AQLDRFAIRLELKYLSESEEATMLRRRLDRGSAPATVNQIVDAQDLLHMQESVEQVSVH
FT                   DDVVQYVVSLAAASRQHPQVAVGASPRAELDLVQLARARALLLGRDYVIPEDVKALAVP
FT                   TMAHRISLRPEMWVRRVQGADVVEELLRRTPVPRAR"
FT   gene            complement(503600..504082)
FT                   /locus_tag="Mflv_0477"
FT   CDS_pept        complement(503600..504082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0477"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0179 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42971"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3P7"
FT                   /protein_id="ABP42971.1"
FT                   /translation="MTKLVVGGVVLVIAVQAFALTQLEREVVVAVTGGALACVLIAVRA
FT                   RLDHDAVPDDDARADDAAAAIRRWLSRTETLISWSESSRSDWDRRLRPMLARQFELAAG
FT                   RRKAKDPRAFEATGRMVFGDELWQWVDPDNISRSGSLEPGPGRRTLDDILRRLERL"
FT   sig_peptide     complement(504023..504082)
FT                   /locus_tag="Mflv_0477"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.728) with cleavage site probability 0.395 at
FT                   residue 20"
FT   gene            complement(504079..505035)
FT                   /locus_tag="Mflv_0478"
FT   CDS_pept        complement(504079..505035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0478"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0178 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42972"
FT                   /db_xref="GOA:A4T3P8"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3P8"
FT                   /protein_id="ABP42972.1"
FT                   /translation="MPEHTGPGDHRAVVRTIAVIVLIAVALVALRGYLPEASEPRPEPE
FT                   RLDSGSGSVAAVVAMLAVSLAAIAISVLAQARQRSGIPSAAEPHRAPRAGPLRLRWRPL
FT                   LIAAAILLAWSVVLLLLMRWVSPLPLDEPPAPQGASATDPAEGAEPGPAPAPRQTGAGD
FT                   SVFGILAVATVVLLGLSVVGTLRGRRQIPAPAVPVEAPSDATTGGAGPDLVRAAELGLA
FT                   EVDDPNRDAREAIIACYLAMERELEKSPGTTPQDSDTPSEVLARATRHHALQADSAAEL
FT                   VDLFEETRFSPHVMDDGHRVAAVRALQAVLRDLRVAP"
FT   gene            complement(505135..506106)
FT                   /locus_tag="Mflv_0479"
FT   CDS_pept        complement(505135..506106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0479"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   mva:Mvan_0177 ErfK/YbiS/YcfS/YnhG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42973"
FT                   /db_xref="GOA:A4T3P9"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="InterPro:IPR041280"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3P9"
FT                   /protein_id="ABP42973.1"
FT                   /translation="MRQRNRKRVMALLMTAGVVAGLTLGAPSALAQPAPAPAPAPVPPP
FT                   ATATGARTPATADPFAVIPGTPQPIPEGTPAGQNPNPFVGQPPFVPPSFNPVNGSIAGA
FT                   AKPIYINFQRPIANRQMAQDAVHISSNPPVPGRFYWVTDTQLRWRPQDFWPAGTVVTID
FT                   AAGTKSSFTVPEQLTATIDNDTKQMEVHRNGVLEKTFPVSMGKPGYDTKNGTYYVLEKF
FT                   DEIVMDSSTYGVPVDDPSGEGYKLKVKDAVRIDNSGIFVHGAPWSVGSQGESNVSHGCI
FT                   NLSAENAKWFRENFGSGDAVVIKNTDGGLYTQPDGASDWQMF"
FT   sig_peptide     complement(505951..506106)
FT                   /locus_tag="Mflv_0479"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.426 at
FT                   residue 52"
FT   gene            506284..506580
FT                   /locus_tag="Mflv_0480"
FT   CDS_pept        506284..506580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0480"
FT                   /product="protein of unknown function DUF77"
FT                   /note="PFAM: protein of unknown function DUF77; KEGG:
FT                   mva:Mvan_0176 protein of unknown function DUF77"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42974"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3P3"
FT                   /protein_id="ABP42974.1"
FT                   /translation="MIVAFSISPSGADETGGVSAAVAEAVRVVRASGLPNETNAMFTNI
FT                   EGEWDEVMAVVKQAVDAVAAVSPRVSLVLKADIRPGFTGQLTAKVQRIDDALA"
FT   gene            506691..507896
FT                   /locus_tag="Mflv_0481"
FT   CDS_pept        506691..507896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0481"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   mva:Mvan_4654 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42975"
FT                   /db_xref="GOA:A4T3P4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3P4"
FT                   /protein_id="ABP42975.1"
FT                   /translation="MPSGVAVGWPVKREFFDLVCGGMPTTEASLAVGVSRRTGWFWWRQ
FT                   AGGMTLRKGGEGLGGLADAGDLERPGGRGHRLSFAERFEIDRGLQAGRSYAEIGRELGR
FT                   DRSVIAREVKRNCLPDGRYHALMAHAAASQKARRPKKFKLDNPALCALIAGWMDEGWSP
FT                   KLISQVLAETYAGDKLMQVSHETIYQCLYVQTRGQLRADLHKCLSTKRRARSPRGHRGR
FT                   TGVYDPDTIFTISDRPAEANDRAVPGHWEGDLILGARHGSAIGTLVERSTRFVILLHLP
FT                   VDHTAQSVAAAMIEAMGELPAHLRRSITWDRGSEMASWKHVQMQLNSPVFFCDPHSPWQ
FT                   RGTNENTNRLLRFWFEKGSDLSVHTRDDLNTVAAKLNSRPRPTLDLDTPAQRMAALLSQ
FT                   AA"
FT   gene            complement(507893..508790)
FT                   /pseudo
FT                   /locus_tag="Mflv_0482"
FT   gene            complement(508794..509978)
FT                   /locus_tag="Mflv_0483"
FT   CDS_pept        complement(508794..509978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0483"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   rha:RHA1_ro00092 probable glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42976"
FT                   /db_xref="GOA:A4T3P5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3P5"
FT                   /protein_id="ABP42976.1"
FT                   /translation="MRVALIAPHHFPIREPFAGGIESHVWHLARALIRQGHAVTLCAAA
FT                   GSDLAMEHPALTVTAMPRSAAASRVFPPPGAIKESAHHAFVELMSELADPASGVDVVHN
FT                   HSLNPVPVLVARRLPVPVLTTLHTPPFPALEAAVGAVARSGQAFAAVSRQAAAAWEHVG
FT                   IRRMALVRNGIDTSRWPAGPGGEDLVWSGRLLEEKGPHLAVDAALRAGRRIVLAGPIVD
FT                   DHFFRRRIAPTLGSRASYAGHLGQRELATLVGRAAAALVTPLWDEPYGQVVVEAMACGT
FT                   PVVAFAGGGIPELVDEHSGRLVEPGDVAALAAAVREAVALPRAGVRRVAVQRHGLARMV
FT                   TGYVALYRALIAEATPPPRPPKLHSSSESANQSQAVSATARACLTNVSGVSAET"
FT   gene            complement(510021..510335)
FT                   /locus_tag="Mflv_0484"
FT   CDS_pept        complement(510021..510335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0484"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   msm:MSMEG_0230 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42977"
FT                   /db_xref="GOA:A4T3P6"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3P6"
FT                   /protein_id="ABP42977.1"
FT                   /translation="MSDDSTTPPDETHGYSAQKENYAKRLRRIEGQVRGIAKMIDEDKY
FT                   CIDVLTQISAVNSALQSVALGLLDEHLGHCVSHAVAAGGADADAKLAEASAAIARLVRS
FT                   "
FT   gene            complement(510332..510955)
FT                   /locus_tag="Mflv_0485"
FT   CDS_pept        complement(510332..510955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0485"
FT                   /product="protein of unknown function DUF305"
FT                   /note="PFAM: protein of unknown function DUF305; KEGG:
FT                   mva:Mvan_0174 protein of unknown function DUF305"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42978"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3N9"
FT                   /protein_id="ABP42978.1"
FT                   /translation="MTSLLLRLFAVLAVLALATGCGGGGDEASGDGSTGPQIPESPVIT
FT                   GNPAGYNAADITFASTMVKHHQQGIELAKLVSARSGNQQLTALADQIVAIQQPEINILN
FT                   VFLVQWDENPDIRTGPGGDEPRDQSVPGTVDDATVARLESLQGPQFDTLWLETMLGHHQ
FT                   GGVDIATREIDNGANVDAVSVAKSIVAGLNPQMSVMRQMLEGMP"
FT   sig_peptide     complement(510863..510955)
FT                   /locus_tag="Mflv_0485"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.992 at
FT                   residue 31"
FT   gene            510996..512765
FT                   /locus_tag="Mflv_0486"
FT   CDS_pept        510996..512765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0486"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="KEGG: mkm:Mkms_0155 dihydroxy-acid dehydratase;
FT                   TIGRFAM: dihydroxy-acid dehydratase; PFAM: dihydroxy-acid
FT                   and 6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42979"
FT                   /db_xref="GOA:A4T3P0"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3P0"
FT                   /protein_id="ABP42979.1"
FT                   /translation="MWPMNRRAHNHPMPSDSRSHSLRASGSSVDIKPRSRDVTDGLERT
FT                   AARGMLRAVGMTDDDWVKPQIGVGSSWNEITPCNMSLQRLAQAVKGGVHEAGGYPLEFG
FT                   TISVSDGISMGHEGMHFSLVSREVIADSVETVVQAERLDGTVLLAGCDKSIPGMLMAAA
FT                   RLDLASVFFYNGSIMPGVAKLTDGSEKEVTIIDAFEAVGACARGLMSREDVDIIERAIC
FT                   PGEGACGGMYTANTMASAAEALGMSLPGSASPVAIDKRRDDFARRSGEAVVEMLRRGIT
FT                   ARDILTKEAFENAIAVVMAFGGSTNAVLHLLAIAWEAQVELTLADFTRIGQKVPHLADV
FT                   KPFGAYVMKHVDEIGGVPVVMRALLDAGLLHGDCLTVTGQTMAENLAHIEPPDPDGKVL
FT                   RAMNNPIHPTGGITILHGSLAPEGAVVKSAGFDSDVFEGTARVFERERAALDALEDGTI
FT                   THGDVVVIRYEGPKGGPGMREMLAITGAIKGAGLGKDVLLMTDGRFSGGTTGLCVGHIA
FT                   PEAVDGGPIAFVRDGDRIRLDVANGTLDILVDEAEFESRKAGFEPLPPVYTTGVLAKYT
FT                   KLVGSAAVGAVCS"
FT   gene            512880..513314
FT                   /locus_tag="Mflv_0487"
FT   CDS_pept        512880..513314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0487"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0171 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42980"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3P1"
FT                   /protein_id="ABP42980.1"
FT                   /translation="MLRVVAATSAAMAVMGAVSVLPLASATPPDRTIRVLDGQIRCLLS
FT                   ADYEGRGRPATVCGRTDGAPFQISPKGKPLAVLLATGEQYYISGTVPGDPSADLVLGPG
FT                   QISKLNGWTVKTEDLRILVSYDIGRHGMRVNPIEVMPAWL"
FT   sig_peptide     512880..512960
FT                   /locus_tag="Mflv_0487"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.606 at
FT                   residue 27"
FT   gene            513453..514151
FT                   /locus_tag="Mflv_0488"
FT   CDS_pept        513453..514151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0488"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mul:MUL_1503 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42981"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3P2"
FT                   /protein_id="ABP42981.1"
FT                   /translation="MMRNLLKTVGGTAAAALAALTFTQAPVAHAFGEYPVASPGAHLVS
FT                   TTLAGNGLPYQCTAGFTVRTPGGSPGMLTAGHCDRDPLNDTVLQRTPTGDRVVGRYVRW
FT                   EVLPGVRDVGLVDLAGSSVPLVDQVDGMRVSRVMSGDDVRREQPELCKSGARTGLSCGP
FT                   VTSVTDNQVSFRAWDDLGDSGAPVYARQPDGTVAAVGILFAHSDDAFGRIVHASLVAPV
FT                   MSLWGLSTWG"
FT   sig_peptide     513453..513545
FT                   /locus_tag="Mflv_0488"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.937 at
FT                   residue 31"
FT   gene            514192..515007
FT                   /locus_tag="Mflv_0489"
FT   CDS_pept        514192..515007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0489"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0168 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42982"
FT                   /db_xref="GOA:A4T3N7"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3N7"
FT                   /protein_id="ABP42982.1"
FT                   /translation="MPTAFPDAPALERVLDLAAHAPSARNAQPWRWLVDDRGVMLFADW
FT                   TRRLGDSDHDRRDVVLSCGAVLHHCAVALAAQGWSSRIHRFPDHDVLATVELEPAPPGG
FT                   GSLELVEAISRRRADRRPFRGDLDAGTIELLMLRAERFGVRLTVVPSARWARDGDTVAL
FT                   RYGDGSPGHPGDDAAMLVLATDTDTEAMRLRAGEALSAVTLSAAALGLVTCPLTEALRE
FT                   ARDRLMLSCELFDGQAVPQALIRLGPQSVGDPLPPVSRRSVAETTTFDL"
FT   gene            complement(515013..515441)
FT                   /locus_tag="Mflv_0490"
FT   CDS_pept        complement(515013..515441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0490"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0166 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42983"
FT                   /db_xref="InterPro:IPR021975"
FT                   /db_xref="InterPro:IPR038611"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3N8"
FT                   /protein_id="ABP42983.1"
FT                   /translation="MVQRPKPFEVHASGAYLHGTKAQLAVGDYLMPGYRSNYDDRRVMN
FT                   HVYITQTLDAAVWGAELAAGEGRGRIYIVEPQGPFEDDPNVTDKKLPGNPTRSFRTREP
FT                   VLVVGEITDWEGHSDEQLQTMRDNLAELRRRGLDVIYD"
FT   gene            complement(515551..515988)
FT                   /locus_tag="Mflv_0491"
FT   CDS_pept        complement(515551..515988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0491"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_5903 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42984"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3N3"
FT                   /protein_id="ABP42984.1"
FT                   /translation="MTAIRAVGTLAVSLGVAWAGVPTAHADTFAQLAPVPVQPSPACGG
FT                   TVRAEAMVAPVQTEDRVENGVRVTINYDAGIYDGSCALTVTAAWTNLDTGRAGSGDITA
FT                   VSTIDGHYGFIGYANTMFVTGEGDVVVTLSSHPDAQLRVTA"
FT   sig_peptide     complement(515908..515988)
FT                   /locus_tag="Mflv_0491"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.802 at
FT                   residue 27"
FT   gene            complement(516351..516932)
FT                   /locus_tag="Mflv_0492"
FT   CDS_pept        complement(516351..516932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0492"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mpa:MAP3548c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42985"
FT                   /db_xref="GOA:A4T3N4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3N4"
FT                   /protein_id="ABP42985.1"
FT                   /translation="MSSDNGRPRDTRIDSAVLDAAAELLLAVGYADLTVAAIAERANTS
FT                   RPAVYRRWPSKAHLVHEAVFREADTSRVPVTGDLGRDLHSIVARTAALLTSPLARLAVP
FT                   GLIGEAASDPSLNQRVLDRFAGSGWSGLDAYLADAAARGELRAGFDAAALLEVVIGSAL
FT                   AAVLVRGPDGLTDTWVSDTTAILLDGVRAR"
FT   gene            516960..519335
FT                   /locus_tag="Mflv_0493"
FT   CDS_pept        516960..519335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0493"
FT                   /product="phosphoenolpyruvate synthase"
FT                   /EC_number="2.7.9.2"
FT                   /note="PFAM: pyruvate phosphate dikinase,
FT                   PEP/pyruvate-binding; PEP-utilising enzyme, mobile region;
FT                   KEGG: mva:Mvan_1818 pyruvate, water dikinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42986"
FT                   /db_xref="GOA:A4T3N5"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3N5"
FT                   /protein_id="ABP42986.1"
FT                   /translation="MFDASSRIVDLADVLDDSFGGKALGLAELTRLGLPVPPGFVIADA
FT                   SGTSLGDAVTERFSRMRAAGQTPVAVRSSAAGEDGAEHSFAGQYDTVLGVGSVDELTAA
FT                   VEKCVRSAGSERAAAYQDGGAAARMHLVVQQMVDARAAGVVFTADPTSGRRDLLVIDAV
FT                   RGLGESLVDGSTASDHFVLTHAGDTVTTEASSQPALADDEIDRIRTGALLAAAHWGRPL
FT                   DLEWAIDRDGLLWWLQARPITTLPGDPNEMDTPVTGPTHVYTRCNIGEMMPGAFCPLTA
FT                   SVSGHAIDYAMQMVQVAGGVQERYEDRARQVGYFFGHMFLNMTEGTALSSGILGNSLEQ
FT                   FSLSVCGRVIDELEPGPPKPFVRKLINTVRLSTFALSSAPAIRRLPQTIAAFPPITSRD
FT                   PAVVLRHLEAGVDIYREVTLIHVRSSSRSAVAANVLESHLVRRAAKRGASDTAGSAEAI
FT                   RLMTGAGVESALMVEELTAVVSMLRRDGDAAARFLAAPAGEAVTRLRAAETPSGAALRT
FT                   FLDRHGHRGYRELCMRDPSWADDPDGLGAMMQVMLRGAAPENPAATAPSDPAQSRTLRV
FT                   LARLAQAGARGREETKSRMALMAHLLKRGYRHLGEVLHEAGRLPDADLVFFFDRRELPL
FT                   VVSGDDVTELVHRARQRREALPFQAALEFGDVSVGRPTPIVRAAVSGDGVVAGRPAGHG
FT                   SVEGVVRVARSVVEARDLQPGEILVAPVTDVGWTPYFAVIAALVTDIGSSVSHGAVVAR
FT                   EYGLPCVVNTLVGTQVLRTGDRVRVDGDRGLVTVLDSP"
FT   gene            519408..520076
FT                   /locus_tag="Mflv_0494"
FT   CDS_pept        519408..520076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0494"
FT                   /product="NADP oxidoreductase, coenzyme F420-dependent"
FT                   /note="PFAM: NADP oxidoreductase, coenzyme F420-dependent;
FT                   6-phosphogluconate dehydrogenase, NAD-binding; KEGG:
FT                   fal:FRAAL3018 conserved hypothetical protein; putative
FT                   NAD(P)-binding Rossmann-fold domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42987"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3N6"
FT                   /protein_id="ABP42987.1"
FT                   /translation="MKIGIIGAGHIGGTLTRRLRELGHEVNVANSRSPETLADLERETG
FT                   ATAVWAKDAAADADLVIVSIPQKNVPDLADGIVDARKPDAPVIETNNYYPQQRDGEIAA
FT                   IEDGQPESAWVAEQIGAPVYKVFNGIFWKHLLERGIPAGSPGRIALPVAGEDGPNRELV
FT                   HIVVDQLGFDPVDAGPVSESWRQQPGTPVYGKDFGVEKTRAALAEAAPERTAEWSARTA
FT                   "
FT   gene            520125..521540
FT                   /locus_tag="Mflv_0495"
FT   CDS_pept        520125..521540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0495"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: msm:MSMEG_6805
FT                   beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42988"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3N0"
FT                   /protein_id="ABP42988.1"
FT                   /translation="MTRSSTRLRRLGAAGAVVLALGACGDRPEPPGTSAVRPPATPTRV
FT                   LPSPPPPVPEVTPTGDFSAVARLVEDAIAARRLPGAVVQVGHAGKVVFRRAFGVRKLES
FT                   EPGLDGAPAPAEPMTEDTVFDIASLTKSLATATAVMQLHEQGRVRIDEPVQTYLPGFNP
FT                   AGDPRRAAVTVRMLLTHTSGIAGDLSLDGPWGLAGPDKADGVRRALGAWVVSDPGEGFH
FT                   YSDINFIILGALVEKITGEPEDSYVDRNVFAPLKMSETRYLPVTKVCGPHRVRGTAIAA
FT                   DPHGQAVDNCPDGTWNIDLLERIAPTALDEDTPGLNPDYGYPLRGTVHDPTARRMGGVA
FT                   GSAGVFTTVHDMGRFAQALLDRVAGRPSPFPLSQAGARMMTTPQQPAPGRDLRGFGWDI
FT                   DTAHSGPRGSVFPVGSFGHTGFTGVSVWLDPESDTYVVILGNVIHQRGGPPITPLSGAV
FT                   ATEAARALHLYGS"
FT   sig_peptide     520125..520307
FT                   /locus_tag="Mflv_0495"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.530 at
FT                   residue 61"
FT   gene            521635..523668
FT                   /locus_tag="Mflv_0496"
FT   CDS_pept        521635..523668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0496"
FT                   /product="DNA topoisomerase (ATP-hydrolyzing)"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: mva:Mvan_5897 DNA topoisomerase
FT                   (ATP-hydrolyzing); PFAM: DNA gyrase, subunit B domain
FT                   protein; ATP-binding region, ATPase domain protein; SMART:
FT                   DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42989"
FT                   /db_xref="GOA:A4T3N1"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3N1"
FT                   /protein_id="ABP42989.1"
FT                   /translation="MSYTAADITELDDVQHTRLRPAVNLGLDVLNTALRELIDNAVEEV
FT                   ADPDHGGSVVTITLHADGSVSVADDGRGLPVDTDPTTGKNGIVKTLGTARAGGKFSAHT
FT                   DATSTGAGLNGIGAAAAVFISARTDVTVRRGGKTYLQSFGRGYPGVFEGKEFDPGAPFT
FT                   RSDTQKLRGVGNRKPDAHGTTVRILFDPAVVPDSAVDIGEVLLRAHAAARMSPGVQLFV
FT                   VDEGWPGEEIPPALLEPFKGPWGTDTLLDLMCTAAGTPAPGVRAVVEGRGEYTTGRGPT
FT                   PFRWSLTAGPAEPATVAAFCNTVRTPGGGSHLTAAVKGLSEALADRASRIRDLGLAKGE
FT                   EGPEPQDFAAVTALAVDTRAPDVAWDSQAKTAVSSRSLNIAMAPDVARSVTVWAANPAN
FT                   SDTVSLWTKLALESARARRSAEGAKARSRAASKAKGLGTNLSLPPKLLPSRETGRGSGA
FT                   ELFLCEGDSALGTIKAARDATFQAAFPLKGKPPNVYGFALSKARAKDEFDSIERILGCG
FT                   VRDNCDPELCRYDRILFASDADPDGGNINSSLISMFLDFYRPLVEAGMVYVTLPPLFVV
FT                   KAGDERIYCQDESERDAAVARLKETSKRKVEVQRNKGLGEMDADDFWNTVLDPQRRTVI
FT                   RLHPDDAEKKLHHTLFGGPPEGRRTWMAEIAARVDTASLDLT"
FT   gene            523688..525838
FT                   /locus_tag="Mflv_0497"
FT   CDS_pept        523688..525838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0497"
FT                   /product="DNA gyrase/topoisomerase IV, subunit A"
FT                   /note="PFAM: DNA gyrase/topoisomerase IV, subunit A; DNA
FT                   gyrase C-terminal repeat, beta-propeller; KEGG:
FT                   mva:Mvan_5898 DNA gyrase/topoisomerase IV, subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42990"
FT                   /db_xref="GOA:A4T3N2"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3N2"
FT                   /protein_id="ABP42990.1"
FT                   /translation="MTATIEQNPELVLDQSADEYWNHYQLTFALYSVSDRAIPSAFDGL
FT                   KPGQRRLLYQMHESRLLPGNKPQKSSKICSAVTGNLHPHGGASMYGAAALMAADFQRVK
FT                   VIDGQGAFPRIQGDIPAADRYTEMRLSAPGAALTAELDSHAVPMVATFDGEWTEPTVLP
FT                   AQWPVLLCNGAVGIAEGWATKVPAHNPREVMAACRALLKTPNMTDDRLVKLIPGPDWGC
FT                   GASVIGTDGLREYITTGRGLFTVRGTVSVDGKNCIITELPPGVASGTVQDRIRALVESG
FT                   EMAGVADMSDLTDRRNGLRIVVTAKRGHSAEQIRDQLLALTPLESSFAASLVALDENRV
FT                   PRWWSVRELIAAFLSLRDSVVLHRSEYRLEKVTARRHLVAGLMTIHLDIDTAVAIIRAS
FT                   DTVDDARLGLQERFAIDAVQADYVLALQLRRLTKLDVIELQAEAEKLDAEFAALTELVS
FT                   NPDARRKVIDQELVETAKLFKGPEYDRRTVLDYDATPVAANNSEDGPRERKVNAAWRLD
FT                   DRGVFSDSHGTLLSSGLGWAVWTDGRIKFTTGGGLPFKIRDIPVSPDITGLLQSGVLAP
FT                   GSHLALITRRGRVLRIDPAAVNPQGAAGNGVAGVKLVADDPEDRVIAALPVSCANGEAI
FT                   LSISEKSWKVTEVADIPVKGRGGAGVGFHPFGKGEDALLSAAISATGYVRGTRTVRAEK
FT                   RAKASIKGSGADVTPADAAPAD"
FT   gene            525871..526221
FT                   /locus_tag="Mflv_0498"
FT   CDS_pept        525871..526221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0498"
FT                   /product="protein of unknown function DUF861, cupin_3"
FT                   /note="PFAM: protein of unknown function DUF861, cupin_3;
FT                   KEGG: mva:Mvan_5899 protein of unknown function DUF861,
FT                   cupin_3"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42991"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3M6"
FT                   /protein_id="ABP42991.1"
FT                   /translation="MTDLTPNSAVSAASVPVETVPVPDNQSVAGQPHTGATALGMFAGL
FT                   EVGVWEMTEGVMTDTEADELFVVISGSARVEFIDGTSPLELSAGDVVHLAAGTQTVWTV
FT                   RSPLRKVYLAAP"
FT   gene            complement(526363..526842)
FT                   /locus_tag="Mflv_0499"
FT   CDS_pept        complement(526363..526842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0499"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_5904 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42992"
FT                   /db_xref="GOA:A4T3M7"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3M7"
FT                   /protein_id="ABP42992.1"
FT                   /translation="MVAQLYDFFGEVFQRYFRPAMDAYPPRGGGPVERMFGLTDAVRDP
FT                   LEQSRRAALAWGHAEVDNARFATELFVITQHGLIYAAELNNPRRSLYYLATPPSLFDPF
FT                   VDQVERARLREGGAVVVDNRLGRDLAAAHPMDAALRRILDQHWALRVDLSSPALC"
FT   gene            complement(526913..527347)
FT                   /locus_tag="Mflv_0500"
FT   CDS_pept        complement(526913..527347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0500"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: mva:Mvan_5905 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42993"
FT                   /db_xref="GOA:A4T3M8"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3M8"
FT                   /protein_id="ABP42993.1"
FT                   /translation="MTTTNVKCPHCGTVNRLPAAANGTPRCPKCKNPLPWIAVAGDGDF
FT                   AEVVERSKVPVLVDLWATWCGPCRMVSPALEQLAAERAGQLKLVKVDVDSARQTAARFS
FT                   VQAVPTLLVIAGGAVLARRAGAAPVATLRTWLDQTLASPR"
FT   gene            complement(527344..528057)
FT                   /locus_tag="Mflv_0501"
FT   CDS_pept        complement(527344..528057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0501"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: mva:Mvan_5910 GntR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42994"
FT                   /db_xref="GOA:A4T3M9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3M9"
FT                   /protein_id="ABP42994.1"
FT                   /translation="MLERPVVGALHSSLVTALGTGIVSGKYPAGCVLTLEAVSAEHGVS
FT                   RSVAREAVRVLESMGMVESRRRVGITVLPADRWNLFDPVVIRWRLEVGDRTAQLVSLSE
FT                   LRMGFEPAAAALAARRASPHQCRVMATAVSDMVMHGRTGDLDAYLLADKLFHQTMLEAS
FT                   GNEMFRALNGVVAEVLAGRTHHGMMPEKPNMAAIALHDEVARAIRMGEQEQAQRAMWAI
FT                   IDESAMAIVEDGGAK"
FT   gene            528182..528694
FT                   /locus_tag="Mflv_0502"
FT   CDS_pept        528182..528694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0502"
FT                   /product="gluconate kinase, SKI family"
FT                   /EC_number="2.7.1.12"
FT                   /note="KEGG: mva:Mvan_5911 carbohydrate kinase,
FT                   thermoresistant glucokinase family; TIGRFAM: carbohydrate
FT                   kinase, thermoresistant glucokinase family; PFAM: shikimate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42995"
FT                   /db_xref="GOA:A4T3M2"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3M2"
FT                   /protein_id="ABP42995.1"
FT                   /translation="MAIPIVVMGVSGSGKSTVGAALAQRLRVPFADADDFHPPANIAKM
FT                   SAGHPLDDEDRYPWLESIGEWLADHPDGGVMSCSALKRVYRDQLRRHCPDIEFLHLAGA
FT                   VETISRRQASRPGHFMPAKLLQSQFQTLEPLEPDERGVVIDVDQSIDGIIENYISSTHS
FT                   PTAEEDR"
FT   gene            528731..530161
FT                   /locus_tag="Mflv_0503"
FT   CDS_pept        528731..530161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0503"
FT                   /product="gluconate transporter"
FT                   /note="TIGRFAM: gluconate transporter; PFAM: Gluconate
FT                   transporter; Citrate transporter; KEGG: mva:Mvan_5912
FT                   gluconate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42996"
FT                   /db_xref="GOA:A4T3M3"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3M3"
FT                   /protein_id="ABP42996.1"
FT                   /translation="MEAIDPAYGTTTLLLIAAGAVALLLFLIIKVKLHAFVALVLVSLL
FT                   TALAAGIPVADVPSALTFGFSNTLGSVALLVGFGVMIGRLLEITGGAQVLADTLIGRFG
FT                   EKRAPLALGVAALLFGFPIFFDAGLVVFLPIIMTVARRFGGSLLLYAFPAAGAFAAMHA
FT                   LVPPHPGPVAAAELLGANIGLTLLVGAPVAVAAWYVGAYLVSQAMGRRIHVDVPTALFG
FT                   EINGGRDTEHPTDDTPGTGAATTATRTAPAFATVLGVLLLPFVLISFNTVIDTLMTAGV
FT                   IEEGATWAEYLKLIGTTSIALLITVIVATLVLGLRGRSMGTVSDILDKALGPICAIILI
FT                   TGAGGMFGGVLRLSGIGDALSGSLSNLGISLILQAFIISTLLRVAQGSATVALTTTAGL
FT                   ISAAVAAADLSNLQLVALVMAIAAGATVLSHVNDSGFWLVNRFFNMDVKTTLKTWTVLE
FT                   TTLGLSVFVISLGLWAIA"
FT   gene            530236..531003
FT                   /locus_tag="Mflv_0504"
FT   CDS_pept        530236..531003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0504"
FT                   /product="twin-arginine translocation pathway signal"
FT                   /note="KEGG: mva:Mvan_5923 twin-arginine translocation
FT                   pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42997"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015020"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3M4"
FT                   /protein_id="ABP42997.1"
FT                   /translation="MSITRRDALRYAAAASALAGLNAAAAALAPAASAAAPTLIDFAMR
FT                   QIPAQDIRAAGHSGVINYVSTSRPGSNFGAKPITLPYAKQLTAAGLVIVSNYQYGKPGG
FT                   TAPSDFTRGFAGGVADARTGWALHTAAGGGKSAPIFFSVDDDIDRQAWNDLALPWFRGI
FT                   NSVIGVQRTGIYAGIRPCQWATADGVIGRSGTPGRVWAWQTRSWSNGQIYPGAVLYQRI
FT                   IDTASNPGPIVGGIRVDVNDVLAQDCGQWNLHP"
FT   sig_peptide     530236..530340
FT                   /locus_tag="Mflv_0504"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.904 at
FT                   residue 35"
FT   gene            complement(531010..532104)
FT                   /locus_tag="Mflv_0505"
FT   CDS_pept        complement(531010..532104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0505"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_5924 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42998"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3M5"
FT                   /protein_id="ABP42998.1"
FT                   /translation="MTGVRHRLRQAVCGAAAACLVAVTAIGDVHADPASDALATLNDLS
FT                   QQAVQSREALTSAQRDADVKFAEQAAADDRHRADRAALDAANAELDPLQNAVDRMAAMD
FT                   YTSGRNGQGAAVLTASSPQNLIDRLSLQRTVGARMAENMKAYRAARERAVVAAQASEKS
FT                   SADARAAAEHAEVVRAELQAKLGELLRQIAAAEAQYAALTPQQQAIVDAAPPPAAAPAP
FT                   PILALPGIPPGDVAPPPAAPILDIPEALPMGVAVEAGLQPNAILAARAVSHQFPQIAEI
FT                   GGVRPDSKPWHPSGLAIDIMIPNHGSPEGIALGDQIMAYAMANAARFGLQDVIWRGTYY
FT                   TPAGPQASGYGHFDHVHITVMPRR"
FT   sig_peptide     complement(532009..532104)
FT                   /locus_tag="Mflv_0505"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 1.000 at
FT                   residue 32"
FT   gene            532417..540867
FT                   /locus_tag="Mflv_0506"
FT   CDS_pept        532417..540867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0506"
FT                   /product="putative outer membrane adhesin like protein"
FT                   /note="TIGRFAM: putative outer membrane adhesin like
FT                   protein; KEGG: pub:SAR11_0932 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42999"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="InterPro:IPR010221"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3L8"
FT                   /protein_id="ABP42999.1"
FT                   /translation="MGVSRCIGRVGALAVALGVGTAVTFPHTALADEGAGSNGSVSSSS
FT                   RESTSGATGTSDRESSSSPSKPAATRPSDSDDTETSGPDGDEPNADGSEPTEEDTEPSS
FT                   TPATSPEPPADPVVEDTTDEALADPDPAESLAPSTLHPESGSTPEPVHSITATTVADLP
FT                   TSAPPEEPASQPPRTDVPAAYPRTSPAIQAPASSVGALSTPVSQPVSLVGALVSTVLAP
FT                   FSGGAPAAPSQPPLLWVVLAWVRRELQRTFANSTPTTTPQSVTLTLDSATSVSAPIEFD
FT                   ADDVDDDPLVYTVPGRGAVGGPTHGTVTVDQTTGTFTYNPDDAYALIGGTDTFTYTVSD
FT                   AGARRTFFGIPLSRSATTATGIVTVTLNPVHVAPVTNGDTATTVEDRPVTIAVLGNDTD
FT                   ANGDALTVSGVTQGTSGTVTFTASGVTYTPNADFTGTDTFTYTATDGRSAGTATVTVTV
FT                   TPVDDAPVAVGDSVTVAEDSGTTVIDVLANDIDVDGGPKVVTGVTPPAHGTVTAIGPSL
FT                   SYTPAADFDGTDAFTYTLNDGSTATVTVIVTPVDDKPVAVGDTVTVAEDSSPTVIDVLA
FT                   NDTDIDAGPKTITGVSQPAKGNVVVTGTTVIYTPTADFTGTDTFTYTLNGGATATVTVT
FT                   VTPVDDAPVTVGDTATVAEDSGPTIIDVLANDTDIDAGPIAITAVTQPVDGTVTFTASE
FT                   VTYTPGADFHGTDTFTYTLNGGATATVTVTVTPVDDAPVTVGDAVTVAEDSGPTIIDVL
FT                   VNDTDIDAGPIAITAVTQPVDGTVTFTASEVTYTPGADFHGTDTFTYTLNGGSVAVVTV
FT                   IVDRVDDTPIAFGDSVTVAEDSGPTTIDVLANDTDIDNGPIAITAVTQPTNGTIDFTVS
FT                   RVTYTPGANFHGTDTFTYTLNGGATATVTVTVNAAPVIGQVTTTPGVGNTWEVSVSADD
FT                   SENDTLTTTVTSADPTVPLTVTKQTDGTFQVVADPTWASAHPAAQIAVTVTVTDTYGSS
FT                   ATITTAIGTANNVISLGWDATGVGNVPALPAGVSYTQVAGGAFHTVFLRSDGSVVGAGQ
FT                   NNYGQLDIPPLPTGITYTQVAAGAWHTVLLRSDGTVVAVGDNFKGQIDIPEPGLGVSYT
FT                   GVAAGELGTILLRSDGTAVAVGDGQYGQLEIPTLPPGVRYTQAAIGSVRSALLRSDGTV
FT                   VTVGMNDAVPTLPAGVRYISVASGAGHAVLLRSDGVAVAFGANDWGQTDIPALPAGVVY
FT                   VNIAASRYHSVLLRSDGTSVAAGQNTSEQLDIPVLPVGVTYTGGAAGGYSTWLISSTTA
FT                   TPFNTPPVAVDDAMTVAEGNTATISVTANDTDADGTIDTATVVITRQSTAGSVAVNAAG
FT                   TVTYVSNGTEVTADSFAYRIDDALGATSNEATVFITITPVDDAPVAVNDAVTVAEGGTI
FT                   TIAVIGNDTDADGTIDTTTVVIVTQPTAGTATVNGDGTVTYVSDGSEVTSDSFTYTVKD
FT                   TAGLTSNVATVSITVNPVNDAPVAVNDAYTVAENGLLVIDAPGLLGNDLDSEHPFIYIT
FT                   TITNPRHGTFDGILSDGSFTYRPHAGYFGTDSFTYQINDVTGLTSNTATVTITITPVDD
FT                   APVAVNDAVTVAEDSGTTVIDVLANDTDIDAGPKTITSITQPNSGTTTITATGVAYTPN
FT                   ENFHGTDTFTYTLNGGTSAEVTVTVTPVNDAPVAPDKVVTISEDTWSVAIHLTDGATDV
FT                   DGDPLRRGYVTYPAIGSTFVDSDNLGIQRLLRYYPPANYTGQITIPYTVWDGQVFSNWA
FT                   TITINVTPVNDVPVAVNDSAAVDAGGTTTITLTANDTDVDTDNGVDPATIVIGTQPSAG
FT                   TVTVNSDGTVTYTSTGTTTTTDIFTYTVEDTTGLVSNPATVTVNVTATATPPVAVNDTV
FT                   TVDEGGTTTLAVIANDTDADGDIDTATVVIVRQPTAGTATVNSDGTVSYASDGSEITTD
FT                   SFEYTVRDVAGAVSNAATVIITVTPVDDAPVAVNDTVTITEDTLATFIDVLANDTDIDG
FT                   GPKTITSITSPAGGHALVIGNRVRYFSAPNFHGTETFTYTLNGGATATVTVIVTPISEA
FT                   PVIHRVTSTPGVGNTWVLSVDASDDDGGALTTTVTSANATVPLTITRLPGGAIQVDIDP
FT                   TWARAHPGAQLPVTVTVTDAENISATKQLTIGTVSNAVFFGHNIYGQRNIPALPEGVTY
FT                   TQVATASLSHTVLLRSDGTAVAVGDNFRGQLNIPPLPTGMTYTQVANGTEHTVLLRSDG
FT                   TAIAVGNNSDGQLNIPRLPAGVTYTRIAAGNYGTVLLRSDGTAVGAGYNTYGQLNIPQP
FT                   PPGVTYTQAAVGLTHTVLLRSDGTAVALGDNAFGQTVIPALPTGLKYTQVAAGDLHSVL
FT                   LRSDGSVVAFGNNQWGQSTVPALPAGLRYTQVAAGRYNSMLLRSDGTAIGFGQNASSQL
FT                   NIPVLPAGLVYTQAAASNHTVLLFSTSSSFNSLPLATNDAATVAEGGTITFSVTANDTD
FT                   TDGTLNTATVVITRQPTSGSVTVNAGGTVTYVSNGAEVSADSFAYRVNDNKGATSNEAT
FT                   VSITITPVNDAPVAVDDAYTVAKNGVLVISAPGLLANDSDPEGNSFTIVAATGTQHGTV
FT                   DPLYSNGSFTYRPAAGYSGTDTFTYTISDGTSTAQATVTIAVSAVDNQAPVAVADSYTV
FT                   AEDGVLNVTGPGVLANDTDADGDPLSVVAAGPTSHGTFTLRSDGSFTYTPVANFHGTDS
FT                   FTYQVSDGSGPSAPATVTITVTPVNDAPVVQNDTIPFPKDGFIGFSLANRSSDVDGDTL
FT                   TATLISGTTHGTLFFDGTNRAFSYRPNTGFTGQDSFTYKVNDGTVDSAIATVTLNVS"
FT   sig_peptide     532417..532512
FT                   /locus_tag="Mflv_0506"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 1.000 at
FT                   residue 32"
FT   gene            540887..542086
FT                   /locus_tag="Mflv_0507"
FT   CDS_pept        540887..542086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0507"
FT                   /product="conserved hypothetical ABC transporter
FT                   periplasmic solute-binding protein"
FT                   /note="KEGG: sme:SMb20158 hypothetical ABC transporter
FT                   periplasmic solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43000"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3L9"
FT                   /protein_id="ABP43000.1"
FT                   /translation="MHTNLSRMRRVTLAGAVLALLVTACAPSDPTTGTGTGTGTTPSPL
FT                   AQKTTQPDEDPANFDLDALIAAARTEPGITVYDQTGKVVDTAKAFAAKYGLDATGVKVE
FT                   LGVIDKVLQENESGDVIGDVVVNEDLPSYAVELLDQGVLVNWVPGDMKDTINPEDQYPL
FT                   VVHYGPMGWAYNSQTYDSCPVSNIWQLTDTEFNGRVAIADPLSNPKYPYWFNSMALNDD
FT                   AALREAYTQHFGTDLETDQPDAAHEWVKRLAQNNPMITPTDEEVSEAVGAPDQKEPSFG
FT                   PMSMAKFRNNADKGYHLALCDGMKPWTLQSFPSAIAYASKTDSPNAAKLYIHYMLTEEG
FT                   FALQLADGKPSSNSEVPAPKDPSGVAELLDQMAPLRSADLVSDYRNKSAWDDFWRTSHN
FT                   "
FT   sig_peptide     540887..540967
FT                   /locus_tag="Mflv_0507"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.312 at
FT                   residue 27"
FT   gene            542209..542682
FT                   /locus_tag="Mflv_0508"
FT   CDS_pept        542209..542682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0508"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mkm:Mkms_5175 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43001"
FT                   /db_xref="InterPro:IPR025358"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3M0"
FT                   /protein_id="ABP43001.1"
FT                   /translation="MCWQCDHPEATRADYHDVLRRKILAHGWAVQYVGSERTPFGYTIG
FT                   LHPAGLPELLVAGLPPETTLKILNTLAGYMVREVEPAPGDTMQLADEWHGEFVAVAEPH
FT                   AHMGLGLELYGPALRGLQFVWRDRDGHTPWCPDFNKGGLRQPVLGNRSAALSP"
FT   gene            complement(542672..543109)
FT                   /locus_tag="Mflv_0509"
FT   CDS_pept        complement(542672..543109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0509"
FT                   /product="cyclase/dehydrase"
FT                   /note="PFAM: cyclase/dehydrase; KEGG: mkm:Mkms_4586
FT                   cyclase/dehydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43002"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3M1"
FT                   /protein_id="ABP43002.1"
FT                   /translation="MAITENREIVIEATRDEILAVLYDLESLTEWSSAHQTVEILERDE
FT                   EGRPKRSRQVVKIVGVSDDQILDYHVYDDGVGWTLVRSDQQRAQEARYRLTQEGESTRV
FT                   RLELMVDLKAPLPGFLVKKGAKGLMDTATHGLRKRVLKIKG"
FT   gene            complement(543128..543508)
FT                   /locus_tag="Mflv_0510"
FT   CDS_pept        complement(543128..543508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0510"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0158 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43003"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3L5"
FT                   /protein_id="ABP43003.1"
FT                   /translation="MWTVDRTLDAPADTVWQILTDLEAWPRWGLTVAKAEMDGSAFELG
FT                   STGRVWTPVGVPLPFVISELDQGRTWAWNVAGVPATRHGVEPRENGSRAWMSAPVWAPA
FT                   YLPVLSLALRRIDEMAAQFRTG"
FT   gene            complement(543535..544314)
FT                   /locus_tag="Mflv_0511"
FT   CDS_pept        complement(543535..544314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0511"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0157 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43004"
FT                   /db_xref="InterPro:IPR041526"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3L6"
FT                   /protein_id="ABP43004.1"
FT                   /translation="MGTRAYLGYRGDDAKTPWGEFFNPEMAPLPAHVVDALHHGPQADQ
FT                   VLLGFDSAAELLEAGYHQTETGYGHLPNGAFQVSVRTDMPGVTPRMWDWWFGWHGTDTR
FT                   RYKLWHPRAHASARWADGGGDGHYVGRTSLIEEYLGSSYAKAAIRFVEPDKIGVPAQRL
FT                   GDSVAVCARLGSSEVPVDIGWFVHHIRRTPQGAEMRSRFWMGGPYVGVRHGNLFANSMV
FT                   RPVAARQLPDPRDLLVHCAQEMNHLAGFLPALHARFG"
FT   gene            complement(544314..544484)
FT                   /locus_tag="Mflv_0512"
FT   CDS_pept        complement(544314..544484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0512"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="KEGG: mva:Mvan_0156 FAD linked oxidase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43005"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3L7"
FT                   /protein_id="ABP43005.1"
FT                   /translation="MRDRAIAAVPYVPADLETWYAGIMSNYPDRHRYAADNMWTCASAD
FT                   ELMPGSRMGRI"
FT   gene            544857..546062
FT                   /locus_tag="Mflv_0513"
FT   CDS_pept        544857..546062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0513"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   cef:CE2553 insertion element conserved hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43006"
FT                   /db_xref="GOA:A4T3L1"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR024473"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3L1"
FT                   /protein_id="ABP43006.1"
FT                   /translation="MPRAGWRKPESDRRLSDLVSVGVLTRVFPPAMVDEVIEATGRTQV
FT                   RHRALPARVMAYFAIGMGLYSDGSYEDVLSQLTDGLAWASGWREQYQLPGKSAIFQARE
FT                   RLGSQPLAALFARVARPLGAADTPGTWVAGRRVVAIDGTCLDVADSPVNEEFFGRPGVN
FT                   KGEKSAFPQARLLAVAECGTHAIFAATIGAYRDAESTMVEHVLDALTPEMLVLADRGFF
FT                   SYALWRNASDTGADLLWRVSTGRNGPTPTHVEDLADGSWLAHLRAAKDRHGEPMLARVI
FT                   DYTVDDGRDNPVAYRLLTTLTDPDTAPAVELAAAYAQRWEIESVFDELKTHQRGSKVVL
FT                   RSKSPDLVLQEIWGYLCCHYAIRSLMSQAAHHSGHDPDRLSFTAALRVVRQSVAHQGAF
FT                   SP"
FT   gene            complement(546275..546937)
FT                   /locus_tag="Mflv_0514"
FT   CDS_pept        complement(546275..546937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0514"
FT                   /product="O-methyltransferase, family 3"
FT                   /note="PFAM: O-methyltransferase, family 3; KEGG:
FT                   mva:Mvan_0154 O-methyltransferase, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43007"
FT                   /db_xref="GOA:A4T3L2"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3L2"
FT                   /protein_id="ABP43007.1"
FT                   /translation="MTTSEWASLDNLFTSVLHSEDDVLRAARESADAAGMPPIEVSAQH
FT                   AKLLSLLVRMSRARRVLEIGTLAGYSTIALARAVGEGGTVVTLEFEQRHAEVAGQNLER
FT                   AGVADKVEIIVGAALDSLPTLQQRGESFDLVFIDADKENNVSYVEWAITLGHPGTVIVV
FT                   DNIARSGRVLDPAPDDAQATAIRAMFDMMGADPRLDTAAIQTVGTKGWDGFAVALVR"
FT   gene            complement(546960..547451)
FT                   /locus_tag="Mflv_0515"
FT   CDS_pept        complement(546960..547451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0153 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43008"
FT                   /db_xref="InterPro:IPR027595"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3L3"
FT                   /protein_id="ABP43008.1"
FT                   /translation="MTRDAQRAKVYAAEGFVRTMFDRAAERGDPVADFFGTHLTLPPEA
FT                   RFASAESVQTYVDDVLAHPAVRERWPAAGAVRVRARRGASAAHYESAGGEATIAVPHGR
FT                   DTWALRELVVLHELAHHLCPSDPPHGPEFVAAHCELAGAVMGPEVAHVLRVVYAKEGVR
FT                   "
FT   gene            complement(547448..548200)
FT                   /locus_tag="Mflv_0516"
FT   CDS_pept        complement(547448..548200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0516"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0152 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43009"
FT                   /db_xref="InterPro:IPR024498"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3L4"
FT                   /protein_id="ABP43009.1"
FT                   /translation="MSTDEKMLGRIAALLRQAEGTDNAHEAEAFMAAAQRLATATSIDL
FT                   AVARSHGDKRTRAQTPVQRTITIGEPGARGLRTYVQLFVVIAAANDVKCDVASNSTFVY
FT                   AYGFDEDIDASHTLYTSLVMQMVRASTEYISSGAHKPTPTITARLNFQLAFGARVGQRL
FT                   AEAREQAQQEAKSGPSAIPGTAIALRNKDLELKDYYRKASKARGTWRATSATAGYSSDA
FT                   RRAGDRAGRRARLGGDTELTGARSALER"
FT   gene            complement(548282..549280)
FT                   /locus_tag="Mflv_0517"
FT   CDS_pept        complement(548282..549280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0517"
FT                   /product="putative secreted protein"
FT                   /note="KEGG: mva:Mvan_0151 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43010"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3K7"
FT                   /protein_id="ABP43010.1"
FT                   /translation="MKKLAVVVFSVLLLVVGCGRGEDSAEQSGWTDEEVTFEADGLTLH
FT                   GTYRHRAEGEPAPAALLLSESGGTDRNGDNVVAGPIGNMRQLAELLSDRGVASLRYDKV
FT                   GTGRTGLGPFQDRPTEVVSAVYTSGAKAAVRFLADRPATDPERISVYALGEGTVHALAL
FT                   AGDTLPDAPKVHSLGLFQPLPGRYLDIITNRVTADGTPETIATWRAAVEEIRTKGTVPD
FT                   TLPDGLNSIVNPGNIAAVIAADEVDPVALAAAVPAGTPVLLTCSDSDSQARCDAVKPLI
FT                   DALAHTDLTVVELKGVNHVLRDDPTDNIANYAKQDPLSEQLVTALDDFAGK"
FT   sig_peptide     complement(549206..549280)
FT                   /locus_tag="Mflv_0517"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.989) with cleavage site probability 0.533 at
FT                   residue 25"
FT   gene            complement(549277..550110)
FT                   /locus_tag="Mflv_0518"
FT   CDS_pept        complement(549277..550110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0518"
FT                   /product="Acylglycerol lipase"
FT                   /EC_number="3.1.1.23"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mva:Mvan_0150
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43011"
FT                   /db_xref="GOA:A4T3K8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3K8"
FT                   /protein_id="ABP43011.1"
FT                   /translation="MTHSERSFDGLGGVRIVYDVWTPESDSRGVVVLAHGYAEHARRYD
FT                   HVAARFAESGLITYALDHRGHGRSGGKRVYLRDITEYTGDFHTLVGIARNAYPHLKLIV
FT                   LGHSMGGGVVFTYGVEHPDDYDAMVLSGPAVNAHDSVPAVKLVMAKVLGRIAPGLPVEN
FT                   LPADAVSRDPQVVSDYENDPLVHHGKLPAGVGRALIAVGETMPARAAAITAPLLVVHGD
FT                   KDRLIPVAGSRQLMECIGSPDAHLKVYPGLYHEVFNEPEKELVLDDVTSWIESKL"
FT   gene            550171..551193
FT                   /locus_tag="Mflv_0519"
FT   CDS_pept        550171..551193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0519"
FT                   /product="RNA polymerase, sigma subunit, ECF family"
FT                   /note="PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70, region 4 type 2; KEGG:
FT                   mva:Mvan_0149 RNA polymerase, sigma-24 subunit, ECF
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43012"
FT                   /db_xref="GOA:A4T3K9"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014305"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3K9"
FT                   /protein_id="ABP43012.1"
FT                   /translation="MSHPMRKLLFVTVLALDEGGAKDAFLADAQKYRRELLAHCYRMTG
FT                   SLHDAEDLVQETYLRAWKSYDRFEGKSSVRTWLYRIATNTCLTALDGRKRRPLPSGLGG
FT                   PSADPYADLTERHEIAWLEPIPDDPHEDPADPSVIAESRESVRLALIAALQHLSPRQRA
FT                   VLVLREVLQWKAAEVGEVIGASTAAVNSLLQRARAQLDEVAPSRDDQPVSPESPQAAEA
FT                   LAKYIAAFEDYDMDRLVELFTADAVWEMPPFDGWYSGPADIIALSKYHCPAAGAGDMRF
FT                   LRTTANGQPVAALYMRNPETNVHEAFQLHVLDLRTRGIAHVVAFMDVSLFRKFGLPETL
FT                   "
FT   gene            complement(551196..551648)
FT                   /locus_tag="Mflv_0520"
FT   CDS_pept        complement(551196..551648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0520"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; regulatory protein,
FT                   ArsR; KEGG: mva:Mvan_0148 transcriptional regulator, MarR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43013"
FT                   /db_xref="GOA:A4T3L0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3L0"
FT                   /protein_id="ABP43013.1"
FT                   /translation="MEWLSDEQQRIWRDYLAMVSKLHTAMHRQLQQDCELSLSDYDVLV
FT                   ALSERGPMRINELGELIGWEQSRLSHQLRRMRGRGLVEREGDGDDRRGATVALTDAGLA
FT                   AVQTAAPGHVDLVRTVVFDGLSKAEERAFGATIAAVLERLNARSAG"
FT   gene            complement(551724..552077)
FT                   /locus_tag="Mflv_0521"
FT   CDS_pept        complement(551724..552077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0521"
FT                   /product="protein of unknown function DUF732"
FT                   /note="KEGG: mva:Mvan_0569 protein of unknown function
FT                   DUF732"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43014"
FT                   /db_xref="InterPro:IPR007969"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3K2"
FT                   /protein_id="ABP43014.1"
FT                   /translation="MKRVFVAVAAATAVLGVIAPPAGADTVAYLVNVHVRPGYNFPNAE
FT                   AAIGYGRTICDRVAAKMNYAQLVDQVKADFRTSDYYQGAYLINQAVNELCPAQIWQLRQ
FT                   SAAGYTYSASITG"
FT   sig_peptide     complement(552003..552077)
FT                   /locus_tag="Mflv_0521"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            complement(552089..552577)
FT                   /locus_tag="Mflv_0522"
FT   CDS_pept        complement(552089..552577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0522"
FT                   /product="Cupin 2, conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2, conserved barrel domain protein;
FT                   KEGG: mkm:Mkms_1750 cupin 2, conserved barrel domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43015"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3K3"
FT                   /protein_id="ABP43015.1"
FT                   /translation="MTLSRDELDEFAKSMARAGGRDSQHVGEKHLVVSSAEAHWIQTAS
FT                   PSQIGLLLRIPARSIEIFLQKIPAGEASDLHRHVHESIHFVQHGSGWSEIGDQRVRWSA
FT                   GSFVYTPPWIWHRHYADDGRDVEMIVIENSRLLAAVDASQRESMGNASFADAFGANTE"
FT   gene            complement(552788..553381)
FT                   /locus_tag="Mflv_0523"
FT   CDS_pept        complement(552788..553381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0523"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mkm:Mkms_1749 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43016"
FT                   /db_xref="GOA:A4T3K4"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3K4"
FT                   /protein_id="ABP43016.1"
FT                   /translation="MCNSTHEKRPRGDQLYARRPNPGAMKMVREPSGGRRLRHPLTLTV
FT                   GIVAVLGVQALLITPAAHGDNKRLNDGVVANVYTIQRQAGCVSDIKISPSLQLAAQWHA
FT                   RDALTNRNVNGDVGSDGSTLQQRAEAAGFSGAVSETVAINPALAFSGIELINQWYHDPV
FT                   DLAVMSDCSNTRIGVWSENSVDRTVVVAVYGKPQ"
FT   gene            complement(553374..554108)
FT                   /locus_tag="Mflv_0524"
FT   CDS_pept        complement(553374..554108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0524"
FT                   /product="NAD-dependent aldehyde dehydrogenases-like
FT                   protein"
FT                   /note="KEGG: mkm:Mkms_1748 NAD-dependent aldehyde
FT                   dehydrogenases-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43017"
FT                   /db_xref="GOA:A4T3K5"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3K5"
FT                   /protein_id="ABP43017.1"
FT                   /translation="MQRILLHVYKFHDATASSRTKVSMIVVANPRKIGAQAGPLVSHAQ
FT                   PERVCRNIASTEGTKFSGGEPSQPDELPGYFAASTIVATLERASAVVQDMQDDIVGSVL
FT                   TLKEFDDEVQAISLANATPYGLAVAVWTRLNDAAIGLSREATAGFTWFNGSRKNSPEMS
FT                   CSGVDNPGCTIAGAAKETRIFGSYDPYPARQSWRIHRSAAVSSILAGPPAAADWIPSIF
FT                   DQCDEAAGGILADYGIGDVSCV"
FT   gene            complement(554173..554895)
FT                   /locus_tag="Mflv_0525"
FT   CDS_pept        complement(554173..554895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0525"
FT                   /product="butyryl-CoA:acetate CoA transferase"
FT                   /EC_number="2.8.3.8"
FT                   /note="KEGG: mkm:Mkms_1747 3-oxoacid CoA-transferase, B
FT                   subunit; TIGRFAM: 3-oxoacid CoA-transferase, B subunit;
FT                   PFAM: coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43018"
FT                   /db_xref="GOA:A4T3K6"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3K6"
FT                   /protein_id="ABP43018.1"
FT                   /translation="MTRTVDASTRACVEHLDRGPLDRREIAAMIARDIPAGSYVNLGIG
FT                   QPTMVADFLDPAAGVVLHTENGMLGMGGEAIGDAIDPDLTNAGKIPVTETPGASYFHHA
FT                   DSFAMMRGGHLDVCVLGAFQVSERGDLANWHTGAPDAIPAVGGAMDLAIGAKSVLVMMT
FT                   LFAKDGTAKLVPSCSYPLTGLRCVNRVYTDYAVFDIDHTGGGQLRVLHTFGLSIAALEE
FT                   RMRMALSCDGRVADLRQC"
FT   gene            complement(554892..555590)
FT                   /locus_tag="Mflv_0526"
FT   CDS_pept        complement(554892..555590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0526"
FT                   /product="3-oxoadipate CoA-transferase alpha subunit"
FT                   /EC_number="2.8.3.6"
FT                   /note="KEGG: mkm:Mkms_1746 3-oxoacid CoA-transferase, A
FT                   subunit; TIGRFAM: 3-oxoacid CoA-transferase, A subunit;
FT                   PFAM: coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43019"
FT                   /db_xref="GOA:A4T3J7"
FT                   /db_xref="InterPro:IPR004163"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3J7"
FT                   /protein_id="ABP43019.1"
FT                   /translation="MSRTVVCDRAEDAVAGIEDGATVLVGGFGMAGMPTTLIDALIRQG
FT                   AADLTIVSNNAGNGDTGLAALLAAGRVTKVICSFPRQADSYVFDALYRAGKVDLEVVPQ
FT                   GNLAERIRAAGAGIGAFFCPTGVGTPLVEGKEIRTIDGRDYVLEYPIFGDVALIGAHVA
FT                   DQVGNLLYRKTARNFGPVMATAALLTVVEVSRVVDTGQIDPETVVTPGIYVDRVLDLSA
FT                   IPETSTEAAS"
FT   gene            complement(555587..556768)
FT                   /locus_tag="Mflv_0527"
FT   CDS_pept        complement(555587..556768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0527"
FT                   /product="4-carboxymuconolactone decarboxylase /
FT                   3-oxoadipate enol-lactonase"
FT                   /EC_number="4.1.1.44"
FT                   /EC_number="3.1.1.24"
FT                   /note="TIGRFAM: 4-carboxymuconolactone decarboxylase; PFAM:
FT                   alpha/beta hydrolase fold; Carboxymuconolactone
FT                   decarboxylase; KEGG: mkm:Mkms_1745 4-carboxymuconolactone
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43020"
FT                   /db_xref="GOA:A4T3J8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR012788"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3J8"
FT                   /protein_id="ABP43020.1"
FT                   /translation="MSNPPLTAIHLGGPDDGPLLLLGPSLGTTTATLWTGVAQRLVDHV
FT                   RVVGWDLPGHGRGRRAHPFTIADLAAAVLVIADDLNVETFHYAGDSVGGCVGLQLLLDA
FT                   PQRVSSATLLCTGAAIGTPDGWLARAATVRAGGVDTMLTGAAERWFAPGFVDREPGTAS
FT                   ALLDALSHTDAESYAQVCEALAVFDVTDRLSEIVTPVLAVAGSADSPTPPESLRRIASD
FT                   VKDGDVVVLEGVGHLAPAEAPERVAGLIAEIVGVPQPPSKTLEDVHRAGMAVRREVLGH
FT                   AHVDRAVAGTTDLTADFQHMITQYAWGSIWTRPGLDFRSRSMITLTALVARGHHEELAM
FT                   HLRAARRNGLSNDEIKELLLQTAIYCGVPDANSAFRIAAEVLPEFDEHPGAPS"
FT   gene            complement(556765..557970)
FT                   /locus_tag="Mflv_0528"
FT   CDS_pept        complement(556765..557970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0528"
FT                   /product="3-carboxy-cis,cis-muconate cycloisomerase"
FT                   /EC_number="5.5.1.2"
FT                   /note="PFAM: fumarate lyase; KEGG: mkm:Mkms_1744 fumarate
FT                   lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43021"
FT                   /db_xref="GOA:A4T3J9"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3J9"
FT                   /protein_id="ABP43021.1"
FT                   /translation="MIDLFWPGDDLAGDLMSDGAFLSAMVAVEQAWLDGLVDAGIAPRQ
FT                   ARADLTILLADGDAATIARRAGADGNPVSALVLMLRERSAEPTARWLHRGLTSQDVVDT
FT                   ALMLCTRDVLIRIGDEFAIQVRALTELAETHRDTSALARTLTQAALPSTLGAKFARWLT
FT                   GVLDAAEPIAGLMASLPAQVGGAVGSLAAATELAGSVEGAIALSDGLAATLRLAPTPPW
FT                   HTTRWQVTRIGDALVSCCDAWGHIATDVTTGCRPEIGELAEGHGGGSSTLPHKNNPVRS
FT                   VLIRRAALTAGPLGSILHTAAGATVDERSDGAWHTEWATLRTLARHTVVAAAHTSDLLS
FT                   GLRVDPPRAAANLAAAESLLSEQRSMTELTGRAALPGYTGAADRLIDSTLGRACRFVKD
FT                   AP"
FT   gene            complement(557967..558536)
FT                   /locus_tag="Mflv_0529"
FT   CDS_pept        complement(557967..558536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0529"
FT                   /product="protocatechuate 3,4-dioxygenase, alpha subunit"
FT                   /note="TIGRFAM: protocatechuate 3,4-dioxygenase, alpha
FT                   subunit; PFAM: intradiol ring-cleavage dioxygenase; KEGG:
FT                   mva:Mvan_0561 protocatechuate 3,4-dioxygenase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43022"
FT                   /db_xref="GOA:A4T3K0"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012786"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3K0"
FT                   /protein_id="ABP43022.1"
FT                   /translation="MSTLLPATPGQTVGPFFGYALPFDRCNELVPPGSPNAVQLHGVVA
FT                   DADGRGLPDALLEIWQADADGTIPNASGSLHRDGWTFTGWGRATTDEAGRYTFTTVIPG
FT                   VTEPVVAPFISITVFARGLLNRLFTRAYIPGKQLENDSLLNTLTPERRDTLIATRDQTG
FT                   LRFDIQLQDTPDKPETVFLRYPGHQR"
FT   gene            complement(558536..559486)
FT                   /locus_tag="Mflv_0530"
FT   CDS_pept        complement(558536..559486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0530"
FT                   /product="protocatechuate 3,4-dioxygenase, beta subunit"
FT                   /note="TIGRFAM: protocatechuate 3,4-dioxygenase, beta
FT                   subunit; PFAM: intradiol ring-cleavage dioxygenase; KEGG:
FT                   mmc:Mmcs_1698 protocatechuate 3,4-dioxygenase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43023"
FT                   /db_xref="GOA:A4T3K1"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012785"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="InterPro:IPR024756"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3K1"
FT                   /protein_id="ABP43023.1"
FT                   /translation="MPLVEGAENVQQTRGDSGSRRRSVPCQLWMAFPLSGILPFASLNV
FT                   VGTVGAVTTLIDSNPDGAVASQSEISAEIGAIESAYQRAGVEETQPRLSYPPYRSSLLR
FT                   HPTKDLHHADPEGVELWTPCFSERDVHPLEADLTVQHSGEPIGERLVVTGRVVDGAGRP
FT                   VRRQLVEIWQANAGGRYIHKGDQHPSPIDPNFTGAGRCLTDEDGIYRFTTIKPGPYPWK
FT                   NHRNAWRPAHIHFSLFGTEFTQRMVTQMYFPGDPLLCLDPIFQAIPDQKARSRLVASYD
FT                   HELSTHEWATGYRWDVVLTGSARTPIENLGRGAHR"
FT   gene            559508..560155
FT                   /locus_tag="Mflv_0531"
FT   CDS_pept        559508..560155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0531"
FT                   /product="regulatory protein, IclR"
FT                   /note="PFAM: regulatory proteins, IclR; KEGG: mkm:Mkms_1741
FT                   regulatory proteins, IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43024"
FT                   /db_xref="GOA:A4T3J3"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3J3"
FT                   /protein_id="ABP43024.1"
FT                   /translation="MARRAGLPIATTHRLAAELVAGSALQRRADGQYVVGRLVWNAGLL
FT                   APVEGQLRQVAEPFLYDVYAATLATVHLAVRDGDEVLYLERMMGRTSVPIVSAVGSRLP
FT                   MHCTGVGKVLLAHAPEDVKDRVFATLTRITPYTIVSPTVLSSQMQRIHREGVATTSEEM
FT                   SLGACSLAVPVIRQTDDAVVAAIAVVVPTLKRDRQRLLGALQVAARGIGRLL"
FT   gene            560430..561407
FT                   /locus_tag="Mflv_0532"
FT   CDS_pept        560430..561407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0532"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   mva:Mvan_0558 dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43025"
FT                   /db_xref="GOA:A4T3J4"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3J4"
FT                   /protein_id="ABP43025.1"
FT                   /translation="MTTTTPLGSDARAWAAENLRGFYMCPVTPLTDEFELDEEGLRQNI
FT                   DAFVEMGCTGLVVGGFFAEGWNMTLAEWQRYHEVVAGATAGRLPLFTIILDHSAYQAIE
FT                   KMRFVESLGFTGAEIMNPSVQLKTDDDVVDYFDFVAPATGLALVLYRTPVSGFVYSHDA
FT                   VARIAEHANVVGIKNGTLSWTDSIALRHRFGDHLVISEPNERYWAHDAALFGGRVLYGE
FT                   LSLILYGKRRQELHQYTDLAFAGELAGALPVSAKVDAIRQVYEEVLIGRIAATGSYVAA
FT                   MPYLKAWFELLGLRAGPVRPPVKARLSAPEREVLQEKLTAAEAI"
FT   gene            561407..562411
FT                   /locus_tag="Mflv_0533"
FT   CDS_pept        561407..562411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0533"
FT                   /product="ketopantoate reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="PFAM: Ketopantoate reductase ApbA/PanE, N-terminal
FT                   domain protein; Ketopantoate reductase ApbA/PanE,
FT                   C-terminal domain protein; KEGG: mkm:Mkms_1739 ketopantoate
FT                   reductase ApbA/PanE, N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43026"
FT                   /db_xref="GOA:A4T3J5"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3J5"
FT                   /protein_id="ABP43026.1"
FT                   /translation="MRVLILGAGGLGSVLGGYLANIGVDVTLVGRPAHTEAITRYGLRI
FT                   TGRRGDLVITDNLTAVDQTAKATGHFDYLVLAVKGKDTAQALAEADGLRDCVSSALSVQ
FT                   NTVEKDATLAGWLGPDRVIGASTIEGGTLLEPGLVRNHLTAEVTAYFGELDGTSSARVD
FT                   DLTAAFTNAGLPAKAVGNIEQVEWEKLAQIALAAAWSVTALGAIPDASVFEGMEVREGA
FT                   MYFVALAKDLLGVYRAKGYEPMNFFAPLSRLKELDALPTADAIEFVIGQGRAMREKGNS
FT                   GHPSMYEDVLRRRKTEVDFMLAPYLAAAQELGMDTPTLRVAYQIIKTVDRFLA"
FT   gene            complement(562437..563546)
FT                   /locus_tag="Mflv_0534"
FT   CDS_pept        complement(562437..563546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0534"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: mkm:Mkms_1738 helix-turn-helix-domain
FT                   containing protein, AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43027"
FT                   /db_xref="GOA:A4T3J6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3J6"
FT                   /protein_id="ABP43027.1"
FT                   /translation="MTQDPESEARPSALVFDGATDSVGELRLPQRESELLPMANGPKMA
FT                   GSYFSRRETVCTEQLSAAEHLASEIFTPHRLRYSRRGQRLNARLSAARIGAVTVGYLRY
FT                   GADVELVNSTALDDYHINVPLTSHADSWCGPATAQATPTQAAVFLPGRPAGIKWAADCG
FT                   QLCVKFSRTDLEYELEGLLGRPAVRPLNITHSMDLTADSSRAWLALLSVLYREVSRPES
FT                   IVQHPMTGRHFEQLVMHGFLHAQPHYQAMALAADQHAAPPPKVLRTALDLIEEHPERSW
FT                   TTTDLAREVGISARALQESFKRHVGLPPLTYLREVRLIRAHAELAASSESAVTVARVAM
FT                   KWGFGHLGRFSAEYRRKFGVTPQHTLRAA"
FT   gene            563864..565070
FT                   /pseudo
FT                   /locus_tag="Mflv_0535"
FT   gene            complement(565420..565938)
FT                   /locus_tag="Mflv_0536"
FT   CDS_pept        complement(565420..565938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0536"
FT                   /product="aromatic-ring-hydroxylating dioxygenase, beta
FT                   subunit"
FT                   /note="PFAM: aromatic-ring-hydroxylating dioxygenase, beta
FT                   subunit; KEGG: mva:Mvan_0547 aromatic-ring-hydroxylating
FT                   dioxygenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43028"
FT                   /db_xref="GOA:A4T3I9"
FT                   /db_xref="InterPro:IPR000391"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3I9"
FT                   /protein_id="ABP43028.1"
FT                   /translation="MVATVEQQLLLRCEMENFLFEEAELLNDGRFHDWLELCAEDIHYI
FT                   IPVRVSRERANGDGNSTTMTHWDDDYAGLELRVLRLDTEYAWAEDPPSRIRHHVSNVRV
FT                   RPGAGTDEYDVRSNLLVFRNRGDSPQHDLISAERHDVIRRSEMGLRLASRRVVLDHAVV
FT                   GTHNLANFF"
FT   gene            complement(566003..567403)
FT                   /locus_tag="Mflv_0537"
FT   CDS_pept        complement(566003..567403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0537"
FT                   /product="ring hydroxylating dioxygenase, alpha subunit"
FT                   /note="PFAM: ring hydroxylating dioxygenase, alpha subunit;
FT                   Rieske [2Fe-2S] domain protein; KEGG: mkm:Mkms_1716 ring
FT                   hydroxylating dioxygenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43029"
FT                   /db_xref="GOA:A4T3J0"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3J0"
FT                   /protein_id="ABP43029.1"
FT                   /translation="MSTVGKNDIQQLVAAGREGLAKGRLPAGLVANAELHKLEAQRVFG
FT                   RCWQFLAHETEIPQAGDYVVRYLGGGSIIVVRGEDGEVRAMANSCRHRGTMLCRTEMGN
FT                   TSHFRCPYHGWTYRNTGTLAGVPAQKEVYGVEMDKNEWSLTQVPRLENYRGMIFGCLDE
FT                   KAEPLVDYLGDMAWYLDLITQKSKGGLEVRGEPQRWIIDSNWKLGADNFVGDAYHTLMT
FT                   HRSAVELGLAPPDPKFASEPAHISLSNGHGLGVLGVTPGQPMPPFMNYPPEVVDGLAAA
FT                   YGDQDRADMLQRSAFIHGTVFPNLSFLNVLIGRDKKSMPVPMLTFRLWRPLSHDTMEVW
FT                   SWFLVEKDADEEFKQQSYETYVRTFGISGVFEQDDAETWRSITAGTQGILAGSQTLNFE
FT                   MGMGVLTSDDTWKGPGRPLSSGYAERNQREFWGRLLELLTDSGDDASETEPKPQLLAQS
FT                   RTNADEVA"
FT   gene            complement(567476..568366)
FT                   /locus_tag="Mflv_0538"
FT   CDS_pept        complement(567476..568366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0538"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: mva:Mvan_0545
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43030"
FT                   /db_xref="GOA:A4T3J1"
FT                   /db_xref="InterPro:IPR000486"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3J1"
FT                   /protein_id="ABP43030.1"
FT                   /translation="MLVKTLGYVGVESPDAKEWLAFGPEVLGMEAVEASSGSVLLRIDD
FT                   ADHRLAVHHGERNRMLYAGWDVGSEEALEAAGELLHKRGIGFEVGTEEDCAARGVLGFL
FT                   TLSDPSGLRHELFYGQKVVPGSFRPGRAISGFVTGAQGLGHVVLATPDLAQADRFLRGV
FT                   LGFKKSDEIYTFMDLWFYHCNPRHHSIALTPMPGVRGLHHVMVEVQSFDDVGMAYDLCM
FT                   SRNIPLSMTLGRHVNDRMVSFYVRTPSGFDIEYGWDAVTVDEETWTVAQYDRPSVWGHQ
FT                   MVAQTPPGALEAATT"
FT   gene            complement(568379..569284)
FT                   /locus_tag="Mflv_0539"
FT   CDS_pept        complement(568379..569284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0539"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mkm:Mkms_1714 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43031"
FT                   /db_xref="GOA:A4T3J2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3J2"
FT                   /protein_id="ABP43031.1"
FT                   /translation="MGRCRATRALRITGGTIVLSWLTGQVALVTGGAAGIGLAVVERFL
FT                   AEGACVGVLDRSEGDLATIGNADGRLIAVTGDVTSYADNVMAVRETVDAFGKLDVFVGN
FT                   AGIFDYFAPLVGFDGADLSSAFDEIFAVNVKGYLLGARAAVPELLKSDGPSMIFTVSNS
FT                   GFYAAGGGPLYTASKHAVVGVVRELAYELAPKIRVNGVAPGGTVTGLRGIEDLGQGQDV
FT                   LSSVPGIADIMSTTNPLQYAQQPADHAGLYLLLASADNSRAVTGVVINSDGVLGVRGLN
FT                   QPSGGTELATGAMRIDVGST"
FT   sig_peptide     complement(569183..569284)
FT                   /locus_tag="Mflv_0539"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.839) with cleavage site probability 0.607 at
FT                   residue 34"
FT   gene            complement(569467..570246)
FT                   /locus_tag="Mflv_0540"
FT   CDS_pept        complement(569467..570246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0540"
FT                   /product="3,4-dihydroxyphthalate decarboxylase"
FT                   /EC_number="4.1.1.69"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: mva:Mvan_0543 class II aldolase/adducin family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43032"
FT                   /db_xref="GOA:A4T3B0"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3B0"
FT                   /protein_id="ABP43032.1"
FT                   /translation="MSSTPSGAGLDTERHAIALACRVLAARDLAPGILGHISLRVDRDR
FT                   LLIRCRGPRERGLAFTSAEDIRMVTLDGTAGGKGELDDGYQPPNELPLHTEVLRTRRDV
FT                   NAVVHAHPEAVVAADLAGLAVRPIVGAFDIPGFRLAAAGVPVYRRGVLVRNRQLAQEMV
FT                   AAMADRPVVVLRAHGLTSAADTVERAVLQAISVDTISRLSLQIASAGGTLADLPDADAA
FT                   ELPDLGNAFNETIAWRHELARLETHGLSCHPSEKRSS"
FT   gene            complement(570780..571733)
FT                   /locus_tag="Mflv_0541"
FT   CDS_pept        complement(570780..571733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0541"
FT                   /product="Extradiol ring-cleavage dioxygenase, class III
FT                   enzyme, subunit B"
FT                   /note="PFAM: Extradiol ring-cleavage dioxygenase, class III
FT                   enzyme, subunit B; KEGG: mmc:Mmcs_1683 extradiol
FT                   ring-cleavage dioxygenase, class III enzyme, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43033"
FT                   /db_xref="GOA:A4T3I7"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3I7"
FT                   /protein_id="ABP43033.1"
FT                   /translation="MGEIVAGYASSHAFTFIPPPRWEGFRTKNRKNYTVRRGKTPPRLR
FT                   KDEEPFDDAAARYAHIENGLQRLRDSIRQDRLDCLIIIGDDQNENFDGSALPQIAIHTG
FT                   DGFTVSDRFLPEARFWKSSPELSKDLSEHTVEAGFDVATVVDFRETTLHSHAHGEIVAN
FT                   ILGDHQIPVVLVFLNAVHVPSLSPKRCFALGRAIADAVRSRRPADERIGVYASGGLSHF
FT                   TAGYPWAAYDGPRVHGSIDDEFDRRTLKCLATGNGYELSKLTSEDLLNSGNIELRSWIC
FT                   AVGAVGGNTPWASVYEPIPRALMGMAVAWTNCEVTV"
FT   gene            complement(571753..572982)
FT                   /locus_tag="Mflv_0542"
FT   CDS_pept        complement(571753..572982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0542"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase,
FT                   C-terminal domain; homoserine dehydrogenase, NAD-binding;
FT                   KEGG: mva:Mvan_0541 oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43034"
FT                   /db_xref="GOA:A4T3I8"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3I8"
FT                   /protein_id="ABP43034.1"
FT                   /translation="MTDVASRELGLGFLGIGQAVARIFQQYPDMSTLPYRVVAAADTRS
FT                   HSLARFATEFSGQTYTNAEQLCADPSVDVVYIATPPELHREHALMAARHGKHMIVEKPL
FT                   AMSIDDCTAMVEAAQAAGVQLMAGHTHSFDAPVRAMAELVASGELGELLMVNTWNFNDF
FT                   NRRPWPTSELRSTSGPVLNQGPHQVDIVRQIVGGVARTVRASTIWDDVRECVGGYTCHL
FT                   GFESGASATLVYDARAFFDVAELHSWVAEDGGRRSPQANQRVANNFAALSQNPDQLEVA
FT                   LEAQKEQGRYGAATTTEESQELWGYSAPGEIIHHPYFGLTVVSCERGAIRQSPDGLVVY
FT                   GQNGLQEIPVARTMRGRAAELAELHRAITEDRPVQHDGRWGRATLEVCFAILQSAYEDR
FT                   EVVLSHQVSL"
FT   gene            complement(573019..573531)
FT                   /locus_tag="Mflv_0543"
FT   CDS_pept        complement(573019..573531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0543"
FT                   /product="aromatic-ring-hydroxylating dioxygenase, beta
FT                   subunit"
FT                   /note="PFAM: aromatic-ring-hydroxylating dioxygenase, beta
FT                   subunit; KEGG: mva:Mvan_0540 aromatic-ring-hydroxylating
FT                   dioxygenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43035"
FT                   /db_xref="GOA:A4T3I2"
FT                   /db_xref="InterPro:IPR000391"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3I2"
FT                   /protein_id="ABP43035.1"
FT                   /translation="METSQLDVELRLRINEFYARETMLLDDGRLDEWLGLLAPDVRYTM
FT                   PFPESSTHPVDDDDGLPPFLLFNDDYESLKLRIARLATGLAPGETPRTITQRLVSDILV
FT                   TDVSDQELSVRSSVMVFLVRHERHESFFIGKRQDVLRRDEDSGLLLAARDITLAHSVLP
FT                   RAISIFF"
FT   gene            complement(573534..574850)
FT                   /locus_tag="Mflv_0544"
FT   CDS_pept        complement(573534..574850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0544"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: ring hydroxylating dioxygenase, alpha subunit;
FT                   Rieske [2Fe-2S] domain protein; KEGG: mva:Mvan_0539 Rieske
FT                   (2Fe-2S) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43036"
FT                   /db_xref="GOA:A4T3I3"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3I3"
FT                   /protein_id="ABP43036.1"
FT                   /translation="METIGSKTGSALPIDSSAFYDEAVYQRELDSIFKRSWLFVGHESM
FT                   IPKPGDFRTTYMADDAVIVCRDKESRVRVLLNKCRHRGNKVCQFDKGNANIFHCSYHGW
FT                   SYDTAGRLRSVPLAESAYGPQFDKASMGLVSPRVATYKGLIFACWDQSAPPLEEYLGEG
FT                   LLWYLDNFLLDCDPNGLQVVPGLHRYLMPVNWKLLAENFGGDQYHFAATHGSVSALSKA
FT                   GQTARINFSIDEGQHYSVVLDGCAPHGLLQLAVGKNFYQDDLAQAETLGTEAVDWLTER
FT                   QRLQDERLATSPVQPYSFHVANIFPNFSMIGMGTAFYGRGFIMWQPRGPRLTEVWEWCL
FT                   VESSAPRAVKERMVFVLSQRQSAAGLVTPDDHENFERLSDALDTGVARDVPFNYSLGED
FT                   VEPMESLVAELPGNVRPQISEAYQREFYRHWHRTMTEPA"
FT   gene            complement(574850..575749)
FT                   /locus_tag="Mflv_0545"
FT   CDS_pept        complement(574850..575749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0545"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mkm:Mkms_5609
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43037"
FT                   /db_xref="GOA:A4T3I4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3I4"
FT                   /protein_id="ABP43037.1"
FT                   /translation="MLKDASICVSLLGAETRFVDVDGVRTRTIQAGEGPDLILMHGGGG
FT                   HAEAFARNVTALSRHFRVHALDLLGHGLTSGCEVAPKRKDYVSHLLGYMDQEGIDRAHL
FT                   VGESLGGWIAAWTALEHPDRVDRLIYVCGARLTLEVGADAEARTAAGRAELARVTRQFL
FT                   ADPSPANVRERMAWLFHHPDRDLTDELVALRWALYQSEESRSALTNATAPPSAATAEDN
FT                   LTAERLTSLTRPTLVLWTSHNPSATVEFGRRAAELIPGAEFALMEDCGHWPQWERPEEF
FT                   NQILTNYLQGDRESRGQR"
FT   gene            complement(576201..576719)
FT                   /locus_tag="Mflv_0546"
FT   CDS_pept        complement(576201..576719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0546"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: mkm:Mkms_5651
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43038"
FT                   /db_xref="GOA:A4T3I5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3I5"
FT                   /protein_id="ABP43038.1"
FT                   /translation="MTTEKLTMAQQVAAKTREAGPDHDPSSLALPLALYRAVTAFGRVA
FT                   VDELTPVDLSMSQFNVLTVLKRADGPITMGALADSISVRQASLTSVVDTLTKAGFVTRK
FT                   MNPRDRRSVVVAISKKGDQFMTEFLPGHYDFLQRLFAGINPRHRQQLLARLNELIDCLE
FT                   NYPSGQRTS"
FT   gene            complement(576885..577763)
FT                   /locus_tag="Mflv_0547"
FT   CDS_pept        complement(576885..577763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0547"
FT                   /product="6-phosphogluconate dehydrogenase, NAD-binding
FT                   protein"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase, NAD-binding;
FT                   KEGG: mva:Mvan_0536 6-phosphogluconate dehydrogenase,
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43039"
FT                   /db_xref="GOA:A4T3H9"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3H9"
FT                   /protein_id="ABP43039.1"
FT                   /translation="MRRVGVIGLGGMGSALAASLLATDHYVVCFDIRPDVLRPIVELGA
FT                   EAAADARELAGACDVVLTFLPGPSQVLEVALGSERGVLAGLADGAALLDMSTCNPEVAA
FT                   IIGQAYDAAGRRFVDCPVSRKAPNMTVLVGGPSGVLGPDADVLAAVSRTLVYCGQRGAG
FT                   YATKLLNQHIKYSWYLASAEALLIAEAMGLNAGDVADAIAECSGGDSGLTTAAAYFRHD
FT                   TESVRNRAPASTITKDSALAERMATNAGIRSRTLEPVVDFFQSVAASEFRDRAYPESTE
FT                   LLQRIRSMPPK"
FT   sig_peptide     complement(577692..577763)
FT                   /locus_tag="Mflv_0547"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.736) with cleavage site probability 0.276 at
FT                   residue 24"
FT   gene            complement(577853..578296)
FT                   /locus_tag="Mflv_0548"
FT   CDS_pept        complement(577853..578296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0548"
FT                   /product="Cupin 2, conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2, conserved barrel domain protein;
FT                   KEGG: mkm:Mkms_5649 cupin 2, conserved barrel domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43040"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3I0"
FT                   /protein_id="ABP43040.1"
FT                   /translation="MSTSLQPKRRADDVTALRVMTEEMRPLLVGDGYQMFDVRAPQSSG
FT                   PPPHQHPWDESYVVLEGELWVSRGGEEATLQVGEAIRVPAGVVHAYRVLSDGARWITTS
FT                   SCPGGALDFFSDVDETSNGPGDVKALIEAAKRNSVRFADPALG"
FT   gene            complement(578396..578950)
FT                   /locus_tag="Mflv_0549"
FT   CDS_pept        complement(578396..578950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0549"
FT                   /product="aromatic-ring-hydroxylating dioxygenase, beta
FT                   subunit"
FT                   /note="PFAM: aromatic-ring-hydroxylating dioxygenase, beta
FT                   subunit; KEGG: mva:Mvan_0534 aromatic-ring-hydroxylating
FT                   dioxygenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43041"
FT                   /db_xref="GOA:A4T3I1"
FT                   /db_xref="InterPro:IPR000391"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3I1"
FT                   /protein_id="ABP43041.1"
FT                   /translation="MSATGGEISTRQDAVEKLLLQAEIADFLYREADLLDERRYSEWLG
FT                   LLTDDYEYSVPLRANVAYDDLAQLEQTQEGHDICWFDEKKETVALRVEQLMTGLHWAEE
FT                   PVSRVSHLVTNVRIEGVDGAEVDVSCRFLVYRNRVADETDLLVGRRKDRLRRVAGDWQL
FT                   CRRRLLLDQTVLLAKNLSIIL"
FT   gene            complement(578947..580362)
FT                   /locus_tag="Mflv_0550"
FT   CDS_pept        complement(578947..580362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0550"
FT                   /product="ring hydroxylating dioxygenase, alpha subunit"
FT                   /note="PFAM: ring hydroxylating dioxygenase, alpha subunit;
FT                   Rieske [2Fe-2S] domain protein; KEGG: mkm:Mkms_5647 ring
FT                   hydroxylating dioxygenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43042"
FT                   /db_xref="GOA:A4T3H4"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3H4"
FT                   /protein_id="ABP43042.1"
FT                   /translation="MTLKMSTSGGSDTTARSLVDVDRGEISREIFTDASIFNRELEYLF
FT                   PRSWLFVGHASQVSAPGQFFSSRMGSDPVLLTRDAQGGVNVLLNSCRHRGMAVCRYDEG
FT                   RALQFTCPYHGWSYSMDGSLVSTPGDLHGVPQQGMAYGNGLDKAAWGLVRAAKVHNYKG
FT                   LVFACWDPSAPEFDEYVGDFHHWLDNLSDAFDGTEGGTEVFRGVQKWRIKSNWKFVSEN
FT                   FLGDTYHGATTHASVEQVGIGPGGRNSRRHGERQDQGGFSKGRVKTSFRMGHGASDNLA
FT                   YEIPYPEFAEEPALSEYFSQAWAVRKERLQAQGRQLGGRGPATMFPNMSFSAGFPRTIL
FT                   VSHPISPTETEVWRWYLIDKNAPDDVRDWLRRYYMRYSGPGGMTEQDDMENWNYATQAS
FT                   QGVIARRYPYNYQQGLDMETPSALDQAVHSHHPIAGEVNARAFYRRWAEFTDNLSWPQL
FT                   IELAKSDERAARS"
FT   gene            complement(580610..580807)
FT                   /locus_tag="Mflv_0551"
FT   CDS_pept        complement(580610..580807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0551"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0532 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43043"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3H5"
FT                   /protein_id="ABP43043.1"
FT                   /translation="MSVIKADVEVCQGYANCVVAAADVFDIGDAGTVVILDDTVAESDE
FT                   ARIVTAIRSCPVSALRLATV"
FT   gene            complement(580838..581884)
FT                   /locus_tag="Mflv_0552"
FT   CDS_pept        complement(580838..581884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0552"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0531 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43044"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3H6"
FT                   /protein_id="ABP43044.1"
FT                   /translation="MAAADELRDRVGEKIHFRGADSVTQNDIRRKLEVFTFSCPLHDDE
FT                   AAAKAHGYLGVVAPVTMTPLWGLPPYWAPGQPSPYLVDGQEMTGNITDTLALPFSRSVN
FT                   VSSEWQYHTPLYLGDRLQGTTTIISVEQKRTRVGTGIFLQYESEYVKVSGELVARNRNT
FT                   VFNYDPDDASRPEPGTSARAQQGDRGPRTRSVDDADTSVDWNTPLQFDDVTVGAQVRGP
FT                   ALALTYQRMVMNIAADRMFSGIHHSAAAAHAAGLADIIFNTRGLETLFETGLRRWMGLR
FT                   GRLVQLGPFKMSASVHPGDVVQARWTVTGKHAQAGADVVDLEFGVFAGDRQAAQGVAAI
FT                   HLNGKKQC"
FT   gene            complement(581871..582329)
FT                   /locus_tag="Mflv_0553"
FT   CDS_pept        complement(581871..582329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0553"
FT                   /product="protein of unknown function DUF35"
FT                   /note="PFAM: protein of unknown function DUF35; KEGG:
FT                   mva:Mvan_0530 protein of unknown function DUF35"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43045"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3H7"
FT                   /protein_id="ABP43045.1"
FT                   /translation="MRRTGPDVAAPPLPSLEGLTAQFYEHCRREELSFQRCSRCDRWRH
FT                   VPRLTCAGCGSNSWSWQRSSGRGVVFSHTVIHRALHPGFDEAVPFVCAVVEMDEGVRMV
FT                   ARIVDLVADGTAMLVDAAVEVVYVHAADDVVLPAFRLPAAEVRGNGRR"
FT   gene            complement(582366..583532)
FT                   /locus_tag="Mflv_0554"
FT   CDS_pept        complement(582366..583532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0554"
FT                   /product="putative nonspecific lipid-transfer protein"
FT                   /note="KEGG: mkm:Mkms_5643 putative nonspecific
FT                   lipid-transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43046"
FT                   /db_xref="GOA:A4T3H8"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3H8"
FT                   /protein_id="ABP43046.1"
FT                   /translation="MSSLRDKACIVGVGHTAYRRDGTESATDLGLQLEAAHAAIVDAGL
FT                   SAGEIDGLICPINGGTAEDFIANLGLTHVRYAVTSHTGGAASVAGLATAAMAVWSGVAR
FT                   HVLIPAGWCGYSGPRARGMASSADMAIGKVVRDYYAPQGAVSAVHQYALVADRYVRKYD
FT                   VPPEAMGAVAVAFRANAQLNSNAVMCGRELTMQDYLDAPPISTPFRLFDCSLETDGAAA
FT                   VVVSAADRAADSPHRPVFVMSVAEGRPFPVDEFANRADPLEIGLAEAAPRAFADAGVTP
FT                   SDIDLLEVYDSFTVNVLRQIEAAGFCKPGEAADFVLDGCIAADGSLPTNLNGGLLSEAH
FT                   VQGMNNLVEAVRQLRGGLPQRQVHNAELAVVTGMGGGWGSGALAILRR"
FT   gene            complement(583529..584782)
FT                   /locus_tag="Mflv_0555"
FT   CDS_pept        complement(583529..584782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0555"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: mva:Mvan_0528 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43047"
FT                   /db_xref="GOA:A4T3H1"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3H1"
FT                   /protein_id="ABP43047.1"
FT                   /translation="MSANMESLFDGLTILELGHVIAAPFAASLIGDFGAQVIKIEDPGS
FT                   GDMLRRSGPRKDGVPLWWKSAARNKSSVAVDLRLAEGQALVRKMVERADVVIENFRPGT
FT                   LERWGLGWEELHAANPRLIMLRISGYGQIGPESAKPGYGRVGEAMSGAVHITGHPDRPP
FT                   THFGFSLGDVTTGIMGAFAVAGALFKREAIGDRFDGECIDLALYESLFRGIDWQVILYD
FT                   QLNFVAERQGNQFQVSPSPVSDTYLSGDGVWYTVATGTVRSVQSLLELLGGTTLRNDPK
FT                   YATQELQMLHREELGEMVRQWFAENNSDIVEKACASSGVVAARIFTPAEMFSSPTFAAR
FT                   QSLVEVADQELGPVRVTGVVPRLTNFPGSVRSTGPGLGIHGQEVLTEWLGMADSEYEAL
FT                   VSSGVVGAVDVDGEVPGH"
FT   gene            complement(584835..585866)
FT                   /locus_tag="Mflv_0556"
FT   CDS_pept        complement(584835..585866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0556"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   mkm:Mkms_1692 alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43048"
FT                   /db_xref="GOA:A4T3H2"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3H2"
FT                   /protein_id="ABP43048.1"
FT                   /translation="MRAAIYHGREDVRIEELPDPSPRAGEVVIEVARAGICGTDLHEYI
FT                   AGPMHAAPGVVIGHEYSGTVVGVGSGVREFTEGDRVCGVGVFGCGECGFCKQGAEALCG
FT                   AVGFIGFAVNGALARYASLPTKALFRIPDEISLAEAAVVEPIASAYHAVRRSGLAAGGT
FT                   VFIAGAGPIGLALVQFSLAQGATQVIVSEVSATRRVAAHRVGATRVIDPLAEDAVEVVR
FT                   TLTNGNGVDISFDAAGVQPALDAALGVLRPRGRLMVVAIWEAPAGIDINRSVMREANIG
FT                   FSFCYEAQRQVPAILDLLATGAINLGELITDEIPLDAVVSQGLEELRVNRDAHVKILID
FT                   PSA"
FT   gene            complement(585973..586515)
FT                   /locus_tag="Mflv_0557"
FT   CDS_pept        complement(585973..586515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0557"
FT                   /product="aromatic-ring-hydroxylating dioxygenase, beta
FT                   subunit"
FT                   /note="PFAM: aromatic-ring-hydroxylating dioxygenase, beta
FT                   subunit; KEGG: mva:Mvan_0526 aromatic-ring-hydroxylating
FT                   dioxygenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43049"
FT                   /db_xref="GOA:A4T3H3"
FT                   /db_xref="InterPro:IPR000391"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3H3"
FT                   /protein_id="ABP43049.1"
FT                   /translation="MTTTVPQDPPQAARVSRDVREEIEDFLFDEADLLDRDEFEEWLEL
FT                   LAPNVHYFARVRQTLRRAGGPGFSERSMHLSDNYTSLKMRIQRHRTSSDWAEDPPSRIR
FT                   HYITNVRVRSGEDGDEYRVTSNALLVRTRGDEAKAETVSAERRDIIRRDETGLKLVQRE
FT                   ILLDHTTLPTHNLSFWI"
FT   gene            complement(586512..587903)
FT                   /locus_tag="Mflv_0558"
FT   CDS_pept        complement(586512..587903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0558"
FT                   /product="ring hydroxylating dioxygenase, alpha subunit"
FT                   /note="PFAM: ring hydroxylating dioxygenase, alpha subunit;
FT                   Rieske [2Fe-2S] domain protein; KEGG: mkm:Mkms_1690 ring
FT                   hydroxylating dioxygenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43050"
FT                   /db_xref="GOA:A4T3G6"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3G6"
FT                   /protein_id="ABP43050.1"
FT                   /translation="MSAHVLGAQIDRKVRPVDSMAPDATTMRTLENARGSILKGRLPAS
FT                   LIANAALYELELKRVFGRTWQFLCHEDEIPNAGDYVVRYIADNSIIVARQQDMTIRAMS
FT                   NSCRHRGTLLCRTESGNESAFQCPYHGWTYRNNGDLIAIPAQQAVYGAAFDKSRLGLRA
FT                   LPMLDSYAGLVFGCVSDEAPGLDEYLGDMRWYLDLMMKKSPAGLEAWGAPQRWVIDANW
FT                   KTGADNFVGDGYHTVMTHRSMCELGLLPPDNVAVSPAHVSLSGGHGAGVLGAPPGIPAP
FT                   PYMGYPEEVVSGLSEGYGDDVHGELLKRTMFIHGNVFPNLSFLNAFIAKDGESMPVPIL
FT                   TLRQWRPLDAARMEVWSWFFVERNAPEEFKQQSFETYVRTFGVGGVFEQDDAEIFQAIT
FT                   KGTRGELAGGVELNLEMGLDNLAPDPTWLGPGRPLASGYAEQNQREYWKQYFDYLATPR
FT                   RDENV"
FT   gene            complement(588274..589173)
FT                   /locus_tag="Mflv_0559"
FT   CDS_pept        complement(588274..589173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0559"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   mkm:Mkms_3253 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43051"
FT                   /db_xref="GOA:A4T3C4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3C4"
FT                   /protein_id="ABP43051.1"
FT                   /translation="MSRFQFVADHLHAFEVKWLCAVVEVARSSFYAWLAGADGRAARRA
FT                   ADEALAERIRAVHDEDNTYGAPRITAELNDGAPEGQRVNHKRVARVMRGAGIAGYRRRR
FT                   RVKTTVADPANQKVPDLLKRDFTAAQVNTRYVGDITYLPLATGANLYLATVIDCCSRRV
FT                   AGWAIADHMRTELVIDALKAAAALRGSLAGAIFHADHGSQYTSRDFANLCRDLGVVQSM
FT                   GAVGSSADNALAESFNAALKREILQDRACWPDAAICRREVFRWLARYNTTRRHSYCRHS
FT                   SPATYERNLTPATLPEAA"
FT   gene            complement(589170..589502)
FT                   /locus_tag="Mflv_0560"
FT   CDS_pept        complement(589170..589502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0560"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   mkm:Mkms_3252 transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43052"
FT                   /db_xref="GOA:A4T3C5"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3C5"
FT                   /protein_id="ABP43052.1"
FT                   /translation="MARKNYPDEFKRDAVALYRDTEGATIAQIAAELGVSEATLSAWCK
FT                   SAGVPIRHRRGVVVAEPVLGAESPEQELARLRSEVKALRATEARLSTERDILRSAAKYF
FT                   AGETNW"
FT   gene            complement(589577..590710)
FT                   /locus_tag="Mflv_0561"
FT   CDS_pept        complement(589577..590710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0561"
FT                   /product="Epoxide hydrolase domain protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; Epoxide hydrolase
FT                   domain protein; KEGG: mva:Mvan_0521 epoxide hydrolase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43053"
FT                   /db_xref="GOA:A4T3G9"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR010497"
FT                   /db_xref="InterPro:IPR016292"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3G9"
FT                   /protein_id="ABP43053.1"
FT                   /translation="MRAVRPFSIHVADDVLDDLRTRLSRTRWPEAECVPDWTQGIPLGY
FT                   TRELAAYWADGYDWRSREAALNRFDQFVVEIHGVDIHFIHQRSPHQEAFPLVITHGWPG
FT                   SIVEFHNVIEPLTNPTAHGGRAEDAFHVVCPALPGYGFSGKPTNAGWGVGKIAQAWETL
FT                   MLRLGYQRYGAQGGDWGAAITTQMGRNRGHCAAIHLNMPIAYPPAGGITDPTEEEQLAL
FT                   AALTTYQRWETGYSEQQSTRPQTVGYGLADSPVGQMAWIVEKFAAWMDCDGHPENVLSR
FT                   DELLDNVMMYWATNSGSSSARLYWESFKTLDATTRVELPTGIAAFPKEVLRAPRSWCEP
FT                   IYNITHWTTMPRGGHFAALEQPRLFVDDIRAFFESVR"
FT   gene            complement(591079..591576)
FT                   /locus_tag="Mflv_0562"
FT   CDS_pept        complement(591079..591576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0562"
FT                   /product="aromatic-ring-hydroxylating dioxygenase, beta
FT                   subunit"
FT                   /note="PFAM: aromatic-ring-hydroxylating dioxygenase, beta
FT                   subunit; KEGG: mva:Mvan_0493 aromatic-ring-hydroxylating
FT                   dioxygenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43054"
FT                   /db_xref="GOA:A4T3H0"
FT                   /db_xref="InterPro:IPR000391"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3H0"
FT                   /protein_id="ABP43054.1"
FT                   /translation="MLTSSVEDRRARAAYLVDELLGAYARAVDDQDFTAWLALFATECA
FT                   YEVRAMENVREGLPLAYMMDDCRERLADRAKMIQEVWAGTVEPYDTRHFQQRTAMRELG
FT                   EDRWEVRSNVLVTYTGASGEPGILVSGYSEDVVVLDDETALFQQKFVVVDNTPPRYLVY
FT                   PV"
FT   gene            complement(591570..592751)
FT                   /locus_tag="Mflv_0563"
FT   CDS_pept        complement(591570..592751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0563"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: ring hydroxylating dioxygenase, alpha subunit;
FT                   Rieske [2Fe-2S] domain protein; KEGG: mva:Mvan_0492 Rieske
FT                   (2Fe-2S) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43055"
FT                   /db_xref="GOA:A4T3G2"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3G2"
FT                   /protein_id="ABP43055.1"
FT                   /translation="MKLGPTMEFDHIQPAIRKRFTSAADIPKEVFSDPDVYREELTRIF
FT                   YGPYWHPIAHRAELAERNAFRTRWLADVPLLMVRDGDDRIRVFVNSCAHRGTLLEQRRC
FT                   GVAERFECPYHRWIFNNDGRFAGAPRRMQFRPDFREEDYGLRELHVVEAWGLIFVSMAA
FT                   QPPPFDDYLGDSADPLRDCMVDDGDLTLLGYQTVVFQSNWKTYIDNDPYHAPLLHSAFK
FT                   LLNWQGGSGNVLVSEPYGHMSILYDAQPYVDNGFLADPSVVTRMGDDSRARVIALRPVT
FT                   GIVRHVDTINIRYARPLGVDRTEVRYTFFGHASDSEDFARHRVRQSSNLLGPSGFISIE
FT                   DAAVYNRVQATARDGGYQRFVAGVGRPLSESSQNDEVANTGWWAHYQEVMEFC"
FT   gene            complement(592748..593833)
FT                   /locus_tag="Mflv_0564"
FT   CDS_pept        complement(592748..593833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0564"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mkm:Mkms_1671 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43056"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3G3"
FT                   /protein_id="ABP43056.1"
FT                   /translation="MVVAATSRGVFTVSGDGKARAWPELPGQVMAMAVQDERVAVAVHK
FT                   HGVFLATAGADHWTDLGDGLAHRDVRALAFDPHTPNALYAGTEPAHLLRWQDGIWAECG
FT                   NVLGVPEAKRWSFPIRPGIAHVRTIAVHPLEADVVYVGIEVGSLLITRDRGQTWEEIDG
FT                   LGHDIHRVVLHPEAPDRLIVTTGQDTKPYRGGKGIYRSTDRGSSWVQSNNGLGERNYTE
FT                   DAIVVHPADPDVVFLAAADGIPPKWAAVRRLVMGAINGNVYFLSPSKLRRRRGADVGFF
FT                   RSNDGGASWVRLNSEDDRGLFDMVWALEGELTEGGELLLYHGTTAGGLYVSEDEGHTWK
FT                   CLADGLGAITHIATPKKGTAQ"
FT   gene            complement(593848..594873)
FT                   /locus_tag="Mflv_0565"
FT   CDS_pept        complement(593848..594873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0565"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   mkm:Mkms_1670 alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43057"
FT                   /db_xref="GOA:A4T3G4"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3G4"
FT                   /protein_id="ABP43057.1"
FT                   /translation="MEAIVLNGTNDVGLTSVPDPAPQDGEVIIEVAATGLCGTDLHEYV
FT                   AGPTFSQPPVVLGHEVSGRIVEVGAGVDQSRIGEGAAVIPMDFCGSCHYCHRSLYHLCQ
FT                   RPGWIGFTRNGGLANYVAVPSRLAVRVPDVVDLEEAALTEPTAVAFHAVRRAELLLGET
FT                   VMVLGAGALGLTVIQCARAAGAARIFVTEPSGVRASLARDLGATLVLDPHDPGTTACIL
FT                   EETRGVGVDVVFHVAGSAEAFTQGLDCLRKQGRFMEMSSWAGAASLDVNRHLLKEIQLR
FT                   MVFGYDMFDDFPAVLALIADGKLALAPQITARVPLDRAVKEGLGGLLEGREGLVKVLVK
FT                   P"
FT   gene            complement(594931..595713)
FT                   /locus_tag="Mflv_0566"
FT   CDS_pept        complement(594931..595713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0566"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mva:Mvan_0489 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43058"
FT                   /db_xref="GOA:A4T3G5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3G5"
FT                   /protein_id="ABP43058.1"
FT                   /translation="MTAGDRRVAIVTAAAAGIGKAIALRWCREGGCCVMADTDGEGLDA
FT                   AVHELAESGAAVCGVAGDVCLSDVANSVVERALTEFGRLDTLFNVVGGSLARNVEEISE
FT                   EQWRSQIDMNLGSVFQMSKPVIPLLRQGGGGSIVNVASTAGILAENRCSAYSASKGGVV
FT                   LLTKNMALDFARDNIRVNAIAPGGTRTPRIERFLAEHPEHASMMVDLCAMQRFAGPDEI
FT                   AAPAVFLASPEASYITGAVLPVDGGMTAGVTFRAFEAV"
FT   gene            complement(595778..597154)
FT                   /locus_tag="Mflv_0567"
FT   CDS_pept        complement(595778..597154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0567"
FT                   /product="ring hydroxylating dioxygenase, alpha subunit"
FT                   /note="PFAM: ring hydroxylating dioxygenase, alpha subunit;
FT                   Rieske [2Fe-2S] domain protein; KEGG: mkm:Mkms_5626 ring
FT                   hydroxylating dioxygenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43059"
FT                   /db_xref="GOA:A4T3F8"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3F8"
FT                   /protein_id="ABP43059.1"
FT                   /translation="MTTETTETTGTADATDPYLRRALRDVADGLKVGRLPARVVSDPAL
FT                   HTIEMERIFGRAWVFLGHESELAKSGDFVVRHIGADSVIVCRDNSGRIQALSNSCRHRG
FT                   ALVCRAEMGNTAHFQCPYHGWVYSNTGELVGVPAMTEAYPGGFDKSQWGLRHIPHVDSY
FT                   AGFIFGSVDPKAPSLTDYLGDTTFYLDLIAKKTAGGLEVIGAPHRWVMSANWKTAADNF
FT                   VGDSYHTLFAHRSMVELGMAPGDPNFASAPAEISLQNGHGVGVLGFPPTLADFPEYEGY
FT                   PDEVVDQMATSYPSPVHKDLMRRSSFIHGTVFPNLSFINVTLAQDHMSPPTPFITFRVW
FT                   HPLSHDRMEILSWFLVERDAPEWLRDASQASYVNNFGPGGVFEQDDAEAWKAITESVQG
FT                   PFAGEGLLNYEMGMDLTPLTDWPGPGEALPSGYAEQNQRRFWGRWLEYMGQPPAFGGRA
FT                   "
FT   gene            complement(597217..597726)
FT                   /locus_tag="Mflv_0568"
FT   CDS_pept        complement(597217..597726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0568"
FT                   /product="aromatic-ring-hydroxylating dioxygenase, beta
FT                   subunit"
FT                   /note="PFAM: aromatic-ring-hydroxylating dioxygenase, beta
FT                   subunit; KEGG: mkm:Mkms_5625 aromatic-ring-hydroxylating
FT                   dioxygenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43060"
FT                   /db_xref="GOA:A4T3F9"
FT                   /db_xref="InterPro:IPR000391"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3F9"
FT                   /protein_id="ABP43060.1"
FT                   /translation="MNAVAVDQDTREAVEEFMFREAELLDGGQFREWLGLLDPDIRYVV
FT                   PVRTTREDSAGWVGAIAHWNDDYTGLEMRVLRGETDFSWAESPRSRTRHFVSNIRTTAG
FT                   PGTEELTVRSNLLFFRSRGDSGRWELLSAERVDVLRRTDDSLRLARREVLLDHSTLPID
FT                   NLSVVL"
FT   gene            complement(598284..599744)
FT                   /locus_tag="Mflv_0569"
FT   CDS_pept        complement(598284..599744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0569"
FT                   /product="Aldehyde dehydrogenase (NAD(+))"
FT                   /EC_number="1.2.1.3"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: mkm:Mkms_1663
FT                   aldehyde dehydrogenase (NAD(+))"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43061"
FT                   /db_xref="GOA:A4T3G0"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3G0"
FT                   /protein_id="ABP43061.1"
FT                   /translation="MINANLIINGREETSDRTIDVVSPADIRVLLGSVPDAAPGQVDEA
FT                   VAAAAMAFPEWSSRPLEERQGALLAAAGTIHDMIEEYAPILSRENGKILEESHVDLEFA
FT                   SGICGYTAGISAEILADQQIRDTGGTTLIRRRPIGPVAAITPWNFPVVLAFMKLAPALV
FT                   AGNTVVLKPAANSPLVLAEVVRALQQHFPPGVLNMVTGGDAVGEALVAHPRIRKIGFTG
FT                   GIDTGRKVMAAAARDIKRVTLELGGNDPAILLDDVDLSPETMRQIVKGAFGTTGQVCFG
FT                   LKRIYVPTRIHDRFVEAFSAAVDEIVVGPGDDPRVTMGPLNNAQQKNLVEKIVDDARSS
FT                   GATVTTLGQRLDSAAWDHGHFMMPSVVTAADPRLAIVEEEQFGPVVPVLKYDELDDVIR
FT                   LVNQSQYGLAASIWTSDEERAFLLGRRFDTGSVFINSHTFTSLDPRAPFGGAKASGLGR
FT                   EFSPASLDSYTELQTISRRIGPPGPPLS"
FT   gene            complement(599940..600230)
FT                   /locus_tag="Mflv_0570"
FT   CDS_pept        complement(599940..600230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0570"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: mva:Mvan_0485 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43062"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3G1"
FT                   /protein_id="ABP43062.1"
FT                   /translation="MIESIDETTCDGCNVCIDSCPTGVIRLVEGDEPWSTTKWRAKIIY
FT                   PNDCHSCRLCAIDCHVDAIVVSHALVIPDPFLPGVEPLDGSRDAPPDEKKT"
FT   gene            complement(600227..601999)
FT                   /locus_tag="Mflv_0571"
FT   CDS_pept        complement(600227..601999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0571"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD dependent oxidoreductase;
FT                   KEGG: mva:Mvan_0484 fumarate reductase/succinate
FT                   dehydrogenase flavoprotein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43063"
FT                   /db_xref="GOA:A4T3F4"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3F4"
FT                   /protein_id="ABP43063.1"
FT                   /translation="MGDLDVSVQECDVLVVGGGIGGVRAALRAAELGSSVILVEKAVVS
FT                   RAGPMTYVHSQYAPDHRVQGEEMTEWAREFVVGSNYLADQDWVQQYIAEAYDRVNEQIE
FT                   WGVPYSTHEDGSLKYVTVRGHNLGTTLGVDGRVCMEILKERMKAAGVRLFERVDVIDLL
FT                   TTDGCRPTAGAVCGAVGVNVVTGQCHVFTAGSVILNTGPWYPKLHYAFADHCSGEGHVA
FT                   AWRVGAEFAGMEFGQFAAWSYFNRSFFTPGQAKIQGIGGKFCNAAGEYFMDRYDPIWGD
FT                   KGGLFTIARAIMTEMVEGRGPCYLDLRHVPQADLEVLYEVSPTVRRAFTEFEVDPSTDL
FT                   LEVTPFIVLGTSSTSGPTIDLDGATTVPGLYAAGYGTACPHLMSGISGSGISSFSAVAG
FT                   YRAGTAAAARGGHAVARSVWENQAQESFAEYFAPMRRLRQVRPVDVWKAIGEATANPAF
FT                   ALFKSEARIDSALAELYRIRDRVLRYVFAPDYQELKKAHEVRAYLTLAIITCEAMKRRT
FT                   ESRGELFRIDYPYADNDEWLKWLLVRRGSGGEFDLQFSERDLPIQSWPVQAPPGRHPSP
FT                   YTVPQGYREEAAVQ"
FT   gene            complement(602122..602667)
FT                   /locus_tag="Mflv_0572"
FT   CDS_pept        complement(602122..602667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0572"
FT                   /product="aromatic-ring-hydroxylating dioxygenase, beta
FT                   subunit"
FT                   /note="PFAM: aromatic-ring-hydroxylating dioxygenase, beta
FT                   subunit; KEGG: mmc:Mmcs_1634 aromatic-ring-hydroxylating
FT                   dioxygenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43064"
FT                   /db_xref="GOA:A4T3F5"
FT                   /db_xref="InterPro:IPR000391"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3F5"
FT                   /protein_id="ABP43064.1"
FT                   /translation="MSVDGLVEEFGVMNAVAVDRDTREAVEAFMFREAELLDGGQFREW
FT                   LGLLDPDIRYVVPVRTTREDSAGWVGAIAHWNDDYTGLEMRVLRGETDFSWAESPRSRT
FT                   RHFVSNIRTTAGPEADELTVRSNLLFFRSRGDSGRWELLSAERVDVLRRTDDSLRLARR
FT                   EVLLDHSTLPIDNLSVVL"
FT   gene            602921..603655
FT                   /pseudo
FT                   /locus_tag="Mflv_0573"
FT   gene            complement(603663..604568)
FT                   /locus_tag="Mflv_0574"
FT   CDS_pept        complement(603663..604568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0574"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   mgm:Mmc1_1989 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43065"
FT                   /db_xref="GOA:A4T3B3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3B3"
FT                   /protein_id="ABP43065.1"
FT                   /translation="MSQKYAFIAAEHADGATFAGMAPTIVQMLKWLGVSKSGFYEWWGR
FT                   PASAAMCRREELKLKIAALFTSFGAVYGYRRIHAELVRAGERVGPELVRTLMRELNLVA
FT                   LQPKPYKRTTIAGESATAVPDLVARDFTADRPGVKLVGDITYIRTWAGWLYLATVIDCF
FT                   NKEVIGYAMADHMRTELATGALEMAARNHALEPGCIMHTDRGTQYTSTDYAIKIADLDM
FT                   RASLGRTGICWDNALAESFFAALKNERVHHMVYPTRKKARADIARYIELFYNRRRLHSA
FT                   LGYRTPHEVRIEYMNSQLAA"
FT   gene            complement(604565..604855)
FT                   /locus_tag="Mflv_0575"
FT   CDS_pept        complement(604565..604855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0575"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   gvi:glr3858 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43066"
FT                   /db_xref="GOA:A4T3B2"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3B2"
FT                   /protein_id="ABP43066.1"
FT                   /translation="MAKKYQKFSPEFREETARLVVDGQKSIAEVAREHGLSDTTVGNWV
FT                   RKYRETHATDEPPLELSERARLRELERENREMAMELAFLKKAAAYFAKEPR"
FT   gene            complement(604994..605893)
FT                   /locus_tag="Mflv_0576"
FT   CDS_pept        complement(604994..605893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0576"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   mkm:Mkms_3253 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43067"
FT                   /db_xref="GOA:A4T3F1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3F1"
FT                   /protein_id="ABP43067.1"
FT                   /translation="MSRFQFVADRLHAFEVKWLCAVVEVARSSFYAWLAGADGRAARRA
FT                   ADEALAERIRAVHDEDNTYGAPRITAELNDGAPEGQRVNHKRVARVMRGAGIAGYRRRR
FT                   RVKTTVADPANQKVPDLLKRDFTAAQVNTRYVGDITYLPLATGANLYLATVIDCCSRRV
FT                   AGWAIADHMRTELVIDALKAAAALRGSLAGAIFHADHGSQYTSRDFANLCRDLGVVQSM
FT                   GAVGSSADNALAESFNAALKREILQDRACWPDAAICRREVFRWLARYNTTRRHSYCRHS
FT                   SPATYERNLTPATLPEAA"
FT   gene            complement(605890..606222)
FT                   /locus_tag="Mflv_0577"
FT   CDS_pept        complement(605890..606222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0577"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   mkm:Mkms_3252 transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43068"
FT                   /db_xref="GOA:A4T3F2"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3F2"
FT                   /protein_id="ABP43068.1"
FT                   /translation="MARKNYPDEFKRDAVALYRDTEGATIAQIAAELGVSEATLSAWCK
FT                   SAGVPIRHRRGVVVAEPVPGAESPEQELARLRSEVKALRATEARLSTERDILRSAAKYF
FT                   AGETNW"
FT   gene            606385..606822
FT                   /locus_tag="Mflv_0578"
FT   CDS_pept        606385..606822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0578"
FT                   /product="integrase, catalytic region"
FT                   /note="KEGG: mva:Mvan_0482 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43069"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3F3"
FT                   /protein_id="ABP43069.1"
FT                   /translation="MLGCAPTDRIGADLAAMLALPPVPPQVGWRNSTRLARDHYVRLDS
FT                   NDYSVHPGVIGRRIEVVADLDRVQVFCEGKTVAEHERVWAWHQTITDPEHREAANMLRR
FT                   NRISALRPVTDSDQQVLVEQRRLSDYDAALGIDLGEGGLVS"
FT   gene            606819..607670
FT                   /locus_tag="Mflv_0579"
FT   CDS_pept        606819..607670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0579"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: aau:AAur_pTC10051 IS21 family
FT                   element, transposase IstB"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43070"
FT                   /db_xref="GOA:A4T3E7"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3E7"
FT                   /protein_id="ABP43070.1"
FT                   /translation="MTTKTATTKTAAASVASRDLTAEIGFLTRALKAPTMREAVARLAE
FT                   RARAESWTHEEFLVACLQREVSARESHGGEGRIRAARFPSRKSLEEFDFDHARGLKRDT
FT                   IAHLGTLDFVVAKDNVVFLGPPGTGKTHLAIGIAIRACQAGHRVLFATASQWVARLAEA
FT                   HQGGRLQQELIRLGRYPLLVVDEVGYIPFEPEAANLFFQLVSSRYERASLIVTSNKPFG
FT                   KAHLFARTCAEVALKRDMFAGIRVGRGGRAVGPRRGDRRDRSSLLRVSSRRLPRRVSGR
FT                   SY"
FT   gene            complement(607549..609192)
FT                   /locus_tag="Mflv_0580"
FT   CDS_pept        complement(607549..609192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0580"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   mva:Mvan_5941 phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43071"
FT                   /db_xref="GOA:A4T3E8"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3E8"
FT                   /protein_id="ABP43071.1"
FT                   /translation="MRLVGKRQRDCVDCGAPVGYIGREHCCHCTRRLRAQAAKARCPGC
FT                   GWDRIVLPETDRCMLCSRRCRECGGPIKFRGETVCRPCQKRATLAAAKSTCPRCAKPGY
FT                   LRESTGWCGPCSRPRPPKYPPRICVSCGELRRHAAHGMCGRCWQRHPDRPFVRGETLAA
FT                   ALTEPPGWLGDFVAYLAARHCPARACRMIATLARLLEDEHPNHPQSVLERSRRPGRSMG
FT                   SLARALEAFFTEHGLAMATDQDQRLAAGRRQKRIDATPGPMRVAVAAFAESMLHNRDRA
FT                   RRAGTRPRSDRTIESALTIVRDLAHFLEAQRGKQDWALVDVTDIEAFLAELPNTRARRL
FT                   TVLGQFFRFARNRRVVLVDPTHGMSAKRHRGFRGRTLTITQQRDLFRRWSADPAAHPHE
FT                   ALFGLLAILHGVSSRELRLLQVDHIDTSDRSIRLGTRPHPVPLDPVSWNALQRSLDHRD
FT                   TQRTNNPHVIVTRGTKADRRPASEAYMSHLLDPCGLPPKMLRSTRLADLVNTIDPKLVA
FT                   AAFGMRPEGAMIYLADHLDEGRLPDHLAQP"
FT   gene            complement(609217..609531)
FT                   /locus_tag="Mflv_0581"
FT   CDS_pept        complement(609217..609531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0581"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_5942 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43072"
FT                   /db_xref="GOA:A4T3E9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3E9"
FT                   /protein_id="ABP43072.1"
FT                   /translation="MRIRWRLRMAAAQREVWTGTELRRLLSERAGLELSAASVSALFTK
FT                   EPSQIKVSTLIALCTALDCTPDDLFEIDTTPVEQPAARPRPVASQPKTATARGRSMPPM
FT                   "
FT   gene            complement(609528..610595)
FT                   /locus_tag="Mflv_0582"
FT   CDS_pept        complement(609528..610595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0582"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   mva:Mvan_5943 phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43073"
FT                   /db_xref="GOA:A4T3F0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3F0"
FT                   /protein_id="ABP43073.1"
FT                   /translation="MRGVEGLRLIPGGAAPVEAVAADPVVFQRECVDAFVASWHARGFS
FT                   PVTIDNDIGLLERTLTALGCPAWEVTSEDIDRVVGELAMAGRAASTRREYVQIFKGFHR
FT                   FLQTRKAAEIEAAFGARLVCPVDEFNASRHVGDDSPAVAAPPTPERVSAFFEFLKTRIA
FT                   TARKYGPAARDYAMFRTLYHAGLRSEESALLEIPDVHFDRGPFGKLHVRFGKAAHMSGP
FT                   RPRWVPMLDGLDVLLQWFLADVRPKFPNSPVLFADESGGALHRGTIRNRLRYLMELEGR
FT                   PATERFSPHALRRACATHNYERGVDLVAIQQLLGHWTVSSTMRYVRPSATFIEDAYRRA
FT                   VTSTLAELSGEDGTA"
FT   gene            610720..610887
FT                   /locus_tag="Mflv_0583"
FT   CDS_pept        610720..610887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0583"
FT                   /product="IS21 family element, transposase IstB"
FT                   /note="KEGG: aau:AAur_pTC10051 IS21 family element,
FT                   transposase IstB"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43074"
FT                   /db_xref="GOA:A4T3E3"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3E3"
FT                   /protein_id="ABP43074.1"
FT                   /translation="MPAPVRWGEVFGDDVVAAAMIDRLVHHAEVIALKGDSYRIKDRDL
FT                   GRVPGSTTEE"
FT   gene            611756..612653
FT                   /pseudo
FT                   /locus_tag="Mflv_0584"
FT   gene            complement(612709..613734)
FT                   /locus_tag="Mflv_0585"
FT   CDS_pept        complement(612709..613734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0585"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   mva:Mvan_0472 dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43075"
FT                   /db_xref="GOA:A4T3E4"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3E4"
FT                   /protein_id="ABP43075.1"
FT                   /translation="MTTRSSELVPSDMKGLWGFVPACSTPDAADVNAVDTIDTDALASL
FT                   VDRLVRDGVDGIVTTGSAGESHTLSDDEYRTLITTVVETVNARVPVFVGASTLNTRDSI
FT                   RRARVIADLGADGIMSGPPMYLPQTAENAVQYYKDLAEAVPELAIMIYQNPHAFRITLP
FT                   PGAFRELAQIRNIVALKQTSMDIFNVIGAIKAVKDKMSVLVLDQLMYPAMMFGAAGAWS
FT                   IDVCMGPWPALSLRDACQRGDWTEAATIADQMQAPFRTLGLTMEEFQAMQSAWWKIAID
FT                   TAGYGRAGAARPPFVHIPQTVVDSAHRYGERWAGLAERYHRSREAAGLPPAAANVAAAS
FT                   S"
FT   gene            complement(613902..614288)
FT                   /locus_tag="Mflv_0586"
FT   CDS_pept        complement(613902..614288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0586"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mkm:Mkms_1657 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43076"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3E5"
FT                   /protein_id="ABP43076.1"
FT                   /translation="MAIQFLTDDWATAVTDAANADERFRIAAKGHDVVLRVSVSQSPAS
FT                   DDYYMHFSDGSLIVGIGSPPRTPDVEAELSYETNVELSRGALNGQTATMTGQMKAVGNM
FT                   MKMMSIGKAQDRLAELESGLDIDY"
FT   gene            complement(614334..615224)
FT                   /locus_tag="Mflv_0587"
FT   CDS_pept        complement(614334..615224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0587"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: mkm:Mkms_1656
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43077"
FT                   /db_xref="GOA:A4T3E6"
FT                   /db_xref="InterPro:IPR000486"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3E6"
FT                   /protein_id="ABP43077.1"
FT                   /translation="MLVKTLGYVGVESPDAKEWLAFGPEVLGMEAVEAASGSVLLRIDD
FT                   ADHRLAVHHGDRNRMLYAGWDVGSEEALEAAGELLHKRGIGFEVGTEEDCAARGVLGFV
FT                   TLSDPSGLRHELFYGQKVVPGSFRPGRAISGFVTGAQGLGHVVLATPDLAQADRFLRGV
FT                   LGFKKSDEIYTFMDLWFYHCNPRHHSIALTPMPGVRGLHHVMVEVQSFDDVGMAYDLCM
FT                   SRNIPLSMTLGRHVNDRMVSFYARTPSGFDIEYGWDAVTVDDDTWTVAQYDRPSVWGHQ
FT                   MVAQTPPGALEAATT"
FT   gene            complement(615243..616241)
FT                   /locus_tag="Mflv_0588"
FT   CDS_pept        complement(615243..616241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0588"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   mva:Mvan_0469 dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43078"
FT                   /db_xref="GOA:A4T3D8"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3D8"
FT                   /protein_id="ABP43078.1"
FT                   /translation="MRDTKLTVDDITGVVGIIPTPSIPTADQPGTAFSVDLDEAAKLAD
FT                   AMVRGGVDVLMTTGTFGECASLTWDELQSFVATVVDAVAGRIPVFAGATTLNTRDTIAR
FT                   GRRLGELGADGLFVGRPMWLPLDDAGIVRFYRDVAEAVPNMALVVYDNPGAFKGKIGTP
FT                   AYEALSQIPQVVAAKHLGLLSGSAFLSDLRAVGGRVRLLPLETDWYYFARLFPEEVTAC
FT                   WSGNVACGPAPVTHLRDLIRARRWDDCQALTDELEGALETLYPGGNFAEFLKYSIQIDN
FT                   AQFQAAGFMRTGPTRPPYTEVPESYLAGGREAGKNWAALQQRYASLAVSNH"
FT   gene            complement(616266..617351)
FT                   /locus_tag="Mflv_0589"
FT   CDS_pept        complement(616266..617351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0589"
FT                   /product="1-hydroxy-2-naphthoate dioxygenase / gentisate
FT                   1,2-dioxygenase"
FT                   /EC_number="1.13.11.38"
FT                   /EC_number="1.13.11.4"
FT                   /note="PFAM: Cupin domain protein; Cupin 2, conserved
FT                   barrel domain protein; KEGG: mva:Mvan_0468 cupin 2,
FT                   conserved barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43079"
FT                   /db_xref="GOA:A4T3D9"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3D9"
FT                   /protein_id="ABP43079.1"
FT                   /translation="MSTAEISGLHEFDAELEAANLRGQWIYDEMLESVVGGPKPAGVPF
FT                   LWRWQDVHAKLLKSCDVMPESLTARRNLSFINPDARGTTHTINMGMQMLKPGEIAYAHR
FT                   HTMAALRFAIQGGPGLVTVVDGEPCQMDTYDLVLTPRWTWHDHENATSENVVWLDVLDI
FT                   GLVLGLNVPFYEPYGEMRQPQREDPGEHLADRGGMLRPAWEQVKAANFPYRYPWRDVER
FT                   QLQRMAGLAGSPYDGVVLRYANPVTGGSTMPTLDCWVQLLRPGQQTEAHRHTSSAVYFV
FT                   VRGEGTTVVDGVELDWGPHDSFVVPNWSTHHFVNRSAENALLFSVNDIPTLKALDLYYE
FT                   EPELSLGTQPFPPVPANLRAR"
FT   gene            complement(617928..619169)
FT                   /locus_tag="Mflv_0590"
FT   CDS_pept        complement(617928..619169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0590"
FT                   /product="phthalate 3,4-dioxygenase, ferredoxin reductase
FT                   subunit"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: mva:Mvan_0467 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43080"
FT                   /db_xref="GOA:A4T3E0"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3E0"
FT                   /protein_id="ABP43080.1"
FT                   /translation="MTSRVVIVGSSVGGVRTAQALRSQGYDGGIVLVGEETALPYDKPP
FT                   LSKALLAGTSDIAAATLLTRDAAAADAIELLLGRRAIGVDVAACQVEFADDEPLHYDHL
FT                   VVATGASARPSPWGHGSGVHVLRTLEDCLRLRADLVAGARLVVIGAGFIGAEVASTARS
FT                   LGLQVTVVDPVPVPMSRVLTEEIGGWFVDLHRDHGVHTRFGVGVENIEGERGNLKIGLT
FT                   DGTVLEADTVVVGIGAVPNDGWLMPSGLVVDDGLVCDEFCRAVTSQNIYAVGDVSRWFH
FT                   RARGVTMRIEHWTNAVDQASCVAHNILYPDELRCYEPVEYVWSDQYDWKIQFCGQTTHL
FT                   GEPLVVGDRLSDNRFTVLYPDGEQRLGGAAVVNWPRALIECRRALQAGSDLESVRGRLE
FT                   VLTNPPDTAATRSP"
FT   gene            complement(619166..619366)
FT                   /locus_tag="Mflv_0591"
FT   CDS_pept        complement(619166..619366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0591"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_4366 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43081"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3E1"
FT                   /protein_id="ABP43081.1"
FT                   /translation="MDGVIKAKREVCQGYANCVVAAEDYFDIDDRGLVEVRKTEVPSAD
FT                   RTRVEEAARSCPVAALEVVDE"
FT   gene            complement(619395..620198)
FT                   /locus_tag="Mflv_0592"
FT   CDS_pept        complement(619395..620198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0592"
FT                   /product="phthalate 3,4-dihydrodiol dehydrogenase"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mva:Mvan_0466 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43082"
FT                   /db_xref="GOA:A4T3E2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3E2"
FT                   /protein_id="ABP43082.1"
FT                   /translation="MTGWLAGKRALIVGAGSGIGRATVDAFLNEDARVAVLEYDSGKCA
FT                   TLRQQLPDVPVIEGDGTTRTANDEAVQVAVDAFGGLDTLVNCVGIFDFYRRIQDIPAER
FT                   IDQAFDEMFRINVLSHIHSVKAAVPALMGQDGASIVLTESASSFYPGRGGLLYVASKFA
FT                   VRGVVTALAHELAPRIRVNGVAPGGTLNTDLRGLDSLDLGARRLDAAPDRARELAARTP
FT                   LGVALSGEDHAWSYVFLASHRSRGLTGETIHPDGGFSLGPPPQRN"
FT   gene            complement(620195..620500)
FT                   /locus_tag="Mflv_0593"
FT   CDS_pept        complement(620195..620500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0593"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0465 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43083"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3D3"
FT                   /protein_id="ABP43083.1"
FT                   /translation="MSSNGSGEGAQSPPQSGCEELATLLAGATGDALNVANEFAEVVVR
FT                   RVTTRNGARLLIQAPKSAQWVSLDALEIEALTWQNPATLAAMVGNAGTPLILGEEV"
FT   gene            complement(620497..621096)
FT                   /locus_tag="Mflv_0594"
FT   CDS_pept        complement(620497..621096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0594"
FT                   /product="phthalate 3,4-dioxygenase, beta subunit"
FT                   /note="PFAM: aromatic-ring-hydroxylating dioxygenase, beta
FT                   subunit; KEGG: mkm:Mkms_1648 aromatic-ring-hydroxylating
FT                   dioxygenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43084"
FT                   /db_xref="GOA:A4T3D4"
FT                   /db_xref="InterPro:IPR000391"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3D4"
FT                   /protein_id="ABP43084.1"
FT                   /translation="MSVHDHQRIGQSAAPSVLGAHAARAQRVGDPLPFDDPRHLQAHSF
FT                   LVNEAYLLDAQDYDRWLGLLTEDIHYYMPVRITTAAGAGFDSSPGMAHFDENKYSLSRR
FT                   VARFATEHAWTEDPPSRLRHFITNVRTFLTDDADYLAVDSAELLFRSRGDVNESTLLSC
FT                   GREDLLRRDGNALKLARRTIAVDESVLRMQNLAVFL"
FT   gene            complement(621093..622544)
FT                   /locus_tag="Mflv_0595"
FT   CDS_pept        complement(621093..622544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0595"
FT                   /product="phthalate 3,4-dioxygenase, alpha subunit"
FT                   /note="PFAM: ring hydroxylating dioxygenase, alpha subunit;
FT                   Rieske [2Fe-2S] domain protein; KEGG: mkm:Mkms_1647 ring
FT                   hydroxylating dioxygenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43085"
FT                   /db_xref="GOA:A4T3D5"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3D5"
FT                   /protein_id="ABP43085.1"
FT                   /translation="MQDHGEVLAAVRTGMIPAHVYNDKQIFSLEKERLFSRAWLFVAHE
FT                   SEIPQPGDYVVRQVLQDSFIVARDSAGEVRVMFNMCLHRGMQVCRAEMGNASNFRCPYH
FT                   GWSYRNDGRIIGLPFHQEAYGGDAGFNKAGQTLLPAPSVASYNGLIFLSMDPDAESLED
FT                   YLGDFRFYLDFYTKQGPNGLEVRGPQRWRVKANWKIAAENFAGDMYHTPQTHTSVVEIG
FT                   LFREPKANKRKDGATYWAGRGGGTTYKLPEGSFEDRMSYVGYPADMISRAKATWTEQQQ
FT                   QVVGTDGFMISAATCFPNISFVHNWPKVEDGEHVLPFISIRVWQPISENETEVLSWFAV
FT                   DSDAPADFKADSYKAYLMCFGSTGMFEQDDVENWVSLTNTAGGSMARRLRLNSRMGLLA
FT                   DDVRVVDTLSSAQFHGPGYAQLGYNENNQRQLLRLWADYLDMPPLRVDPATVLSDNPHG
FT                   IEPMVQTNGAAAADIDSGSAESVML"
FT   gene            622995..623876
FT                   /locus_tag="Mflv_0596"
FT   CDS_pept        622995..623876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0596"
FT                   /product="Transcriptional regulator PhtR / transcriptional
FT                   regulator, IclR family"
FT                   /note="PFAM: regulatory proteins, IclR; KEGG: mkm:Mkms_1646
FT                   regulatory proteins, IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43086"
FT                   /db_xref="GOA:A4T3D6"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3D6"
FT                   /protein_id="ABP43086.1"
FT                   /translation="MKASFRRRWLSVAILRAAFGFHRGKVSVMQKPPVAGMEHDSTGKL
FT                   PQYPIESVDNALRLILLLGDRSEIRLTDASEYLHVASSTAHRLLSMLQYRGFVRQDPIS
FT                   RAYQPGPSLTNVAFAVHSRMDIPRTAAPILRQLVDTLQETVHVGTLDGRLVRFIAALES
FT                   PSAVRVISRLGSTRPAHCTSTGKVLLAGLSVDELDQLYPDPHLEPLTEHSVRTLTELRT
FT                   QLAEVRKSGFAISRQESEEGVASVAVAVPQGGSGIRLALNASAPSYRFRPSDVRKACSA
FT                   LKDAAAELAVLT"
FT   gene            complement(624179..624559)
FT                   /locus_tag="Mflv_0597"
FT   CDS_pept        complement(624179..624559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0597"
FT                   /product="integrase, catalytic region"
FT                   /note="KEGG: mkm:Mkms_2638 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43087"
FT                   /db_xref="GOA:A4T3D7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3D7"
FT                   /protein_id="ABP43087.1"
FT                   /translation="MARWSRGTTLQNLICHSDAGSQFTSIRYGERLAEIGGVPSIGTVG
FT                   DSFDNALAETVNGYYKAELIYGPARSGPWKTVEDVELATLSWVYWHNTSRLHSYLGDLP
FT                   PAEFEAAFYDASRSGQPLVEIQ"
FT   gene            complement(624743..626149)
FT                   /locus_tag="Mflv_0598"
FT   CDS_pept        complement(624743..626149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0598"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   msm:MSMEG_6146 ISMsm3, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43088"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3C9"
FT                   /protein_id="ABP43088.1"
FT                   /translation="MKSIAAASRVKVSADGHGVVSHAGMGLLRELADRTGLSAQVTGAL
FT                   ADTYRGPWTYAPGEVFADLAAAVADGADCIDGVGQLCGDREHAFGAKASTTTMWRLVDE
FT                   RIDAAHLPAVRAARASARAAAWAAGAAPEPGGWLHIDIDATLVIDHSDNKHGATPTWKK
FT                   SFGHHPLLAFLDRPEIAGGEALAGLLRSGNAGSNTASDHIIVLAQALAALPAPWRPDPS
FT                   RGGGPDRPQVLVRCDTAGATHRFADACREQGVGFSFGYPVDARVQDAVDTLNLAQGWYP
FT                   AIDTDGGLRDGAWVAEATTLVNLNSWPPGTRLILRKERPHPGAQLRFTDTDGMRVTAFI
FT                   TDTPTGVVAGQVAGLELRHRQHARVEDRIRELKNTGLRNLPCHGFWANAAWLEIVLAAA
FT                   DLVTWARLIGFTSDPTLARAEIATFRYRVLHVAARITRGARQLRLRIDATWRWATSIAT
FT                   AWQTIRTAFG"
FT   gene            complement(626226..626717)
FT                   /locus_tag="Mflv_0599"
FT   CDS_pept        complement(626226..626717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0599"
FT                   /product="integrase, catalytic region"
FT                   /note="KEGG: mkm:Mkms_2638 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43089"
FT                   /db_xref="GOA:A4T3D0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3D0"
FT                   /protein_id="ABP43089.1"
FT                   /translation="MAPSTYYDAKTRPPSARAQRDAVLGPALRQLWKDNYCVYGAHKLW
FT                   KTARRAGYDVGRDQVARLMRAAGIQGVRRGKRVRTTKPDPVAARHPDLVKRKFTATAPN
FT                   QLWVTDLTFVPTWAGVAYVCFIVDAHSRMIVGWRVASHMRTSMVLAQIFRGLLLVTACR
FT                   "
FT   gene            complement(626795..627139)
FT                   /locus_tag="Mflv_0600"
FT   CDS_pept        complement(626795..627139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0600"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   mkm:Mkms_2637 transcriptional regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43090"
FT                   /db_xref="GOA:A4T3D1"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3D1"
FT                   /protein_id="ABP43090.1"
FT                   /translation="MPKEQSPGKPTTRRYSSEEKAAAVRMVRTLREELGTEQGTVTRVA
FT                   HQLGYGVESVRSWVRQADIDDGHAPGVTSTESAKVKELEQEIRELKRANEILKRAASFF
FT                   GAELDRQHKK"
FT   gene            complement(627169..627897)
FT                   /pseudo
FT                   /locus_tag="Mflv_0601"
FT   gene            627986..628267
FT                   /locus_tag="Mflv_0602"
FT   CDS_pept        627986..628267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0602"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   msm:MSMEG_1867 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43091"
FT                   /db_xref="GOA:A4T3D2"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3D2"
FT                   /protein_id="ABP43091.1"
FT                   /translation="MAGRKRNSAEDIVRKLRRADELAAEGKTGEEIAAELGVSPATLYN
FT                   WRRTYGGMDTDAAKELKELREQNARLKRLLADAELEKDALREVAKGKF"
FT   gene            628318..629133
FT                   /locus_tag="Mflv_0603"
FT   CDS_pept        628318..629133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0603"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   msm:MSMEG_1866 transposase B"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43092"
FT                   /db_xref="GOA:A4T3C6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3C6"
FT                   /protein_id="ABP43092.1"
FT                   /translation="MSERLACKAVGLARSTYRRLPLGQTPDDPDAEMRAWLRSYATKHP
FT                   CHGFRRAWAALRYDEGREVNRKKIHRLWREEGLQVRVHSPRKRAGVSSVPPILADAPGV
FT                   VWAIDFQFDSTVDGKAIKIASMIDEHTRESLLNLVERSITGEALVAELTKVFAAAGGPP
FT                   KVLRMDNGPEMVSQALQRFCENRTGMVYIPPGCPWDNGYIESFNNRLRRECLNRNYWNT
FT                   LFEARVVIGDFKHEHNHRHRHSALGYLTPAEYAAACRCTHTPGVCCMIR"
FT   gene            complement(629143..629526)
FT                   /locus_tag="Mflv_0604"
FT   CDS_pept        complement(629143..629526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0604"
FT                   /product="transposase subunit"
FT                   /note="KEGG: msm:MSMEG_6888 transposase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43093"
FT                   /db_xref="GOA:A4T3C7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3C7"
FT                   /protein_id="ABP43093.1"
FT                   /translation="MKSRLTTTALSSAVARRGDVAGCILHSDRGSQFRSRRFVHALGRY
FT                   EVVGSMGRVGAAGDNAAMESFFSLLQKNVLDRRRWSTREELRIAIVTWIERTYHRRRRQ
FT                   AGLGRLTPIEFEAIMTTPASQAA"
FT   gene            629744..630133
FT                   /locus_tag="Mflv_0605"
FT   CDS_pept        629744..630133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0605"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein, ArsR; KEGG: mva:Mvan_3640
FT                   regulatory protein, ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43094"
FT                   /db_xref="GOA:A4T3C8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3C8"
FT                   /protein_id="ABP43094.1"
FT                   /translation="MNKRDTCLAGNTSDLDAAVALFHSLSDATRLTIVRRLADGEARVV
FT                   DLIGELGLAQSTVSAHVACLRDCGLVTGRPEGRQVFYSLSRPELLDVLAAAETLLAATG
FT                   NAVALCPTYGTGARGAAIDTEETRQ"
FT   gene            630130..632097
FT                   /locus_tag="Mflv_0606"
FT   CDS_pept        630130..632097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0606"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; cadmium-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; E1-E2
FT                   ATPase-associated domain protein; KEGG: mkm:Mkms_5743 heavy
FT                   metal translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43095"
FT                   /db_xref="GOA:A4T3C2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3C2"
FT                   /protein_id="ABP43095.1"
FT                   /translation="MSDACGCGSDEPRSAEEQEREPERLWQITELQFAALSGVLLLAAL
FT                   IANLVGAADPVVLTLEAAALLAGAYTFVPSTLGRLAKGKIGVGTLMTIAAVGAVLLGEV
FT                   GEAAMLAFLFSISEGLEEYSLARTRRGLRALLSLVPDEATVRRDGTETTIAPTELRIGD
FT                   LMVVKPGERVATDGIITRGRTALDLSAITGESVPVEAGPGDEVFAGSINGAGALEVEVS
FT                   TTAEDNSLARIVRIVEAEQSRKGAAQRLADRIAKPLVPAVMIAAALIAVAGSLLGDPAT
FT                   WIERALVVLVAASPCALAISVPVTVVAAIGAASKLGALVKGGAALEALGRIRGVALDKT
FT                   GTLTANRPTVIEVATTPDVTPEHVLDLAAAVEARSEHPLAAAILAAAGTVTPAADVEAV
FT                   TGAGLTGHRDGHRIRLGRPGWLDRGPLTAEVTRMQQAGATAVLVEDNGQVIGAIAVRDE
FT                   LRPEATEVITQLRRDGYQVAMLTGDNHATAAALAREVGIDTVHADLRPEDKARLIEQLR
FT                   TQRPTAMVGDGVNDAPALATADLGIAMGAMGTDVAIETADVALMGEDLRHLPQTFTHAR
FT                   RARRIMLQNVGLSLGLIIVLMPLALFGVLGLAAVVLVHELAEIVVIANGVRAGRTTALT
FT                   ALTAQRSTNLATATAVGAPS"
FT   gene            632117..632356
FT                   /locus_tag="Mflv_0607"
FT   CDS_pept        632117..632356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0607"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mva:Mvan_3642 cadmium resistance transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43096"
FT                   /db_xref="GOA:A4T3C3"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3C3"
FT                   /protein_id="ABP43096.1"
FT                   /translation="MILSSVLPAIGLFIVTNIDDIIVLSLFFARGAGQRGTTSRITAGQ
FT                   YLGFAGIRALPPCSGHGICGYAASGSVAGVRFLS"
FT   gene            complement(632311..633210)
FT                   /locus_tag="Mflv_0608"
FT   CDS_pept        complement(632311..633210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0608"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   mkm:Mkms_3253 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43097"
FT                   /db_xref="GOA:A4T3C4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3C4"
FT                   /protein_id="ABP43097.1"
FT                   /translation="MSRFQFVADHLHAFEVKWLCAVVEVARSSFYAWLAGADGRAARRA
FT                   ADEALAERIRAVHDEDNTYGAPRITAELNDGAPEGQRVNHKRVARVMRGAGIAGYRRRR
FT                   RVKTTVADPANQKVPDLLKRDFTAAQVNTRYVGDITYLPLATGANLYLATVIDCCSRRV
FT                   AGWAIADHMRTELVIDALKAAAALRGSLAGAIFHADHGSQYTSRDFANLCRDLGVVQSM
FT                   GAVGSSADNALAESFNAALKREILQDRACWPDAAICRREVFRWLARYNTTRRHSYCRHS
FT                   SPATYERNLTPATLPEAA"
FT   gene            complement(633207..633539)
FT                   /locus_tag="Mflv_0609"
FT   CDS_pept        complement(633207..633539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0609"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   mkm:Mkms_3252 transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43098"
FT                   /db_xref="GOA:A4T3C5"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3C5"
FT                   /protein_id="ABP43098.1"
FT                   /translation="MARKNYPDEFKRDAVALYRDTEGATIAQIAAELGVSEATLSAWCK
FT                   SAGVPIRHRRGVVVAEPVLGAESPEQELARLRSEVKALRATEARLSTERDILRSAAKYF
FT                   AGETNW"
FT   gene            633632..634051
FT                   /locus_tag="Mflv_0610"
FT   CDS_pept        633632..634051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0610"
FT                   /product="cadmium resistance transporter"
FT                   /note="KEGG: mva:Mvan_3642 cadmium resistance transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43099"
FT                   /db_xref="GOA:A4T3B8"
FT                   /db_xref="InterPro:IPR004676"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3B8"
FT                   /protein_id="ABP43099.1"
FT                   /translation="MTLGAGAFLPPDVIPFFGLIPLALGLKAAWQAWRGNGDDDGDAKV
FT                   AGKTVSVWAVAGVTFANGGDNVGVYVPVFLSVGHAAVVAYCVVFLLLVGVLVVIARYVA
FT                   TRRPIAEILERWEHILFPIVLIGLGIVILIGGLAF"
FT   gene            complement(634141..635004)
FT                   /locus_tag="Mflv_0611"
FT   CDS_pept        complement(634141..635004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0611"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: msm:MSMEG_3322 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43100"
FT                   /db_xref="InterPro:IPR009492"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3B9"
FT                   /protein_id="ABP43100.1"
FT                   /translation="MITDWPRLPPRPLPQSVTAFRDETVYSFTTRLAHANRIPPQSLRD
FT                   YAARESHYVDPERLARLSGYPRHVLCARLRGLTADERDLTRQRARARPICRYCTARRGV
FT                   PQPVHCWLPDHLTVCHRHGRWIGPSAQRWDDQMSLKHHPAVARSARAHHALAKRNAPDI
FT                   VELAINDASRIVLRQRRFRRDDGLGDSAATGIALRGRWASISTVNLHIATYVETVRMAA
FT                   VIIDQRPALLNRTGDPSVARVALLAAANAVFGAEDETATTAALDGWLNNQQIIRKSRDK
FT                   SMIVHT"
FT   gene            complement(635007..636020)
FT                   /locus_tag="Mflv_0612"
FT   CDS_pept        complement(635007..636020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0612"
FT                   /product="ATP/GTP-binding protein"
FT                   /note="KEGG: msm:MSMEG_3321 ATP/GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43101"
FT                   /db_xref="InterPro:IPR008868"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3C0"
FT                   /protein_id="ABP43101.1"
FT                   /translation="MALVSPISQLEERRQPTTTLEGWRRFIDADRPEFTLLPDQDWSDL
FT                   DDADRIAYNEARVAHHSELVVVTTSAIQKITNEGQLLTLLNQREIGARRGLIVSGGAAT
FT                   GKTTAIKQLGRFHELRIRTRYSDKTRIPVVYVTAPPKGSARKLAMEFARFLGLPPVRRM
FT                   NVTDIADAVCQVLIDARTDIVVVDEIHNLNLDTRAGEELSDHLKYFTEHLPATFVYAGI
FT                   DVERSGVFTGTRGRQLAGRCGVINTAAFPYGQEWRALVAAMEGTLRLHRHEPGTLVRQT
FT                   KHLHQRTGGMIGSLAHLIRSAAIRAMLDHTEHIDREGLDSVLIDYAAQASAQRSAG"
FT   gene            complement(636008..637912)
FT                   /locus_tag="Mflv_0613"
FT   CDS_pept        complement(636008..637912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0613"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   rha:RHA1_ro07276 possible transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43102"
FT                   /db_xref="GOA:A4T3C1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015378"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3C1"
FT                   /protein_id="ABP43102.1"
FT                   /translation="MLWSVEALEGVPEEVADRARWWEQHIVEVLTGRRPESPPGQPIRP
FT                   EFDPAVRSLRQRELTKLEELRAAGHDLALITLQRQRSRYEAKGLLGLVDGRYLAKRPVL
FT                   GRVDERVVAVVRRLIDNETELSTGTVSRLQRKLEKALLAEYGPDDAPKAPSQATFYRLV
FT                   KRLEEGKHTFGSARTRRSLAKQPDGPFGTVTAARPGEMVEIDSTPLDVRVVLDDGVVDR
FT                   VELTAMVDNVTRSIPAAVLRPTTKAVDAALLLAKALTPEPMRPGWSDALRLSRSVLPHR
FT                   RLTDIDQRLADAAARPVIAPETIVCDHGKAFLSKTFEQACCSLGINLQPAHPDQPTDKP
FT                   KVERTLQSVGTLFAQYVAGYVGSSVERRGKNADQDAVWSLVELQALLDEWLVAVWQNRP
FT                   HDGLRDPVTPGKALTPNEKFAALVEVAGYVPVPLSADAYIELLPATWRTIGSAGIRVNH
FT                   RTYDARALNPYRRVDSGVRSRNGRWEVHYDPYDVSQIWVRNHHDDGWITATWTHMRTAA
FT                   VPFGDTVWKQAQAIVAERGADPVTEAEIAAAADALLDRAERGPDTQQDPPAARRAAARA
FT                   RSIPEPSWPHPSVEGTNQNQEPSEVSTDRPANSDDDDLADVIPLPVFDARKEAEQWHW"
FT   gene            complement(638098..638769)
FT                   /locus_tag="Mflv_0614"
FT   CDS_pept        complement(638098..638769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0614"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO7843 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43103"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3B4"
FT                   /protein_id="ABP43103.1"
FT                   /translation="MDGTSRLPLELAHGIRFDVDCEPVRSFPSFRGQRNFPGLWWFATT
FT                   RRHIGYESWVERDQLMALDANPETVGVASQPFRLRWPDGRHHVPDYYARRSDGTVVIVD
FT                   VRPDDRIPESDAELFARSEVVCIAAGWQYRRVGVLDPVLAANLRWLSGYRHPRALRPGV
FT                   AAELLSCFAREQPLLEGATAVGDPLVVLPVLFHLLWHRRLVVDLSRTVLDDRTAVSAAA
FT                   L"
FT   gene            complement(638909..639373)
FT                   /locus_tag="Mflv_0615"
FT   CDS_pept        complement(638909..639373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mflv_0615"
FT                   /product="transposase subunit"
FT                   /note="KEGG: msm:MSMEG_6888 transposase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mflv_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABP43104"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A4T3B5"
FT                   /protein_id="ABP43104.1"
FT                   /translation="MTCRVLKLARQPYYRWRADPITEAEVIEAYRANALFDAHNDDPEF
FT                   GYRYLVEEAREAGEPMAERTAWRICSQNQLWSVFGKKRGKNGKVGPPVHDD